BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF029J09

Length=740
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009621845.1|  PREDICTED: MLO-like protein 1                      243   3e-90   Nicotiana tomentosiformis
ref|XP_009770323.1|  PREDICTED: MLO-like protein 1                      243   4e-90   Nicotiana sylvestris
ref|XP_011089565.1|  PREDICTED: MLO-like protein 1                      243   7e-90   Sesamum indicum [beniseed]
emb|CDP04006.1|  unnamed protein product                                241   3e-88   Coffea canephora [robusta coffee]
ref|XP_006344359.1|  PREDICTED: MLO-like protein 1-like                 228   2e-85   Solanum tuberosum [potatoes]
gb|EYU36872.1|  hypothetical protein MIMGU_mgv1a004875mg                229   3e-84   Erythranthe guttata [common monkey flower]
ref|XP_008460095.1|  PREDICTED: MLO-like protein 1                      225   4e-83   
ref|XP_004145008.1|  PREDICTED: MLO-like protein 1-like                 225   6e-83   Cucumis sativus [cucumbers]
ref|NP_001284374.1|  MLO-like protein 1                                 222   3e-82   Cucumis melo [Oriental melon]
gb|KDP39614.1|  hypothetical protein JCGZ_02634                         216   3e-81   Jatropha curcas
ref|XP_010052699.1|  PREDICTED: MLO-like protein 1                      216   1e-80   Eucalyptus grandis [rose gum]
ref|XP_003522288.1|  PREDICTED: MLO-like protein 1-like                 217   1e-80   Glycine max [soybeans]
gb|EPS69012.1|  hypothetical protein M569_05755                         208   7e-80   Genlisea aurea
ref|XP_008345263.1|  PREDICTED: MLO-like protein 1                      213   2e-79   
emb|CAN71629.1|  hypothetical protein VITISV_015579                     212   2e-79   Vitis vinifera
ref|XP_007029886.1|  Seven transmembrane MLO family protein             205   2e-79   
ref|XP_008369123.1|  PREDICTED: MLO-like protein 1                      212   2e-79   
ref|XP_003527594.1|  PREDICTED: MLO-like protein 1-like                 218   2e-79   Glycine max [soybeans]
ref|NP_001045040.1|  Os01g0888600                                       215   2e-79   
gb|KHN19980.1|  MLO-like protein 1                                      218   3e-79   Glycine soja [wild soybean]
gb|KHG28287.1|  MLO-like protein 1                                      204   1e-78   Gossypium arboreum [tree cotton]
gb|KHG28285.1|  MLO-like protein 1                                      204   1e-78   Gossypium arboreum [tree cotton]
ref|XP_010528781.1|  PREDICTED: MLO-like protein 1                      206   1e-78   Tarenaya hassleriana [spider flower]
gb|KJB82477.1|  hypothetical protein B456_013G197800                    204   2e-78   Gossypium raimondii
gb|KHG28286.1|  MLO-like protein 1                                      203   2e-78   Gossypium arboreum [tree cotton]
ref|XP_006437326.1|  hypothetical protein CICLE_v10031281mg             209   2e-78   Citrus clementina [clementine]
ref|XP_008235036.1|  PREDICTED: MLO-like protein 1                      208   2e-78   Prunus mume [ume]
ref|XP_006437327.1|  hypothetical protein CICLE_v10031281mg             209   2e-78   
ref|XP_002874907.1|  predicted protein                                  207   3e-78   Arabidopsis lyrata subsp. lyrata
ref|XP_010277858.1|  PREDICTED: MLO-like protein 1                      206   5e-78   Nelumbo nucifera [Indian lotus]
ref|XP_003636499.1|  MLO-like protein                                   207   5e-78   
ref|XP_006645146.1|  PREDICTED: MLO-like protein 1-like                 214   5e-78   Oryza brachyantha
ref|XP_007137327.1|  hypothetical protein PHAVU_009G117900g             209   7e-78   Phaseolus vulgaris [French bean]
ref|XP_007199791.1|  hypothetical protein PRUPE_ppa004508mg             206   7e-78   Prunus persica
ref|XP_004510198.1|  PREDICTED: MLO-like protein 1-like                 205   1e-77   Cicer arietinum [garbanzo]
ref|XP_003547751.1|  PREDICTED: MLO-like protein 1-like                 210   1e-77   Glycine max [soybeans]
ref|XP_010422570.1|  PREDICTED: MLO-like protein 1                      202   3e-77   Camelina sativa [gold-of-pleasure]
ref|XP_004500713.1|  PREDICTED: MLO-like protein 1-like isoform X1      207   4e-77   Cicer arietinum [garbanzo]
ref|NP_192169.1|  MLO-like protein 1                                    202   5e-77   Arabidopsis thaliana [mouse-ear cress]
emb|CDY21899.1|  BnaC09g00050D                                          201   7e-77   Brassica napus [oilseed rape]
dbj|BAH20436.1|  AT4G02600                                              202   9e-77   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001268003.1|  MLO5 protein                                       204   1e-76   Vitis vinifera
dbj|BAH57094.1|  AT4G02600                                              202   1e-76   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009111270.1|  PREDICTED: MLO-like protein 1                      201   1e-76   Brassica rapa
emb|CDY22065.1|  BnaA09g00940D                                          201   1e-76   Brassica napus [oilseed rape]
ref|XP_010456010.1|  PREDICTED: MLO-like protein 1                      200   1e-76   Camelina sativa [gold-of-pleasure]
ref|XP_009144550.1|  PREDICTED: MLO-like protein 1                      199   1e-76   Brassica rapa
ref|XP_006287341.1|  hypothetical protein CARUB_v10000540mg             200   1e-76   
ref|XP_004290766.1|  PREDICTED: MLO-like protein 1                      202   1e-76   Fragaria vesca subsp. vesca
ref|XP_010679042.1|  PREDICTED: MLO-like protein 1                      202   3e-76   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007134284.1|  hypothetical protein PHAVU_010G034400g             204   3e-76   Phaseolus vulgaris [French bean]
gb|ABK96389.1|  unknown                                                 201   3e-76   Populus trichocarpa x Populus deltoides
emb|CDX91294.1|  BnaC02g27050D                                          199   4e-76   
tpg|DAA56449.1|  TPA: seven transmembrane protein Mlo5                  205   5e-76   
ref|XP_008674721.1|  PREDICTED: MLO-like protein 1                      205   5e-76   
ref|XP_010429895.1|  PREDICTED: MLO-like protein 1                      197   1e-75   Camelina sativa [gold-of-pleasure]
tpg|DAA56448.1|  TPA: seven transmembrane protein Mlo5                  204   1e-75   
gb|KEH18066.1|  seven transmembrane MLO family protein                  199   3e-75   Medicago truncatula
ref|XP_010907544.1|  PREDICTED: LOW QUALITY PROTEIN: MLO-like pro...    201   3e-75   Elaeis guineensis
ref|XP_008232215.1|  PREDICTED: MLO-like protein 1                      205   4e-75   
gb|AIZ94062.1|  Mlo protein                                             216   4e-75   Hevea brasiliensis [jebe]
ref|XP_006396473.1|  hypothetical protein EUTSA_v10028582mg             196   5e-75   Eutrema salsugineum [saltwater cress]
ref|XP_003636497.1|  MLO-like protein                                   199   6e-75   
ref|XP_003636206.1|  MLO-like protein                                   199   6e-75   
ref|XP_011011036.1|  PREDICTED: MLO-like protein 1 isoform X1           197   6e-75   Populus euphratica
gb|EEE63750.1|  hypothetical protein OsJ_18569                          201   6e-75   Oryza sativa Japonica Group [Japonica rice]
gb|AAU10790.1|  putative seven transmembrane MLO family protein         201   7e-75   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001105171.1|  barley mlo defense gene homolog8                   201   7e-75   Zea mays [maize]
ref|XP_011011038.1|  PREDICTED: MLO-like protein 1 isoform X2           197   7e-75   Populus euphratica
ref|NP_001174425.1|  Os05g0418100                                       200   1e-74   
ref|XP_007217923.1|  hypothetical protein PRUPE_ppa004866mg             203   2e-74   Prunus persica
ref|XP_003520359.1|  PREDICTED: MLO-like protein 1-like                 201   3e-74   Glycine max [soybeans]
ref|XP_003604071.1|  MLO-like protein                                   196   7e-74   Medicago truncatula
gb|EAY98072.1|  hypothetical protein OsI_19990                          197   9e-74   Oryza sativa Indica Group [Indian rice]
ref|XP_003568437.1|  PREDICTED: MLO-like protein 1                      195   2e-73   Brachypodium distachyon [annual false brome]
gb|ABK95021.1|  unknown                                                 193   2e-73   Populus trichocarpa [western balsam poplar]
ref|XP_004970844.1|  PREDICTED: MLO-like protein 1-like isoform X1      199   3e-73   Setaria italica
emb|CDM85394.1|  unnamed protein product                                197   3e-73   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008812868.1|  PREDICTED: MLO-like protein 1 isoform X1           192   6e-73   Phoenix dactylifera
ref|XP_009399143.1|  PREDICTED: MLO-like protein 1                      193   7e-73   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006858689.1|  hypothetical protein AMTR_s00066p00091160          196   7e-73   Amborella trichopoda
ref|XP_008812870.1|  PREDICTED: MLO-like protein 1 isoform X3           192   8e-73   
ref|XP_004500714.1|  PREDICTED: MLO-like protein 1-like isoform X2      192   2e-72   
ref|XP_009376309.1|  PREDICTED: MLO-like protein 1                      194   2e-72   Pyrus x bretschneideri [bai li]
ref|XP_009600156.1|  PREDICTED: MLO-like protein 1 isoform X2           185   2e-72   Nicotiana tomentosiformis
ref|XP_009410722.1|  PREDICTED: MLO-like protein 1 isoform X2           191   4e-72   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009410721.1|  PREDICTED: MLO-like protein 1 isoform X1           191   5e-72   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006655330.1|  PREDICTED: MLO-like protein 1-like                 191   8e-72   Oryza brachyantha
ref|XP_010908317.1|  PREDICTED: MLO-like protein 1 isoform X1           195   8e-72   Elaeis guineensis
ref|XP_008375689.1|  PREDICTED: MLO-like protein 1                      191   1e-71   
ref|XP_009361360.1|  PREDICTED: MLO-like protein 1                      191   2e-71   Pyrus x bretschneideri [bai li]
ref|XP_008344996.1|  PREDICTED: MLO-like protein 1 isoform X1           191   2e-71   
ref|XP_008375669.1|  PREDICTED: MLO-like protein 1                      190   2e-71   
gb|KHG04571.1|  MLO-like protein 1                                      203   7e-71   Gossypium arboreum [tree cotton]
ref|XP_003636203.1|  MLO-like protein                                   184   7e-71   
ref|XP_004962063.1|  PREDICTED: MLO-like protein 1-like isoform X1      191   2e-70   Setaria italica
ref|XP_008802152.1|  PREDICTED: MLO-like protein 1                      191   2e-70   
ref|XP_008788294.1|  PREDICTED: MLO-like protein 1                      190   2e-70   Phoenix dactylifera
ref|XP_002319210.2|  hypothetical protein POPTR_0013s06680g             192   3e-70   
dbj|BAK08220.1|  predicted protein                                      189   3e-70   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006375950.1|  hypothetical protein POPTR_0013s06680g             192   3e-70   
ref|XP_009794450.1|  PREDICTED: MLO-like protein 1 isoform X1           177   6e-70   Nicotiana sylvestris
gb|ABY77906.1|  mildew resistance locus o 15                            186   7e-70   Vitis vinifera
ref|NP_001267997.1|  mildew resistance locus o 15                       185   9e-70   Vitis vinifera
dbj|BAJ24148.1|  seven trans-membrane protein                           184   1e-69   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008243092.1|  PREDICTED: MLO-like protein 1                      180   1e-69   Prunus mume [ume]
ref|XP_004962062.1|  PREDICTED: MLO-like protein 1-like                 202   1e-69   Setaria italica
gb|KDP29534.1|  hypothetical protein JCGZ_19247                         183   1e-69   Jatropha curcas
ref|XP_004244787.1|  PREDICTED: MLO-like protein 1                      188   1e-69   
ref|XP_006478504.1|  PREDICTED: MLO-like protein 1-like                 185   2e-69   Citrus sinensis [apfelsine]
ref|XP_003564808.1|  PREDICTED: MLO-like protein 1                      196   2e-69   Brachypodium distachyon [annual false brome]
ref|XP_002441109.1|  hypothetical protein SORBIDRAFT_09g020570          202   2e-69   
ref|XP_006441977.1|  hypothetical protein CICLE_v10019784mg             184   4e-69   Citrus clementina [clementine]
ref|XP_007203635.1|  hypothetical protein PRUPE_ppa004012mg             178   4e-69   Prunus persica
ref|XP_006366803.1|  PREDICTED: MLO-like protein 1-like                 176   5e-69   
ref|XP_006372313.1|  hypothetical protein POPTR_0017s00470g             178   1e-68   
ref|XP_011014744.1|  PREDICTED: MLO-like protein 1                      179   2e-68   Populus euphratica
ref|XP_011004548.1|  PREDICTED: MLO-like protein 1                      179   2e-68   Populus euphratica
gb|ABK93651.1|  unknown                                                 176   4e-68   Populus trichocarpa [western balsam poplar]
ref|XP_006372312.1|  hypothetical protein POPTR_0017s00450g             176   4e-68   
ref|XP_006351085.1|  PREDICTED: MLO-like protein 1-like                 186   5e-68   Solanum tuberosum [potatoes]
ref|XP_006372311.1|  hypothetical protein POPTR_0017s00450g             176   6e-68   
ref|XP_010065113.1|  PREDICTED: MLO-like protein 1                      186   6e-68   Eucalyptus grandis [rose gum]
ref|XP_010040798.1|  PREDICTED: MLO-like protein 1                      186   8e-68   Eucalyptus grandis [rose gum]
ref|XP_010930331.1|  PREDICTED: MLO-like protein 1 isoform X1           181   2e-67   Elaeis guineensis
ref|XP_010930334.1|  PREDICTED: MLO-like protein 1 isoform X3           180   3e-67   
gb|KJB28898.1|  hypothetical protein B456_005G074900                    182   5e-67   Gossypium raimondii
gb|KHG23854.1|  MLO-like protein 1                                      181   6e-67   Gossypium arboreum [tree cotton]
gb|KJB28899.1|  hypothetical protein B456_005G074900                    182   6e-67   Gossypium raimondii
ref|XP_002441107.1|  hypothetical protein SORBIDRAFT_09g020550          183   6e-67   Sorghum bicolor [broomcorn]
ref|XP_008656279.1|  PREDICTED: MLO-like protein 1                      192   8e-67   Zea mays [maize]
ref|XP_006478537.1|  PREDICTED: MLO-like protein 1-like                 171   9e-67   Citrus sinensis [apfelsine]
ref|XP_010065098.1|  PREDICTED: MLO-like protein 1                      186   1e-66   
gb|EPS69013.1|  hypothetical protein M569_05756                         179   1e-66   Genlisea aurea
ref|XP_006441984.1|  hypothetical protein CICLE_v10020313mg             171   1e-66   
ref|XP_011085087.1|  PREDICTED: MLO-like protein 1 isoform X3           179   2e-66   
gb|KDO49756.1|  hypothetical protein CISIN_1g0113632mg                  170   2e-66   Citrus sinensis [apfelsine]
ref|XP_011085085.1|  PREDICTED: MLO-like protein 15 isoform X1          179   2e-66   
ref|XP_011085086.1|  PREDICTED: MLO-like protein 1 isoform X2           179   2e-66   Sesamum indicum [beniseed]
ref|XP_002533335.1|  Protein MLO, putative                              173   1e-65   
ref|XP_008383732.1|  PREDICTED: MLO-like protein 1                      166   2e-65   Malus domestica [apple tree]
ref|XP_007020280.1|  Seven transmembrane MLO family protein             171   3e-65   
gb|ABR16800.1|  unknown                                                 175   3e-65   Picea sitchensis
ref|XP_010559056.1|  PREDICTED: MLO-like protein 15 isoform X1          173   4e-65   
gb|EMT10343.1|  MLO-like protein 1                                      186   5e-65   
ref|XP_006295922.1|  hypothetical protein CARUB_v10025059mg             174   5e-65   
ref|XP_009757992.1|  PREDICTED: MLO-like protein 1                      174   6e-65   Nicotiana sylvestris
ref|XP_009366270.1|  PREDICTED: MLO-like protein 1                      165   6e-65   Pyrus x bretschneideri [bai li]
ref|XP_006397586.1|  hypothetical protein EUTSA_v10001415mg             172   1e-64   Eutrema salsugineum [saltwater cress]
ref|XP_010508339.1|  PREDICTED: MLO-like protein 15                     173   1e-64   Camelina sativa [gold-of-pleasure]
ref|XP_009413424.1|  PREDICTED: MLO-like protein 1                      174   1e-64   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010517997.1|  PREDICTED: MLO-like protein 15 isoform X2          173   2e-64   Camelina sativa [gold-of-pleasure]
ref|XP_010517996.1|  PREDICTED: MLO-like protein 15 isoform X1          172   2e-64   Camelina sativa [gold-of-pleasure]
emb|CDP19084.1|  unnamed protein product                                183   3e-64   Coffea canephora [robusta coffee]
ref|XP_010913228.1|  PREDICTED: MLO-like protein 13 isoform X1          184   8e-64   Elaeis guineensis
gb|KFK37229.1|  hypothetical protein AALP_AA4G230500                    169   1e-63   Arabis alpina [alpine rockcress]
ref|XP_010913229.1|  PREDICTED: MLO-like protein 13 isoform X2          184   1e-63   Elaeis guineensis
ref|XP_010913234.1|  PREDICTED: MLO-like protein 1 isoform X6           183   1e-63   
ref|XP_010913230.1|  PREDICTED: MLO-like protein 13 isoform X3          183   2e-63   
ref|XP_010506316.1|  PREDICTED: MLO-like protein 15                     168   2e-63   Camelina sativa [gold-of-pleasure]
ref|XP_011005242.1|  PREDICTED: MLO-like protein 1                      177   4e-63   Populus euphratica
ref|XP_002309708.1|  hypothetical protein POPTR_0007s00240g             177   4e-63   
ref|XP_009615189.1|  PREDICTED: MLO-like protein 1 isoform X2           169   5e-63   Nicotiana tomentosiformis
ref|XP_009615188.1|  PREDICTED: MLO-like protein 1 isoform X1           169   5e-63   Nicotiana tomentosiformis
ref|NP_973686.1|  MLO-like protein 15                                   168   8e-63   Arabidopsis thaliana [mouse-ear cress]
ref|NP_181939.1|  MLO-like protein 15                                   168   9e-63   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010069191.1|  PREDICTED: MLO-like protein 1 isoform X1           163   1e-62   Eucalyptus grandis [rose gum]
ref|XP_007026460.1|  Seven transmembrane MLO family protein             160   1e-62   
ref|XP_008649648.1|  PREDICTED: MLO-like protein 1 isoform X2           188   1e-62   Zea mays [maize]
gb|EMT27451.1|  MLO-like protein 1                                      159   2e-62   
gb|KDO49761.1|  hypothetical protein CISIN_1g044857mg                   161   2e-62   Citrus sinensis [apfelsine]
ref|XP_004287195.1|  PREDICTED: MLO-like protein 15                     158   3e-62   Fragaria vesca subsp. vesca
ref|XP_004242449.1|  PREDICTED: MLO-like protein 1                      154   3e-62   Solanum lycopersicum
ref|XP_009620916.1|  PREDICTED: MLO-like protein 1                      163   5e-62   Nicotiana tomentosiformis
gb|KGN46257.1|  hypothetical protein Csa_6G078520                       155   5e-62   Cucumis sativus [cucumbers]
ref|XP_006857534.1|  hypothetical protein AMTR_s00061p00034560          178   1e-61   
gb|KDO49428.1|  hypothetical protein CISIN_1g0104501mg                  154   1e-61   Citrus sinensis [apfelsine]
ref|XP_002441108.1|  hypothetical protein SORBIDRAFT_09g020560          171   1e-61   
gb|KDO49429.1|  hypothetical protein CISIN_1g0104501mg                  153   1e-61   Citrus sinensis [apfelsine]
ref|XP_002523965.1|  calmodulin binding protein, putative               152   2e-61   
ref|XP_007208676.1|  hypothetical protein PRUPE_ppa024581mg             156   8e-61   Prunus persica
ref|XP_008227254.1|  PREDICTED: MLO-like protein 1                      155   2e-60   Prunus mume [ume]
ref|XP_010251437.1|  PREDICTED: MLO-like protein 1 isoform X1           160   3e-60   Nelumbo nucifera [Indian lotus]
ref|XP_009794451.1|  PREDICTED: MLO-like protein 1 isoform X2           145   4e-60   Nicotiana sylvestris
ref|XP_010054950.1|  PREDICTED: MLO-like protein 1                      157   4e-60   
ref|XP_010040938.1|  PREDICTED: MLO-like protein 1                      164   4e-60   
ref|XP_010251439.1|  PREDICTED: MLO-like protein 1 isoform X2           159   5e-60   Nelumbo nucifera [Indian lotus]
ref|XP_004970845.1|  PREDICTED: MLO-like protein 1-like isoform X2      200   5e-59   
ref|XP_006478540.1|  PREDICTED: MLO-like protein 1-like                 169   5e-59   Citrus sinensis [apfelsine]
ref|XP_008649647.1|  PREDICTED: MLO-like protein 1 isoform X1           188   8e-59   Zea mays [maize]
ref|XP_009399302.1|  PREDICTED: MLO-like protein 1                      155   4e-58   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006441978.1|  hypothetical protein CICLE_v10023336mg             166   5e-58   
ref|XP_011460878.1|  PREDICTED: MLO-like protein 1 isoform X2           148   8e-58   Fragaria vesca subsp. vesca
ref|XP_004294225.1|  PREDICTED: MLO-like protein 15 isoform X1          148   1e-57   Fragaria vesca subsp. vesca
ref|XP_011469571.1|  PREDICTED: MLO-like protein 1                      150   9e-57   Fragaria vesca subsp. vesca
ref|XP_010930330.1|  PREDICTED: MLO-like protein 1                      156   1e-56   
ref|XP_009600155.1|  PREDICTED: MLO-like protein 1 isoform X1           186   1e-56   Nicotiana tomentosiformis
ref|XP_010066114.1|  PREDICTED: MLO-like protein 1                      157   2e-56   
ref|XP_008806171.1|  PREDICTED: MLO-like protein 13 isoform X2          176   5e-56   
ref|XP_008806170.1|  PREDICTED: MLO-like protein 13 isoform X1          176   5e-56   
gb|EAY86311.1|  hypothetical protein OsI_07684                          152   2e-55   Oryza sativa Indica Group [Indian rice]
ref|XP_011460879.1|  PREDICTED: MLO-like protein 1                      154   9e-55   Fragaria vesca subsp. vesca
gb|EEE57203.1|  hypothetical protein OsJ_07160                          151   1e-54   Oryza sativa Japonica Group [Japonica rice]
emb|CDY30455.1|  BnaA04g25560D                                          160   1e-54   Brassica napus [oilseed rape]
gb|EYU36622.1|  hypothetical protein MIMGU_mgv1a005184mg                146   2e-54   Erythranthe guttata [common monkey flower]
emb|CDY23418.1|  BnaC04g49460D                                          159   2e-54   Brassica napus [oilseed rape]
ref|XP_011026717.1|  PREDICTED: endoglucanase 25-like isoform X3        156   2e-54   Populus euphratica
ref|XP_009142246.1|  PREDICTED: MLO-like protein 15                     159   3e-54   Brassica rapa
gb|EYU22367.1|  hypothetical protein MIMGU_mgv1a0228202mg               145   3e-54   Erythranthe guttata [common monkey flower]
gb|EMT25264.1|  MLO-like protein 1                                      155   4e-54   
ref|XP_008802140.1|  PREDICTED: MLO-like protein 1                      144   4e-54   
ref|XP_002299404.2|  hypothetical protein POPTR_0001s11880g             156   8e-54   
ref|XP_006648751.1|  PREDICTED: MLO-like protein 1-like                 145   5e-53   Oryza brachyantha
ref|XP_010672534.1|  PREDICTED: MLO-like protein 15                     154   5e-53   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004952743.1|  PREDICTED: MLO-like protein 1-like                 154   9e-53   Setaria italica
ref|XP_011026716.1|  PREDICTED: MLO-like protein 13 isoform X2          155   1e-52   Populus euphratica
gb|EYU33241.1|  hypothetical protein MIMGU_mgv1a017858mg                153   1e-52   Erythranthe guttata [common monkey flower]
ref|XP_011026715.1|  PREDICTED: MLO-like protein 13 isoform X1          154   2e-52   Populus euphratica
gb|KJB56407.1|  hypothetical protein B456_009G118700                    152   5e-52   Gossypium raimondii
ref|XP_008678707.1|  PREDICTED: MLO-like protein 1                      153   1e-51   Zea mays [maize]
dbj|BAJ24153.1|  seven trans-membrane protein                           145   2e-51   Triticum aestivum [Canadian hard winter wheat]
ref|XP_007023831.1|  Glycosyl hydrolase 9A1                             156   2e-51   
gb|EYU29404.1|  hypothetical protein MIMGU_mgv1a004805mg                152   2e-51   Erythranthe guttata [common monkey flower]
ref|XP_003575162.1|  PREDICTED: MLO-like protein 1                      145   3e-51   Brachypodium distachyon [annual false brome]
gb|EMT22302.1|  MLO-like protein 1                                      146   4e-51   
gb|EMT12340.1|  MLO-like protein 1                                      144   4e-51   
ref|XP_008798739.1|  PREDICTED: MLO-like protein 13                     169   1e-50   Phoenix dactylifera
ref|XP_010913231.1|  PREDICTED: MLO-like protein 13 isoform X4          141   1e-50   
ref|XP_002454019.1|  hypothetical protein SORBIDRAFT_04g023170          148   1e-50   Sorghum bicolor [broomcorn]
dbj|BAJ91124.1|  predicted protein                                      143   2e-50   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010247041.1|  PREDICTED: MLO-like protein 13 isoform X2          154   3e-50   Nelumbo nucifera [Indian lotus]
dbj|BAJ94381.1|  predicted protein                                      143   3e-50   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010247040.1|  PREDICTED: MLO-like protein 13 isoform X1          154   3e-50   Nelumbo nucifera [Indian lotus]
gb|AAK38341.1|  seven transmembrane protein Mlo5                        172   4e-50   Zea mays [maize]
gb|AAS93431.1|  Mlo3                                                    145   5e-50   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010913978.1|  PREDICTED: MLO-like protein 13                     166   5e-50   
ref|XP_011087587.1|  PREDICTED: MLO-like protein 13                     159   6e-50   Sesamum indicum [beniseed]
gb|AFW81913.1|  hypothetical protein ZEAMMB73_691352                    135   1e-49   
ref|XP_002266927.3|  PREDICTED: endoglucanase 25                        162   2e-49   
ref|XP_010521421.1|  PREDICTED: MLO-like protein 13 isoform X2          154   3e-49   Tarenaya hassleriana [spider flower]
ref|XP_010521420.1|  PREDICTED: MLO-like protein 13 isoform X1          154   4e-49   Tarenaya hassleriana [spider flower]
ref|XP_008345009.1|  PREDICTED: MLO-like protein 1 isoform X2           110   5e-49   
dbj|BAJ97456.1|  predicted protein                                      137   2e-48   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010097666.1|  MLO-like protein 1                                 159   2e-48   
ref|XP_004959126.1|  PREDICTED: MLO-like protein 1-like                 157   2e-48   
gb|KDO49759.1|  hypothetical protein CISIN_1g0474502mg                  169   3e-48   Citrus sinensis [apfelsine]
ref|XP_006283629.1|  hypothetical protein CARUB_v10004686mg             156   4e-48   Capsella rubella
ref|XP_009392166.1|  PREDICTED: MLO-like protein 13 isoform X1          156   5e-48   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACN35418.1|  unknown                                                 113   5e-48   Zea mays [maize]
ref|XP_010439065.1|  PREDICTED: MLO-like protein 13                     157   7e-48   Camelina sativa [gold-of-pleasure]
ref|XP_010448588.1|  PREDICTED: MLO-like protein 13                     157   8e-48   Camelina sativa [gold-of-pleasure]
ref|XP_009392168.1|  PREDICTED: MLO-like protein 13 isoform X3          156   9e-48   
emb|CBI29605.3|  unnamed protein product                                156   1e-47   Vitis vinifera
ref|XP_010433797.1|  PREDICTED: MLO-like protein 13                     157   1e-47   Camelina sativa [gold-of-pleasure]
emb|CAB45060.1|  Mlo-like protein                                       155   3e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009391802.1|  PREDICTED: MLO-like protein 13                     168   4e-47   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_567697.1|  MLO-like protein 13                                   155   4e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002867673.1|  hypothetical protein ARALYDRAFT_914165             154   6e-47   Arabidopsis lyrata subsp. lyrata
gb|EMS64374.1|  MLO-like protein 1                                      135   6e-47   Triticum urartu
ref|XP_006413455.1|  hypothetical protein EUTSA_v10024937mg             151   1e-46   
gb|KJB44399.1|  hypothetical protein B456_007G250700                    110   2e-46   Gossypium raimondii
ref|XP_008668644.1|  PREDICTED: barley mlo defense gene homolog3 ...    138   2e-46   Zea mays [maize]
gb|KJB70716.1|  hypothetical protein B456_011G089600                    149   2e-46   Gossypium raimondii
gb|EMT13719.1|  MLO-like protein 1                                      135   2e-46   
ref|XP_008379019.1|  PREDICTED: LOW QUALITY PROTEIN: endoglucanas...    152   2e-46   
emb|CDX92627.1|  BnaC07g38850D                                          154   4e-46   
ref|XP_008812869.1|  PREDICTED: MLO-like protein 1 isoform X2           108   4e-46   
ref|NP_001105527.1|  barley mlo defense gene homolog3                   137   4e-46   Zea mays [maize]
dbj|BAJ24151.1|  seven trans-membrane protein                           148   4e-46   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002447908.1|  hypothetical protein SORBIDRAFT_06g017770          138   5e-46   Sorghum bicolor [broomcorn]
ref|XP_009395397.1|  PREDICTED: MLO-like protein 9                      145   7e-46   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY03468.1|  BnaC01g16140D                                          152   8e-46   
emb|CDY10997.1|  BnaA03g46560D                                          152   1e-45   Brassica napus [oilseed rape]
ref|XP_009137434.1|  PREDICTED: MLO-like protein 13                     152   1e-45   Brassica rapa
emb|CDY34270.1|  BnaA01g13730D                                          150   2e-45   Brassica napus [oilseed rape]
ref|XP_009137855.1|  PREDICTED: MLO-like protein 13                     150   2e-45   Brassica rapa
ref|XP_004962064.1|  PREDICTED: MLO-like protein 1-like isoform X2      107   3e-45   
ref|XP_006855670.1|  hypothetical protein AMTR_s00044p00123510          140   3e-45   Amborella trichopoda
gb|EMS49775.1|  MLO-like protein 1                                      125   5e-45   Triticum urartu
gb|KCW71438.1|  hypothetical protein EUGRSUZ_E000081                    157   5e-45   
gb|EMT12339.1|  MLO-like protein 1                                      124   7e-45   
ref|XP_008786683.1|  PREDICTED: MLO-like protein 10                     140   7e-45   
ref|XP_004978312.1|  PREDICTED: MLO-like protein 5-like                 140   8e-45   
gb|EAY94273.1|  hypothetical protein OsI_16042                          129   8e-45   
ref|XP_010908325.1|  PREDICTED: MLO-like protein 1 isoform X2           105   9e-45   
ref|XP_009386660.1|  PREDICTED: MLO-like protein 9                      135   9e-45   
ref|XP_003571073.1|  PREDICTED: MLO-like protein 13                     145   1e-44   
ref|XP_002972783.1|  hypothetical protein SELMODRAFT_97970              134   1e-44   
ref|XP_002984361.1|  hypothetical protein SELMODRAFT_120181             134   1e-44   
ref|XP_010559057.1|  PREDICTED: MLO-like protein 15 isoform X2          106   1e-44   
ref|XP_008647383.1|  PREDICTED: uncharacterized protein LOC100193...    140   1e-44   
gb|EPS69181.1|  hypothetical protein M569_05587                         135   2e-44   
ref|XP_004975728.1|  PREDICTED: MLO-like protein 1-like                 135   2e-44   
ref|XP_006648422.1|  PREDICTED: MLO-like protein 13-like                146   3e-44   
gb|EMS45065.1|  MLO-like protein 1                                      107   3e-44   
ref|XP_006654121.1|  PREDICTED: MLO-like protein 5-like                 141   4e-44   
ref|XP_008228898.1|  PREDICTED: MLO protein homolog 1-like              141   5e-44   
ref|XP_009355375.1|  PREDICTED: MLO-like protein 13                     159   6e-44   
emb|CAD40974.1|  OSJNBa0027P08.3                                        126   7e-44   
gb|EMS53724.1|  MLO-like protein 5                                      143   1e-43   
gb|KJB23604.1|  hypothetical protein B456_004G106900                    129   1e-43   
ref|XP_007018110.1|  Seven transmembrane MLO family protein             135   2e-43   
ref|XP_008218604.1|  PREDICTED: endoglucanase 25                        155   2e-43   
gb|EEC72681.1|  hypothetical protein OsI_06239                          145   2e-43   
ref|XP_010030234.1|  PREDICTED: MLO-like protein 13                     146   2e-43   
gb|AFW69614.1|  hypothetical protein ZEAMMB73_948296                    135   2e-43   
ref|NP_001105170.1|  barley mlo defense gene homolog6                   136   3e-43   
emb|CDP17762.1|  unnamed protein product                                150   3e-43   
ref|XP_008680455.1|  PREDICTED: MLO-like protein 1                      155   3e-43   
ref|XP_004486414.1|  PREDICTED: MLO-like protein 13-like                147   3e-43   
ref|XP_002273002.1|  PREDICTED: MLO protein homolog 1-like              143   3e-43   
ref|XP_003568790.1|  PREDICTED: MLO-like protein 9                      139   4e-43   
emb|CBI40746.3|  unnamed protein product                                143   4e-43   
ref|XP_002439069.1|  hypothetical protein SORBIDRAFT_10g031010          135   4e-43   
ref|XP_010064954.1|  PREDICTED: MLO-like protein 9                      134   6e-43   
ref|XP_008237952.1|  PREDICTED: MLO protein homolog 1-like              139   7e-43   
ref|XP_007210822.1|  hypothetical protein PRUPE_ppa020311mg             139   1e-42   
ref|XP_009601752.1|  PREDICTED: MLO-like protein 8                      136   1e-42   
ref|XP_004232584.1|  PREDICTED: MLO-like protein 8                      136   1e-42   
ref|XP_009772716.1|  PREDICTED: MLO-like protein 10                     136   2e-42   
gb|KDO53879.1|  hypothetical protein CISIN_1g010805mg                   155   2e-42   
ref|XP_009372684.1|  PREDICTED: MLO protein homolog 1-like              137   2e-42   
ref|XP_010663996.1|  PREDICTED: MLO-like protein 9                      134   2e-42   
ref|XP_007046462.1|  Seven transmembrane MLO family protein             137   2e-42   
ref|XP_010270524.1|  PREDICTED: MLO-like protein 9                      130   3e-42   
ref|XP_009395303.1|  PREDICTED: MLO-like protein 6                      134   3e-42   
emb|CDP07267.1|  unnamed protein product                                140   3e-42   
ref|XP_008464826.1|  PREDICTED: MLO-like protein 9                      133   3e-42   
ref|XP_010693799.1|  PREDICTED: uncharacterized protein LOC104906705    121   4e-42   
ref|XP_004301591.2|  PREDICTED: endoglucanase 25                        157   4e-42   
ref|XP_009390750.1|  PREDICTED: MLO-like protein 9 isoform X1           138   4e-42   
ref|XP_002276608.1|  PREDICTED: MLO-like protein 10                     135   4e-42   
gb|EEC78643.1|  hypothetical protein OsI_18731                          136   5e-42   
gb|EYU36580.1|  hypothetical protein MIMGU_mgv1a020678mg                139   5e-42   
ref|XP_007156260.1|  hypothetical protein PHAVU_003G271300g             131   6e-42   
ref|XP_004144292.1|  PREDICTED: MLO-like protein 5-like                 130   6e-42   
ref|XP_006599251.1|  PREDICTED: MLO-like protein 8-like                 131   6e-42   
gb|EMT01433.1|  MLO-like protein 5                                      146   7e-42   
gb|KHN12501.1|  MLO-like protein 8                                      130   7e-42   
gb|EEE62569.1|  hypothetical protein OsJ_17368                          135   7e-42   
ref|XP_010682204.1|  PREDICTED: MLO-like protein 13                     149   7e-42   
gb|AAU44315.1|  hypothetical protein                                    136   8e-42   
ref|XP_009384603.1|  PREDICTED: MLO-like protein 10                     137   8e-42   
ref|NP_001054825.2|  Os05g0183300                                       135   9e-42   
ref|XP_009382074.1|  PREDICTED: MLO-like protein 9                      140   1e-41   
ref|XP_003534232.1|  PREDICTED: MLO-like protein 10-like isoform X1     130   1e-41   
ref|XP_008237943.1|  PREDICTED: MLO-like protein 9                      137   1e-41   
emb|CBI40748.3|  unnamed protein product                                131   2e-41   
ref|XP_010680631.1|  PREDICTED: MLO-like protein 10 isoform X1          128   2e-41   
ref|XP_006587547.1|  PREDICTED: MLO-like protein 10-like isoform X2     130   2e-41   
gb|KJB70717.1|  hypothetical protein B456_011G089600                    132   2e-41   
ref|XP_007211108.1|  hypothetical protein PRUPE_ppa024488mg             136   2e-41   
ref|XP_006343450.1|  PREDICTED: MLO-like protein 3-like                 137   2e-41   
ref|XP_009418888.1|  PREDICTED: MLO-like protein 9                      137   3e-41   
gb|ACN85192.1|  Mlo family protein                                      141   3e-41   
gb|ACN85176.1|  Mlo family protein                                      141   3e-41   
gb|ACN85209.1|  Mlo family protein                                      140   3e-41   
gb|KHN35943.1|  MLO-like protein 8                                      127   3e-41   
ref|XP_003517123.1|  PREDICTED: MLO-like protein 8-like isoform 1       127   3e-41   
gb|AES64675.2|  seven transmembrane MLO family protein                  140   3e-41   
gb|EMS50279.1|  MLO-like protein 13                                     141   4e-41   
ref|XP_002967927.1|  hypothetical protein SELMODRAFT_88157              124   4e-41   
ref|XP_008378938.1|  PREDICTED: MLO-like protein 13                     150   4e-41   
ref|XP_006356610.1|  PREDICTED: MLO-like protein 5-like                 130   5e-41   
ref|XP_008804580.1|  PREDICTED: MLO-like protein 9 isoform X1           132   6e-41   
ref|XP_006855658.1|  hypothetical protein AMTR_s00044p00117330          140   7e-41   
ref|XP_008804588.1|  PREDICTED: MLO-like protein 9 isoform X2           132   7e-41   
ref|XP_002981181.1|  hypothetical protein SELMODRAFT_154277             137   8e-41   
ref|XP_006366655.1|  PREDICTED: MLO-like protein 8-like isoform X1      128   8e-41   
ref|XP_011022136.1|  PREDICTED: MLO-like protein 8                      126   8e-41   
ref|XP_002982658.1|  hypothetical protein SELMODRAFT_155205             137   8e-41   
ref|XP_006366656.1|  PREDICTED: MLO-like protein 8-like isoform X2      128   9e-41   
gb|AHF52924.1|  Mlo protein                                             132   1e-40   
gb|AHF52923.1|  Mlo protein                                             132   1e-40   
ref|XP_010539025.1|  PREDICTED: MLO-like protein 9                      139   1e-40   
ref|XP_004240662.1|  PREDICTED: MLO-like protein 3                      136   1e-40   
gb|KDO53881.1|  hypothetical protein CISIN_1g010805mg                   155   1e-40   
ref|XP_003560590.1|  PREDICTED: MLO-like protein 13                     139   1e-40   
ref|XP_010918343.1|  PREDICTED: MLO protein homolog 1                   135   1e-40   
ref|XP_007147546.1|  hypothetical protein PHAVU_006G133800g             139   1e-40   
ref|XP_002963998.1|  hypothetical protein SELMODRAFT_81494              123   1e-40   
ref|XP_009347039.1|  PREDICTED: MLO-like protein 3                      129   1e-40   
ref|XP_008806842.1|  PREDICTED: MLO-like protein 6                      131   1e-40   
gb|AAG46114.1|AC073166_12  putative Mlo (pathogen resistance) pro...    133   2e-40   
ref|XP_004253244.1|  PREDICTED: MLO-like protein 9                      128   2e-40   
ref|XP_007013887.1|  Seven transmembrane MLO family protein, puta...    132   2e-40   
gb|EYU41181.1|  hypothetical protein MIMGU_mgv1a007661mg                137   2e-40   
gb|KJB14197.1|  hypothetical protein B456_002G113800                    133   2e-40   
gb|EAY79378.1|  hypothetical protein OsI_34504                          133   2e-40   
ref|XP_009779220.1|  PREDICTED: MLO-like protein 13                     152   2e-40   
gb|ACN85231.1|  Mlo family protein                                      140   2e-40   
gb|ACN85224.1|  Mlo family protein                                      140   2e-40   
ref|XP_001776768.1|  predicted protein                                  127   2e-40   
gb|ABB47940.1|  MLO-like protein 10, putative, expressed                133   2e-40   
ref|NP_001065189.1|  Os10g0541000                                       133   2e-40   
ref|XP_009790030.1|  PREDICTED: MLO-like protein 8                      126   2e-40   
ref|XP_007135969.1|  hypothetical protein PHAVU_009G007000g             125   3e-40   
ref|XP_008338387.1|  PREDICTED: MLO-like protein 3                      128   3e-40   
ref|XP_009619517.1|  PREDICTED: MLO-like protein 8                      126   3e-40   
gb|ACN85251.1|  Mlo family protein                                      137   3e-40   
gb|ACN85241.1|  Mlo family protein                                      137   3e-40   
emb|CDP06355.1|  unnamed protein product                                129   3e-40   
ref|XP_003527633.1|  PREDICTED: MLO-like protein 5-like                 124   3e-40   
gb|ACN85263.1|  Mlo family protein                                      139   3e-40   
gb|KHN33779.1|  MLO-like protein 5                                      124   3e-40   
ref|XP_003523524.1|  PREDICTED: MLO-like protein 5-like                 124   4e-40   
ref|XP_003540745.1|  PREDICTED: MLO-like protein 6-like isoform X1      133   4e-40   
ref|XP_006431345.1|  hypothetical protein CICLE_v10000909mg             155   4e-40   
ref|XP_002307201.1|  hypothetical protein POPTR_0005s10210g             125   4e-40   
ref|XP_011098015.1|  PREDICTED: MLO-like protein 10 isoform X1          128   4e-40   
ref|XP_006431344.1|  hypothetical protein CICLE_v10000909mg             155   4e-40   
ref|XP_011074255.1|  PREDICTED: MLO-like protein 9                      127   4e-40   
ref|XP_009603524.1|  PREDICTED: MLO-like protein 13                     150   4e-40   
ref|XP_004500844.1|  PREDICTED: MLO protein homolog 1-like              133   4e-40   
gb|ACN85283.1|  Mlo family protein                                      139   4e-40   
gb|ABD32919.1|  Mlo-related protein                                     136   4e-40   
ref|XP_003594424.1|  MLO-like protein                                   136   5e-40   
ref|XP_010934812.1|  PREDICTED: MLO-like protein 2                      127   5e-40   
gb|KDO53878.1|  hypothetical protein CISIN_1g010805mg                   155   5e-40   
ref|XP_006470774.1|  PREDICTED: MLO-like protein 13-like                154   5e-40   
ref|XP_011098016.1|  PREDICTED: MLO-like protein 10 isoform X2          127   5e-40   
ref|XP_010030238.1|  PREDICTED: MLO-like protein 13                     132   5e-40   
gb|KHN20092.1|  MLO-like protein 5                                      123   6e-40   
gb|EMS49774.1|  MLO-like protein 1                                      145   6e-40   
gb|KJB10414.1|  hypothetical protein B456_001G200000                    126   6e-40   
ref|XP_002510708.1|  Protein MLO, putative                              128   7e-40   
ref|XP_010935416.1|  PREDICTED: MLO-like protein 9                      127   7e-40   
ref|XP_010413828.1|  PREDICTED: MLO-like protein 5                      134   7e-40   
ref|XP_003538050.1|  PREDICTED: MLO-like protein 6-like                 132   8e-40   
gb|KJB10419.1|  hypothetical protein B456_001G200000                    125   9e-40   
gb|KJB10418.1|  hypothetical protein B456_001G200000                    125   9e-40   
dbj|BAD35488.1|  putative seven transmembrane protein Mlo7              135   9e-40   
gb|EMT10344.1|  MLO-like protein 1                                    97.4    9e-40   
ref|XP_002465008.1|  hypothetical protein SORBIDRAFT_01g030400          130   1e-39   
ref|XP_008352533.1|  PREDICTED: MLO-like protein 3                      128   1e-39   
ref|XP_011089886.1|  PREDICTED: MLO-like protein 3                      130   1e-39   
ref|XP_006850616.1|  hypothetical protein AMTR_s00034p00158070          131   1e-39   
gb|ACN85338.1|  Mlo family protein                                      136   1e-39   
gb|KHN33781.1|  MLO protein like 1                                      134   1e-39   
ref|XP_004983794.1|  PREDICTED: MLO-like protein 5-like                 130   1e-39   
emb|CBI16290.3|  unnamed protein product                                130   1e-39   
gb|KDO49430.1|  hypothetical protein CISIN_1g0104501mg                  110   1e-39   
ref|XP_002282216.1|  PREDICTED: MLO-like protein 6                      130   2e-39   
gb|KDP43787.1|  hypothetical protein JCGZ_22414                         139   2e-39   
gb|EMS61495.1|  MLO-like protein 8                                      127   2e-39   
ref|XP_004169166.1|  PREDICTED: MLO-like protein 8-like                 128   2e-39   
ref|XP_011077127.1|  PREDICTED: MLO-like protein 12                     134   2e-39   
ref|XP_004134822.1|  PREDICTED: LOW QUALITY PROTEIN: MLO-like pro...    128   2e-39   
ref|XP_004487692.1|  PREDICTED: MLO-like protein 11-like                130   2e-39   
gb|KGN49000.1|  hypothetical protein Csa_6G509690                       128   2e-39   
ref|XP_007015436.1|  Seven transmembrane MLO family protein isofo...    132   2e-39   
ref|XP_006302048.1|  hypothetical protein CARUB_v10020030mg             131   2e-39   
ref|XP_007015437.1|  Seven transmembrane MLO family protein isofo...    132   2e-39   
gb|AAK53798.1|AF369566_1  membrane protein Mlo5                         133   2e-39   
gb|KHN20094.1|  MLO protein like 1                                      133   2e-39   
ref|XP_003527634.1|  PREDICTED: MLO protein homolog 1-like              133   2e-39   
ref|XP_006473919.1|  PREDICTED: MLO protein homolog 1-like              135   3e-39   
ref|XP_008225351.1|  PREDICTED: MLO-like protein 3 isoform X1           123   3e-39   
ref|XP_004163965.1|  PREDICTED: MLO-like protein 3-like                 129   3e-39   
ref|XP_004147296.1|  PREDICTED: MLO-like protein 3-like                 129   3e-39   
ref|XP_004146181.1|  PREDICTED: MLO-like protein 8-like                 118   3e-39   
ref|XP_007015440.1|  MLO, putative                                      127   3e-39   
ref|NP_001105168.1|  barley mlo defense gene homolog2                   127   3e-39   
gb|KEH36350.1|  seven transmembrane MLO family protein                  130   3e-39   
ref|XP_008225359.1|  PREDICTED: MLO-like protein 3 isoform X2           123   3e-39   
ref|XP_010043720.1|  PREDICTED: MLO-like protein 6 isoform X1           133   3e-39   
ref|XP_004231310.1|  PREDICTED: MLO-like protein 13                     150   3e-39   
ref|XP_008440929.1|  PREDICTED: MLO-like protein 8                      127   3e-39   
tpg|DAA46106.1|  TPA: hypothetical protein ZEAMMB73_604520              127   4e-39   
gb|ACN85293.1|  Mlo family protein                                      136   4e-39   
ref|XP_007027288.1|  Seven transmembrane MLO family protein, puta...    132   4e-39   
ref|XP_006435410.1|  hypothetical protein CICLE_v10003446mg             135   4e-39   
ref|XP_011089887.1|  PREDICTED: MLO-like protein 6                      130   4e-39   
ref|XP_004159746.1|  PREDICTED: MLO-like protein 8-like                 117   4e-39   
ref|XP_006358492.1|  PREDICTED: MLO-like protein 13-like                150   4e-39   
gb|EYU18859.1|  hypothetical protein MIMGU_mgv1a003503mg                130   4e-39   
ref|XP_003603854.1|  MLO protein-like protein                           130   5e-39   
emb|CDP07138.1|  unnamed protein product                                129   5e-39   
ref|XP_009586729.1|  PREDICTED: MLO-like protein 9                      124   5e-39   
ref|XP_010270522.1|  PREDICTED: MLO-like protein 9 isoform X1           136   6e-39   
ref|XP_010523625.1|  PREDICTED: MLO-like protein 9                      132   6e-39   
ref|XP_010686828.1|  PREDICTED: MLO-like protein 9                      127   6e-39   
ref|NP_180923.1|  MLO-like protein 5                                    131   6e-39   
ref|XP_006296403.1|  hypothetical protein CARUB_v10025579mg             131   6e-39   
gb|ACN85306.1|  Mlo family protein                                      131   6e-39   
ref|XP_010509851.1|  PREDICTED: MLO-like protein 5                      131   6e-39   
gb|AGV68801.1|  MLO4                                                    133   7e-39   
ref|XP_004309423.1|  PREDICTED: MLO-like protein 6                      126   7e-39   
ref|XP_008338448.1|  PREDICTED: MLO-like protein 6                      127   7e-39   
ref|XP_009411538.1|  PREDICTED: MLO-like protein 6                      132   7e-39   
ref|XP_006662559.1|  PREDICTED: MLO-like protein 9-like                 129   8e-39   
gb|KFK31027.1|  hypothetical protein AALP_AA6G058600                    131   8e-39   
ref|XP_010469445.1|  PREDICTED: MLO-like protein 5                      131   8e-39   
ref|XP_008463924.1|  PREDICTED: MLO-like protein 6 isoform X1           127   8e-39   
ref|XP_004287711.1|  PREDICTED: MLO-like protein 10                     124   8e-39   
ref|XP_003574266.1|  PREDICTED: MLO-like protein 9                      126   8e-39   
gb|KJB55487.1|  hypothetical protein B456_009G078700                    127   9e-39   
ref|XP_008463775.1|  PREDICTED: MLO-like protein 6                      128   9e-39   
gb|EMS53781.1|  MLO-like protein 1                                      112   9e-39   
ref|XP_011089323.1|  PREDICTED: MLO-like protein 6                      128   1e-38   



>ref|XP_009621845.1| PREDICTED: MLO-like protein 1 [Nicotiana tomentosiformis]
Length=490

 Score =   243 bits (619),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 128/144 (89%), Gaps = 1/144 (1%)
 Frame = -3

Query  555  PSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIGV  376
            PSDEHFWF RPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMG V FI+PRLVIGV
Sbjct  346  PSDEHFWFNRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGQVGFIVPRLVIGV  405

Query  375  IIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGINHG  196
            IIQ+LCSYSTLP+YA+VTQMGTHFKKSIFDEHIQVGL+GWA+K K++KGLKAA    N G
Sbjct  406  IIQILCSYSTLPLYALVTQMGTHFKKSIFDEHIQVGLIGWAEKVKRKKGLKAATESSNQG  465

Query  195  GALTDGSSTGVQMGGVGRKESGST  124
             + T+GS+ G+QM G+GRKE  + 
Sbjct  466  NS-TEGSTVGLQMSGIGRKEPPAN  488


 Score =   117 bits (293),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 58/60 (97%), Positives = 60/60 (100%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            WVFVVIFLLLN+NGWHTYFWIAF+PFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV
Sbjct  285  WVFVVIFLLLNVNGWHTYFWIAFVPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  344



>ref|XP_009770323.1| PREDICTED: MLO-like protein 1 [Nicotiana sylvestris]
Length=492

 Score =   243 bits (621),  Expect(2) = 4e-90, Method: Compositional matrix adjust.
 Identities = 116/144 (81%), Positives = 129/144 (90%), Gaps = 1/144 (1%)
 Frame = -3

Query  555  PSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIGV  376
            PSDEHFWF RPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMG V FI+PRLVIGV
Sbjct  348  PSDEHFWFNRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGQVGFIVPRLVIGV  407

Query  375  IIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGINHG  196
            IIQVLCSYSTLP+YA+VTQMGTHFKKSIFDEHIQVGL+GWA+K K++KGLKAA  G N G
Sbjct  408  IIQVLCSYSTLPLYALVTQMGTHFKKSIFDEHIQVGLLGWAEKVKRKKGLKAATEGSNQG  467

Query  195  GALTDGSSTGVQMGGVGRKESGST  124
             + T+GS+ G+QM G+GRKE  + 
Sbjct  468  SS-TEGSTVGLQMLGIGRKEPPAN  490


 Score =   116 bits (290),  Expect(2) = 4e-90, Method: Compositional matrix adjust.
 Identities = 57/60 (95%), Positives = 60/60 (100%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            WVFVVIFLL+N+NGWHTYFWIAF+PFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV
Sbjct  287  WVFVVIFLLVNVNGWHTYFWIAFVPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  346



>ref|XP_011089565.1| PREDICTED: MLO-like protein 1 [Sesamum indicum]
Length=498

 Score =   243 bits (620),  Expect(2) = 7e-90, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 128/144 (89%), Gaps = 1/144 (1%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + +PSD HFWF RPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMG V++I+PRL+
Sbjct  344  VVKPSDNHFWFHRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGQVRYIVPRLI  403

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGI  205
            IGV IQVLCSYSTLP+YA+VTQMGT+FKKSIFDEH+QVGLVGWAQKAK+RKGLKA  GG 
Sbjct  404  IGVFIQVLCSYSTLPLYALVTQMGTYFKKSIFDEHVQVGLVGWAQKAKKRKGLKATLGGS  463

Query  204  NHGGALTDGSSTGVQMGGVGRKES  133
              GG+ T+G S G+QM  +GRKE 
Sbjct  464  TQGGS-TNGPSIGIQMAAIGRKEE  486


 Score =   115 bits (289),  Expect(2) = 7e-90, Method: Compositional matrix adjust.
 Identities = 57/60 (95%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            WVFV+IFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVI QLAHEVAEKH+AIEGELVV
Sbjct  286  WVFVIIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVISQLAHEVAEKHIAIEGELVV  345



>emb|CDP04006.1| unnamed protein product [Coffea canephora]
Length=468

 Score =   241 bits (614),  Expect(2) = 3e-88, Method: Compositional matrix adjust.
 Identities = 114/141 (81%), Positives = 125/141 (89%), Gaps = 1/141 (1%)
 Frame = -3

Query  558  QPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIG  379
            QPSD+HFWF RPQIVLFLIHFILFQNAFEIAFFFWI VQYGFDSCIMG V++I+PRL+IG
Sbjct  325  QPSDDHFWFHRPQIVLFLIHFILFQNAFEIAFFFWIWVQYGFDSCIMGQVRYIVPRLIIG  384

Query  378  VIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGINH  199
            V IQVLCSYSTLP+YAIVTQMGTHFKKSIFDEH+QVGL+GWAQK KQ+KGLK   GG N 
Sbjct  385  VFIQVLCSYSTLPLYAIVTQMGTHFKKSIFDEHVQVGLLGWAQKVKQKKGLKGPLGGSNQ  444

Query  198  GGALTDGSSTGVQMGGVGRKE  136
              + T+G S GVQMGG GRKE
Sbjct  445  RNS-TEGPSAGVQMGGTGRKE  464


 Score =   112 bits (281),  Expect(2) = 3e-88, Method: Compositional matrix adjust.
 Identities = 54/60 (90%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVV+FLLLN+NGWHTYFWIAFIPFILLLAVGTKLEH+I QLAHEVAEKHVAIEGEL V
Sbjct  265  WIFVVVFLLLNVNGWHTYFWIAFIPFILLLAVGTKLEHIISQLAHEVAEKHVAIEGELAV  324



>ref|XP_006344359.1| PREDICTED: MLO-like protein 1-like [Solanum tuberosum]
Length=477

 Score =   228 bits (582),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 109/147 (74%), Positives = 124/147 (84%), Gaps = 4/147 (3%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + QPSD+HFWF RPQIVL LIHFILFQNAFEIAFFFWILVQYGF+SCIMG V FI+PRLV
Sbjct  335  VVQPSDDHFWFKRPQIVLILIHFILFQNAFEIAFFFWILVQYGFNSCIMGQVGFIVPRLV  394

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGI  205
            IGVIIQVLCSYSTLP+YA+VTQMGTHFKKSIFDEHIQVGL+GWA KAK ++GLKAA    
Sbjct  395  IGVIIQVLCSYSTLPLYALVTQMGTHFKKSIFDEHIQVGLLGWASKAKMKRGLKAA----  450

Query  204  NHGGALTDGSSTGVQMGGVGRKESGST  124
               G   +GS+  +QM G+ +KE+  T
Sbjct  451  TDAGTSIEGSTVRLQMSGINQKETTPT  477


 Score =   115 bits (287),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 56/60 (93%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            WVFVVIFL LN+NGWHTYFWIAFIPF+LL+AVGTKLEHVIIQLAHEVAEKHVAIEGELVV
Sbjct  277  WVFVVIFLFLNVNGWHTYFWIAFIPFVLLIAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  336



>gb|EYU36872.1| hypothetical protein MIMGU_mgv1a004875mg [Erythranthe guttata]
Length=506

 Score =   229 bits (583),  Expect(2) = 3e-84, Method: Compositional matrix adjust.
 Identities = 107/153 (70%), Positives = 127/153 (83%), Gaps = 9/153 (6%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + QPSD+HFWF RP+IVL LIHFILFQNAFEIAFFFWI VQYGF+SCIMG V++I+PRL+
Sbjct  342  VVQPSDDHFWFRRPRIVLILIHFILFQNAFEIAFFFWIWVQYGFNSCIMGKVRYIVPRLI  401

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGI  205
            IGV IQVLCSYSTLP+YA+VTQMGTHFKKSIF+EH+QVGLVGWAQK K+++GLKAA GG 
Sbjct  402  IGVFIQVLCSYSTLPLYALVTQMGTHFKKSIFEEHVQVGLVGWAQKVKKKQGLKAALGGS  461

Query  204  NHGGAL---------TDGSSTGVQMGGVGRKES  133
               G+          T GSS G+QM G+ R+E+
Sbjct  462  TQAGSTQGGSTQAGSTGGSSLGIQMAGIARRET  494


 Score =   110 bits (276),  Expect(2) = 3e-84, Method: Compositional matrix adjust.
 Identities = 53/60 (88%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            WVFVV+FLLLNINGWHTYFWIAF PF+LLLAVG KLEH+I QLAHEVAEKH+AIEGELVV
Sbjct  284  WVFVVLFLLLNINGWHTYFWIAFFPFVLLLAVGAKLEHIISQLAHEVAEKHIAIEGELVV  343



>ref|XP_008460095.1| PREDICTED: MLO-like protein 1 [Cucumis melo]
Length=514

 Score =   225 bits (573),  Expect(2) = 4e-83, Method: Compositional matrix adjust.
 Identities = 111/166 (67%), Positives = 131/166 (79%), Gaps = 10/166 (6%)
 Frame = -3

Query  570  NWLCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPR  391
            + + QPSD+HFWF RP+IVLFLIHFILFQNAFEI FFFWI VQYGFDSCIMG V++IIPR
Sbjct  356  DLVVQPSDDHFWFQRPRIVLFLIHFILFQNAFEIGFFFWIWVQYGFDSCIMGQVRYIIPR  415

Query  390  LVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFG  211
            L+IGV +QVLCSYSTLP+YAIVTQMG+ FKK+IFDEH+QVGLVGWAQK K+RKGL+AA  
Sbjct  416  LIIGVFVQVLCSYSTLPLYAIVTQMGSSFKKAIFDEHVQVGLVGWAQKVKKRKGLRAAAD  475

Query  210  GINHGGALTDGSSTGVQMGGVGRKESGSTDGASVRALQQMGGDGSK  73
            G +  G    GS+ G+Q+G V RK S         A Q++  D SK
Sbjct  476  GSSQ-GVKEGGSTVGIQLGNVMRKAS---------APQEIKPDDSK  511


 Score =   111 bits (277),  Expect(2) = 4e-83, Method: Compositional matrix adjust.
 Identities = 52/60 (87%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVV+FL LN++GWHTYFWIAFIPF+LLLAVGTKLEHVI QLAHEVAEKHVAIEG+LVV
Sbjct  300  WIFVVVFLFLNVSGWHTYFWIAFIPFVLLLAVGTKLEHVITQLAHEVAEKHVAIEGDLVV  359



>ref|XP_004145008.1| PREDICTED: MLO-like protein 1-like [Cucumis sativus]
 ref|XP_004154026.1| PREDICTED: MLO-like protein 1-like [Cucumis sativus]
 ref|XP_004160672.1| PREDICTED: MLO-like protein 1-like [Cucumis sativus]
Length=516

 Score =   225 bits (573),  Expect(2) = 6e-83, Method: Compositional matrix adjust.
 Identities = 111/166 (67%), Positives = 131/166 (79%), Gaps = 10/166 (6%)
 Frame = -3

Query  570  NWLCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPR  391
            + + QPSD+HFWF RP+IVLFLIHFILFQNAFEI FFFWI VQYGFDSCIMG V++IIPR
Sbjct  356  DLVVQPSDDHFWFQRPRIVLFLIHFILFQNAFEIGFFFWIWVQYGFDSCIMGQVRYIIPR  415

Query  390  LVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFG  211
            L+IGV +QVLCSYSTLP+YAIVTQMG+ FKK+IFDEH+QVGLVGWAQK K+RKGL+AA  
Sbjct  416  LIIGVFVQVLCSYSTLPLYAIVTQMGSSFKKAIFDEHVQVGLVGWAQKVKKRKGLRAAAD  475

Query  210  GINHGGALTDGSSTGVQMGGVGRKESGSTDGASVRALQQMGGDGSK  73
            G +  G    GS+ G+Q+G V RK S         A Q++  D SK
Sbjct  476  G-SSQGVKEGGSTVGIQLGNVMRKAS---------APQEIKPDDSK  511


 Score =   110 bits (275),  Expect(2) = 6e-83, Method: Compositional matrix adjust.
 Identities = 51/60 (85%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVV+FL LN++GWHTYFWIAFIPF+LLLAVGTKLEHVI QLAHEVAEKH+AIEG+LVV
Sbjct  300  WIFVVVFLFLNVSGWHTYFWIAFIPFVLLLAVGTKLEHVITQLAHEVAEKHIAIEGDLVV  359



>ref|NP_001284374.1| MLO-like protein 1 [Cucumis melo]
 gb|ACX55085.1| Mlo1 [Cucumis melo]
Length=516

 Score =   222 bits (566),  Expect(2) = 3e-82, Method: Compositional matrix adjust.
 Identities = 110/166 (66%), Positives = 130/166 (78%), Gaps = 10/166 (6%)
 Frame = -3

Query  570  NWLCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPR  391
            + + QPSD+HFWF RP+IVLFLIHFILFQNAFEI FFFWI VQYGFDSCIMG V++IIPR
Sbjct  356  DLVVQPSDDHFWFQRPRIVLFLIHFILFQNAFEIGFFFWIWVQYGFDSCIMGQVRYIIPR  415

Query  390  LVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFG  211
            L+IGV +QVLCSYSTLP+YAIVTQMG+ FKK+IFDEH+QVGLVGWAQK K+RKGL+AA  
Sbjct  416  LIIGVFVQVLCSYSTLPLYAIVTQMGSSFKKAIFDEHVQVGLVGWAQKVKKRKGLRAAAD  475

Query  210  GINHGGALTDGSSTGVQMGGVGRKESGSTDGASVRALQQMGGDGSK  73
            G +  G    GS+ G+Q+G V RK           A Q++  D SK
Sbjct  476  GSSQ-GVKEGGSTVGIQLGNVMRK---------AFAPQEIKPDDSK  511


 Score =   111 bits (277),  Expect(2) = 3e-82, Method: Compositional matrix adjust.
 Identities = 52/60 (87%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVV+FL LN++GWHTYFWIAFIPF+LLLAVGTKLEHVI QLAHEVAEKHVAIEG+LVV
Sbjct  300  WIFVVVFLFLNVSGWHTYFWIAFIPFVLLLAVGTKLEHVITQLAHEVAEKHVAIEGDLVV  359



>gb|KDP39614.1| hypothetical protein JCGZ_02634 [Jatropha curcas]
Length=536

 Score =   216 bits (550),  Expect(2) = 3e-81, Method: Compositional matrix adjust.
 Identities = 98/136 (72%), Positives = 118/136 (87%), Gaps = 0/136 (0%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + +PSD+HFWFGRP IVLFLIHFILFQNAFEIAFFFWI VQYGFDSCIMG V++I+PRL+
Sbjct  353  IVKPSDDHFWFGRPHIVLFLIHFILFQNAFEIAFFFWIWVQYGFDSCIMGQVRYIVPRLI  412

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGI  205
            IGVIIQ+LCSYSTLP+YAIVTQMG+ FK++IFD+HIQ G+VGWAQKAK++KGL+AA    
Sbjct  413  IGVIIQILCSYSTLPLYAIVTQMGSSFKRAIFDDHIQAGIVGWAQKAKKKKGLRAAAATD  472

Query  204  NHGGALTDGSSTGVQM  157
                A +  SS G+Q+
Sbjct  473  GSNQASSHESSVGIQL  488


 Score =   113 bits (283),  Expect(2) = 3e-81, Method: Compositional matrix adjust.
 Identities = 53/60 (88%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FV+IFLLLN+NGWHTYFWIAFIPF LLLAVGTKLEHVIIQLAH+VAEKHVAIEG+L+V
Sbjct  295  WIFVIIFLLLNVNGWHTYFWIAFIPFALLLAVGTKLEHVIIQLAHDVAEKHVAIEGDLIV  354



>ref|XP_010052699.1| PREDICTED: MLO-like protein 1 [Eucalyptus grandis]
 gb|KCW76769.1| hypothetical protein EUGRSUZ_D01126 [Eucalyptus grandis]
 gb|KCW76770.1| hypothetical protein EUGRSUZ_D01126 [Eucalyptus grandis]
Length=514

 Score =   216 bits (550),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 111/166 (67%), Positives = 130/166 (78%), Gaps = 11/166 (7%)
 Frame = -3

Query  558  QPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIG  379
            QPSDEHFWF RP+IVL+LIHFILFQ AFEIAFFFWI  QYGFDSCIMG V++IIPRL+IG
Sbjct  356  QPSDEHFWFQRPRIVLYLIHFILFQIAFEIAFFFWIWFQYGFDSCIMGKVRYIIPRLIIG  415

Query  378  VIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGINH  199
            V IQVLCSYSTLP+YAIVTQMG+ FKK+IFD+H+QVGLV WA+KAK++KGL+AA G  + 
Sbjct  416  VFIQVLCSYSTLPLYAIVTQMGSSFKKAIFDDHLQVGLVNWAEKAKKKKGLRAAAGDGSG  475

Query  198  GGALT--DGSSTGVQMGGVGRKES--GSTDGASVRALQQMGGDGSK  73
             G  +  DGS+  VQ+G V RK S  G T   S       G +GSK
Sbjct  476  SGQASSHDGSTIRVQLGRVFRKASAPGETQPTS-------GPEGSK  514


 Score =   111 bits (278),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 52/60 (87%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVV+FLLLN+NGWHTYFWIAF+P ILLLAVGTKLEHVI QLAHEVAEKH+A+EGELVV
Sbjct  296  WIFVVVFLLLNVNGWHTYFWIAFLPCILLLAVGTKLEHVITQLAHEVAEKHIAVEGELVV  355



>ref|XP_003522288.1| PREDICTED: MLO-like protein 1-like [Glycine max]
 gb|KHN33659.1| MLO-like protein 1 [Glycine soja]
Length=506

 Score =   217 bits (553),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 100/151 (66%), Positives = 126/151 (83%), Gaps = 2/151 (1%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + QPSD+HFWF RP++VLFLIHFILFQNAFEIAFFFWI V YGFDSCIMG V++I+PRLV
Sbjct  348  VVQPSDDHFWFHRPRVVLFLIHFILFQNAFEIAFFFWIWVTYGFDSCIMGQVRYIVPRLV  407

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGI  205
            IGV IQVLCSYSTLP+YAIVTQMGTH+K++IF++H+Q  +VGWAQKAK+RKGLKA   G 
Sbjct  408  IGVFIQVLCSYSTLPLYAIVTQMGTHYKRAIFNDHLQQNIVGWAQKAKKRKGLKA--DGN  465

Query  204  NHGGALTDGSSTGVQMGGVGRKESGSTDGAS  112
               G+  + ++TG+Q+G + +K +   D +S
Sbjct  466  PGQGSSQESANTGIQLGSIFKKATAPGDSSS  496


 Score =   110 bits (276),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 54/60 (90%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVVIFLLLNINGWHTYFWIAFIP ILLLAVGTKLEH+I QLAHEVAEKH AIEG+LVV
Sbjct  290  WLFVVIFLLLNINGWHTYFWIAFIPVILLLAVGTKLEHIITQLAHEVAEKHAAIEGDLVV  349



>gb|EPS69012.1| hypothetical protein M569_05755 [Genlisea aurea]
Length=477

 Score =   208 bits (530),  Expect(2) = 7e-80, Method: Compositional matrix adjust.
 Identities = 101/132 (77%), Positives = 110/132 (83%), Gaps = 9/132 (7%)
 Frame = -3

Query  558  QPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIG  379
            QPSD+HFWF RP+IVL LIHFILFQNAFEIAFFFWI VQYGFDSCIMG V+FI+PRL+I 
Sbjct  340  QPSDDHFWFSRPKIVLVLIHFILFQNAFEIAFFFWIWVQYGFDSCIMGRVRFIVPRLIIA  399

Query  378  VIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGL--------K  223
            VIIQ LCSYSTLP+YA+VTQMGTHFKKSIFDEH+Q GLVGWAQK K+RKGL         
Sbjct  400  VIIQTLCSYSTLPLYALVTQMGTHFKKSIFDEHVQAGLVGWAQKVKKRKGLGSGSGSGSA  459

Query  222  AAFG-GINHGGA  190
            A  G G NHG A
Sbjct  460  AVTGEGSNHGAA  471


 Score =   116 bits (291),  Expect(2) = 7e-80, Method: Compositional matrix adjust.
 Identities = 58/60 (97%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVI QLAHEVAEKHVA+EGELVV
Sbjct  280  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVITQLAHEVAEKHVAVEGELVV  339



>ref|XP_008345263.1| PREDICTED: MLO-like protein 1 [Malus domestica]
Length=504

 Score =   213 bits (541),  Expect(2) = 2e-79, Method: Compositional matrix adjust.
 Identities = 101/159 (64%), Positives = 124/159 (78%), Gaps = 10/159 (6%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + QPSD+HFWFG+P++VLFLIHFILFQNAFEIAFFFWI +QYGFDSCIMG VK+I+PRL+
Sbjct  345  VVQPSDDHFWFGKPRLVLFLIHFILFQNAFEIAFFFWIWLQYGFDSCIMGQVKYIVPRLI  404

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFG--  211
            IGV IQVLCSYSTLP+YAIVTQMGTHFKK+IFD+H+QVGLVGWAQK K++K ++AA    
Sbjct  405  IGVFIQVLCSYSTLPLYAIVTQMGTHFKKAIFDDHVQVGLVGWAQKVKKKKAMQAANAND  464

Query  210  ------GINHGGALTDGSSTGVQMGGVGRKESGSTDGAS  112
                  G +H G  +   S G+QM     K +   +  +
Sbjct  465  ASDSGQGSSHEG--SAAGSVGIQMAKFMNKATKKEERVT  501


 Score =   111 bits (277),  Expect(2) = 2e-79, Method: Compositional matrix adjust.
 Identities = 51/60 (85%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVVIFLL+NINGWHTYFWIAF+PF+LLLAVGTKLEH+I QLAHEVAEKH+A+EG+LVV
Sbjct  287  WIFVVIFLLMNINGWHTYFWIAFVPFLLLLAVGTKLEHIINQLAHEVAEKHIAVEGDLVV  346



>emb|CAN71629.1| hypothetical protein VITISV_015579 [Vitis vinifera]
Length=1031

 Score =   212 bits (539),  Expect(2) = 2e-79, Method: Composition-based stats.
 Identities = 99/146 (68%), Positives = 114/146 (78%), Gaps = 12/146 (8%)
 Frame = -3

Query  558  QPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIG  379
            QPSD+HFWF RP+IVLFLIH ILFQN+FE+AFFFWIL  YGFDSCIMG V++IIPRLVIG
Sbjct  362  QPSDDHFWFHRPRIVLFLIHIILFQNSFEMAFFFWILFTYGFDSCIMGKVQYIIPRLVIG  421

Query  378  VIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGINH  199
            VIIQVLCSYSTLP+YAIVTQMGTHFKK+IFDEH+Q GLVGWAQKA++    K   G  N 
Sbjct  422  VIIQVLCSYSTLPLYAIVTQMGTHFKKAIFDEHVQAGLVGWAQKARK----KTTTGNANR  477

Query  198  GGALTDGSSTGVQMGGVGRKESGSTD  121
            G          +Q+G V R E+   +
Sbjct  478  GPT--------IQLGRVVRSENAKEE  495


 Score =   112 bits (279),  Expect(2) = 2e-79, Method: Compositional matrix adjust.
 Identities = 53/60 (88%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVV+FLLLN++GWHTYFWIAFIPFILLLAVG KLEHVI QLAHEVAEKH AIEGELVV
Sbjct  302  WIFVVVFLLLNVDGWHTYFWIAFIPFILLLAVGAKLEHVISQLAHEVAEKHAAIEGELVV  361



>ref|XP_007029886.1| Seven transmembrane MLO family protein [Theobroma cacao]
 gb|EOY10388.1| Seven transmembrane MLO family protein [Theobroma cacao]
Length=510

 Score =   205 bits (521),  Expect(2) = 2e-79, Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 119/148 (80%), Gaps = 4/148 (3%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + QPSD+HFWF +P+IVLFLIHFILFQNAFEIAFFFWI VQ+GFDSCIMG + +IIPRLV
Sbjct  355  VVQPSDDHFWFNKPRIVLFLIHFILFQNAFEIAFFFWIWVQFGFDSCIMGQIGYIIPRLV  414

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGI  205
            IGV IQVLCSYSTLP+YAIVTQMG+ FKK+IFDEH+Q GLVGWAQKAK++KGL+AA    
Sbjct  415  IGVFIQVLCSYSTLPLYAIVTQMGSSFKKAIFDEHVQAGLVGWAQKAKKKKGLRAATEAA  474

Query  204  NHGGALTDGSSTGVQMGGVGRKESGSTD  121
                A  +  S  +QMG V R  +   +
Sbjct  475  ----AQEERPSVAIQMGRVLRNAAAPEE  498


 Score =   118 bits (296),  Expect(2) = 2e-79, Method: Compositional matrix adjust.
 Identities = 59/60 (98%), Positives = 60/60 (100%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            WVFVVIFLLLN+NGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV
Sbjct  297  WVFVVIFLLLNVNGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  356



>ref|XP_008369123.1| PREDICTED: MLO-like protein 1 [Malus domestica]
Length=504

 Score =   212 bits (540),  Expect(2) = 2e-79, Method: Compositional matrix adjust.
 Identities = 101/159 (64%), Positives = 124/159 (78%), Gaps = 10/159 (6%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + QPSD+HFWFG+P++VLFLIHFILFQNAFEIAFFFWI +QYGFDSCIMG VK+I+PRL+
Sbjct  345  VVQPSDDHFWFGKPRLVLFLIHFILFQNAFEIAFFFWIWLQYGFDSCIMGQVKYIVPRLI  404

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFG--  211
            IGV IQVLCSYSTLP+YAIVTQMGTHFKK+IFD+H+QVGLVGWAQK K++K ++AA    
Sbjct  405  IGVFIQVLCSYSTLPLYAIVTQMGTHFKKAIFDDHVQVGLVGWAQKVKKKKAMQAANAND  464

Query  210  ------GINHGGALTDGSSTGVQMGGVGRKESGSTDGAS  112
                  G +H G  +   S G+QM     K +   +  +
Sbjct  465  ASDSGQGSSHEG--SAAGSVGIQMAKFMNKATKKEERVT  501


 Score =   111 bits (277),  Expect(2) = 2e-79, Method: Compositional matrix adjust.
 Identities = 51/60 (85%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVVIFLL+NINGWHTYFWIAF+PF+LLLAVGTKLEH+I QLAHEVAEKH+A+EG+LVV
Sbjct  287  WIFVVIFLLMNINGWHTYFWIAFVPFLLLLAVGTKLEHIINQLAHEVAEKHIAVEGDLVV  346



>ref|XP_003527594.1| PREDICTED: MLO-like protein 1-like [Glycine max]
Length=488

 Score =   218 bits (554),  Expect(2) = 2e-79, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 128/162 (79%), Gaps = 4/162 (2%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + QPSDEHFWF RP +VLFLIHFILFQNAFEIAFFFWI V YGFDSCIMG V++I+PRLV
Sbjct  330  VVQPSDEHFWFHRPHVVLFLIHFILFQNAFEIAFFFWIWVTYGFDSCIMGQVRYIVPRLV  389

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGI  205
            IGV IQVLCSYSTLP+YAIVTQMGTH+K++IF+EH+Q  +VGWAQKAK+RKGLKA   G 
Sbjct  390  IGVFIQVLCSYSTLPLYAIVTQMGTHYKRAIFNEHLQQNIVGWAQKAKKRKGLKA--DGN  447

Query  204  NHGGALTDGSSTGVQMGGVGRKESGSTDGASVRALQQMGGDG  79
               G+  + ++TG+Q+G + +K   S  G S  A +  G + 
Sbjct  448  PGQGSSQESANTGIQLGSIFKK--ASAPGGSSSATKADGTNS  487


 Score =   105 bits (263),  Expect(2) = 2e-79, Method: Compositional matrix adjust.
 Identities = 52/60 (87%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVVIFLLLNINGWHTYFWIAFIP +LLLAVGTKL HVI QLA EVAEKH AIEG+LVV
Sbjct  272  WLFVVIFLLLNINGWHTYFWIAFIPVVLLLAVGTKLGHVITQLAQEVAEKHAAIEGDLVV  331



>ref|NP_001045040.1| Os01g0888600 [Oryza sativa Japonica Group]
 dbj|BAB92639.1| putative seven transmembrane protein Mlo8 [Oryza sativa Japonica 
Group]
 dbj|BAD82145.1| putative seven transmembrane protein Mlo8 [Oryza sativa Japonica 
Group]
 dbj|BAF06954.1| Os01g0888600 [Oryza sativa Japonica Group]
 dbj|BAH00453.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC71925.1| hypothetical protein OsI_04724 [Oryza sativa Indica Group]
 gb|EEE55778.1| hypothetical protein OsJ_04347 [Oryza sativa Japonica Group]
Length=502

 Score =   215 bits (547),  Expect(2) = 2e-79, Method: Compositional matrix adjust.
 Identities = 103/158 (65%), Positives = 125/158 (79%), Gaps = 5/158 (3%)
 Frame = -3

Query  558  QPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIG  379
             PSDEHFWFGRP+++L+LIHFILFQNAFEIAFFFWIL  YGF+SCIM HV FI+ RL+IG
Sbjct  346  NPSDEHFWFGRPKVILYLIHFILFQNAFEIAFFFWILTTYGFNSCIMDHVPFILTRLIIG  405

Query  378  VIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGINH  199
             I+Q+LCSYSTLPIYAIVTQMG+ FKK IFDEH+Q GLVGWAQKAK+RKGLK + G +  
Sbjct  406  AIVQILCSYSTLPIYAIVTQMGSFFKKEIFDEHVQQGLVGWAQKAKKRKGLKESNGAMAG  465

Query  198  GGALTDGSSTGVQMGGVGRK----ESGSTDGASVRALQ  97
             G+ T+GSS    +  + R+    E GS++G  +R  Q
Sbjct  466  AGS-TNGSSQPSSILQMVRRAAASEEGSSNGGDMRTNQ  502


 Score =   108 bits (270),  Expect(2) = 2e-79, Method: Compositional matrix adjust.
 Identities = 50/60 (83%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FV+IFLLLN+NGWHTYFWI+F+P +LLLAVGTKLEHVI QLAHEVAEKH AIEG+LVV
Sbjct  286  WIFVMIFLLLNVNGWHTYFWISFVPLLLLLAVGTKLEHVITQLAHEVAEKHSAIEGDLVV  345



>gb|KHN19980.1| MLO-like protein 1 [Glycine soja]
Length=488

 Score =   218 bits (554),  Expect(2) = 3e-79, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 128/162 (79%), Gaps = 4/162 (2%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + QPSDEHFWF RP +VLFLIHFILFQNAFEIAFFFWI V YGFDSCIMG V++I+PRLV
Sbjct  330  VVQPSDEHFWFHRPHVVLFLIHFILFQNAFEIAFFFWIWVTYGFDSCIMGQVRYIVPRLV  389

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGI  205
            IGV IQVLCSYSTLP+YAIVTQMGTH+K++IF+EH+Q  +VGWAQKAK+RKGLKA   G 
Sbjct  390  IGVFIQVLCSYSTLPLYAIVTQMGTHYKRAIFNEHLQQNIVGWAQKAKKRKGLKA--DGN  447

Query  204  NHGGALTDGSSTGVQMGGVGRKESGSTDGASVRALQQMGGDG  79
               G+  + ++TG+Q+G + +K   S  G S  A +  G + 
Sbjct  448  PGQGSSQESANTGIQLGSIFKK--ASAPGGSSSATKADGTNS  487


 Score =   105 bits (263),  Expect(2) = 3e-79, Method: Compositional matrix adjust.
 Identities = 52/60 (87%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVVIFLLLNINGWHTYFWIAFIP +LLLAVGTKL HVI QLA EVAEKH AIEG+LVV
Sbjct  272  WLFVVIFLLLNINGWHTYFWIAFIPVVLLLAVGTKLGHVITQLAQEVAEKHAAIEGDLVV  331



>gb|KHG28287.1| MLO-like protein 1 [Gossypium arboreum]
Length=503

 Score =   204 bits (519),  Expect(2) = 1e-78, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 119/146 (82%), Gaps = 1/146 (1%)
 Frame = -3

Query  558  QPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIG  379
            QPSD+HFWF +P+IVLFLIHFILFQNAFEIAFFFWI VQ+GFDSCIMG V++I+PRLVIG
Sbjct  351  QPSDDHFWFNKPRIVLFLIHFILFQNAFEIAFFFWIWVQFGFDSCIMGQVRYIVPRLVIG  410

Query  378  VIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGINH  199
            V IQVLCSYSTLP+YAIVTQMG+ FKKSIFDEH+QVGLVGWAQK K++KGLKAA G    
Sbjct  411  VFIQVLCSYSTLPLYAIVTQMGSSFKKSIFDEHVQVGLVGWAQKVKKKKGLKAATGSAAQ  470

Query  198  GGALTDGSSTGVQMGGVGRKESGSTD  121
              +     S  +QMG V R  S   +
Sbjct  471  ENS-EQNPSVAIQMGRVLRNASAPEE  495


 Score =   117 bits (293),  Expect(2) = 1e-78, Method: Compositional matrix adjust.
 Identities = 58/60 (97%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            WVFVVIFLLLN+NGWHTYFWIAFIPFILLLAVGTKLEHVI QLAHEVAEKHVAIEGELVV
Sbjct  291  WVFVVIFLLLNVNGWHTYFWIAFIPFILLLAVGTKLEHVITQLAHEVAEKHVAIEGELVV  350



>gb|KHG28285.1| MLO-like protein 1 [Gossypium arboreum]
Length=537

 Score =   204 bits (518),  Expect(2) = 1e-78, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 119/146 (82%), Gaps = 1/146 (1%)
 Frame = -3

Query  558  QPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIG  379
            QPSD+HFWF +P+IVLFLIHFILFQNAFEIAFFFWI VQ+GFDSCIMG V++I+PRLVIG
Sbjct  385  QPSDDHFWFNKPRIVLFLIHFILFQNAFEIAFFFWIWVQFGFDSCIMGQVRYIVPRLVIG  444

Query  378  VIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGINH  199
            V IQVLCSYSTLP+YAIVTQMG+ FKKSIFDEH+QVGLVGWAQK K++KGLKAA G    
Sbjct  445  VFIQVLCSYSTLPLYAIVTQMGSSFKKSIFDEHVQVGLVGWAQKVKKKKGLKAATGSAAQ  504

Query  198  GGALTDGSSTGVQMGGVGRKESGSTD  121
              +     S  +QMG V R  S   +
Sbjct  505  ENS-EQNPSVAIQMGRVLRNASAPEE  529


 Score =   117 bits (293),  Expect(2) = 1e-78, Method: Compositional matrix adjust.
 Identities = 58/60 (97%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            WVFVVIFLLLN+NGWHTYFWIAFIPFILLLAVGTKLEHVI QLAHEVAEKHVAIEGELVV
Sbjct  325  WVFVVIFLLLNVNGWHTYFWIAFIPFILLLAVGTKLEHVITQLAHEVAEKHVAIEGELVV  384



>ref|XP_010528781.1| PREDICTED: MLO-like protein 1 [Tarenaya hassleriana]
Length=510

 Score =   206 bits (525),  Expect(2) = 1e-78, Method: Compositional matrix adjust.
 Identities = 102/149 (68%), Positives = 118/149 (79%), Gaps = 1/149 (1%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + +PSDEHFWF RP IVLFLIHFILFQNAFEIAFFFWI V YGFDSCIMG V++I+PRLV
Sbjct  354  VVKPSDEHFWFDRPHIVLFLIHFILFQNAFEIAFFFWIWVTYGFDSCIMGQVRYIVPRLV  413

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGI  205
            IGV IQVLCSYSTLP+YAIVTQMG+ FKK+IFDE IQVGLVGWAQK K +KGL+AA    
Sbjct  414  IGVFIQVLCSYSTLPLYAIVTQMGSSFKKAIFDESIQVGLVGWAQKVKNKKGLRAAAATT  473

Query  204  NHGGAL-TDGSSTGVQMGGVGRKESGSTD  121
                A+   G++ G+Q+    R  S + D
Sbjct  474  TSSQAVPGGGAAAGIQLSTALRNNSHNPD  502


 Score =   114 bits (286),  Expect(2) = 1e-78, Method: Compositional matrix adjust.
 Identities = 56/60 (93%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVVIFLLLN+NGWHTYFWIAFIPFILLLAVGTKLEHVI QLAHEVAEKH+AIEGELVV
Sbjct  296  WMFVVIFLLLNVNGWHTYFWIAFIPFILLLAVGTKLEHVIAQLAHEVAEKHIAIEGELVV  355



>gb|KJB82477.1| hypothetical protein B456_013G197800 [Gossypium raimondii]
 gb|KJB82478.1| hypothetical protein B456_013G197800 [Gossypium raimondii]
 gb|KJB82479.1| hypothetical protein B456_013G197800 [Gossypium raimondii]
 gb|KJB82480.1| hypothetical protein B456_013G197800 [Gossypium raimondii]
 gb|KJB82481.1| hypothetical protein B456_013G197800 [Gossypium raimondii]
Length=504

 Score =   204 bits (520),  Expect(2) = 2e-78, Method: Compositional matrix adjust.
 Identities = 104/148 (70%), Positives = 120/148 (81%), Gaps = 1/148 (1%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + QPSD+HFWF RP+IVLFLIHFILFQNAFEIAFFFWI VQ+GFDSCIMG V++I+PRLV
Sbjct  351  VVQPSDDHFWFNRPRIVLFLIHFILFQNAFEIAFFFWIWVQFGFDSCIMGQVRYIVPRLV  410

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGI  205
            IGV IQVLCSYSTLP+YAIVTQMG+ FKKSIFDEH+QVGLVGWAQK K++KG+KAA G  
Sbjct  411  IGVFIQVLCSYSTLPLYAIVTQMGSSFKKSIFDEHVQVGLVGWAQKVKKKKGVKAATGSA  470

Query  204  NHGGALTDGSSTGVQMGGVGRKESGSTD  121
                +     S  +QMG V R  S   +
Sbjct  471  AQENS-EPNPSVAIQMGRVLRNASAPEE  497


 Score =   115 bits (289),  Expect(2) = 2e-78, Method: Compositional matrix adjust.
 Identities = 57/60 (95%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            WVFVVIFLLLN+NGWHTYFWIAFIPFILLL+VGTKLEHVI QLAHEVAEKHVAIEGELVV
Sbjct  293  WVFVVIFLLLNVNGWHTYFWIAFIPFILLLSVGTKLEHVITQLAHEVAEKHVAIEGELVV  352



>gb|KHG28286.1| MLO-like protein 1 [Gossypium arboreum]
Length=516

 Score =   203 bits (517),  Expect(2) = 2e-78, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 119/146 (82%), Gaps = 1/146 (1%)
 Frame = -3

Query  558  QPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIG  379
            QPSD+HFWF +P+IVLFLIHFILFQNAFEIAFFFWI VQ+GFDSCIMG V++I+PRLVIG
Sbjct  364  QPSDDHFWFNKPRIVLFLIHFILFQNAFEIAFFFWIWVQFGFDSCIMGQVRYIVPRLVIG  423

Query  378  VIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGINH  199
            V IQVLCSYSTLP+YAIVTQMG+ FKKSIFDEH+QVGLVGWAQK K++KGLKAA G    
Sbjct  424  VFIQVLCSYSTLPLYAIVTQMGSSFKKSIFDEHVQVGLVGWAQKVKKKKGLKAATGSAAQ  483

Query  198  GGALTDGSSTGVQMGGVGRKESGSTD  121
              +     S  +QMG V R  S   +
Sbjct  484  ENS-EQNPSVAIQMGRVLRNASAPEE  508


 Score =   117 bits (292),  Expect(2) = 2e-78, Method: Compositional matrix adjust.
 Identities = 58/60 (97%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            WVFVVIFLLLN+NGWHTYFWIAFIPFILLLAVGTKLEHVI QLAHEVAEKHVAIEGELVV
Sbjct  304  WVFVVIFLLLNVNGWHTYFWIAFIPFILLLAVGTKLEHVITQLAHEVAEKHVAIEGELVV  363



>ref|XP_006437326.1| hypothetical protein CICLE_v10031281mg [Citrus clementina]
 ref|XP_006484761.1| PREDICTED: MLO-like protein 1-like [Citrus sinensis]
 gb|ESR50566.1| hypothetical protein CICLE_v10031281mg [Citrus clementina]
Length=510

 Score =   209 bits (532),  Expect(2) = 2e-78, Method: Compositional matrix adjust.
 Identities = 102/162 (63%), Positives = 123/162 (76%), Gaps = 9/162 (6%)
 Frame = -3

Query  558  QPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIG  379
            QPSD+HFWF RPQIVLFLIHFILFQN+FEIAFFFWIL+QYGFDSCIMG V +I+PRL+IG
Sbjct  358  QPSDQHFWFNRPQIVLFLIHFILFQNSFEIAFFFWILIQYGFDSCIMGQVCYIVPRLIIG  417

Query  378  VIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGINH  199
            V IQVLCSYSTLP+YAIVTQMG+ FKK+IF+E++QVG+VGWA+K +++K  KAA      
Sbjct  418  VFIQVLCSYSTLPLYAIVTQMGSSFKKAIFEENVQVGIVGWAEKVRRKKDPKAA-----K  472

Query  198  GGALTDGSSTGVQMGGVGRKESGSTDGASVRALQQMGGDGSK  73
             G+    S  GVQ+G   RK S   +          G +GSK
Sbjct  473  DGSTQSSSHQGVQLGRAFRKSSTPEEIQP----STHGSEGSK  510


 Score =   111 bits (278),  Expect(2) = 2e-78, Method: Compositional matrix adjust.
 Identities = 55/60 (92%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVVIFLLLNIN WHTYFWIAFIPFILLLAVG KLEHVI QLAHEVAEKH+AIEGELVV
Sbjct  298  WIFVVIFLLLNINEWHTYFWIAFIPFILLLAVGAKLEHVISQLAHEVAEKHIAIEGELVV  357



>ref|XP_008235036.1| PREDICTED: MLO-like protein 1 [Prunus mume]
Length=504

 Score =   208 bits (530),  Expect(2) = 2e-78, Method: Compositional matrix adjust.
 Identities = 101/158 (64%), Positives = 123/158 (78%), Gaps = 12/158 (8%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + QPSD+HFWFG+P+IVLFLIHFILFQNAFEIAFFFWI +QYGFDSCIMG V++IIPRL+
Sbjct  342  VVQPSDDHFWFGKPKIVLFLIHFILFQNAFEIAFFFWIWLQYGFDSCIMGQVRYIIPRLI  401

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFG--  211
            IGV IQVLCSYSTLP+YAIV QMGT+FK +IF+EH+QVGLVGWAQK K++K L+AA    
Sbjct  402  IGVFIQVLCSYSTLPLYAIVAQMGTNFKAAIFNEHVQVGLVGWAQKVKKKKSLEAANDAS  461

Query  210  --------GINHGGALTDGSSTGVQMGGVGRKESGSTD  121
                      +HGG L   S+ G+Q+G    K +   +
Sbjct  462  GSGSGQGQASSHGGGL--ASNMGIQLGKFINKATKQEE  497


 Score =   112 bits (279),  Expect(2) = 2e-78, Method: Compositional matrix adjust.
 Identities = 52/60 (87%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVVIFLL+NINGWHTYFWIAF PF+LLLAVGTKLEH+I QLAHEVAEKH+AIEG+LVV
Sbjct  284  WIFVVIFLLMNINGWHTYFWIAFAPFVLLLAVGTKLEHIITQLAHEVAEKHIAIEGDLVV  343



>ref|XP_006437327.1| hypothetical protein CICLE_v10031281mg [Citrus clementina]
 gb|ESR50567.1| hypothetical protein CICLE_v10031281mg [Citrus clementina]
Length=448

 Score =   209 bits (531),  Expect(2) = 2e-78, Method: Compositional matrix adjust.
 Identities = 102/162 (63%), Positives = 123/162 (76%), Gaps = 9/162 (6%)
 Frame = -3

Query  558  QPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIG  379
            QPSD+HFWF RPQIVLFLIHFILFQN+FEIAFFFWIL+QYGFDSCIMG V +I+PRL+IG
Sbjct  296  QPSDQHFWFNRPQIVLFLIHFILFQNSFEIAFFFWILIQYGFDSCIMGQVCYIVPRLIIG  355

Query  378  VIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGINH  199
            V IQVLCSYSTLP+YAIVTQMG+ FKK+IF+E++QVG+VGWA+K +++K  KAA      
Sbjct  356  VFIQVLCSYSTLPLYAIVTQMGSSFKKAIFEENVQVGIVGWAEKVRRKKDPKAA-----K  410

Query  198  GGALTDGSSTGVQMGGVGRKESGSTDGASVRALQQMGGDGSK  73
             G+    S  GVQ+G   RK S   +          G +GSK
Sbjct  411  DGSTQSSSHQGVQLGRAFRKSSTPEEIQP----STHGSEGSK  448


 Score =   111 bits (277),  Expect(2) = 2e-78, Method: Compositional matrix adjust.
 Identities = 55/60 (92%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVVIFLLLNIN WHTYFWIAFIPFILLLAVG KLEHVI QLAHEVAEKH+AIEGELVV
Sbjct  236  WIFVVIFLLLNINEWHTYFWIAFIPFILLLAVGAKLEHVISQLAHEVAEKHIAIEGELVV  295



>ref|XP_002874907.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51166.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=526

 Score =   207 bits (526),  Expect(2) = 3e-78, Method: Compositional matrix adjust.
 Identities = 100/165 (61%), Positives = 123/165 (75%), Gaps = 16/165 (10%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + +PSDEHFWF +PQIVL+LIHFILFQNAFEIAFFFWI V YGFDSCIMG V++I+PRLV
Sbjct  354  VVKPSDEHFWFSKPQIVLYLIHFILFQNAFEIAFFFWIWVTYGFDSCIMGQVRYIVPRLV  413

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGI  205
            IGV IQVLCSYSTLP+YAIV+QMG+ FKK+IF+E++QVGLVGWAQK KQ++ LKAA    
Sbjct  414  IGVFIQVLCSYSTLPLYAIVSQMGSSFKKAIFEENVQVGLVGWAQKVKQKRDLKAAASNG  473

Query  204  NHGGALT-DGSSTG---------------VQMGGVGRKESGSTDG  118
            N G +    G  +G               +Q+G + R  +G T+ 
Sbjct  474  NEGSSQAGPGPDSGSGSVPAAGPGAGFAGIQLGRLTRNNAGDTNN  518


 Score =   113 bits (282),  Expect(2) = 3e-78, Method: Compositional matrix adjust.
 Identities = 55/60 (92%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVVIFLLLN+NGWHTYFWIAFIPF LLLAVGTKLEHVI QLAHEVAEKHVAIEG+LVV
Sbjct  296  WIFVVIFLLLNVNGWHTYFWIAFIPFALLLAVGTKLEHVIAQLAHEVAEKHVAIEGDLVV  355



>ref|XP_010277858.1| PREDICTED: MLO-like protein 1 [Nelumbo nucifera]
Length=498

 Score =   206 bits (525),  Expect(2) = 5e-78, Method: Compositional matrix adjust.
 Identities = 103/153 (67%), Positives = 119/153 (78%), Gaps = 11/153 (7%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + QPSD+HFWF RPQIVLFLIH ILFQNAFEIAFFFWI VQYGFDSCIMG V +IIPRLV
Sbjct  343  IVQPSDDHFWFHRPQIVLFLIHIILFQNAFEIAFFFWIWVQYGFDSCIMGQVCYIIPRLV  402

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGI  205
            IGV IQ+LCSYSTLP+YAIVTQMG+ FKKSIFDEH+Q GLVGWA+ AK++ G KA     
Sbjct  403  IGVFIQILCSYSTLPLYAIVTQMGSSFKKSIFDEHVQEGLVGWARNAKKKMGAKAG----  458

Query  204  NHGGALTDGSSTGVQMG-GVGRKESGSTDGASV  109
                    GS  G+Q+G  V ++ES   +G +V
Sbjct  459  ------AKGSIAGIQLGEKVRQRESAMEEGKAV  485


 Score =   112 bits (281),  Expect(2) = 5e-78, Method: Compositional matrix adjust.
 Identities = 54/60 (90%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVVIFLLLN++GWHTYFWIAFIPFILLLAVGTKLEHVI QLAHEVAEKHVA+EGEL+V
Sbjct  285  WLFVVIFLLLNVDGWHTYFWIAFIPFILLLAVGTKLEHVIAQLAHEVAEKHVAVEGELIV  344



>ref|XP_003636499.1| MLO-like protein [Medicago truncatula]
 gb|KEH18068.1| seven transmembrane MLO family protein [Medicago truncatula]
Length=520

 Score =   207 bits (527),  Expect(2) = 5e-78, Method: Compositional matrix adjust.
 Identities = 101/154 (66%), Positives = 122/154 (79%), Gaps = 6/154 (4%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + QPSD+HFWF RP+IVLFLIH ILFQN+FEIAFFFWI +QYGF+SCIMG VKFI PRLV
Sbjct  364  IVQPSDDHFWFHRPRIVLFLIHLILFQNSFEIAFFFWIWIQYGFNSCIMGQVKFIYPRLV  423

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGI  205
            +GV IQVLCSYSTLP+YAIVTQMGTHFK+SIFD+ +Q  L+GWAQKAK +KGL+   G  
Sbjct  424  MGVFIQVLCSYSTLPLYAIVTQMGTHFKRSIFDDQVQTRLIGWAQKAK-KKGLR---GDS  479

Query  204  NHG--GALTDGSSTGVQMGGVGRKESGSTDGASV  109
            NH   G+  +G ST +Q+G + R+     + A V
Sbjct  480  NHSVQGSSHNGGSTNIQLGSMFRRGPAPENNAFV  513


 Score =   111 bits (278),  Expect(2) = 5e-78, Method: Compositional matrix adjust.
 Identities = 54/60 (90%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVVIFLLLN+NGWHTYFWIAFIP ILLLAVGTKLEHVIIQLAHEVAEKH AI+GEL+V
Sbjct  306  WIFVVIFLLLNVNGWHTYFWIAFIPVILLLAVGTKLEHVIIQLAHEVAEKHSAIQGELIV  365



>ref|XP_006645146.1| PREDICTED: MLO-like protein 1-like [Oryza brachyantha]
Length=507

 Score =   214 bits (546),  Expect(2) = 5e-78, Method: Compositional matrix adjust.
 Identities = 105/161 (65%), Positives = 121/161 (75%), Gaps = 9/161 (6%)
 Frame = -3

Query  558  QPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIG  379
             PSDEHFWFGRP++VLFLIHFILFQNAFEIAFFFWIL  YG +SCIM H+ FI+PRL+IG
Sbjct  346  NPSDEHFWFGRPKVVLFLIHFILFQNAFEIAFFFWILTSYGINSCIMDHIPFILPRLIIG  405

Query  378  VIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGINH  199
            VIIQ+LCSYSTLP+YAIVTQMGT FKK IFDEH+Q GLVGWAQKAK+RKGLK    G   
Sbjct  406  VIIQLLCSYSTLPLYAIVTQMGTFFKKEIFDEHVQQGLVGWAQKAKKRKGLKEGSSGSTA  465

Query  198  GGALTDGSS-------TGVQMGGVGRKESGSTDGASVRALQ  97
            G   T+GSS         +       +E GS++G  +R  Q
Sbjct  466  GA--TNGSSHSQPSSLLAMVRRAAATEEEGSSNGGDMRTDQ  504


 Score =   104 bits (259),  Expect(2) = 5e-78, Method: Compositional matrix adjust.
 Identities = 48/60 (80%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FV++FLLLNI+GWHTYFWI+F+P +LLLAVGTKLEHVI QLAHEVAEKH AIEG+L V
Sbjct  286  WIFVMVFLLLNIHGWHTYFWISFVPLLLLLAVGTKLEHVITQLAHEVAEKHSAIEGDLAV  345



>ref|XP_007137327.1| hypothetical protein PHAVU_009G117900g [Phaseolus vulgaris]
 gb|ESW09321.1| hypothetical protein PHAVU_009G117900g [Phaseolus vulgaris]
Length=513

 Score =   209 bits (531),  Expect(2) = 7e-78, Method: Compositional matrix adjust.
 Identities = 100/152 (66%), Positives = 125/152 (82%), Gaps = 3/152 (2%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + QPSDEHFWF RP++VLFLIHFILFQNAFEIAFFFWI V YGFDSCIMG V++IIPRLV
Sbjct  356  VVQPSDEHFWFHRPRVVLFLIHFILFQNAFEIAFFFWIWVTYGFDSCIMGQVRYIIPRLV  415

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGI  205
            IGV IQVLCSYSTLP+YA+VTQMGTH+K++IF++H+Q  +VGWAQKAK+RK  + A G  
Sbjct  416  IGVFIQVLCSYSTLPLYALVTQMGTHYKRAIFNDHLQQNIVGWAQKAKRRKE-QNADGNP  474

Query  204  NHGGALTDGSSTGVQMGGV-GRKESGSTDGAS  112
              G +  +G +TG+Q+G +  +K SG  + +S
Sbjct  475  GQGSSQENG-NTGIQLGSIFPKKASGPGNSSS  505


 Score =   109 bits (273),  Expect(2) = 7e-78, Method: Compositional matrix adjust.
 Identities = 53/60 (88%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVVIFLLLNINGWHTYFWIAFIP ILLL+VGTKLEHVI QLAH+VAEKH AIEG+LVV
Sbjct  298  WLFVVIFLLLNINGWHTYFWIAFIPVILLLSVGTKLEHVITQLAHDVAEKHAAIEGDLVV  357



>ref|XP_007199791.1| hypothetical protein PRUPE_ppa004508mg [Prunus persica]
 gb|EMJ00990.1| hypothetical protein PRUPE_ppa004508mg [Prunus persica]
Length=506

 Score =   206 bits (524),  Expect(2) = 7e-78, Method: Compositional matrix adjust.
 Identities = 99/149 (66%), Positives = 120/149 (81%), Gaps = 14/149 (9%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + QPSD+HFWFG+P+IVLFLIHFILFQNAFEIAFFFWI +QYGFDSCIMG V++I+PRL+
Sbjct  342  VVQPSDDHFWFGKPKIVLFLIHFILFQNAFEIAFFFWIWLQYGFDSCIMGQVRYIVPRLI  401

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAA----  217
            IGV IQVLCSYSTLP+YAIV QMGT+FK +IF+EH+QVGLVGWAQK K++K L+AA    
Sbjct  402  IGVFIQVLCSYSTLPLYAIVAQMGTNFKAAIFNEHVQVGLVGWAQKVKKKKALEAANDAS  461

Query  216  --------FGGINHGGALTDGSSTGVQMG  154
                        +HGG L   S+ G+Q+G
Sbjct  462  GSGSGSGQGQASSHGGGL--ASNMGIQLG  488


 Score =   112 bits (281),  Expect(2) = 7e-78, Method: Compositional matrix adjust.
 Identities = 54/60 (90%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            WVFVVIFLL+NINGWHTYFWIAF PF+LLLAVGTKLEH+I QLAHEVAEKHVAIEG+LVV
Sbjct  284  WVFVVIFLLMNINGWHTYFWIAFAPFVLLLAVGTKLEHIITQLAHEVAEKHVAIEGDLVV  343



>ref|XP_004510198.1| PREDICTED: MLO-like protein 1-like [Cicer arietinum]
Length=513

 Score =   205 bits (522),  Expect(2) = 1e-77, Method: Compositional matrix adjust.
 Identities = 99/159 (62%), Positives = 120/159 (75%), Gaps = 2/159 (1%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + QPSD+HFWF RP+IVLFLIH ILFQN+FEIAFFFWILV YGFDSCIMG +++IIPRL+
Sbjct  357  VVQPSDDHFWFHRPRIVLFLIHLILFQNSFEIAFFFWILVTYGFDSCIMGRIRYIIPRLI  416

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGI  205
            IGV IQ+LCSYSTLP+YA+VTQMGTHFK  IFDE +Q  LVGWAQKAK +KGL+      
Sbjct  417  IGVFIQLLCSYSTLPLYALVTQMGTHFKSVIFDEQVQARLVGWAQKAK-KKGLRGDNNQS  475

Query  204  NHGGALTDGSSTGVQMGGVGRKESGSTDGASVRALQQMG  88
            N   A   GSS  +Q+G + R+ S   +   V   ++ G
Sbjct  476  NQESA-HHGSSVNIQLGSIFRRGSVPENNTIVSRDEESG  513


 Score =   112 bits (280),  Expect(2) = 1e-77, Method: Compositional matrix adjust.
 Identities = 55/60 (92%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            WV+VV+FLLLNINGWHTYFWIAFIP ILLLAVGTKLEHVIIQLAHEVAEKH AI+GELVV
Sbjct  299  WVYVVLFLLLNINGWHTYFWIAFIPLILLLAVGTKLEHVIIQLAHEVAEKHTAIQGELVV  358



>ref|XP_003547751.1| PREDICTED: MLO-like protein 1-like [Glycine max]
 gb|KHM99994.1| MLO-like protein 1 [Glycine soja]
Length=515

 Score =   210 bits (534),  Expect(2) = 1e-77, Method: Compositional matrix adjust.
 Identities = 100/152 (66%), Positives = 117/152 (77%), Gaps = 4/152 (3%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + QP D+HFWF RP IVLFLIHFILFQNAFEIAFFFWI V YGFDSCIMG V++I+PRL+
Sbjct  361  VVQPRDDHFWFNRPHIVLFLIHFILFQNAFEIAFFFWIWVTYGFDSCIMGRVRYIVPRLI  420

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGI  205
            IGV IQ+LCSYSTLP+YAIVTQMGTHFKK+IFDE +Q  LVGWAQKAK+    K   G  
Sbjct  421  IGVFIQLLCSYSTLPLYAIVTQMGTHFKKAIFDEQVQARLVGWAQKAKK----KGQRGDN  476

Query  204  NHGGALTDGSSTGVQMGGVGRKESGSTDGASV  109
            +  G  +  +  G+Q+G V R+ES S D   V
Sbjct  477  SLSGQESSRAGAGIQLGSVFRRESASEDNVIV  508


 Score =   107 bits (268),  Expect(2) = 1e-77, Method: Compositional matrix adjust.
 Identities = 52/60 (87%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVVIF+LLN++GWH YFWI+FIP ILLLAVGTKLEHVIIQLAHEVAEKH AIEGELVV
Sbjct  303  WIFVVIFMLLNVHGWHAYFWISFIPLILLLAVGTKLEHVIIQLAHEVAEKHSAIEGELVV  362



>ref|XP_010422570.1| PREDICTED: MLO-like protein 1 [Camelina sativa]
Length=530

 Score =   202 bits (513),  Expect(2) = 3e-77, Method: Compositional matrix adjust.
 Identities = 98/151 (65%), Positives = 117/151 (77%), Gaps = 3/151 (2%)
 Frame = -3

Query  570  NWLCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPR  391
            + + +PSDEHFWF +PQ+VL+LIHFILFQNAFEIAFFFWI V YGFDSCIMG V++I+PR
Sbjct  352  DLVVKPSDEHFWFSKPQVVLYLIHFILFQNAFEIAFFFWIWVTYGFDSCIMGQVRYIVPR  411

Query  390  LVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFG  211
            LVIGV IQVLCSYSTLP+YAIV+QMG+ FKK+IF+E++QVGLVGWAQK KQ++ LKA+ G
Sbjct  412  LVIGVFIQVLCSYSTLPLYAIVSQMGSSFKKAIFEENVQVGLVGWAQKVKQKRELKASNG  471

Query  210  GINHGGALTDGSSTGVQMGGVGRKESGSTDG  118
                  A  D  S      G G   SG   G
Sbjct  472  TEGGSQAGPDSGSGSAPAPGAG---SGPAPG  499


 Score =   115 bits (287),  Expect(2) = 3e-77, Method: Compositional matrix adjust.
 Identities = 56/60 (93%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVVIFLLLN+NGWHTYFWIAFIPFILLLAVGTKLEHVI QLAHEVAEKHVAIEG+LVV
Sbjct  296  WIFVVIFLLLNVNGWHTYFWIAFIPFILLLAVGTKLEHVISQLAHEVAEKHVAIEGDLVV  355



>ref|XP_004500713.1| PREDICTED: MLO-like protein 1-like isoform X1 [Cicer arietinum]
Length=533

 Score =   207 bits (527),  Expect(2) = 4e-77, Method: Compositional matrix adjust.
 Identities = 103/148 (70%), Positives = 125/148 (84%), Gaps = 5/148 (3%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + QPSDEHFWF RP++VLFLIHFILFQNAFEIAFFFWI V YGFDSCIMGH+++I+PRLV
Sbjct  348  VVQPSDEHFWFHRPRVVLFLIHFILFQNAFEIAFFFWIWVTYGFDSCIMGHIRYIVPRLV  407

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGI  205
            IGV IQVLCSYSTLP+YA+VTQMGTHFK+ IF+EH+Q GLVGWAQK K++K +KA   G 
Sbjct  408  IGVFIQVLCSYSTLPLYALVTQMGTHFKRVIFNEHVQDGLVGWAQKVKKKKVVKADGQGS  467

Query  204  NHGGALTDGSSTGVQMGGVGRKESGSTD  121
            +H     +GSSTGVQ+G V +K + + +
Sbjct  468  SH-----EGSSTGVQLGSVFQKRASAHE  490


 Score =   108 bits (271),  Expect(2) = 4e-77, Method: Compositional matrix adjust.
 Identities = 53/60 (88%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVVIFLLLNINGWHTYFWIAF+P ILLLAVGTKL HVI QLAHEVAEKH AIEG+LVV
Sbjct  290  WLFVVIFLLLNINGWHTYFWIAFVPLILLLAVGTKLGHVITQLAHEVAEKHAAIEGDLVV  349



>ref|NP_192169.1| MLO-like protein 1 [Arabidopsis thaliana]
 ref|NP_001031578.1| MLO-like protein 1 [Arabidopsis thaliana]
 sp|O49621.1|MLO1_ARATH RecName: Full=MLO-like protein 1; Short=AtMlo1; AltName: Full=MLO 
protein homolog 1; Short=AtMlo-H1 [Arabidopsis thaliana]
 emb|CAB08605.1| AtMlo-h1 [Arabidopsis thaliana]
 gb|AAC78258.1| AtMlo-h1 [Arabidopsis thaliana]
 emb|CAB80753.1| AtMlo-h1-like protein [Arabidopsis thaliana]
 gb|AAL59957.1| putative AtMlo-h1 protein [Arabidopsis thaliana]
 gb|AAM45040.1| putative AtMlo-h1 protein [Arabidopsis thaliana]
 gb|AEE82202.1| MLO-like protein 1 [Arabidopsis thaliana]
 gb|AEE82203.1| MLO-like protein 1 [Arabidopsis thaliana]
Length=526

 Score =   202 bits (514),  Expect(2) = 5e-77, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + +PSDEHFWF +PQIVL+LIHFILFQNAFEIAFFFWI V YGFDSCIMG V++I+PRLV
Sbjct  354  VVKPSDEHFWFSKPQIVLYLIHFILFQNAFEIAFFFWIWVTYGFDSCIMGQVRYIVPRLV  413

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGI  205
            IGV IQVLCSYSTLP+YAIV+QMG+ FKK+IF+E++QVGLVGWAQK KQ++ LKAA    
Sbjct  414  IGVFIQVLCSYSTLPLYAIVSQMGSSFKKAIFEENVQVGLVGWAQKVKQKRDLKAAASNG  473

Query  204  NHGGA  190
            + G +
Sbjct  474  DEGSS  478


 Score =   113 bits (282),  Expect(2) = 5e-77, Method: Compositional matrix adjust.
 Identities = 55/60 (92%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVVIFLLLN+NGWHTYFWIAFIPF LLLAVGTKLEHVI QLAHEVAEKHVAIEG+LVV
Sbjct  296  WIFVVIFLLLNVNGWHTYFWIAFIPFALLLAVGTKLEHVIAQLAHEVAEKHVAIEGDLVV  355



>emb|CDY21899.1| BnaC09g00050D [Brassica napus]
Length=529

 Score =   201 bits (511),  Expect(2) = 7e-77, Method: Compositional matrix adjust.
 Identities = 90/121 (74%), Positives = 108/121 (89%), Gaps = 0/121 (0%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + +PSDEHFWF +PQ+VLFLIHFILFQNAFEIAFFFWI V YGFDSCIMG V++I+PRLV
Sbjct  353  VVKPSDEHFWFSKPQVVLFLIHFILFQNAFEIAFFFWIWVTYGFDSCIMGQVRYIVPRLV  412

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGI  205
            IGV IQVLCSYSTLP+YA+V+QMG++FKK+IF+E++QVGLVGWAQK K ++ LKAA    
Sbjct  413  IGVFIQVLCSYSTLPLYALVSQMGSNFKKAIFEENVQVGLVGWAQKVKNKRELKAAAAAS  472

Query  204  N  202
            N
Sbjct  473  N  473


 Score =   114 bits (285),  Expect(2) = 7e-77, Method: Compositional matrix adjust.
 Identities = 55/60 (92%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVVIFLLLN+NGWHTYFWIAFIPFILLLAVGTKLEHVI QLAHEVAEKH+AIEG+LVV
Sbjct  295  WIFVVIFLLLNVNGWHTYFWIAFIPFILLLAVGTKLEHVISQLAHEVAEKHIAIEGDLVV  354



>dbj|BAH20436.1| AT4G02600 [Arabidopsis thaliana]
Length=400

 Score =   202 bits (513),  Expect(2) = 9e-77, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 120/165 (73%), Gaps = 16/165 (10%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + +PSDEHFWF +PQIVL+LIHFILFQNAFEIAFFFWI V YGFDSCIMG V++I+PRLV
Sbjct  228  VVKPSDEHFWFSKPQIVLYLIHFILFQNAFEIAFFFWIWVTYGFDSCIMGQVRYIVPRLV  287

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGI  205
            IGV IQVLCSYSTLP+YAIV+QMG+ FKK+IF+E++QVGLVGWAQK KQ++ LKAA    
Sbjct  288  IGVFIQVLCSYSTLPLYAIVSQMGSSFKKAIFEENVQVGLVGWAQKVKQKRDLKAAASNG  347

Query  204  NHGGA----------------LTDGSSTGVQMGGVGRKESGSTDG  118
            + G +                       G+Q+  V R  +G T+ 
Sbjct  348  DEGSSQAGPGPDSGSGSAPAAGPGAGFAGIQLSRVTRNNAGDTNN  392


 Score =   112 bits (281),  Expect(2) = 9e-77, Method: Compositional matrix adjust.
 Identities = 55/60 (92%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVVIFLLLN+NGWHTYFWIAFIPF LLLAVGTKLEHVI QLAHEVAEKHVAIEG+LVV
Sbjct  170  WIFVVIFLLLNVNGWHTYFWIAFIPFALLLAVGTKLEHVIAQLAHEVAEKHVAIEGDLVV  229



>ref|NP_001268003.1| MLO5 protein [Vitis vinifera]
 gb|ACF25909.1| MLO-like protein 1 [Vitis vinifera]
 emb|CBI25680.3| unnamed protein product [Vitis vinifera]
Length=482

 Score =   204 bits (520),  Expect(2) = 1e-76, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 115/148 (78%), Gaps = 12/148 (8%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + QPSD+HFWF RP+IVLFLIH ILFQN+FE+AFFFWIL  YGFDSCIMG V++IIPRLV
Sbjct  336  VVQPSDDHFWFHRPRIVLFLIHIILFQNSFEMAFFFWILFTYGFDSCIMGKVQYIIPRLV  395

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGI  205
            IGVIIQVLCSYSTLP+YAIVTQMGTHFKK+IFDEH+Q GLVGWAQKA++    K   G  
Sbjct  396  IGVIIQVLCSYSTLPLYAIVTQMGTHFKKAIFDEHVQAGLVGWAQKARK----KTTTGNA  451

Query  204  NHGGALTDGSSTGVQMGGVGRKESGSTD  121
            N G          +Q+G V R E+   +
Sbjct  452  NRGPT--------IQLGRVVRSENAKEE  471


 Score =   110 bits (274),  Expect(2) = 1e-76, Method: Compositional matrix adjust.
 Identities = 53/60 (88%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVV+FLLLN++GWHTYFWIAFIPFILLLAVG KLEHVI QLAHEVAEKH AIEGELVV
Sbjct  278  WIFVVVFLLLNVDGWHTYFWIAFIPFILLLAVGAKLEHVISQLAHEVAEKHAAIEGELVV  337



>dbj|BAH57094.1| AT4G02600 [Arabidopsis thaliana]
Length=265

 Score =   202 bits (513),  Expect(2) = 1e-76, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 120/165 (73%), Gaps = 16/165 (10%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + +PSDEHFWF +PQIVL+LIHFILFQNAFEIAFFFWI V YGFDSCIMG V++I+PRLV
Sbjct  93   VVKPSDEHFWFSKPQIVLYLIHFILFQNAFEIAFFFWIWVTYGFDSCIMGQVRYIVPRLV  152

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGI  205
            IGV IQVLCSYSTLP+YAIV+QMG+ FKK+IF+E++QVGLVGWAQK KQ++ LKAA    
Sbjct  153  IGVFIQVLCSYSTLPLYAIVSQMGSSFKKAIFEENVQVGLVGWAQKVKQKRDLKAAASNG  212

Query  204  NHGGA----------------LTDGSSTGVQMGGVGRKESGSTDG  118
            + G +                       G+Q+  V R  +G T+ 
Sbjct  213  DEGSSQAGPGPDSGSGSAPAAGPGAGFAGIQLSRVTRNNAGDTNN  257


 Score =   112 bits (281),  Expect(2) = 1e-76, Method: Compositional matrix adjust.
 Identities = 55/60 (92%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVVIFLLLN+NGWHTYFWIAFIPF LLLAVGTKLEHVI QLAHEVAEKHVAIEG+LVV
Sbjct  35   WIFVVIFLLLNVNGWHTYFWIAFIPFALLLAVGTKLEHVIAQLAHEVAEKHVAIEGDLVV  94



>ref|XP_009111270.1| PREDICTED: MLO-like protein 1 [Brassica rapa]
Length=529

 Score =   201 bits (510),  Expect(2) = 1e-76, Method: Compositional matrix adjust.
 Identities = 90/121 (74%), Positives = 108/121 (89%), Gaps = 0/121 (0%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + +PSDEHFWF +PQ+VLFLIHFILFQNAFEIAFFFWI V YGFDSCIMG V++I+PRLV
Sbjct  353  VVKPSDEHFWFSKPQVVLFLIHFILFQNAFEIAFFFWIWVTYGFDSCIMGQVRYIVPRLV  412

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGI  205
            IGV IQVLCSYSTLP+YA+V+QMG++FKK+IF+E++QVGLVGWAQK K ++ LKAA    
Sbjct  413  IGVFIQVLCSYSTLPLYALVSQMGSNFKKAIFEENVQVGLVGWAQKVKNKRELKAAAAAS  472

Query  204  N  202
            N
Sbjct  473  N  473


 Score =   114 bits (284),  Expect(2) = 1e-76, Method: Compositional matrix adjust.
 Identities = 55/60 (92%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVVIFLLLN+NGWHTYFWIAFIPFILLLAVGTKLEHVI QLAHEVAEKH+AIEG+LVV
Sbjct  295  WIFVVIFLLLNVNGWHTYFWIAFIPFILLLAVGTKLEHVISQLAHEVAEKHIAIEGDLVV  354



>emb|CDY22065.1| BnaA09g00940D [Brassica napus]
Length=467

 Score =   201 bits (510),  Expect(2) = 1e-76, Method: Compositional matrix adjust.
 Identities = 90/121 (74%), Positives = 108/121 (89%), Gaps = 0/121 (0%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + +PSDEHFWF +PQ+VLFLIHFILFQNAFEIAFFFWI V YGFDSCIMG V++I+PRLV
Sbjct  291  VVKPSDEHFWFSKPQVVLFLIHFILFQNAFEIAFFFWIWVTYGFDSCIMGQVRYIVPRLV  350

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGI  205
            IGV IQVLCSYSTLP+YA+V+QMG++FKK+IF+E++QVGLVGWAQK K ++ LKAA    
Sbjct  351  IGVFIQVLCSYSTLPLYALVSQMGSNFKKAIFEENVQVGLVGWAQKVKNKRELKAAAAAS  410

Query  204  N  202
            N
Sbjct  411  N  411


 Score =   114 bits (284),  Expect(2) = 1e-76, Method: Compositional matrix adjust.
 Identities = 55/60 (92%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVVIFLLLN+NGWHTYFWIAFIPFILLLAVGTKLEHVI QLAHEVAEKH+AIEG+LVV
Sbjct  233  WIFVVIFLLLNVNGWHTYFWIAFIPFILLLAVGTKLEHVISQLAHEVAEKHIAIEGDLVV  292



>ref|XP_010456010.1| PREDICTED: MLO-like protein 1 [Camelina sativa]
Length=532

 Score =   200 bits (508),  Expect(2) = 1e-76, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + +PSDEHFWF +PQ+VL+LIHFILFQNAFEIAFFFWI V YGFDSCIMG V++I+PRLV
Sbjct  354  VVKPSDEHFWFSKPQVVLYLIHFILFQNAFEIAFFFWIWVTYGFDSCIMGQVRYIVPRLV  413

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFG  211
            IGV IQVLCSYSTLP+YAIV+QMG+ FKK+IF+E++QVGLVGWAQK KQ++ LKA+ G
Sbjct  414  IGVFIQVLCSYSTLPLYAIVSQMGSSFKKAIFEENVQVGLVGWAQKVKQKRELKASNG  471


 Score =   114 bits (286),  Expect(2) = 1e-76, Method: Compositional matrix adjust.
 Identities = 56/60 (93%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVVIFLLLN+NGWHTYFWIAFIPFILLLAVGTKLEHVI QLAHEVAEKHVAIEG+LVV
Sbjct  296  WIFVVIFLLLNVNGWHTYFWIAFIPFILLLAVGTKLEHVISQLAHEVAEKHVAIEGDLVV  355



>ref|XP_009144550.1| PREDICTED: MLO-like protein 1 [Brassica rapa]
Length=516

 Score =   199 bits (506),  Expect(2) = 1e-76, Method: Compositional matrix adjust.
 Identities = 92/151 (61%), Positives = 116/151 (77%), Gaps = 4/151 (3%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + +PSDEHFWF +P+ VLFLIHFILFQNAFEIAFFFWI V YGFDSCIMG V++I+PRLV
Sbjct  353  VVKPSDEHFWFSKPEFVLFLIHFILFQNAFEIAFFFWIWVTYGFDSCIMGQVRYIVPRLV  412

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGI  205
            IGV IQVLCSYSTLP+YAIV+QMG+++KK+IF+E++QVGLVGWAQK K ++      G  
Sbjct  413  IGVFIQVLCSYSTLPLYAIVSQMGSNYKKAIFEENVQVGLVGWAQKVKNKRASNGNEGSS  472

Query  204  NHGGALTDGSS----TGVQMGGVGRKESGST  124
            N G   +   +     G+Q+  + R  +G T
Sbjct  473  NAGTTPSPPGAGAGFAGIQLSRLTRNNAGET  503


 Score =   115 bits (288),  Expect(2) = 1e-76, Method: Compositional matrix adjust.
 Identities = 57/60 (95%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVVIFLLLN+NGWHTYFWIAFIPFILLLAVGTKLEHVI QLAHEVAEKHVAIEGELVV
Sbjct  295  WIFVVIFLLLNVNGWHTYFWIAFIPFILLLAVGTKLEHVISQLAHEVAEKHVAIEGELVV  354



>ref|XP_006287341.1| hypothetical protein CARUB_v10000540mg, partial [Capsella rubella]
 gb|EOA20239.1| hypothetical protein CARUB_v10000540mg, partial [Capsella rubella]
Length=590

 Score =   200 bits (508),  Expect(2) = 1e-76, Method: Compositional matrix adjust.
 Identities = 91/127 (72%), Positives = 110/127 (87%), Gaps = 0/127 (0%)
 Frame = -3

Query  570  NWLCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPR  391
            + + +PSDEHFWF +PQIVL+LIHFILFQNAFEIAFFFWI V YGFDSCIMG V++I+PR
Sbjct  412  DLVVKPSDEHFWFSKPQIVLYLIHFILFQNAFEIAFFFWIWVTYGFDSCIMGQVRYIVPR  471

Query  390  LVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFG  211
            LVIGV IQVLCSYSTLP+YAIV+QMG+ FKK+IF+E++QVGLVGWAQK KQ++ LK A  
Sbjct  472  LVIGVFIQVLCSYSTLPLYAIVSQMGSSFKKAIFEENVQVGLVGWAQKVKQKRDLKTAAS  531

Query  210  GINHGGA  190
              + G +
Sbjct  532  NGSEGDS  538


 Score =   114 bits (286),  Expect(2) = 1e-76, Method: Compositional matrix adjust.
 Identities = 55/60 (92%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVVIFLLLN+NGWHTYFWIAFIPFILLLAVGTKLEHVI QLAHEVAEKH+AIEG+LVV
Sbjct  356  WIFVVIFLLLNVNGWHTYFWIAFIPFILLLAVGTKLEHVISQLAHEVAEKHIAIEGDLVV  415



>ref|XP_004290766.1| PREDICTED: MLO-like protein 1 [Fragaria vesca subsp. vesca]
Length=514

 Score =   202 bits (515),  Expect(2) = 1e-76, Method: Compositional matrix adjust.
 Identities = 104/167 (62%), Positives = 128/167 (77%), Gaps = 15/167 (9%)
 Frame = -3

Query  555  PSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIGV  376
            PSD HFWFG+P++VLFLIHFILFQNAFEIAFFFWI VQYGFDSCIMG V+FI+PRLVIGV
Sbjct  347  PSDGHFWFGKPKLVLFLIHFILFQNAFEIAFFFWIWVQYGFDSCIMGQVRFIVPRLVIGV  406

Query  375  IIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGI---  205
             IQVLCSYSTLP+YAI+TQMG+ FKK+IFDEH+QVGLVGWAQK K++K   AA       
Sbjct  407  FIQVLCSYSTLPLYAIITQMGSSFKKAIFDEHVQVGLVGWAQKVKKKKAAAAADASGSGS  466

Query  204  ----------NHGGALTDGSSTGVQMGGVGRKESGSTDGASVRALQQ  94
                      +HGG+++  S+ G+QMG +G+K +   +  S +  Q+
Sbjct  467  GSGSGSVQPSSHGGSIS--SAFGIQMGKLGKKTTKPEENNSDQKKQE  511


 Score =   111 bits (278),  Expect(2) = 1e-76, Method: Compositional matrix adjust.
 Identities = 54/65 (83%), Positives = 61/65 (94%), Gaps = 1/65 (2%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            WVFVVIFLLLN+NGWHTYFW+AF+PF LL+AVGTKLEHVI QLAHEVAEKH+AIEG+LVV
Sbjct  286  WVFVVIFLLLNVNGWHTYFWVAFLPFFLLVAVGTKLEHVITQLAHEVAEKHIAIEGDLVV  345

Query  559  -PTFG  548
             P+ G
Sbjct  346  TPSDG  350



>ref|XP_010679042.1| PREDICTED: MLO-like protein 1 [Beta vulgaris subsp. vulgaris]
Length=497

 Score =   202 bits (513),  Expect(2) = 3e-76, Method: Compositional matrix adjust.
 Identities = 98/144 (68%), Positives = 120/144 (83%), Gaps = 0/144 (0%)
 Frame = -3

Query  558  QPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIG  379
            +PSDEHFWF RPQI LFLIHFILFQNAFEIA+FFWI VQYGF SCIMG V++I+PRL+IG
Sbjct  344  KPSDEHFWFSRPQITLFLIHFILFQNAFEIAYFFWIWVQYGFSSCIMGQVRYIVPRLIIG  403

Query  378  VIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGINH  199
            VIIQVLCSYSTLP+YAIVTQMG++FKK+IFDEH+Q G++GW  K K++K LK A  G   
Sbjct  404  VIIQVLCSYSTLPLYAIVTQMGSNFKKAIFDEHVQAGILGWRDKVKKKKALKDAVNGSTA  463

Query  198  GGALTDGSSTGVQMGGVGRKESGS  127
             G  T+G +T +QM  + +KE+G+
Sbjct  464  SGTSTEGPTTRIQMARLIQKENGN  487


 Score =   111 bits (278),  Expect(2) = 3e-76, Method: Compositional matrix adjust.
 Identities = 53/60 (88%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            WVFV+IFLLLN++GWHTYFWIAFIPFILLLAVGTKLEH+I +LAHEVAEKHVAIEG+LVV
Sbjct  284  WVFVIIFLLLNVDGWHTYFWIAFIPFILLLAVGTKLEHIITELAHEVAEKHVAIEGDLVV  343



>ref|XP_007134284.1| hypothetical protein PHAVU_010G034400g [Phaseolus vulgaris]
 gb|ESW06278.1| hypothetical protein PHAVU_010G034400g [Phaseolus vulgaris]
Length=507

 Score =   204 bits (520),  Expect(2) = 3e-76, Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 118/148 (80%), Gaps = 3/148 (2%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + QP D+HFWF RP IVLFLIHFILFQNAFEIAFFFWIL  YGFDSCIMG V++I+PRLV
Sbjct  359  VVQPRDDHFWFHRPHIVLFLIHFILFQNAFEIAFFFWILFTYGFDSCIMGRVRYIVPRLV  418

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGI  205
            IG+ IQVLCSYSTLP+YAIVTQMGTHFKK+IFD+ +Q  LVGWAQKAK +KGL+    G 
Sbjct  419  IGIFIQVLCSYSTLPLYAIVTQMGTHFKKAIFDDQVQARLVGWAQKAK-KKGLRGDNNGQ  477

Query  204  NHGGALTDGSSTGVQMGGVGRKESGSTD  121
            +  G+   G+  G+Q+G V RK S   D
Sbjct  478  SVQGSPHVGA--GIQLGPVFRKPSPPED  503


 Score =   108 bits (271),  Expect(2) = 3e-76, Method: Compositional matrix adjust.
 Identities = 53/60 (88%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVVIF+LLN++GWHTYFWI+FIP ILLLAVGTKLEHVIIQLAHEVAEKH AIEGELVV
Sbjct  301  WIFVVIFMLLNVHGWHTYFWISFIPLILLLAVGTKLEHVIIQLAHEVAEKHSAIEGELVV  360



>gb|ABK96389.1| unknown [Populus trichocarpa x Populus deltoides]
Length=527

 Score =   201 bits (510),  Expect(2) = 3e-76, Method: Compositional matrix adjust.
 Identities = 96/156 (62%), Positives = 117/156 (75%), Gaps = 6/156 (4%)
 Frame = -3

Query  558  QPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIG  379
            QPSD HFWF RP  V  LIHFILFQNAFEIAFFFWI VQYGFDSCIMG +K+I+PRL+IG
Sbjct  357  QPSDNHFWFHRPGFVHLLIHFILFQNAFEIAFFFWIWVQYGFDSCIMGQIKYIVPRLIIG  416

Query  378  VIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGINH  199
            V IQVLCSYSTLP+YAIV+QMG+ FKKSIF+EH+Q GLVGWAQK K+++G K +  G + 
Sbjct  417  VFIQVLCSYSTLPLYAIVSQMGSTFKKSIFEEHVQAGLVGWAQKVKKKRGQKGSTEGSSE  476

Query  198  ------GGALTDGSSTGVQMGGVGRKESGSTDGASV  109
                   G L  G   G++    G  +S S +G+++
Sbjct  477  ASSHVSAGGLQLGRLKGLKEANEGSAQSSSHEGSTL  512


 Score =   112 bits (280),  Expect(2) = 3e-76, Method: Compositional matrix adjust.
 Identities = 57/60 (95%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            WVFVVIFLLLNINGWHTYFWIAFIP ILLLAVGTKLEHVI QLA+EVAEKHVAIEGELVV
Sbjct  297  WVFVVIFLLLNINGWHTYFWIAFIPLILLLAVGTKLEHVINQLAYEVAEKHVAIEGELVV  356



>emb|CDX91294.1| BnaC02g27050D [Brassica napus]
Length=506

 Score =   199 bits (505),  Expect(2) = 4e-76, Method: Compositional matrix adjust.
 Identities = 92/151 (61%), Positives = 116/151 (77%), Gaps = 4/151 (3%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + +PSDEHFWF +P+ VLFLIHFILFQNAFEIAFFFWI V YGFDSCIMG V++I+PRLV
Sbjct  343  VVKPSDEHFWFSKPEFVLFLIHFILFQNAFEIAFFFWIWVTYGFDSCIMGQVRYIVPRLV  402

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGI  205
            IGV IQVLCSYSTLP+YAIV+QMG+++KK+IF+E++QVGLVGWAQK K ++      G  
Sbjct  403  IGVFIQVLCSYSTLPLYAIVSQMGSNYKKAIFEENVQVGLVGWAQKVKNKRASNGNEGSS  462

Query  204  NHGGALTDGSS----TGVQMGGVGRKESGST  124
            N G   +   +     G+Q+  + R  +G T
Sbjct  463  NAGTTPSPPGAGAGFAGIQLSRLTRNNAGET  493


 Score =   114 bits (284),  Expect(2) = 4e-76, Method: Compositional matrix adjust.
 Identities = 55/60 (92%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVVIFLLLN+NGWHTYFWIAFIPFILLLAVGTKLEHVI QLAHEVAEKH+AIEG+LVV
Sbjct  285  WIFVVIFLLLNVNGWHTYFWIAFIPFILLLAVGTKLEHVISQLAHEVAEKHIAIEGDLVV  344



>tpg|DAA56449.1| TPA: seven transmembrane protein Mlo5 [Zea mays]
Length=475

 Score =   205 bits (522),  Expect(2) = 5e-76, Method: Compositional matrix adjust.
 Identities = 99/155 (64%), Positives = 115/155 (74%), Gaps = 3/155 (2%)
 Frame = -3

Query  558  QPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIG  379
             PSD+HFWFGRP+IVL+LIHFILFQNAFEIAFFFWIL  YGF+SCIM HV FI+PRLV+G
Sbjct  309  NPSDDHFWFGRPKIVLYLIHFILFQNAFEIAFFFWILTTYGFNSCIMDHVPFIVPRLVVG  368

Query  378  VIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGINH  199
             IIQ+LCSYSTLP+YAIVTQMGT FKK IFDEH+Q  L+GWAQKAK+RK L+    G N 
Sbjct  369  AIIQLLCSYSTLPLYAIVTQMGTFFKKEIFDEHVQQSLLGWAQKAKKRKALRNNGNGSNG  428

Query  198  GGALTDGSSTGVQMGGVGRK---ESGSTDGASVRA  103
              A +   S   ++  + R    E GS  G    A
Sbjct  429  AAAGSSHPSATARLELMRRAVALEEGSAGGNGSEA  463


 Score =   107 bits (267),  Expect(2) = 5e-76, Method: Compositional matrix adjust.
 Identities = 49/60 (82%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVV+F+LLNINGWHTYFWI+FIP +LLLAVGTKLEHVI QLA EVAEKH A+EG+LVV
Sbjct  249  WIFVVVFMLLNINGWHTYFWISFIPLLLLLAVGTKLEHVITQLAQEVAEKHSAVEGDLVV  308



>ref|XP_008674721.1| PREDICTED: MLO-like protein 1 [Zea mays]
 gb|ACF84059.1| unknown [Zea mays]
 tpg|DAA56450.1| TPA: seven transmembrane protein Mlo5 [Zea mays]
Length=514

 Score =   205 bits (522),  Expect(2) = 5e-76, Method: Compositional matrix adjust.
 Identities = 99/155 (64%), Positives = 115/155 (74%), Gaps = 3/155 (2%)
 Frame = -3

Query  558  QPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIG  379
             PSD+HFWFGRP+IVL+LIHFILFQNAFEIAFFFWIL  YGF+SCIM HV FI+PRLV+G
Sbjct  348  NPSDDHFWFGRPKIVLYLIHFILFQNAFEIAFFFWILTTYGFNSCIMDHVPFIVPRLVVG  407

Query  378  VIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGINH  199
             IIQ+LCSYSTLP+YAIVTQMGT FKK IFDEH+Q  L+GWAQKAK+RK L+    G N 
Sbjct  408  AIIQLLCSYSTLPLYAIVTQMGTFFKKEIFDEHVQQSLLGWAQKAKKRKALRNNGNGSNG  467

Query  198  GGALTDGSSTGVQMGGVGRK---ESGSTDGASVRA  103
              A +   S   ++  + R    E GS  G    A
Sbjct  468  AAAGSSHPSATARLELMRRAVALEEGSAGGNGSEA  502


 Score =   107 bits (266),  Expect(2) = 5e-76, Method: Compositional matrix adjust.
 Identities = 49/60 (82%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVV+F+LLNINGWHTYFWI+FIP +LLLAVGTKLEHVI QLA EVAEKH A+EG+LVV
Sbjct  288  WIFVVVFMLLNINGWHTYFWISFIPLLLLLAVGTKLEHVITQLAQEVAEKHSAVEGDLVV  347



>ref|XP_010429895.1| PREDICTED: MLO-like protein 1 [Camelina sativa]
Length=533

 Score =   197 bits (500),  Expect(2) = 1e-75, Method: Compositional matrix adjust.
 Identities = 89/123 (72%), Positives = 106/123 (86%), Gaps = 0/123 (0%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + +PSDEHFWF +PQ+VL+LIHFILFQNAFEIAFFFWI V YGFDSCIMG V++I+PRLV
Sbjct  354  VVKPSDEHFWFSKPQVVLYLIHFILFQNAFEIAFFFWIWVTYGFDSCIMGQVRYIVPRLV  413

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGI  205
            IGV IQVLCSYSTLP+YAIV+QMG+ FKK+IF+E++QVGLVGWAQK KQ++      GG 
Sbjct  414  IGVFIQVLCSYSTLPLYAIVSQMGSSFKKAIFEENVQVGLVGWAQKVKQKRASNGTEGGS  473

Query  204  NHG  196
              G
Sbjct  474  QAG  476


 Score =   114 bits (286),  Expect(2) = 1e-75, Method: Compositional matrix adjust.
 Identities = 56/60 (93%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVVIFLLLN+NGWHTYFWIAFIPFILLLAVGTKLEHVI QLAHEVAEKHVAIEG+LVV
Sbjct  296  WIFVVIFLLLNVNGWHTYFWIAFIPFILLLAVGTKLEHVISQLAHEVAEKHVAIEGDLVV  355



>tpg|DAA56448.1| TPA: seven transmembrane protein Mlo5 [Zea mays]
Length=449

 Score =   204 bits (520),  Expect(2) = 1e-75, Method: Compositional matrix adjust.
 Identities = 99/155 (64%), Positives = 115/155 (74%), Gaps = 3/155 (2%)
 Frame = -3

Query  558  QPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIG  379
             PSD+HFWFGRP+IVL+LIHFILFQNAFEIAFFFWIL  YGF+SCIM HV FI+PRLV+G
Sbjct  283  NPSDDHFWFGRPKIVLYLIHFILFQNAFEIAFFFWILTTYGFNSCIMDHVPFIVPRLVVG  342

Query  378  VIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGINH  199
             IIQ+LCSYSTLP+YAIVTQMGT FKK IFDEH+Q  L+GWAQKAK+RK L+    G N 
Sbjct  343  AIIQLLCSYSTLPLYAIVTQMGTFFKKEIFDEHVQQSLLGWAQKAKKRKALRNNGNGSNG  402

Query  198  GGALTDGSSTGVQMGGVGRK---ESGSTDGASVRA  103
              A +   S   ++  + R    E GS  G    A
Sbjct  403  AAAGSSHPSATARLELMRRAVALEEGSAGGNGSEA  437


 Score =   106 bits (265),  Expect(2) = 1e-75, Method: Compositional matrix adjust.
 Identities = 49/60 (82%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVV+F+LLNINGWHTYFWI+FIP +LLLAVGTKLEHVI QLA EVAEKH A+EG+LVV
Sbjct  223  WIFVVVFMLLNINGWHTYFWISFIPLLLLLAVGTKLEHVITQLAQEVAEKHSAVEGDLVV  282



>gb|KEH18066.1| seven transmembrane MLO family protein [Medicago truncatula]
Length=520

 Score =   199 bits (507),  Expect(2) = 3e-75, Method: Compositional matrix adjust.
 Identities = 97/157 (62%), Positives = 121/157 (77%), Gaps = 6/157 (4%)
 Frame = -3

Query  558  QPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIG  379
            QPSD+HFWF RP+IVLFLIH ILFQN+FEIAFFFWILV +GF+SC+MG + + IPRLVIG
Sbjct  366  QPSDDHFWFHRPRIVLFLIHLILFQNSFEIAFFFWILVTFGFNSCMMGKLHYTIPRLVIG  425

Query  378  VIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGINH  199
            ++IQV+CSYSTLP+YAIVTQMGT++KK+IFDE IQ  L+GWAQKAK +KGL+   G  N 
Sbjct  426  LLIQVICSYSTLPLYAIVTQMGTYYKKAIFDEQIQTCLLGWAQKAK-KKGLR---GNNNQ  481

Query  198  G--GALTDGSSTGVQMGGVGRKESGSTDGASVRALQQ  94
               G+   G+S+ +Q+G V R+     D   V   QQ
Sbjct  482  SGEGSTHSGASSNIQLGSVFRRAPAPEDNTIVPKDQQ  518


 Score =   110 bits (275),  Expect(2) = 3e-75, Method: Compositional matrix adjust.
 Identities = 53/60 (88%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVVIF+LLNINGWHTYFW+AFIP ILLLAVGTKLEHVIIQLAHEVAEKH AI+G+LVV
Sbjct  306  WIFVVIFMLLNINGWHTYFWVAFIPVILLLAVGTKLEHVIIQLAHEVAEKHSAIQGKLVV  365



>ref|XP_010907544.1| PREDICTED: LOW QUALITY PROTEIN: MLO-like protein 1 [Elaeis guineensis]
Length=497

 Score =   201 bits (512),  Expect(2) = 3e-75, Method: Compositional matrix adjust.
 Identities = 101/157 (64%), Positives = 119/157 (76%), Gaps = 6/157 (4%)
 Frame = -3

Query  570  NWLCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPR  391
            + + QPSD+HFWF RP+IVL+LIHFILF NAFEIAFFFWIL  YGFDSCIM H  FIIPR
Sbjct  341  DLIVQPSDDHFWFHRPRIVLYLIHFILFXNAFEIAFFFWILTTYGFDSCIMDHAGFIIPR  400

Query  390  LVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFG  211
            L IGVIIQ+LCSYSTLP+YAIVTQMG+ FKK+IFDEH+Q GLVGWA+K K+RKG K   G
Sbjct  401  LAIGVIIQLLCSYSTLPLYAIVTQMGSSFKKAIFDEHVQEGLVGWARKVKRRKGTKMDNG  460

Query  210  --GINHGGALTDGSSTGVQMGG-VGRKESGSTDGASV  109
              G +H  A        ++M   VG+KE G +  A+ 
Sbjct  461  VAGSSHSSA---APYVKIEMQKLVGQKEEGKSGDANT  494


 Score =   108 bits (270),  Expect(2) = 3e-75, Method: Compositional matrix adjust.
 Identities = 50/60 (83%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVVIFLLLN+NGWHTYFWIAF+P +LLLAVGTKLEHVI QLAHEVAEKH AI+G+L+V
Sbjct  285  WIFVVIFLLLNVNGWHTYFWIAFVPLLLLLAVGTKLEHVITQLAHEVAEKHSAIQGDLIV  344



>ref|XP_008232215.1| PREDICTED: MLO-like protein 1 [Prunus mume]
 ref|XP_008232216.1| PREDICTED: MLO-like protein 1 [Prunus mume]
 ref|XP_008232217.1| PREDICTED: MLO-like protein 1 [Prunus mume]
Length=488

 Score =   205 bits (522),  Expect(2) = 4e-75, Method: Compositional matrix adjust.
 Identities = 102/144 (71%), Positives = 119/144 (83%), Gaps = 7/144 (5%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + QPSDEHFWFG+P+ VLFLIHFILFQNAFE+AFFFWI VQYGF SCIMG VK+IIPR+V
Sbjct  349  IVQPSDEHFWFGKPKFVLFLIHFILFQNAFEMAFFFWIWVQYGFTSCIMGKVKYIIPRIV  408

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGI  205
            IGV IQVLCSYSTLP+YAIVTQMGT+FKK+IFDE I++GLVGWA+KAK+R   KA+  G 
Sbjct  409  IGVFIQVLCSYSTLPLYAIVTQMGTNFKKAIFDEDIRLGLVGWAKKAKRR---KASMDGS  465

Query  204  NHGGALTDGSSTGVQMGGVGRKES  133
              G     GS  GVQ+G V +K +
Sbjct  466  GSG----TGSDVGVQLGKVNQKTT  485


 Score =   103 bits (258),  Expect(2) = 4e-75, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVV+F+L+N++GWH YFWIAF+PF LLLAVG KL+HVI QLAHEVAEKH+AIEGEL+V
Sbjct  291  WIFVVLFMLMNVDGWHAYFWIAFVPFFLLLAVGAKLQHVITQLAHEVAEKHIAIEGELIV  350



>gb|AIZ94062.1| Mlo protein [Hevea brasiliensis]
Length=516

 Score =   216 bits (550),  Expect(2) = 4e-75, Method: Compositional matrix adjust.
 Identities = 105/151 (70%), Positives = 125/151 (83%), Gaps = 7/151 (5%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + +PSDEHFWF RP IVLFLIHFILFQNAFEIAFFFWI VQYGFDSCIMG V++I+PRL+
Sbjct  356  VVKPSDEHFWFNRPDIVLFLIHFILFQNAFEIAFFFWIWVQYGFDSCIMGQVRYIVPRLI  415

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK----AA  217
            IGV IQ+LCSYSTLP+YAIVTQMG+ +KK+IFDEH+Q GLVGWA+K K++KGLK    AA
Sbjct  416  IGVFIQILCSYSTLPLYAIVTQMGSSYKKAIFDEHVQAGLVGWAEKVKRKKGLKGATAAA  475

Query  216  FGGINHGGALTDGSSTGVQMGGVGRKESGST  124
             GG N   +  + SS G+Q+G VG   +GST
Sbjct  476  RGGSNQPSS-HESSSLGIQLGRVGH--NGST  503


 Score = 93.2 bits (230),  Expect(2) = 4e-75, Method: Compositional matrix adjust.
 Identities = 53/60 (88%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVVIFLLLN+NGWHTYFWIAF+PF+LLLAVGTKLEHVI QLAH+VAEKHVAIEG+LVV
Sbjct  298  WIFVVIFLLLNVNGWHTYFWIAFLPFLLLLAVGTKLEHVITQLAHDVAEKHVAIEGDLVV  357



>ref|XP_006396473.1| hypothetical protein EUTSA_v10028582mg [Eutrema salsugineum]
 dbj|BAJ33805.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ37926.1| hypothetical protein EUTSA_v10028582mg [Eutrema salsugineum]
Length=516

 Score =   196 bits (498),  Expect(2) = 5e-75, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 106/119 (89%), Gaps = 0/119 (0%)
 Frame = -3

Query  558  QPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIG  379
            +PSDEHFWF +PQ+VL+LIHFILFQNAFEIAFFFWI V YGFDSCIMG V++I+PRLVIG
Sbjct  353  KPSDEHFWFSKPQVVLYLIHFILFQNAFEIAFFFWIWVTYGFDSCIMGQVRYIVPRLVIG  412

Query  378  VIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGIN  202
            V IQVLCSYSTLP+YAIV+QMG++FKK+IF++++QVGLVGWAQK K ++ LK A    N
Sbjct  413  VFIQVLCSYSTLPLYAIVSQMGSNFKKAIFEKNVQVGLVGWAQKVKNKRDLKTAASNGN  471


 Score =   113 bits (282),  Expect(2) = 5e-75, Method: Compositional matrix adjust.
 Identities = 56/60 (93%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVVIFLLLNINGWHTYFWIAFIPFILL+AVG KLEHVI QLAHEVAEKHVAIEGELVV
Sbjct  293  WIFVVIFLLLNINGWHTYFWIAFIPFILLIAVGAKLEHVISQLAHEVAEKHVAIEGELVV  352



>ref|XP_003636497.1| MLO-like protein [Medicago truncatula]
Length=729

 Score =   199 bits (505),  Expect(2) = 6e-75, Method: Compositional matrix adjust.
 Identities = 97/159 (61%), Positives = 122/159 (77%), Gaps = 6/159 (4%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + QPSD+HFWF RP+IVLFLIH ILFQN+FEIAFFFWILV +GF+SC+MG + + IPRLV
Sbjct  345  VVQPSDDHFWFHRPRIVLFLIHLILFQNSFEIAFFFWILVTFGFNSCMMGKLHYTIPRLV  404

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGI  205
            IG++IQV+CSYSTLP+YAIVTQMGT++KK+IFDE IQ  L+GWAQKAK +KGL+   G  
Sbjct  405  IGLLIQVICSYSTLPLYAIVTQMGTYYKKAIFDEQIQTCLLGWAQKAK-KKGLR---GNN  460

Query  204  NHG--GALTDGSSTGVQMGGVGRKESGSTDGASVRALQQ  94
            N    G+   G+S+ +Q+G V R+     D   V   QQ
Sbjct  461  NQSGEGSTHSGASSNIQLGSVFRRAPAPEDNTIVPKDQQ  499


 Score =   110 bits (274),  Expect(2) = 6e-75, Method: Compositional matrix adjust.
 Identities = 53/60 (88%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVVIF+LLNINGWHTYFW+AFIP ILLLAVGTKLEHVIIQLAHEVAEKH AI+G+LVV
Sbjct  287  WIFVVIFMLLNINGWHTYFWVAFIPVILLLAVGTKLEHVIIQLAHEVAEKHSAIQGKLVV  346



>ref|XP_003636206.1| MLO-like protein [Medicago truncatula]
Length=501

 Score =   199 bits (505),  Expect(2) = 6e-75, Method: Compositional matrix adjust.
 Identities = 97/157 (62%), Positives = 121/157 (77%), Gaps = 6/157 (4%)
 Frame = -3

Query  558  QPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIG  379
            QPSD+HFWF RP+IVLFLIH ILFQN+FEIAFFFWILV +GF+SC+MG + + IPRLVIG
Sbjct  347  QPSDDHFWFHRPRIVLFLIHLILFQNSFEIAFFFWILVTFGFNSCMMGKLHYTIPRLVIG  406

Query  378  VIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGINH  199
            ++IQV+CSYSTLP+YAIVTQMGT++KK+IFDE IQ  L+GWAQKAK +KGL+   G  N 
Sbjct  407  LLIQVICSYSTLPLYAIVTQMGTYYKKAIFDEQIQTCLLGWAQKAK-KKGLR---GNNNQ  462

Query  198  G--GALTDGSSTGVQMGGVGRKESGSTDGASVRALQQ  94
               G+   G+S+ +Q+G V R+     D   V   QQ
Sbjct  463  SGEGSTHSGASSNIQLGSVFRRAPAPEDNTIVPKDQQ  499


 Score =   110 bits (274),  Expect(2) = 6e-75, Method: Compositional matrix adjust.
 Identities = 53/60 (88%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVVIF+LLNINGWHTYFW+AFIP ILLLAVGTKLEHVIIQLAHEVAEKH AI+G+LVV
Sbjct  287  WIFVVIFMLLNINGWHTYFWVAFIPVILLLAVGTKLEHVIIQLAHEVAEKHSAIQGKLVV  346



>ref|XP_011011036.1| PREDICTED: MLO-like protein 1 isoform X1 [Populus euphratica]
 ref|XP_011011037.1| PREDICTED: MLO-like protein 1 isoform X1 [Populus euphratica]
Length=527

 Score =   197 bits (500),  Expect(2) = 6e-75, Method: Compositional matrix adjust.
 Identities = 96/161 (60%), Positives = 118/161 (73%), Gaps = 7/161 (4%)
 Frame = -3

Query  558  QPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIG  379
            QPSD HFWF RP  V  LIHFILFQNAFEIAFFFWI VQYGFDSCIMG +K+I+PRL+IG
Sbjct  357  QPSDNHFWFHRPGFVHLLIHFILFQNAFEIAFFFWIWVQYGFDSCIMGQIKYIVPRLIIG  416

Query  378  VIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGINH  199
            V IQVLCSYSTLP+YAIV+QMG+ FKKSIF+EH+Q GLVGWAQK K+++G K +  G   
Sbjct  417  VFIQVLCSYSTLPLYAIVSQMGSTFKKSIFEEHVQAGLVGWAQKVKKKRGQKGSTEG---  473

Query  198  GGALTDGSSTGVQMGGVGRKESGSTDGASVRALQQMGGDGS  76
                +  +S+ V  GG+  ++      A+  + Q    +GS
Sbjct  474  ----SSEASSHVSAGGLQLEKLKRLKEANEGSAQSSSHEGS  510


 Score =   111 bits (278),  Expect(2) = 6e-75, Method: Compositional matrix adjust.
 Identities = 56/60 (93%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            WVFVVIFLLLNINGWHTYFWIAFIP  LLLAVGTKLEHVI QLA+EVAEKHVAIEGELVV
Sbjct  297  WVFVVIFLLLNINGWHTYFWIAFIPLFLLLAVGTKLEHVITQLAYEVAEKHVAIEGELVV  356



>gb|EEE63750.1| hypothetical protein OsJ_18569 [Oryza sativa Japonica Group]
Length=499

 Score =   201 bits (510),  Expect(2) = 6e-75, Method: Compositional matrix adjust.
 Identities = 94/162 (58%), Positives = 117/162 (72%), Gaps = 7/162 (4%)
 Frame = -3

Query  570  NWLCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPR  391
            + + +PSD+HFW GRP+I+L+LIHFILFQNAFEIAFFFWIL  YGF SCIMG V FI+PR
Sbjct  338  DLVVKPSDDHFWLGRPRIILYLIHFILFQNAFEIAFFFWILTTYGFSSCIMGQVSFIVPR  397

Query  390  LVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFG  211
            LVIGV IQ+LCSYST+P+YA+VTQMG+ +KK IF++H+Q G++GWAQK K RKGLK    
Sbjct  398  LVIGVTIQLLCSYSTMPLYAVVTQMGSFYKKEIFNDHVQQGVLGWAQKVKMRKGLKEGSA  457

Query  210  GI-------NHGGALTDGSSTGVQMGGVGRKESGSTDGASVR  106
            G        N GG  T G S  ++M     +E     G S+ 
Sbjct  458  GAGVAAEPSNGGGGDTAGPSVKIEMMRRAAREGNDEAGVSIE  499


 Score =   107 bits (268),  Expect(2) = 6e-75, Method: Compositional matrix adjust.
 Identities = 52/60 (87%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            WVFVVIFLLLN+NGWHTYFWIAF+P ILLLAVGTKLEHVI QLAH+VAEK+ AIEG+LVV
Sbjct  282  WVFVVIFLLLNVNGWHTYFWIAFLPLILLLAVGTKLEHVIAQLAHDVAEKNSAIEGDLVV  341



>gb|AAU10790.1| putative seven transmembrane MLO family protein [Oryza sativa 
Japonica Group]
 gb|AAV25638.1| putative MLO family protein [Oryza sativa Japonica Group]
 dbj|BAH00439.1| unnamed protein product [Oryza sativa Japonica Group]
Length=287

 Score =   201 bits (510),  Expect(2) = 7e-75, Method: Compositional matrix adjust.
 Identities = 94/160 (59%), Positives = 116/160 (73%), Gaps = 7/160 (4%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + +PSD+HFW GRP+I+L+LIHFILFQNAFEIAFFFWIL  YGF SCIMG V FI+PRLV
Sbjct  128  VVKPSDDHFWLGRPRIILYLIHFILFQNAFEIAFFFWILTTYGFSSCIMGQVSFIVPRLV  187

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGI  205
            IGV IQ+LCSYST+P+YA+VTQMG+ +KK IF++H+Q G++GWAQK K RKGLK    G 
Sbjct  188  IGVTIQLLCSYSTMPLYAVVTQMGSFYKKEIFNDHVQQGVLGWAQKVKMRKGLKEGSAGA  247

Query  204  -------NHGGALTDGSSTGVQMGGVGRKESGSTDGASVR  106
                   N GG  T G S  ++M     +E     G S+ 
Sbjct  248  GVAAEPSNGGGGDTAGPSVKIEMMRRAAREGNDEAGVSIE  287


 Score =   108 bits (269),  Expect(2) = 7e-75, Method: Compositional matrix adjust.
 Identities = 52/60 (87%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            WVFVVIFLLLN+NGWHTYFWIAF+P ILLLAVGTKLEHVI QLAH+VAEK+ AIEG+LVV
Sbjct  70   WVFVVIFLLLNVNGWHTYFWIAFLPLILLLAVGTKLEHVIAQLAHDVAEKNSAIEGDLVV  129



>ref|NP_001105171.1| barley mlo defense gene homolog8 [Zea mays]
 gb|AAK38344.1| seven transmembrane protein Mlo8 [Zea mays]
 gb|ACF88127.1| unknown [Zea mays]
 gb|ACG43194.1| MLO-like protein 1 [Zea mays]
 gb|ACL54646.1| unknown [Zea mays]
 gb|AFW78033.1| MLO-like protein 1Seven transmembrane protein Mlo8 [Zea mays]
Length=492

 Score =   201 bits (512),  Expect(2) = 7e-75, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 117/159 (74%), Gaps = 6/159 (4%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + +PSDEHFWFG+P+++L+LIHFILFQNAFEIAFFFWIL  YGFDSCIMG V+FI+PRLV
Sbjct  340  IVKPSDEHFWFGKPRVILYLIHFILFQNAFEIAFFFWILSTYGFDSCIMGQVRFIVPRLV  399

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGI  205
            IGV+IQ+LCSYSTLP+YAIVTQMG+ +KK IF+EH+Q G++GWAQK K +KGLK A    
Sbjct  400  IGVVIQLLCSYSTLPLYAIVTQMGSCYKKEIFNEHVQQGVLGWAQKVKMKKGLKGA----  455

Query  204  NHGGALTDGSSTGVQMGGVGRKESGSTDGASVRALQQMG  88
                A  D S T     G   K   +  G  V  +   G
Sbjct  456  --ASASKDESITNADSAGPSVKIEMAKAGEDVEIVGNTG  492


 Score =   107 bits (267),  Expect(2) = 7e-75, Method: Compositional matrix adjust.
 Identities = 49/60 (82%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            WVFVVIFLLLN+NGWHTYFWIAF+P ILLLA+GTKLEHVI QLAH+VAEKH A+EG+++V
Sbjct  282  WVFVVIFLLLNVNGWHTYFWIAFLPLILLLAIGTKLEHVIAQLAHDVAEKHTAVEGDVIV  341



>ref|XP_011011038.1| PREDICTED: MLO-like protein 1 isoform X2 [Populus euphratica]
Length=502

 Score =   197 bits (501),  Expect(2) = 7e-75, Method: Compositional matrix adjust.
 Identities = 96/161 (60%), Positives = 118/161 (73%), Gaps = 7/161 (4%)
 Frame = -3

Query  558  QPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIG  379
            QPSD HFWF RP  V  LIHFILFQNAFEIAFFFWI VQYGFDSCIMG +K+I+PRL+IG
Sbjct  332  QPSDNHFWFHRPGFVHLLIHFILFQNAFEIAFFFWIWVQYGFDSCIMGQIKYIVPRLIIG  391

Query  378  VIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGINH  199
            V IQVLCSYSTLP+YAIV+QMG+ FKKSIF+EH+Q GLVGWAQK K+++G K +  G   
Sbjct  392  VFIQVLCSYSTLPLYAIVSQMGSTFKKSIFEEHVQAGLVGWAQKVKKKRGQKGSTEG---  448

Query  198  GGALTDGSSTGVQMGGVGRKESGSTDGASVRALQQMGGDGS  76
                +  +S+ V  GG+  ++      A+  + Q    +GS
Sbjct  449  ----SSEASSHVSAGGLQLEKLKRLKEANEGSAQSSSHEGS  485


 Score =   111 bits (278),  Expect(2) = 7e-75, Method: Compositional matrix adjust.
 Identities = 56/60 (93%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            WVFVVIFLLLNINGWHTYFWIAFIP  LLLAVGTKLEHVI QLA+EVAEKHVAIEGELVV
Sbjct  272  WVFVVIFLLLNINGWHTYFWIAFIPLFLLLAVGTKLEHVITQLAYEVAEKHVAIEGELVV  331



>ref|NP_001174425.1| Os05g0418100 [Oryza sativa Japonica Group]
 dbj|BAH93153.1| Os05g0418100, partial [Oryza sativa Japonica Group]
Length=325

 Score =   200 bits (508),  Expect(2) = 1e-74, Method: Compositional matrix adjust.
 Identities = 94/160 (59%), Positives = 116/160 (73%), Gaps = 7/160 (4%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + +PSD+HFW GRP+I+L+LIHFILFQNAFEIAFFFWIL  YGF SCIMG V FI+PRLV
Sbjct  166  VVKPSDDHFWLGRPRIILYLIHFILFQNAFEIAFFFWILTTYGFSSCIMGQVSFIVPRLV  225

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGI  205
            IGV IQ+LCSYST+P+YA+VTQMG+ +KK IF++H+Q G++GWAQK K RKGLK    G 
Sbjct  226  IGVTIQLLCSYSTMPLYAVVTQMGSFYKKEIFNDHVQQGVLGWAQKVKMRKGLKEGSAGA  285

Query  204  -------NHGGALTDGSSTGVQMGGVGRKESGSTDGASVR  106
                   N GG  T G S  ++M     +E     G S+ 
Sbjct  286  GVAAEPSNGGGGDTAGPSVKIEMMRRAAREGNDEAGVSIE  325


 Score =   107 bits (268),  Expect(2) = 1e-74, Method: Compositional matrix adjust.
 Identities = 52/60 (87%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            WVFVVIFLLLN+NGWHTYFWIAF+P ILLLAVGTKLEHVI QLAH+VAEK+ AIEG+LVV
Sbjct  108  WVFVVIFLLLNVNGWHTYFWIAFLPLILLLAVGTKLEHVIAQLAHDVAEKNSAIEGDLVV  167



>ref|XP_007217923.1| hypothetical protein PRUPE_ppa004866mg [Prunus persica]
 gb|EMJ19122.1| hypothetical protein PRUPE_ppa004866mg [Prunus persica]
Length=488

 Score =   203 bits (517),  Expect(2) = 2e-74, Method: Compositional matrix adjust.
 Identities = 100/144 (69%), Positives = 120/144 (83%), Gaps = 7/144 (5%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + QPSDEHFWFG+P+ VLFLIHFILFQNAFE+AFFFWI VQYGF SCIMG VK+IIPR+V
Sbjct  349  IVQPSDEHFWFGKPKFVLFLIHFILFQNAFEMAFFFWIWVQYGFTSCIMGKVKYIIPRIV  408

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGI  205
            IG+ IQVLCSYSTLP+YAIVTQMGT+FKK+IFDE +++GLVGWA+KAK+R   KA+  G 
Sbjct  409  IGLFIQVLCSYSTLPLYAIVTQMGTNFKKAIFDEDVRLGLVGWAKKAKRR---KASMDGS  465

Query  204  NHGGALTDGSSTGVQMGGVGRKES  133
            + G     GS  GVQ+G V +K +
Sbjct  466  SSG----IGSDVGVQLGKVNQKTT  485


 Score =   103 bits (258),  Expect(2) = 2e-74, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVV+F+L+N++GWH YFWIAF+PF LLLAVG KL+HVI QLAHEVAEKH+A+EGEL+V
Sbjct  291  WIFVVLFMLMNVDGWHAYFWIAFVPFFLLLAVGAKLQHVITQLAHEVAEKHIAVEGELIV  350



>ref|XP_003520359.1| PREDICTED: MLO-like protein 1-like [Glycine max]
 gb|KHN07795.1| MLO-like protein 1 [Glycine soja]
Length=517

 Score =   201 bits (512),  Expect(2) = 3e-74, Method: Compositional matrix adjust.
 Identities = 96/152 (63%), Positives = 115/152 (76%), Gaps = 4/152 (3%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + QP D+HFWF RP IVLFLIHFILFQNAFEIAFFFWI V YGFDSCIMG V++I+PRL+
Sbjct  363  VVQPRDDHFWFNRPHIVLFLIHFILFQNAFEIAFFFWIWVIYGFDSCIMGRVRYIVPRLI  422

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGI  205
            IG+ IQ+LCSYSTLP+YAIVTQMGTHFKK++FDE +Q  LVGWAQKAK+    K   G  
Sbjct  423  IGIFIQLLCSYSTLPLYAIVTQMGTHFKKAVFDEQVQARLVGWAQKAKK----KGQRGDN  478

Query  204  NHGGALTDGSSTGVQMGGVGRKESGSTDGASV  109
            +H G  +     G+Q+G V ++ S   D   V
Sbjct  479  SHSGQGSSHVGAGIQLGSVFKRPSVPEDNVIV  510


 Score =   105 bits (261),  Expect(2) = 3e-74, Method: Compositional matrix adjust.
 Identities = 51/60 (85%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVVIF+LLN++GWH YFWI+FIP ILLLAVG KLEHVIIQLAHEVAEKH AIEGELVV
Sbjct  305  WIFVVIFMLLNVHGWHAYFWISFIPLILLLAVGAKLEHVIIQLAHEVAEKHSAIEGELVV  364



>ref|XP_003604071.1| MLO-like protein [Medicago truncatula]
 gb|AES74322.1| seven transmembrane MLO family protein [Medicago truncatula]
Length=517

 Score =   196 bits (497),  Expect(2) = 7e-74, Method: Compositional matrix adjust.
 Identities = 104/156 (67%), Positives = 125/156 (80%), Gaps = 4/156 (3%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + QPSD HFWF RP IVLFLIHFILFQNAFEIAFFFWI V YGFDSCIMG V++I+PRLV
Sbjct  355  VVQPSDNHFWFHRPHIVLFLIHFILFQNAFEIAFFFWIWVTYGFDSCIMGQVRYIVPRLV  414

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKA---AF  214
            IGV IQVLCSYSTLP+YA+VTQMG+HFK++IF++H+QVG+VGWA+K K++K LKA     
Sbjct  415  IGVFIQVLCSYSTLPLYAVVTQMGSHFKRAIFNDHVQVGIVGWAEKVKKKKALKADGQPS  474

Query  213  GGINHGGALTDGSSTGVQMGGVGRKE-SGSTDGASV  109
             G +H    + GSSTG+Q+G V +K  S   D  SV
Sbjct  475  QGSSHIHEGSTGSSTGIQLGSVFQKRASAPEDTTSV  510


 Score =   109 bits (273),  Expect(2) = 7e-74, Method: Compositional matrix adjust.
 Identities = 53/60 (88%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVVIFLLLNINGWHTYFWIAF+P ILLL+VGTKLEHVI QLAHEVAEKH AIEG+LVV
Sbjct  297  WLFVVIFLLLNINGWHTYFWIAFVPVILLLSVGTKLEHVITQLAHEVAEKHAAIEGDLVV  356



>gb|EAY98072.1| hypothetical protein OsI_19990 [Oryza sativa Indica Group]
Length=488

 Score =   197 bits (501),  Expect(2) = 9e-74, Method: Compositional matrix adjust.
 Identities = 92/155 (59%), Positives = 116/155 (75%), Gaps = 4/155 (3%)
 Frame = -3

Query  570  NWLCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPR  391
            + + +PSD+HFW GRP+I+L+LIHFILFQNAFEIAFFFWIL  YGF SCIMG V FI+PR
Sbjct  338  DLVVKPSDDHFWLGRPRIILYLIHFILFQNAFEIAFFFWILTTYGFYSCIMGQVGFIVPR  397

Query  390  LVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFG  211
            LVIGV IQ+LCSYST+P+YA+VTQMG+ +KK IF++H+Q G++GWAQK K RKGLK    
Sbjct  398  LVIGVTIQLLCSYSTMPLYAVVTQMGSFYKKEIFNDHVQQGVLGWAQKVKMRKGLKEG--  455

Query  210  GINHGGALTDGSSTGVQMGGVGRKESGSTDGASVR  106
              + GG  T G S  ++M     +E     G S+ 
Sbjct  456  --SAGGGDTAGPSVKIEMMRRAAREGNDEAGVSIE  488


 Score =   107 bits (268),  Expect(2) = 9e-74, Method: Compositional matrix adjust.
 Identities = 52/60 (87%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            WVFVVIFLLLN+NGWHTYFWIAF+P ILLLAVGTKLEHVI QLAH+VAEK+ AIEG+LVV
Sbjct  282  WVFVVIFLLLNVNGWHTYFWIAFLPLILLLAVGTKLEHVIAQLAHDVAEKNSAIEGDLVV  341



>ref|XP_003568437.1| PREDICTED: MLO-like protein 1 [Brachypodium distachyon]
Length=493

 Score =   195 bits (495),  Expect(2) = 2e-73, Method: Compositional matrix adjust.
 Identities = 93/157 (59%), Positives = 117/157 (75%), Gaps = 7/157 (4%)
 Frame = -3

Query  570  NWLCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPR  391
            + + +PSD+HFWFGRP+I+LFLIHFILFQN+FEIAFFFWIL  YGF+SCIMG V FI+PR
Sbjct  339  DLIVKPSDDHFWFGRPRIILFLIHFILFQNSFEIAFFFWILTTYGFNSCIMGQVGFIVPR  398

Query  390  LVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFG  211
            LVIG+IIQ+LCSYSTLP+YAIVTQMG+ +KK IF++H+Q G++GWAQK K RKGLK    
Sbjct  399  LVIGLIIQLLCSYSTLPLYAIVTQMGSFYKKEIFNDHVQQGVLGWAQKVKMRKGLKEG--  456

Query  210  GINHGGALT---DGSSTGVQMGGVGRKESGSTDGASV  109
              N    LT   D +   V++  + R      D   +
Sbjct  457  --NATAGLTNTVDSAGPSVKIEMMKRAGREGNDAGEI  491


 Score =   109 bits (272),  Expect(2) = 2e-73, Method: Compositional matrix adjust.
 Identities = 52/60 (87%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            WVFVVIFLLLN+NGWHTYFWIAFIP +LLLAVGTKLEHVI QLAH+VAEKH AIEG+L+V
Sbjct  283  WVFVVIFLLLNVNGWHTYFWIAFIPLLLLLAVGTKLEHVIAQLAHDVAEKHSAIEGDLIV  342



>gb|ABK95021.1| unknown [Populus trichocarpa]
Length=265

 Score =   193 bits (490),  Expect(2) = 2e-73, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + QPSD HFWF RP  V  LIHFILFQNAFEIAFFFWI VQYGFDSCIMG +K+I+PRL+
Sbjct  93   VVQPSDNHFWFHRPGFVHLLIHFILFQNAFEIAFFFWIWVQYGFDSCIMGQIKYIVPRLI  152

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGI  205
            IGV IQVLCSYSTLP+YAIV+QMG+ FKKSIF+EH+Q GLVGWAQK K+++G K +  G 
Sbjct  153  IGVFIQVLCSYSTLPLYAIVSQMGSTFKKSIFEEHVQAGLVGWAQKVKKKRGQKGSTEGS  212

Query  204  NHGGA  190
            +   +
Sbjct  213  SEASS  217


 Score =   110 bits (276),  Expect(2) = 2e-73, Method: Compositional matrix adjust.
 Identities = 57/60 (95%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            WVFVVIFLLLNINGWHTYFWIAFIP ILLLAVGTKLEHVI QLA+EVAEKHVAIEGELVV
Sbjct  35   WVFVVIFLLLNINGWHTYFWIAFIPLILLLAVGTKLEHVINQLAYEVAEKHVAIEGELVV  94



>ref|XP_004970844.1| PREDICTED: MLO-like protein 1-like isoform X1 [Setaria italica]
Length=501

 Score =   199 bits (506),  Expect(2) = 3e-73, Method: Compositional matrix adjust.
 Identities = 90/112 (80%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = -3

Query  558  QPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIG  379
             PSDEHFWFGRP+IVL+LIHFILFQNAFEIAFFFWIL  YGF+SCIM HV FI+PRLV+G
Sbjct  348  NPSDEHFWFGRPKIVLYLIHFILFQNAFEIAFFFWILTTYGFNSCIMDHVPFIVPRLVVG  407

Query  378  VIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
              IQ++CSYSTLP+YAIVTQMGT FKK IFDEH+Q  LVGWAQKAK+RK LK
Sbjct  408  ATIQLVCSYSTLPLYAIVTQMGTFFKKEIFDEHVQQSLVGWAQKAKKRKALK  459


 Score =   103 bits (258),  Expect(2) = 3e-73, Method: Compositional matrix adjust.
 Identities = 49/60 (82%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVV+F+LLN+NGWHTYFWI+FIP +LLLAVGTKLEHVI QLA EVAEKH AIEG+LVV
Sbjct  288  WIFVVVFMLLNVNGWHTYFWISFIPLLLLLAVGTKLEHVITQLAIEVAEKHSAIEGDLVV  347



>emb|CDM85394.1| unnamed protein product [Triticum aestivum]
Length=483

 Score =   197 bits (500),  Expect(2) = 3e-73, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 104/126 (83%), Gaps = 3/126 (2%)
 Frame = -3

Query  558  QPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIG  379
             PSDEHFW G+P+++L+LIHFILFQNAFEIA FFWIL  YGF+SCIM HV FI+PRLVIG
Sbjct  337  NPSDEHFWCGKPRVILYLIHFILFQNAFEIALFFWILTTYGFNSCIMDHVPFIVPRLVIG  396

Query  378  VIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK---AAFGG  208
            V+IQ+LCSYSTLP+YAIVTQMGT FKK IFDEHIQ GLVGWAQKA+ R  L    AA G 
Sbjct  397  VVIQLLCSYSTLPLYAIVTQMGTFFKKEIFDEHIQQGLVGWAQKARMRTELSKDAAAAGP  456

Query  207  INHGGA  190
              HG +
Sbjct  457  TRHGPS  462


 Score =   106 bits (265),  Expect(2) = 3e-73, Method: Compositional matrix adjust.
 Identities = 49/60 (82%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVVIF+LLN+NGWHTYFWI+F+P ILLLAVGTKLEHVI QLA++VAEKH AIEG+LVV
Sbjct  277  WIFVVIFMLLNVNGWHTYFWISFLPLILLLAVGTKLEHVIAQLAYDVAEKHSAIEGDLVV  336



>ref|XP_008812868.1| PREDICTED: MLO-like protein 1 isoform X1 [Phoenix dactylifera]
Length=502

 Score =   192 bits (488),  Expect(2) = 6e-73, Method: Compositional matrix adjust.
 Identities = 96/153 (63%), Positives = 115/153 (75%), Gaps = 2/153 (1%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + +PSD+HFWF RP+++L+LIHFILFQNAFE AFFFWIL  YGF+SCIM H  FII RLV
Sbjct  346  IVKPSDDHFWFHRPRVILYLIHFILFQNAFEFAFFFWILTTYGFNSCIMDHAGFIISRLV  405

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGI  205
            IGVIIQ+LCSYSTLP+YAIVTQMG+ FKK+IFDEH+Q GLVGWAQK K+RKG K   G  
Sbjct  406  IGVIIQLLCSYSTLPLYAIVTQMGSSFKKAIFDEHVQEGLVGWAQKVKRRKGTKMGNGSA  465

Query  204  NHGGALTDGSSTGVQMGG-VGRKESGSTDGASV  109
                +  +     +QM   VG+KE G +  A  
Sbjct  466  GSSHSSAE-PYVKIQMQKLVGQKEEGKSGDADT  497


 Score =   110 bits (274),  Expect(2) = 6e-73, Method: Compositional matrix adjust.
 Identities = 52/60 (87%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVVIFLLLN+NGWHTYFWIAFIP +LLLAVGTKLEHVI QLAHEVAEKH AIEG+L+V
Sbjct  288  WIFVVIFLLLNVNGWHTYFWIAFIPLLLLLAVGTKLEHVITQLAHEVAEKHSAIEGDLIV  347



>ref|XP_009399143.1| PREDICTED: MLO-like protein 1 [Musa acuminata subsp. malaccensis]
Length=516

 Score =   193 bits (491),  Expect(2) = 7e-73, Method: Compositional matrix adjust.
 Identities = 87/115 (76%), Positives = 102/115 (89%), Gaps = 0/115 (0%)
 Frame = -3

Query  555  PSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIGV  376
            PSD+HFWF RPQIVL+LIHFILFQNAFEIAFFFWI   YG++SCIM H  FI+PRLVIGV
Sbjct  359  PSDDHFWFHRPQIVLYLIHFILFQNAFEIAFFFWIFTTYGYNSCIMDHACFIVPRLVIGV  418

Query  375  IIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFG  211
             IQ+LCSYSTLP+YAIVTQMG++FKK+IFDEH+Q GLVGWA+K K+RKG++   G
Sbjct  419  TIQLLCSYSTLPLYAIVTQMGSYFKKAIFDEHVQEGLVGWAEKVKKRKGVRIGNG  473


 Score =   108 bits (270),  Expect(2) = 7e-73, Method: Compositional matrix adjust.
 Identities = 52/60 (87%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            WVFVVIF+LLN+NGWHTYFWIAFIP ILLLA+GTKLEHVI QLA EVAEKH AIEG+LVV
Sbjct  298  WVFVVIFMLLNVNGWHTYFWIAFIPLILLLALGTKLEHVITQLAQEVAEKHTAIEGDLVV  357



>ref|XP_006858689.1| hypothetical protein AMTR_s00066p00091160 [Amborella trichopoda]
 gb|ERN20156.1| hypothetical protein AMTR_s00066p00091160 [Amborella trichopoda]
Length=510

 Score =   196 bits (499),  Expect(2) = 7e-73, Method: Compositional matrix adjust.
 Identities = 96/166 (58%), Positives = 118/166 (71%), Gaps = 12/166 (7%)
 Frame = -3

Query  570  NWLCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPR  391
            + + +PSD+HFWF RP+IVL+LIHFILFQNAFEIAFFFWIL  +G+DSCIMG V++IIPR
Sbjct  348  DLVVRPSDDHFWFHRPRIVLYLIHFILFQNAFEIAFFFWILTTFGWDSCIMGQVRYIIPR  407

Query  390  LVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFG  211
            L+IGVIIQV+CSYSTLP+YAIVTQMGT FKK+IFDEH+Q GL+GWAQK K RK +K + G
Sbjct  408  LIIGVIIQVVCSYSTLPLYAIVTQMGTTFKKAIFDEHVQQGLLGWAQKVKNRK-IKPSKG  466

Query  210  GINHGGALTDGSSTGVQMGGVGRKESGSTDGASVRALQQMGGDGSK  73
                G            + G       +    SV  +Q +  D  K
Sbjct  467  NSREGS-----------VAGAASCSRRAQANVSVEGIQLLKKDDKK  501


 Score =   105 bits (262),  Expect(2) = 7e-73, Method: Compositional matrix adjust.
 Identities = 49/60 (82%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVV+FLLLN++GWHTYFWIAFIP  LLLAVGTKLEH+I QLA EVAEKH AIEG+LVV
Sbjct  292  WIFVVLFLLLNVDGWHTYFWIAFIPLFLLLAVGTKLEHIITQLAQEVAEKHTAIEGDLVV  351



>ref|XP_008812870.1| PREDICTED: MLO-like protein 1 isoform X3 [Phoenix dactylifera]
Length=329

 Score =   192 bits (488),  Expect(2) = 8e-73, Method: Compositional matrix adjust.
 Identities = 96/153 (63%), Positives = 114/153 (75%), Gaps = 2/153 (1%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + +PSD+HFWF RP+++L+LIHFILFQNAFE AFFFWIL  YGF+SCIM H  FII RLV
Sbjct  173  IVKPSDDHFWFHRPRVILYLIHFILFQNAFEFAFFFWILTTYGFNSCIMDHAGFIISRLV  232

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGI  205
            IGVIIQ+LCSYSTLP+YAIVTQMG+ FKK+IFDEH+Q GLVGWAQK K+RKG K    G 
Sbjct  233  IGVIIQLLCSYSTLPLYAIVTQMGSSFKKAIFDEHVQEGLVGWAQKVKRRKGTKMG-NGS  291

Query  204  NHGGALTDGSSTGVQMGG-VGRKESGSTDGASV  109
                  +      +QM   VG+KE G +  A  
Sbjct  292  AGSSHSSAEPYVKIQMQKLVGQKEEGKSGDADT  324


 Score =   109 bits (272),  Expect(2) = 8e-73, Method: Compositional matrix adjust.
 Identities = 52/61 (85%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVVIFLLLN+NGWHTYFWIAFIP +LLLAVGTKLEHVI QLAHEVAEKH AIEG+L+V
Sbjct  115  WIFVVIFLLLNVNGWHTYFWIAFIPLLLLLAVGTKLEHVITQLAHEVAEKHSAIEGDLIV  174

Query  559  P  557
             
Sbjct  175  K  175



>ref|XP_004500714.1| PREDICTED: MLO-like protein 1-like isoform X2 [Cicer arietinum]
Length=508

 Score =   192 bits (489),  Expect(2) = 2e-72, Method: Compositional matrix adjust.
 Identities = 86/105 (82%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + QPSDEHFWF RP++VLFLIHFILFQNAFEIAFFFWI V YGFDSCIMGH+++I+PRLV
Sbjct  348  VVQPSDEHFWFHRPRVVLFLIHFILFQNAFEIAFFFWIWVTYGFDSCIMGHIRYIVPRLV  407

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQ  250
            IGV IQVLCSYSTLP+YA+VTQMGTHFK+ IF+EH+Q GLVGWAQ
Sbjct  408  IGVFIQVLCSYSTLPLYALVTQMGTHFKRVIFNEHVQDGLVGWAQ  452


 Score =   108 bits (269),  Expect(2) = 2e-72, Method: Compositional matrix adjust.
 Identities = 53/60 (88%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVVIFLLLNINGWHTYFWIAF+P ILLLAVGTKL HVI QLAHEVAEKH AIEG+LVV
Sbjct  290  WLFVVIFLLLNINGWHTYFWIAFVPLILLLAVGTKLGHVITQLAHEVAEKHAAIEGDLVV  349



>ref|XP_009376309.1| PREDICTED: MLO-like protein 1 [Pyrus x bretschneideri]
Length=466

 Score =   194 bits (493),  Expect(2) = 2e-72, Method: Compositional matrix adjust.
 Identities = 88/112 (79%), Positives = 104/112 (93%), Gaps = 0/112 (0%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + QPSD+HFWFG+P+ VLFLIHFILFQNAFE+AFFFWI VQYGF SCIMG V++I+PRLV
Sbjct  350  IVQPSDKHFWFGKPKFVLFLIHFILFQNAFEMAFFFWIWVQYGFTSCIMGKVRYIVPRLV  409

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKG  229
            IGV IQVLCSYSTLP+YAI+TQMGT+FKK++FDE+I+ GLVGWAQKAK+RK 
Sbjct  410  IGVFIQVLCSYSTLPLYAIITQMGTNFKKAMFDENIRSGLVGWAQKAKRRKA  461


 Score =   106 bits (264),  Expect(2) = 2e-72, Method: Compositional matrix adjust.
 Identities = 48/60 (80%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVV+F+LLN++GWH YFWIAF+PF LLLAVGTKL+HVI QLAHEVAEKH+AIEGEL+V
Sbjct  292  WIFVVLFMLLNVDGWHAYFWIAFVPFFLLLAVGTKLQHVITQLAHEVAEKHIAIEGELIV  351



>ref|XP_009600156.1| PREDICTED: MLO-like protein 1 isoform X2 [Nicotiana tomentosiformis]
Length=493

 Score =   185 bits (469),  Expect(2) = 2e-72, Method: Compositional matrix adjust.
 Identities = 98/144 (68%), Positives = 112/144 (78%), Gaps = 2/144 (1%)
 Frame = -3

Query  558  QPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIG  379
            QPSD HFWF RPQIVLFLIHFILFQNAFEIAFFFWIL QYGF SCIMG   F+ PRLVIG
Sbjct  350  QPSDSHFWFDRPQIVLFLIHFILFQNAFEIAFFFWILFQYGFYSCIMGKYVFVTPRLVIG  409

Query  378  VIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGINH  199
            V IQVLCSYSTLP+YA+VTQMG+H+KKS+FD+H+Q  L+ WA+K K++K  KAA  G NH
Sbjct  410  VFIQVLCSYSTLPLYALVTQMGSHYKKSMFDDHVQACLIEWAEKVKKKKAQKAARDGSNH  469

Query  198  GGALTDGSSTGVQMGGVGRKESGS  127
                 DG + G  M   G KES +
Sbjct  470  ST--DDGFTIGSPMSVHGSKESPN  491


 Score =   115 bits (287),  Expect(2) = 2e-72, Method: Compositional matrix adjust.
 Identities = 55/60 (92%), Positives = 60/60 (100%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FV++FLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHE+AEKHVA+EGELVV
Sbjct  290  WIFVILFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEIAEKHVAVEGELVV  349



>ref|XP_009410722.1| PREDICTED: MLO-like protein 1 isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=502

 Score =   191 bits (485),  Expect(2) = 4e-72, Method: Compositional matrix adjust.
 Identities = 93/154 (60%), Positives = 115/154 (75%), Gaps = 6/154 (4%)
 Frame = -3

Query  570  NWLCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPR  391
            + + +PSD+HFWF RP+IVL LIHFILFQNAFEIAFFFWIL  +GFDSCIM    FI+PR
Sbjct  346  DLVVKPSDDHFWFRRPRIVLNLIHFILFQNAFEIAFFFWILTTFGFDSCIMDQFSFIVPR  405

Query  390  LVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFG  211
            LVIGV+IQ+LCSYSTLP+YAIVTQMG++FKK+IFDEH+Q GL+ WAQK K+RKG      
Sbjct  406  LVIGVVIQLLCSYSTLPLYAIVTQMGSYFKKAIFDEHVQEGLMDWAQKVKRRKG-----N  460

Query  210  GINHGGALTDGSSTGVQMGG-VGRKESGSTDGAS  112
            G+       D  S  +++   V + ES   +G S
Sbjct  461  GLVRSSQGQDEPSRKIELQKLVQQTESDLEEGRS  494


 Score =   108 bits (269),  Expect(2) = 4e-72, Method: Compositional matrix adjust.
 Identities = 51/60 (85%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            WVFV IFLLLN+NGWHTYFWI+FIP ILLLAVGTKLEH+I QLAHEVAEKH AI+G+LVV
Sbjct  290  WVFVFIFLLLNVNGWHTYFWISFIPLILLLAVGTKLEHIITQLAHEVAEKHSAIQGDLVV  349



>ref|XP_009410721.1| PREDICTED: MLO-like protein 1 isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=504

 Score =   191 bits (485),  Expect(2) = 5e-72, Method: Compositional matrix adjust.
 Identities = 93/154 (60%), Positives = 115/154 (75%), Gaps = 6/154 (4%)
 Frame = -3

Query  570  NWLCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPR  391
            + + +PSD+HFWF RP+IVL LIHFILFQNAFEIAFFFWIL  +GFDSCIM    FI+PR
Sbjct  348  DLVVKPSDDHFWFRRPRIVLNLIHFILFQNAFEIAFFFWILTTFGFDSCIMDQFSFIVPR  407

Query  390  LVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFG  211
            LVIGV+IQ+LCSYSTLP+YAIVTQMG++FKK+IFDEH+Q GL+ WAQK K+RKG      
Sbjct  408  LVIGVVIQLLCSYSTLPLYAIVTQMGSYFKKAIFDEHVQEGLMDWAQKVKRRKG-----N  462

Query  210  GINHGGALTDGSSTGVQMGG-VGRKESGSTDGAS  112
            G+       D  S  +++   V + ES   +G S
Sbjct  463  GLVRSSQGQDEPSRKIELQKLVQQTESDLEEGRS  496


 Score =   108 bits (269),  Expect(2) = 5e-72, Method: Compositional matrix adjust.
 Identities = 51/60 (85%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            WVFV IFLLLN+NGWHTYFWI+FIP ILLLAVGTKLEH+I QLAHEVAEKH AI+G+LVV
Sbjct  292  WVFVFIFLLLNVNGWHTYFWISFIPLILLLAVGTKLEHIITQLAHEVAEKHSAIQGDLVV  351



>ref|XP_006655330.1| PREDICTED: MLO-like protein 1-like [Oryza brachyantha]
Length=509

 Score =   191 bits (484),  Expect(2) = 8e-72, Method: Compositional matrix adjust.
 Identities = 84/112 (75%), Positives = 102/112 (91%), Gaps = 0/112 (0%)
 Frame = -3

Query  558  QPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIG  379
            +PSD+HFW G+P+IVL+LIHFILFQNAFEIAFFFWIL  YGF+SCIMG V FI+PRLVIG
Sbjct  349  KPSDDHFWLGKPRIVLYLIHFILFQNAFEIAFFFWILTTYGFNSCIMGQVGFIVPRLVIG  408

Query  378  VIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            VIIQ+LCSYST+P+YA+VTQMG+ +KK IF++HIQ G++GWAQK K RKGL+
Sbjct  409  VIIQLLCSYSTMPLYAVVTQMGSFYKKEIFNDHIQQGVLGWAQKVKMRKGLR  460


 Score =   107 bits (268),  Expect(2) = 8e-72, Method: Compositional matrix adjust.
 Identities = 52/60 (87%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            WVFVVIFLLLN+NGWHTYFWIAF+P ILLLAVGTKLEHVI QLAH+VAEK+ AIEG+LVV
Sbjct  289  WVFVVIFLLLNVNGWHTYFWIAFLPLILLLAVGTKLEHVIAQLAHDVAEKNSAIEGDLVV  348



>ref|XP_010908317.1| PREDICTED: MLO-like protein 1 isoform X1 [Elaeis guineensis]
Length=498

 Score =   195 bits (495),  Expect(2) = 8e-72, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 117/148 (79%), Gaps = 5/148 (3%)
 Frame = -3

Query  570  NWLCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPR  391
            + + +PSD+HFWF RP++VL+L+HFILFQNAFEIAFFFWIL  +G DSC++ HV F+IPR
Sbjct  342  DLVVKPSDDHFWFHRPRLVLYLVHFILFQNAFEIAFFFWILTTFGLDSCMLDHVGFVIPR  401

Query  390  LVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKA--A  217
            LVIGVIIQ+LCSYSTLP+YAIV+QMG+ FKK+IFDEH+Q GLV WA+K K+RKG K    
Sbjct  402  LVIGVIIQLLCSYSTLPLYAIVSQMGSSFKKAIFDEHVQEGLVSWAEKVKRRKGAKVGNE  461

Query  216  FGGINHGGALTDGSSTGVQMGGVGRKES  133
              G++   A    SS  ++M G+ RK+ 
Sbjct  462  LAGLSRRSA---ESSVKIEMQGLVRKKE  486


 Score =   103 bits (257),  Expect(2) = 8e-72, Method: Compositional matrix adjust.
 Identities = 48/60 (80%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FV+IF++LN+NGWHT+FWIAFIP ILLLA+GTKLEHVI QLA EVAEKH AIEG+LVV
Sbjct  286  WIFVIIFMVLNVNGWHTFFWIAFIPLILLLALGTKLEHVITQLAREVAEKHSAIEGDLVV  345



>ref|XP_008375689.1| PREDICTED: MLO-like protein 1 [Malus domestica]
Length=417

 Score =   191 bits (484),  Expect(2) = 1e-71, Method: Compositional matrix adjust.
 Identities = 88/112 (79%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + QPSD+HFWFG+P+ VLFLIH ILFQNAFE+AFFFWI VQYGF SCIMG V++I+PRLV
Sbjct  277  IVQPSDKHFWFGKPKFVLFLIHLILFQNAFEMAFFFWIWVQYGFTSCIMGKVRYIVPRLV  336

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKG  229
            IGV IQVLCSYSTLP+YAIVTQMGT FKK+IFDE I+ GL+GWAQKAK+RK 
Sbjct  337  IGVFIQVLCSYSTLPLYAIVTQMGTKFKKAIFDEGIRSGLIGWAQKAKKRKA  388


 Score =   107 bits (266),  Expect(2) = 1e-71, Method: Compositional matrix adjust.
 Identities = 48/60 (80%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVVIF+L+N++GWH YFWIAFIPF LLLAVGTKL+HVI QLAHEVAEKH+A+EGEL+V
Sbjct  219  WIFVVIFMLMNVDGWHAYFWIAFIPFFLLLAVGTKLQHVITQLAHEVAEKHIAVEGELIV  278



>ref|XP_009361360.1| PREDICTED: MLO-like protein 1 [Pyrus x bretschneideri]
Length=489

 Score =   191 bits (484),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 88/112 (79%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + QPSD+HFWFG+P+ VLFLIH ILFQNAFE+AFFFWI VQYGF SCIMG V++I+PRLV
Sbjct  349  IVQPSDKHFWFGKPKFVLFLIHLILFQNAFEMAFFFWIWVQYGFTSCIMGKVRYIVPRLV  408

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKG  229
            IGV IQVLCSYSTLP+YAIVTQMGT FKK+IFDE I+ GL+GWAQKAK+RK 
Sbjct  409  IGVFIQVLCSYSTLPLYAIVTQMGTKFKKAIFDEGIRSGLIGWAQKAKKRKA  460


 Score =   106 bits (265),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 48/60 (80%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVVIF+L+N++GWH YFWIAFIPF LLLAVGTKL+HVI QLAHEVAEKH+A+EGEL+V
Sbjct  291  WIFVVIFMLMNVDGWHAYFWIAFIPFFLLLAVGTKLQHVITQLAHEVAEKHIAVEGELIV  350



>ref|XP_008344996.1| PREDICTED: MLO-like protein 1 isoform X1 [Malus domestica]
 ref|XP_008345003.1| PREDICTED: MLO-like protein 1 isoform X1 [Malus domestica]
Length=466

 Score =   191 bits (485),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 88/112 (79%), Positives = 102/112 (91%), Gaps = 0/112 (0%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + QPSD+HFWFG+P+ VLFLIHFILFQNAFE+AFFFWI VQYGF SCIMG V +I+PRLV
Sbjct  350  IVQPSDKHFWFGKPKFVLFLIHFILFQNAFEMAFFFWIWVQYGFTSCIMGKVXYIVPRLV  409

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKG  229
            IGV IQVLCSYSTLP+YAIVTQMGT+FKK++FDE+I+ GLVGWAQ AK+RK 
Sbjct  410  IGVFIQVLCSYSTLPLYAIVTQMGTNFKKAMFDENIRSGLVGWAQXAKRRKA  461


 Score =   106 bits (264),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 48/60 (80%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVV+F+LLN++GWH YFWIAF+PF LLLAVGTKL+HVI QLAHEVAEKH+AIEGEL+V
Sbjct  292  WIFVVLFMLLNVDGWHAYFWIAFVPFFLLLAVGTKLQHVITQLAHEVAEKHIAIEGELIV  351



>ref|XP_008375669.1| PREDICTED: MLO-like protein 1 [Malus domestica]
Length=489

 Score =   190 bits (483),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 88/112 (79%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + QPSD+HFWFG+P+ VLFLIH ILFQNAFE+AFFFWI VQYGF SCIMG V++I+PRLV
Sbjct  349  IVQPSDKHFWFGKPKFVLFLIHLILFQNAFEMAFFFWIWVQYGFTSCIMGKVRYIVPRLV  408

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKG  229
            IGV IQVLCSYSTLP+YAIVTQMGT FKK+IFDE I+ GL+GWAQKAK+RK 
Sbjct  409  IGVFIQVLCSYSTLPLYAIVTQMGTKFKKAIFDEGIRSGLIGWAQKAKKRKA  460


 Score =   106 bits (265),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 48/60 (80%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVVIF+L+N++GWH YFWIAFIPF LLLAVGTKL+HVI QLAHEVAEKH+A+EGEL+V
Sbjct  291  WIFVVIFMLMNVDGWHAYFWIAFIPFFLLLAVGTKLQHVITQLAHEVAEKHIAVEGELIV  350



>gb|KHG04571.1| MLO-like protein 1 [Gossypium arboreum]
Length=485

 Score =   203 bits (517),  Expect(2) = 7e-71, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 119/146 (82%), Gaps = 1/146 (1%)
 Frame = -3

Query  558  QPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIG  379
            QPSD+HFWF +P+IVLFLIHFILFQNAFEIAFFFWI VQ+GFDSCIMG V++I+PRLVIG
Sbjct  333  QPSDDHFWFNKPRIVLFLIHFILFQNAFEIAFFFWIWVQFGFDSCIMGQVRYIVPRLVIG  392

Query  378  VIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGINH  199
            V IQVLCSYSTLP+YAIVTQMG+ FKKSIFDEH+QVGLVGWAQK K++KGLKAA G    
Sbjct  393  VFIQVLCSYSTLPLYAIVTQMGSSFKKSIFDEHVQVGLVGWAQKVKKKKGLKAATGSAAQ  452

Query  198  GGALTDGSSTGVQMGGVGRKESGSTD  121
              +     S  +QMG V R  S   +
Sbjct  453  ENS-EQNPSVAIQMGRVLRNASAPEE  477


 Score = 91.7 bits (226),  Expect(2) = 7e-71, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -2

Query  715  LLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            LL    WHTYFWIAFIPFILLLAVGTKLEHVI QLAHEVAEKHVAIEGELVV
Sbjct  281  LLVAECWHTYFWIAFIPFILLLAVGTKLEHVITQLAHEVAEKHVAIEGELVV  332



>ref|XP_003636203.1| MLO-like protein [Medicago truncatula]
Length=484

 Score =   184 bits (466),  Expect(2) = 7e-71, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 113/144 (78%), Gaps = 13/144 (9%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + QPSD+HFWF RP+IVLFLIH ILFQN+FEI       +QYGF+SCIMG VKFI PRLV
Sbjct  341  IVQPSDDHFWFHRPRIVLFLIHLILFQNSFEI-------IQYGFNSCIMGQVKFIYPRLV  393

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGI  205
            +GV IQVLCSYSTLP+YAIVTQMGTHFK+SIFD+ +Q  L+GWAQKAK +KGL+   G  
Sbjct  394  MGVFIQVLCSYSTLPLYAIVTQMGTHFKRSIFDDQVQTRLIGWAQKAK-KKGLR---GDS  449

Query  204  NHG--GALTDGSSTGVQMGGVGRK  139
            NH   G+  +G ST +Q+G + R+
Sbjct  450  NHSVQGSSHNGGSTNIQLGSMFRR  473


 Score =   111 bits (277),  Expect(2) = 7e-71, Method: Compositional matrix adjust.
 Identities = 54/60 (90%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVVIFLLLN+NGWHTYFWIAFIP ILLLAVGTKLEHVIIQLAHEVAEKH AI+GEL+V
Sbjct  283  WIFVVIFLLLNVNGWHTYFWIAFIPVILLLAVGTKLEHVIIQLAHEVAEKHSAIQGELIV  342



>ref|XP_004962063.1| PREDICTED: MLO-like protein 1-like isoform X1 [Setaria italica]
Length=485

 Score =   191 bits (486),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 83/112 (74%), Positives = 103/112 (92%), Gaps = 0/112 (0%)
 Frame = -3

Query  558  QPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIG  379
            +PSDEHFWFGRP+IVL LIHFILFQNAFE++FFFWIL+ YGF SC M HV F++PRLV+G
Sbjct  351  KPSDEHFWFGRPRIVLHLIHFILFQNAFELSFFFWILMTYGFHSCFMDHVGFLVPRLVLG  410

Query  378  VIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            V+IQ+LCSYSTLP+YAIVTQMG+++KK IF+EH+Q G++GWA+KAK+R GLK
Sbjct  411  VVIQLLCSYSTLPLYAIVTQMGSYYKKEIFNEHVQQGVLGWAEKAKKRSGLK  462


 Score =   102 bits (255),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            WVFVVIFLLLN+NGWHTYFW+AF+P +LL+A+GTKLEHVI QLA++VA +H AIEG+LVV
Sbjct  291  WVFVVIFLLLNVNGWHTYFWMAFLPLVLLMAIGTKLEHVIAQLAYDVASRHAAIEGDLVV  350



>ref|XP_008802152.1| PREDICTED: MLO-like protein 1 [Phoenix dactylifera]
Length=230

 Score =   191 bits (484),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 89/131 (68%), Positives = 104/131 (79%), Gaps = 0/131 (0%)
 Frame = -3

Query  555  PSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIGV  376
            PSD+ FWF RP+IVLFLIHFILFQNAFEIAFFFW+L  Y FDSCIMG   FIIPRLVI V
Sbjct  67   PSDDLFWFHRPKIVLFLIHFILFQNAFEIAFFFWVLTTYNFDSCIMGQAGFIIPRLVISV  126

Query  375  IIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGINHG  196
            +IQ+LCSYSTLP+YAIVTQMG+ FKK+IFDE++Q GLVGWAQ+ K+RKG++         
Sbjct  127  LIQILCSYSTLPLYAIVTQMGSSFKKAIFDENVQEGLVGWAQQVKKRKGMRVMNRESGST  186

Query  195  GALTDGSSTGV  163
              L  G+ T V
Sbjct  187  STLQSGNGTSV  197


 Score =   103 bits (257),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 47/60 (78%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FV++FLLL++NGWH YFWI+FIP ILLLA+GTKLEH+I QLAHEVAEKH AIEG+LVV
Sbjct  6    WIFVMVFLLLDVNGWHAYFWISFIPLILLLALGTKLEHIITQLAHEVAEKHSAIEGDLVV  65



>ref|XP_008788294.1| PREDICTED: MLO-like protein 1 [Phoenix dactylifera]
Length=490

 Score =   190 bits (483),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 115/148 (78%), Gaps = 6/148 (4%)
 Frame = -3

Query  570  NWLCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPR  391
            + + +PSD HFWF RP+IVL+LIHFILFQNAFEIAFFFWIL  YGF SCIM HV FIIPR
Sbjct  346  DLVVKPSDNHFWFHRPRIVLYLIHFILFQNAFEIAFFFWILTTYGFRSCIMDHVGFIIPR  405

Query  390  LVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFG  211
            LVIGVIIQ+LCSYSTLP+YAIV+QMG+ FKK+IFD+H++  LVGWA+K K+RK  K   G
Sbjct  406  LVIGVIIQLLCSYSTLPLYAIVSQMGSSFKKAIFDDHVREDLVGWAEKVKKRKVAKMGNG  465

Query  210  GINHGGALTDGSSTGVQM---GGVGRKE  136
               H G     + + V++   G VG+KE
Sbjct  466  ---HAGLSRTPAESYVKIEMQGVVGQKE  490


 Score =   103 bits (257),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 48/60 (80%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVVIF++LN+NGWHT+FW+AFIP ILLLA+GTKLEHVI QLA+EVAEKH AIEG+LVV
Sbjct  290  WIFVVIFMVLNVNGWHTFFWVAFIPLILLLALGTKLEHVIAQLANEVAEKHSAIEGDLVV  349



>ref|XP_002319210.2| hypothetical protein POPTR_0013s06680g [Populus trichocarpa]
 gb|EEE95133.2| hypothetical protein POPTR_0013s06680g [Populus trichocarpa]
Length=388

 Score =   192 bits (489),  Expect(2) = 3e-70, Method: Compositional matrix adjust.
 Identities = 92/158 (58%), Positives = 114/158 (72%), Gaps = 6/158 (4%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + QPSD HFWF RP  V  LIHFILFQNAFEIAFFFWI VQYGFDSCIMG +K+I+PRL+
Sbjct  216  VVQPSDNHFWFHRPGFVHLLIHFILFQNAFEIAFFFWIWVQYGFDSCIMGQIKYIVPRLI  275

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGI  205
            IGV IQVLCSYSTLP+YAIV+QMG+ FKKSIF+EH+Q GLVGWAQK K+++G K +  G 
Sbjct  276  IGVFIQVLCSYSTLPLYAIVSQMGSTFKKSIFEEHVQAGLVGWAQKVKKKRGQKGSTEGS  335

Query  204  NHGGALTDGSSTGVQM------GGVGRKESGSTDGASV  109
            +   +        +           G  +S S +G+++
Sbjct  336  SEASSHVSAGGLLLGRLKGLKEANEGSAQSSSHEGSTL  373


 Score =   100 bits (250),  Expect(2) = 3e-70, Method: Compositional matrix adjust.
 Identities = 54/60 (90%), Positives = 55/60 (92%), Gaps = 3/60 (5%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            WVFV   LLLNINGWHTYFWIAFIP ILLLAVGTKLEHVI QLA+EVAEKHVAIEGELVV
Sbjct  161  WVFV---LLLNINGWHTYFWIAFIPLILLLAVGTKLEHVINQLAYEVAEKHVAIEGELVV  217



>dbj|BAK08220.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=483

 Score =   189 bits (481),  Expect(2) = 3e-70, Method: Compositional matrix adjust.
 Identities = 84/111 (76%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = -3

Query  558  QPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIG  379
             PSDEHFW G+P+++L+LIHFILFQNAFEIA FFWIL  YGF+SCIM HV FI+PRLVIG
Sbjct  335  NPSDEHFWCGKPRVILYLIHFILFQNAFEIALFFWILTTYGFNSCIMDHVPFIVPRLVIG  394

Query  378  VIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGL  226
            V+IQ+LCSYSTLP+YAIVTQMGT +KK IFDEH+Q GL+GWAQKA+ R  L
Sbjct  395  VVIQLLCSYSTLPLYAIVTQMGTFYKKEIFDEHVQQGLLGWAQKARMRTEL  445


 Score =   103 bits (258),  Expect(2) = 3e-70, Method: Compositional matrix adjust.
 Identities = 48/60 (80%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVVIF+LLN+NGWHTYFWI+F+P ILLLAVGTKLEHVI QLA +V EKH AIEG+LVV
Sbjct  275  WIFVVIFMLLNVNGWHTYFWISFVPLILLLAVGTKLEHVIDQLAQDVVEKHSAIEGDLVV  334



>ref|XP_006375950.1| hypothetical protein POPTR_0013s06680g [Populus trichocarpa]
 gb|ERP53747.1| hypothetical protein POPTR_0013s06680g [Populus trichocarpa]
Length=394

 Score =   192 bits (488),  Expect(2) = 3e-70, Method: Compositional matrix adjust.
 Identities = 92/158 (58%), Positives = 114/158 (72%), Gaps = 6/158 (4%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + QPSD HFWF RP  V  LIHFILFQNAFEIAFFFWI VQYGFDSCIMG +K+I+PRL+
Sbjct  222  VVQPSDNHFWFHRPGFVHLLIHFILFQNAFEIAFFFWIWVQYGFDSCIMGQIKYIVPRLI  281

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGI  205
            IGV IQVLCSYSTLP+YAIV+QMG+ FKKSIF+EH+Q GLVGWAQK K+++G K +  G 
Sbjct  282  IGVFIQVLCSYSTLPLYAIVSQMGSTFKKSIFEEHVQAGLVGWAQKVKKKRGQKGSTEGS  341

Query  204  NHGGALTDGSSTGVQM------GGVGRKESGSTDGASV  109
            +   +        +           G  +S S +G+++
Sbjct  342  SEASSHVSAGGLLLGRLKGLKEANEGSAQSSSHEGSTL  379


 Score =   100 bits (250),  Expect(2) = 3e-70, Method: Compositional matrix adjust.
 Identities = 54/60 (90%), Positives = 55/60 (92%), Gaps = 3/60 (5%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            WVFV   LLLNINGWHTYFWIAFIP ILLLAVGTKLEHVI QLA+EVAEKHVAIEGELVV
Sbjct  167  WVFV---LLLNINGWHTYFWIAFIPLILLLAVGTKLEHVINQLAYEVAEKHVAIEGELVV  223



>ref|XP_009794450.1| PREDICTED: MLO-like protein 1 isoform X1 [Nicotiana sylvestris]
Length=494

 Score =   177 bits (449),  Expect(2) = 6e-70, Method: Compositional matrix adjust.
 Identities = 94/135 (70%), Positives = 106/135 (79%), Gaps = 2/135 (1%)
 Frame = -3

Query  558  QPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIG  379
            QPSD HFWF RPQIVLFLIHFILFQNAFEIAFFFWIL QYGF SCIMG   F+ PRLVIG
Sbjct  350  QPSDSHFWFDRPQIVLFLIHFILFQNAFEIAFFFWILFQYGFYSCIMGKYVFVAPRLVIG  409

Query  378  VIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGINH  199
            V IQVLCSYSTLP+YA+VTQMG+H+KKS+FD+H+Q  L+ WA+K K++K  KAA  G NH
Sbjct  410  VFIQVLCSYSTLPLYALVTQMGSHYKKSMFDDHVQACLIEWAEKVKKKKAQKAARDGSNH  469

Query  198  --GGALTDGSSTGVQ  160
                  T GS   V 
Sbjct  470  PTDDGFTIGSPESVH  484


 Score =   115 bits (287),  Expect(2) = 6e-70, Method: Compositional matrix adjust.
 Identities = 55/60 (92%), Positives = 60/60 (100%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FV++FLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHE+AEKHVA+EGELVV
Sbjct  290  WIFVILFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEIAEKHVAVEGELVV  349



>gb|ABY77906.1| mildew resistance locus o 15 [Vitis vinifera]
 emb|CBI24772.3| unnamed protein product [Vitis vinifera]
Length=506

 Score =   186 bits (471),  Expect(2) = 7e-70, Method: Compositional matrix adjust.
 Identities = 96/164 (59%), Positives = 111/164 (68%), Gaps = 2/164 (1%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + +PSD+HFWF RPQIVLFLI  ILFQN+FE+AFFFWI VQYGFDSCIMG + FIIPRL 
Sbjct  345  VVRPSDDHFWFHRPQIVLFLIQIILFQNSFELAFFFWIWVQYGFDSCIMGQLGFIIPRLF  404

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGI  205
            IG  +Q LCSYSTLP+YAIV QMG+ FK+SIF+EHIQ GLV WA KAK + G K    G 
Sbjct  405  IGAFVQFLCSYSTLPLYAIVAQMGSSFKRSIFEEHIQHGLVEWAHKAKLKTGFKKNANGP  464

Query  204  NHGGALTDGSSTGVQMGGVGRKESGSTDGASVRALQQMGGDGSK  73
            +  G   +     VQ+  V  KES    G         G  GSK
Sbjct  465  SQVGP-KEVPPPAVQLAEV-VKESAEEKGNVGEIHPATGSGGSK  506


 Score =   106 bits (264),  Expect(2) = 7e-70, Method: Compositional matrix adjust.
 Identities = 51/60 (85%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVV+FLLLN+ GWH YFWIAFIPFILLL VGTKLEHV  QLAHEVAEKHVAIEG+LVV
Sbjct  287  WIFVVVFLLLNVKGWHAYFWIAFIPFILLLLVGTKLEHVTTQLAHEVAEKHVAIEGDLVV  346



>ref|NP_001267997.1| mildew resistance locus o 15 [Vitis vinifera]
 gb|ACF25912.1| MLO-like protein 7 [Vitis vinifera]
Length=506

 Score =   185 bits (470),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 96/164 (59%), Positives = 111/164 (68%), Gaps = 2/164 (1%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + +PSD+HFWF RPQIVLFLI  ILFQN+FE+AFFFWI VQYGFDSCIMG + FIIPRL 
Sbjct  345  VVRPSDDHFWFHRPQIVLFLIQIILFQNSFELAFFFWIWVQYGFDSCIMGQLGFIIPRLF  404

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGI  205
            IG  +Q LCSYSTLP+YAIV QMG+ FK+SIF+EHIQ GLV WA KAK + G K    G 
Sbjct  405  IGAFVQFLCSYSTLPLYAIVAQMGSSFKRSIFEEHIQHGLVEWAHKAKLKTGFKKNANGP  464

Query  204  NHGGALTDGSSTGVQMGGVGRKESGSTDGASVRALQQMGGDGSK  73
            +  G   +     VQ+  V  KES    G         G  GSK
Sbjct  465  SQVGP-KEVPPXAVQLAEV-VKESAEEKGNVGEIHPATGSGGSK  506


 Score =   106 bits (264),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 51/60 (85%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVV+FLLLN+ GWH YFWIAFIPFILLL VGTKLEHV  QLAHEVAEKHVAIEG+LVV
Sbjct  287  WIFVVVFLLLNVKGWHAYFWIAFIPFILLLLVGTKLEHVTTQLAHEVAEKHVAIEGDLVV  346



>dbj|BAJ24148.1| seven trans-membrane protein [Triticum aestivum]
Length=499

 Score =   184 bits (467),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 96/151 (64%), Positives = 119/151 (79%), Gaps = 4/151 (3%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + +PSD+HFWFGRP+IVLFLIHFILFQNAFEIAFFFWIL  YGF+SCIMG V FI+PRLV
Sbjct  347  IVKPSDDHFWFGRPRIVLFLIHFILFQNAFEIAFFFWILTTYGFNSCIMGQVGFIVPRLV  406

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGI  205
            IG+IIQ+LCSYSTLP+YAIVTQMG+ +KK IF+EH+Q G++GWAQKAK +KG K + G  
Sbjct  407  IGLIIQLLCSYSTLPLYAIVTQMGSFYKKEIFNEHVQQGVLGWAQKAKMKKGFKKSNGAA  466

Query  204  NHGGAL-TDGSSTGVQMGGVGRKESGSTDGA  115
                 + + G S  V+M    R+ +G  + A
Sbjct  467  ESTSPVGSAGPSAKVEM---VRRPAGQGNDA  494


 Score =   107 bits (267),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 51/60 (85%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            WVFVVIFLLLN+NGWHTYFWIAFIP ILLLAVGTKLEHVI QLA +VAEKH A+EG+L+V
Sbjct  289  WVFVVIFLLLNVNGWHTYFWIAFIPLILLLAVGTKLEHVIAQLAQDVAEKHSAVEGDLIV  348



>ref|XP_008243092.1| PREDICTED: MLO-like protein 1 [Prunus mume]
Length=532

 Score =   180 bits (456),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 111/147 (76%), Gaps = 1/147 (1%)
 Frame = -3

Query  558  QPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIG  379
            QPSD+HFWF RP++VL LI  ILFQN+FE+AFFFWI VQY FDSCIMG V +IIPRLVIG
Sbjct  354  QPSDDHFWFHRPRLVLLLIQIILFQNSFELAFFFWIWVQYSFDSCIMGQVGYIIPRLVIG  413

Query  378  VIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGINH  199
              IQ +CSYSTLP+YAIVTQMG+ FKK+IF+EHIQVGLVGWA+ AK+ K L+ A  G + 
Sbjct  414  AFIQFVCSYSTLPLYAIVTQMGSSFKKAIFEEHIQVGLVGWARSAKKNKALRKAANGSSS  473

Query  198  GGALTDGSSTGVQMGGV-GRKESGSTD  121
                   +S  VQ+  V G KES   D
Sbjct  474  SQGGPKEASQTVQLAQVAGHKESSRED  500


 Score =   111 bits (277),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 53/60 (88%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVVIFLLLN++GWH YFWIAFIPFILLLAVGTKLEHVI QLAHEVAEKH+AIEG+LVV
Sbjct  294  WIFVVIFLLLNVSGWHAYFWIAFIPFILLLAVGTKLEHVITQLAHEVAEKHIAIEGDLVV  353



>ref|XP_004962062.1| PREDICTED: MLO-like protein 1-like [Setaria italica]
Length=494

 Score =   202 bits (515),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 94/141 (67%), Positives = 116/141 (82%), Gaps = 1/141 (1%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + +PSD+HFWFG+P+++LFLIHFILFQNAFEIAFFFWIL  YGFDSCIMG V+FI+PRLV
Sbjct  344  VVKPSDDHFWFGKPRVILFLIHFILFQNAFEIAFFFWILSTYGFDSCIMGQVRFIVPRLV  403

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK-AAFGG  208
            IGV+IQ+LCSYSTLP+YAIVTQMG+ +KK IF+EH+Q G++GWAQK K RKGLK AA   
Sbjct  404  IGVLIQLLCSYSTLPLYAIVTQMGSCYKKEIFNEHVQQGVLGWAQKVKMRKGLKGAANKA  463

Query  207  INHGGALTDGSSTGVQMGGVG  145
             +   A + G S  ++M   G
Sbjct  464  ESTSNADSAGPSATIEMAKAG  484


 Score = 88.6 bits (218),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 51/60 (85%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            WVFVVIFLLLN+NGWHTYFWIAF+P  LLLA+GTKLEHVI QLAH+VAEKH AIEGE+VV
Sbjct  286  WVFVVIFLLLNVNGWHTYFWIAFLPLFLLLAIGTKLEHVIAQLAHDVAEKHTAIEGEVVV  345



>gb|KDP29534.1| hypothetical protein JCGZ_19247 [Jatropha curcas]
Length=497

 Score =   183 bits (465),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 95/146 (65%), Positives = 113/146 (77%), Gaps = 1/146 (1%)
 Frame = -3

Query  558  QPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIG  379
            QPSD+HFWF RPQIV+ LIH ILFQN+FE+AFFFWI  QYGFDSCIMG V +IIPRL+IG
Sbjct  342  QPSDDHFWFHRPQIVIILIHIILFQNSFELAFFFWIWAQYGFDSCIMGQVGYIIPRLIIG  401

Query  378  VIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGINH  199
              +Q +CSYSTLP+YAIVTQMG+ FKK+IFDEHIQVGLVGWA++AK+   L+ A  G + 
Sbjct  402  AFVQFVCSYSTLPLYAIVTQMGSSFKKAIFDEHIQVGLVGWAKQAKKNTVLRKAAHGSSQ  461

Query  198  GGALTDGSSTGVQMGGVGRKESGSTD  121
             G   D S   VQ+  +G KES   D
Sbjct  462  VGHKED-SPPAVQLANIGDKESAMED  486


 Score =   107 bits (267),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 51/60 (85%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FV IFLLLNI GWHTYFWIAF+PFILLLAVGTKLEHVI QLAHEVAEKHVA++G+LV+
Sbjct  282  WLFVFIFLLLNIAGWHTYFWIAFVPFILLLAVGTKLEHVITQLAHEVAEKHVAVKGDLVI  341



>ref|XP_004244787.1| PREDICTED: MLO-like protein 1 [Solanum lycopersicum]
Length=504

 Score =   188 bits (478),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 92/149 (62%), Positives = 109/149 (73%), Gaps = 5/149 (3%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + +PSD+HFWF RP++VLFLIH ILFQN+FEIAFFFWI  QY F+SCIMG V +IIPRLV
Sbjct  344  VVKPSDDHFWFHRPRLVLFLIHIILFQNSFEIAFFFWIWAQYRFNSCIMGQVGYIIPRLV  403

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGI  205
            IGV +Q LCSYSTLP+YAIVTQMG+ FKK IFDEHIQ GL+ WA KA++R     A  G 
Sbjct  404  IGVFVQFLCSYSTLPLYAIVTQMGSSFKKEIFDEHIQEGLLVWANKARRR-----AVNGS  458

Query  204  NHGGALTDGSSTGVQMGGVGRKESGSTDG  118
            N        S   VQ+  VG +ES   +G
Sbjct  459  NQVEHKESTSLMSVQLAQVGTQESAMEEG  487


 Score =   102 bits (254),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 49/60 (82%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            WVFVV+FLLLN++GWHTYFWIAF+PF LLLAVGTKLEHVI QLA EVA KH+A+EG+LVV
Sbjct  286  WVFVVLFLLLNVHGWHTYFWIAFVPFGLLLAVGTKLEHVITQLAGEVAAKHIAVEGDLVV  345



>ref|XP_006478504.1| PREDICTED: MLO-like protein 1-like [Citrus sinensis]
Length=510

 Score =   185 bits (470),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 86/146 (59%), Positives = 109/146 (75%), Gaps = 0/146 (0%)
 Frame = -3

Query  558  QPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIG  379
            +PSD+HFWF +P++VL LIH ILFQN+FEIA F WI VQY F SCIMG   +IIPRL+IG
Sbjct  349  KPSDDHFWFRKPRLVLVLIHIILFQNSFEIAVFLWICVQYKFHSCIMGPYGYIIPRLIIG  408

Query  378  VIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGINH  199
            + +Q  CSYSTLP+YAIVTQMG+ FKKSIFDEHIQ GLVGWA++AK+  GL+ A    ++
Sbjct  409  LFVQFFCSYSTLPLYAIVTQMGSSFKKSIFDEHIQEGLVGWAKQAKKNMGLRKAAAKGSN  468

Query  198  GGALTDGSSTGVQMGGVGRKESGSTD  121
                 D SS  +QM  V  +++ + D
Sbjct  469  QVVHKDDSSASIQMTNVQSEQNSAED  494


 Score =   105 bits (262),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 50/60 (83%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            WVFVV+FLLLN++ WH YFWI+FIPFILLLAVGTKLEH+I QLAHEVAEKHVAIEG+L V
Sbjct  289  WVFVVVFLLLNVHNWHAYFWISFIPFILLLAVGTKLEHIITQLAHEVAEKHVAIEGDLYV  348



>ref|XP_003564808.1| PREDICTED: MLO-like protein 1 [Brachypodium distachyon]
Length=500

 Score =   196 bits (499),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = -3

Query  558  QPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIG  379
             PSDEHFW  RP+++L+LIHFILFQNAFEIA FFW+L  YGF+SCIM HV FI+PRLVIG
Sbjct  352  NPSDEHFWCARPRVILYLIHFILFQNAFEIALFFWMLTTYGFNSCIMDHVPFIVPRLVIG  411

Query  378  VIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAA  217
            VIIQ+LCSYSTLP+YAIVTQMGT FKK IFDEH+Q GLVGWAQKAK+RK  K A
Sbjct  412  VIIQLLCSYSTLPLYAIVTQMGTFFKKEIFDEHVQQGLVGWAQKAKRRKESKEA  465


 Score = 94.0 bits (232),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 48/60 (80%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVVIF+LLN+NGWHTYFWI+F+P +LLLAVGTKLEHVI QLA EVAEKH +IEG+LVV
Sbjct  292  WLFVVIFMLLNVNGWHTYFWISFLPLLLLLAVGTKLEHVIAQLAQEVAEKHSSIEGDLVV  351



>ref|XP_002441109.1| hypothetical protein SORBIDRAFT_09g020570 [Sorghum bicolor]
 gb|EES19539.1| hypothetical protein SORBIDRAFT_09g020570 [Sorghum bicolor]
Length=498

 Score =   202 bits (515),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 97/160 (61%), Positives = 119/160 (74%), Gaps = 7/160 (4%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + +PSDEHFWFG+P+I+L+LIHFILFQNAFEIAFFFWIL  YGFDSCIMG V+FI+PRLV
Sbjct  345  IVKPSDEHFWFGKPRIILYLIHFILFQNAFEIAFFFWILSTYGFDSCIMGQVRFIVPRLV  404

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK-AAFGG  208
            IGV+IQ+LCSYSTLP+YAIVTQMG+ +KK IF+EH+Q G++GWAQK K RKGLK AA   
Sbjct  405  IGVVIQLLCSYSTLPLYAIVTQMGSCYKKEIFNEHVQQGVLGWAQKVKMRKGLKGAAAAS  464

Query  207  INHGGALTDGSSTGVQMGGVGRKESGSTDGASVRALQQMG  88
             N      D +   V++      E    +G  V  +   G
Sbjct  465  KNESTINADSAGPSVKI------EMAKAEGEDVEVVGNTG  498


 Score = 87.4 bits (215),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 49/60 (82%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            WVFVVIFLLLN+NGWHTYFWIAF+P  LLLA+GTKLEHVI QLAH+VAEKH AIEG+++V
Sbjct  287  WVFVVIFLLLNVNGWHTYFWIAFLPLFLLLAIGTKLEHVIAQLAHDVAEKHTAIEGDVIV  346



>ref|XP_006441977.1| hypothetical protein CICLE_v10019784mg [Citrus clementina]
 gb|ESR55217.1| hypothetical protein CICLE_v10019784mg [Citrus clementina]
Length=508

 Score =   184 bits (466),  Expect(2) = 4e-69, Method: Compositional matrix adjust.
 Identities = 86/146 (59%), Positives = 108/146 (74%), Gaps = 0/146 (0%)
 Frame = -3

Query  558  QPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIG  379
            +PSD+HFWF +P++VL LIH ILFQN+FEIA F WI VQY F SCIMG   +IIPRL+IG
Sbjct  347  KPSDDHFWFRKPRLVLVLIHIILFQNSFEIAVFLWICVQYKFHSCIMGPYGYIIPRLIIG  406

Query  378  VIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGINH  199
            + +Q  CSYSTLP+YAIVTQMG+ FKKSIFDEHIQ GLVGWA++AK+  GL+ A    ++
Sbjct  407  LFVQFFCSYSTLPLYAIVTQMGSSFKKSIFDEHIQEGLVGWAKQAKKNMGLRKAAAKGSN  466

Query  198  GGALTDGSSTGVQMGGVGRKESGSTD  121
                 D SS   QM  V  +++ + D
Sbjct  467  QVVHKDDSSASTQMTNVQSEQNSAID  492


 Score =   105 bits (262),  Expect(2) = 4e-69, Method: Compositional matrix adjust.
 Identities = 50/60 (83%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            WVFVV+FLLLN++ WH YFWI+FIPFILLLAVGTKLEH+I QLAHEVAEKHVAIEG+L V
Sbjct  287  WVFVVVFLLLNVHNWHAYFWISFIPFILLLAVGTKLEHIITQLAHEVAEKHVAIEGDLYV  346



>ref|XP_007203635.1| hypothetical protein PRUPE_ppa004012mg [Prunus persica]
 gb|EMJ04834.1| hypothetical protein PRUPE_ppa004012mg [Prunus persica]
Length=535

 Score =   178 bits (451),  Expect(2) = 4e-69, Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 110/147 (75%), Gaps = 1/147 (1%)
 Frame = -3

Query  558  QPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIG  379
            QPSD+HFWF RP++VL LI  ILFQN+FE+AFFFWI VQY FDSCIMG V +IIPRLVIG
Sbjct  356  QPSDDHFWFHRPRLVLLLIQIILFQNSFELAFFFWIWVQYSFDSCIMGQVGYIIPRLVIG  415

Query  378  VIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGINH  199
              IQ +CSYSTLP+YAIVTQMG+ FKK+IF+EHIQ GLVGWA+ AK+ K L+ A  G + 
Sbjct  416  AFIQFVCSYSTLPLYAIVTQMGSSFKKAIFEEHIQEGLVGWARSAKKNKALRKAANGSSS  475

Query  198  GGALTDGSSTGVQMGGV-GRKESGSTD  121
                   +S  VQ+  V G KES   D
Sbjct  476  SQGGPKEASQTVQLAQVAGNKESSRED  502


 Score =   111 bits (277),  Expect(2) = 4e-69, Method: Compositional matrix adjust.
 Identities = 53/60 (88%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVVIFLLLN++GWH YFWIAFIPFILLLAVGTKLEHVI QLAHEVAEKH+AIEG+LVV
Sbjct  296  WIFVVIFLLLNVSGWHAYFWIAFIPFILLLAVGTKLEHVITQLAHEVAEKHIAIEGDLVV  355



>ref|XP_006366803.1| PREDICTED: MLO-like protein 1-like [Solanum tuberosum]
Length=507

 Score =   176 bits (446),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 90/102 (88%), Gaps = 0/102 (0%)
 Frame = -3

Query  555  PSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIGV  376
            PSD HFWF  PQI+LFLIHFILFQNAFEIAFFFWIL QYGF SCIMG   F+IPRLVIGV
Sbjct  365  PSDNHFWFDNPQIILFLIHFILFQNAFEIAFFFWILFQYGFHSCIMGKYVFVIPRLVIGV  424

Query  375  IIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQ  250
            IIQVLCSYSTLP+YA+VTQMG+H+KKS+FD H+Q  L+ WA+
Sbjct  425  IIQVLCSYSTLPLYALVTQMGSHYKKSMFDNHVQACLMEWAE  466


 Score =   112 bits (281),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 54/60 (90%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FV++FLLLNINGWHTYFWIAF PFILLLAVGTKLEHVI+QLAHE+AEKHVAIEGELVV
Sbjct  304  WIFVILFLLLNINGWHTYFWIAFFPFILLLAVGTKLEHVILQLAHEIAEKHVAIEGELVV  363



>ref|XP_006372313.1| hypothetical protein POPTR_0017s00470g [Populus trichocarpa]
 gb|ERP50110.1| hypothetical protein POPTR_0017s00470g [Populus trichocarpa]
Length=499

 Score =   178 bits (451),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 89/149 (60%), Positives = 111/149 (74%), Gaps = 0/149 (0%)
 Frame = -3

Query  558  QPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIG  379
            +PSD+HFWF +P+IVL LIH ILFQN+FE+AFFFWI VQYGFDSCIMG V +IIPRLVIG
Sbjct  342  RPSDDHFWFNKPKIVLLLIHIILFQNSFELAFFFWIWVQYGFDSCIMGQVGYIIPRLVIG  401

Query  378  VIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGINH  199
              +Q LCSYSTLP+YAIVTQMG+ FK+ IF+EHIQ GLVGWA++AK++ GL+      +H
Sbjct  402  AFVQFLCSYSTLPLYAIVTQMGSSFKREIFEEHIQEGLVGWAKQAKKKAGLRRTANESSH  461

Query  198  GGALTDGSSTGVQMGGVGRKESGSTDGAS  112
                    S  +QM   G +E+   +  S
Sbjct  462  NQVGPKEESPLIQMAKAGSRETAVEENKS  490


 Score =   109 bits (273),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 52/60 (87%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVVIFL LN++GWH YFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVA++G+LVV
Sbjct  282  WLFVVIFLCLNVSGWHAYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAVQGDLVV  341



>ref|XP_011014744.1| PREDICTED: MLO-like protein 1 [Populus euphratica]
Length=499

 Score =   179 bits (453),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 89/151 (59%), Positives = 113/151 (75%), Gaps = 0/151 (0%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + +PSD+HFWF +P+IVL LIH ILFQN+FE+AFFFWI VQYGFDSCIMG V +IIPRLV
Sbjct  340  VVRPSDDHFWFNKPKIVLLLIHIILFQNSFELAFFFWIWVQYGFDSCIMGQVGYIIPRLV  399

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGI  205
            IG  +Q LCSYSTLP+YAIVTQMG+ FK+ IF+E+IQ GLVGWA++AK++ GL+ A    
Sbjct  400  IGAFVQFLCSYSTLPLYAIVTQMGSSFKREIFEEYIQEGLVGWAKQAKKKAGLRRAANES  459

Query  204  NHGGALTDGSSTGVQMGGVGRKESGSTDGAS  112
            +H        S  +QM   G +E+   +  S
Sbjct  460  SHNQVSPKEESPLIQMAKAGSRETAVEENKS  490


 Score =   108 bits (269),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 52/60 (87%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVVIFL LN++GWH YFWIAFIPFILLLAVGTKLEHVIIQLA EVAEKHVA+EG+LVV
Sbjct  282  WLFVVIFLFLNVSGWHAYFWIAFIPFILLLAVGTKLEHVIIQLAREVAEKHVAVEGDLVV  341



>ref|XP_011004548.1| PREDICTED: MLO-like protein 1 [Populus euphratica]
 ref|XP_011004549.1| PREDICTED: MLO-like protein 1 [Populus euphratica]
 ref|XP_011004550.1| PREDICTED: MLO-like protein 1 [Populus euphratica]
Length=499

 Score =   179 bits (453),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 89/151 (59%), Positives = 113/151 (75%), Gaps = 0/151 (0%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + +PSD+HFWF +P+IVL LIH ILFQN+FE+AFFFWI VQYGFDSCIMG V +IIPRLV
Sbjct  340  VVRPSDDHFWFNKPKIVLLLIHIILFQNSFELAFFFWIWVQYGFDSCIMGQVGYIIPRLV  399

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGI  205
            IG  +Q LCSYSTLP+YAIVTQMG+ FK+ IF+E+IQ GLVGWA++AK++ GL+ A    
Sbjct  400  IGAFVQFLCSYSTLPLYAIVTQMGSSFKREIFEEYIQEGLVGWAKQAKKKAGLRRAANES  459

Query  204  NHGGALTDGSSTGVQMGGVGRKESGSTDGAS  112
            +H        S  +QM   G +E+   +  S
Sbjct  460  SHNQVSPKEESPLIQMAKAGSRETAVEENKS  490


 Score =   108 bits (269),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 52/60 (87%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVVIFL LN++GWH YFWIAFIPFILLLAVGTKLEHVIIQLA EVAEKHVA+EG+LVV
Sbjct  282  WLFVVIFLFLNVSGWHAYFWIAFIPFILLLAVGTKLEHVIIQLAREVAEKHVAVEGDLVV  341



>gb|ABK93651.1| unknown [Populus trichocarpa]
Length=439

 Score =   176 bits (447),  Expect(2) = 4e-68, Method: Compositional matrix adjust.
 Identities = 89/149 (60%), Positives = 111/149 (74%), Gaps = 0/149 (0%)
 Frame = -3

Query  558  QPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIG  379
            +PSD+HFWF +P+IVL LIH ILFQN+FE+AFFFWI VQYGFDSCIMG V +IIPRLVIG
Sbjct  282  RPSDDHFWFNKPKIVLLLIHIILFQNSFELAFFFWIWVQYGFDSCIMGQVGYIIPRLVIG  341

Query  378  VIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGINH  199
              +Q LCSYSTLP+YAIVTQMG+ FK+ IF+EHIQ GLVGWA++AK++ GL+      +H
Sbjct  342  AFVQFLCSYSTLPLYAIVTQMGSSFKREIFEEHIQEGLVGWAKQAKKKAGLRRDANESSH  401

Query  198  GGALTDGSSTGVQMGGVGRKESGSTDGAS  112
                    S  +QM   G +E+   +  S
Sbjct  402  NQVGPKVESPLIQMAKAGSRETAVEENKS  430


 Score =   109 bits (273),  Expect(2) = 4e-68, Method: Compositional matrix adjust.
 Identities = 52/60 (87%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVVIFL LN++GWH YFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVA++G+LVV
Sbjct  222  WLFVVIFLCLNVSGWHAYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAVQGDLVV  281



>ref|XP_006372312.1| hypothetical protein POPTR_0017s00450g [Populus trichocarpa]
 gb|ERP50109.1| hypothetical protein POPTR_0017s00450g [Populus trichocarpa]
Length=499

 Score =   176 bits (447),  Expect(2) = 4e-68, Method: Compositional matrix adjust.
 Identities = 89/151 (59%), Positives = 112/151 (74%), Gaps = 0/151 (0%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + +PSD+HFWF +P+IVL LIH ILFQN+FE+AFFFWI VQYGFDSCIMG V +IIPRLV
Sbjct  340  VVRPSDDHFWFKKPKIVLLLIHIILFQNSFELAFFFWIWVQYGFDSCIMGQVGYIIPRLV  399

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGI  205
            IG  +Q LCSYSTLP+YAIVTQMG+ FK+ IF+EHIQ GLVGWA++AK++ GL+      
Sbjct  400  IGAFVQFLCSYSTLPLYAIVTQMGSSFKREIFEEHIQEGLVGWAKQAKKKAGLRRDANES  459

Query  204  NHGGALTDGSSTGVQMGGVGRKESGSTDGAS  112
            +H        S  +QM   G +E+   +  S
Sbjct  460  SHNQVGPKVESPLIQMAKAGSRETAVEENKS  490


 Score =   109 bits (273),  Expect(2) = 4e-68, Method: Compositional matrix adjust.
 Identities = 52/60 (87%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVVIFL LN++GWH YFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVA++G+LVV
Sbjct  282  WLFVVIFLFLNVSGWHAYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAVQGDLVV  341



>ref|XP_006351085.1| PREDICTED: MLO-like protein 1-like [Solanum tuberosum]
Length=504

 Score =   186 bits (471),  Expect(2) = 5e-68, Method: Compositional matrix adjust.
 Identities = 91/149 (61%), Positives = 109/149 (73%), Gaps = 5/149 (3%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + +PSD+HFWF RP++VLFLIH ILFQN+FEIAFFFWI  QY F+SCIMG V +IIPRLV
Sbjct  344  VVKPSDDHFWFHRPRLVLFLIHIILFQNSFEIAFFFWIWAQYRFNSCIMGQVGYIIPRLV  403

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGI  205
            IGV +Q LCSYSTLP+YAIVTQMG+ FKK IFDE+IQ GLV WA+KA++R     A  G 
Sbjct  404  IGVFVQFLCSYSTLPLYAIVTQMGSSFKKEIFDEYIQDGLVVWAKKARRR-----AVNGS  458

Query  204  NHGGALTDGSSTGVQMGGVGRKESGSTDG  118
            N  G     S   VQ+  V  + S   +G
Sbjct  459  NQVGHKESTSPMAVQLAQVETQVSAMEEG  487


 Score =   100 bits (248),  Expect(2) = 5e-68, Method: Compositional matrix adjust.
 Identities = 48/60 (80%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            WVFVV+FLLLN++GWH YFWIAF+PF LLLAVGTKLEHVI QLA EVA KH+A+EG+LVV
Sbjct  286  WVFVVLFLLLNVHGWHAYFWIAFVPFGLLLAVGTKLEHVITQLAGEVAAKHIAVEGDLVV  345



>ref|XP_006372311.1| hypothetical protein POPTR_0017s00450g [Populus trichocarpa]
 gb|ERP50108.1| hypothetical protein POPTR_0017s00450g [Populus trichocarpa]
Length=439

 Score =   176 bits (445),  Expect(2) = 6e-68, Method: Compositional matrix adjust.
 Identities = 89/151 (59%), Positives = 112/151 (74%), Gaps = 0/151 (0%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + +PSD+HFWF +P+IVL LIH ILFQN+FE+AFFFWI VQYGFDSCIMG V +IIPRLV
Sbjct  280  VVRPSDDHFWFKKPKIVLLLIHIILFQNSFELAFFFWIWVQYGFDSCIMGQVGYIIPRLV  339

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGI  205
            IG  +Q LCSYSTLP+YAIVTQMG+ FK+ IF+EHIQ GLVGWA++AK++ GL+      
Sbjct  340  IGAFVQFLCSYSTLPLYAIVTQMGSSFKREIFEEHIQEGLVGWAKQAKKKAGLRRDANES  399

Query  204  NHGGALTDGSSTGVQMGGVGRKESGSTDGAS  112
            +H        S  +QM   G +E+   +  S
Sbjct  400  SHNQVGPKVESPLIQMAKAGSRETAVEENKS  430


 Score =   109 bits (273),  Expect(2) = 6e-68, Method: Compositional matrix adjust.
 Identities = 52/60 (87%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVVIFL LN++GWH YFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVA++G+LVV
Sbjct  222  WLFVVIFLFLNVSGWHAYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAVQGDLVV  281



>ref|XP_010065113.1| PREDICTED: MLO-like protein 1 [Eucalyptus grandis]
Length=387

 Score =   186 bits (473),  Expect(2) = 6e-68, Method: Compositional matrix adjust.
 Identities = 93/164 (57%), Positives = 118/164 (72%), Gaps = 19/164 (12%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + QPSD+HFWF RP++VL LIH I FQN+FE+AFFF+I +QY F SCIMG V +IIPRL+
Sbjct  215  VVQPSDDHFWFHRPRLVLVLIHIIQFQNSFELAFFFFIWIQYNFSSCIMGEVGYIIPRLI  274

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGI  205
            IGV +Q LCSYSTLP+YAIVTQMGT FKK+IFDEHI  GLVGWA+ AK+ K L+      
Sbjct  275  IGVFVQFLCSYSTLPLYAIVTQMGTSFKKAIFDEHIHQGLVGWARHAKKNKNLRK-----  329

Query  204  NHGGALTDGSSTGVQMGGVGRKESGSTDGASVRALQQMGGDGSK  73
                  TDGSST          ++GS +G+    L++ GG+G++
Sbjct  330  ----TATDGSST----------QTGSKEGSVGVELRENGGNGTE  359


 Score = 99.0 bits (245),  Expect(2) = 6e-68, Method: Compositional matrix adjust.
 Identities = 47/60 (78%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVV+FLLLN+ GWH YFWI+FIP ILLLAVGTKLEHVI QLA EVA++HVAI G+LVV
Sbjct  157  WLFVVVFLLLNVAGWHAYFWISFIPLILLLAVGTKLEHVITQLAQEVAQRHVAIAGDLVV  216



>ref|XP_010040798.1| PREDICTED: MLO-like protein 1 [Eucalyptus grandis]
Length=517

 Score =   186 bits (473),  Expect(2) = 8e-68, Method: Compositional matrix adjust.
 Identities = 94/162 (58%), Positives = 117/162 (72%), Gaps = 19/162 (12%)
 Frame = -3

Query  558  QPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIG  379
            QPSD+HFWF RP++VL LIH ILFQN+FE+AFFF+IL+QY F SCIMG V +IIPRL+IG
Sbjct  347  QPSDDHFWFHRPRLVLVLIHIILFQNSFELAFFFFILLQYNFSSCIMGEVGYIIPRLIIG  406

Query  378  VIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGINH  199
            V +Q LCSYSTLP+YAIVTQMGT FKK IFDEHI  GLVGWA+ AK+ K L+        
Sbjct  407  VFVQFLCSYSTLPLYAIVTQMGTSFKKVIFDEHIHQGLVGWARHAKKNKNLRK-------  459

Query  198  GGALTDGSSTGVQMGGVGRKESGSTDGASVRALQQMGGDGSK  73
               +T GSST          ++GS +G+    L + GG+G++
Sbjct  460  --TVTVGSST----------QTGSKEGSVGVELTKNGGNGTE  489


 Score = 99.0 bits (245),  Expect(2) = 8e-68, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVV+FLLLN+ GWH YFWI+FIP +LLLAVGTKLEHVI QLA EVA++HVAI G+LVV
Sbjct  287  WLFVVVFLLLNVAGWHAYFWISFIPLLLLLAVGTKLEHVITQLAQEVAQRHVAIAGDLVV  346



>ref|XP_010930331.1| PREDICTED: MLO-like protein 1 isoform X1 [Elaeis guineensis]
Length=508

 Score =   181 bits (458),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 88/134 (66%), Positives = 101/134 (75%), Gaps = 0/134 (0%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            +  PSDE FWF RP+IVLFLIHFILFQNAFEIAFFFWIL  Y FDSCIMG   FIIPRLV
Sbjct  342  IVTPSDELFWFHRPKIVLFLIHFILFQNAFEIAFFFWILTTYHFDSCIMGQAVFIIPRLV  401

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGI  205
            I VIIQ+LC YSTLP+YAIVTQMG+ FK +IFDE++QVGLVGWAQ+ ++ KG +      
Sbjct  402  ICVIIQLLCGYSTLPLYAIVTQMGSSFKMAIFDENVQVGLVGWAQQVRKGKGKRVVNRES  461

Query  204  NHGGALTDGSSTGV  163
                    G+ T V
Sbjct  462  RSTSTPQSGNGTSV  475


 Score =   103 bits (256),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 47/60 (78%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FV++FLLL++NGWH YFWI+FIP ILLLAVGTKLEH+I QLAHEVAEKH AIEG L+V
Sbjct  284  WIFVMVFLLLDVNGWHAYFWISFIPLILLLAVGTKLEHIITQLAHEVAEKHSAIEGHLIV  343



>ref|XP_010930334.1| PREDICTED: MLO-like protein 1 isoform X3 [Elaeis guineensis]
Length=414

 Score =   180 bits (457),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 88/134 (66%), Positives = 101/134 (75%), Gaps = 0/134 (0%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            +  PSDE FWF RP+IVLFLIHFILFQNAFEIAFFFWIL  Y FDSCIMG   FIIPRLV
Sbjct  248  IVTPSDELFWFHRPKIVLFLIHFILFQNAFEIAFFFWILTTYHFDSCIMGQAVFIIPRLV  307

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGI  205
            I VIIQ+LC YSTLP+YAIVTQMG+ FK +IFDE++QVGLVGWAQ+ ++ KG +      
Sbjct  308  ICVIIQLLCGYSTLPLYAIVTQMGSSFKMAIFDENVQVGLVGWAQQVRKGKGKRVVNRES  367

Query  204  NHGGALTDGSSTGV  163
                    G+ T V
Sbjct  368  RSTSTPQSGNGTSV  381


 Score =   103 bits (256),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 47/60 (78%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FV++FLLL++NGWH YFWI+FIP ILLLAVGTKLEH+I QLAHEVAEKH AIEG L+V
Sbjct  190  WIFVMVFLLLDVNGWHAYFWISFIPLILLLAVGTKLEHIITQLAHEVAEKHSAIEGHLIV  249



>gb|KJB28898.1| hypothetical protein B456_005G074900 [Gossypium raimondii]
Length=462

 Score =   182 bits (463),  Expect(2) = 5e-67, Method: Compositional matrix adjust.
 Identities = 89/150 (59%), Positives = 112/150 (75%), Gaps = 4/150 (3%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + QPSD HFWF RP++VL LIH ILFQN+FE+AFF WI VQYGF+SC+MG V+FIIPRLV
Sbjct  312  VVQPSDNHFWFNRPRLVLRLIHIILFQNSFEMAFFAWIWVQYGFNSCMMGQVRFIIPRLV  371

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRK---GLKAAF  214
            IGV +Q +CSYSTLP+YA VTQMG+ +KK+IF+EHIQ GLVGWA+KA+++    GLK   
Sbjct  372  IGVFVQFVCSYSTLPLYAFVTQMGSSYKKAIFEEHIQEGLVGWARKARKKNKGSGLKRPS  431

Query  213  GGINHGGALTDGSSTGVQMGGVGRKESGST  124
               +  G   + S    +M  V  KES S+
Sbjct  432  NESSQVGP-KEESPLVFEMDKVNGKESSSS  460


 Score = 99.8 bits (247),  Expect(2) = 5e-67, Method: Compositional matrix adjust.
 Identities = 48/60 (80%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W FV IFLLLN  GWHTYFWIAFIPFILLLAVGTKLEH+I QLA EVAE+H+ + GELVV
Sbjct  254  WAFVAIFLLLNFVGWHTYFWIAFIPFILLLAVGTKLEHIITQLAQEVAERHMVVTGELVV  313



>gb|KHG23854.1| MLO-like protein 1 [Gossypium arboreum]
Length=471

 Score =   181 bits (459),  Expect(2) = 6e-67, Method: Compositional matrix adjust.
 Identities = 88/150 (59%), Positives = 112/150 (75%), Gaps = 4/150 (3%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + QPSD HFWF RP++VL LIH ILFQN+FE+AFF WI VQYGF+SC+MG V+FIIPRLV
Sbjct  321  VVQPSDNHFWFNRPRLVLRLIHIILFQNSFEMAFFAWIWVQYGFNSCMMGQVRFIIPRLV  380

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRK---GLKAAF  214
            IGV +Q +CSYSTLP+YA VTQMG+ +KK+IF+EHIQ GLVGWA+KA+++    G K + 
Sbjct  381  IGVFVQFVCSYSTLPLYAFVTQMGSSYKKAIFEEHIQEGLVGWARKARKKNKGSGFKRSS  440

Query  213  GGINHGGALTDGSSTGVQMGGVGRKESGST  124
               +  G   + S    +M  V  KES S+
Sbjct  441  NESSQVGP-KEESPLVFEMHKVNGKESSSS  469


 Score =   100 bits (250),  Expect(2) = 6e-67, Method: Compositional matrix adjust.
 Identities = 49/60 (82%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W FVVIFLLLN  GWHTYFWIAFIPFILLLAVGTKLEH+I QLA EVAE+H+ + GELVV
Sbjct  263  WAFVVIFLLLNFVGWHTYFWIAFIPFILLLAVGTKLEHIITQLAQEVAERHMVVTGELVV  322



>gb|KJB28899.1| hypothetical protein B456_005G074900 [Gossypium raimondii]
Length=497

 Score =   182 bits (463),  Expect(2) = 6e-67, Method: Compositional matrix adjust.
 Identities = 89/150 (59%), Positives = 112/150 (75%), Gaps = 4/150 (3%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + QPSD HFWF RP++VL LIH ILFQN+FE+AFF WI VQYGF+SC+MG V+FIIPRLV
Sbjct  347  VVQPSDNHFWFNRPRLVLRLIHIILFQNSFEMAFFAWIWVQYGFNSCMMGQVRFIIPRLV  406

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRK---GLKAAF  214
            IGV +Q +CSYSTLP+YA VTQMG+ +KK+IF+EHIQ GLVGWA+KA+++    GLK   
Sbjct  407  IGVFVQFVCSYSTLPLYAFVTQMGSSYKKAIFEEHIQEGLVGWARKARKKNKGSGLKRPS  466

Query  213  GGINHGGALTDGSSTGVQMGGVGRKESGST  124
               +  G   + S    +M  V  KES S+
Sbjct  467  NESSQVGP-KEESPLVFEMDKVNGKESSSS  495


 Score = 99.8 bits (247),  Expect(2) = 6e-67, Method: Compositional matrix adjust.
 Identities = 48/60 (80%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W FV IFLLLN  GWHTYFWIAFIPFILLLAVGTKLEH+I QLA EVAE+H+ + GELVV
Sbjct  289  WAFVAIFLLLNFVGWHTYFWIAFIPFILLLAVGTKLEHIITQLAQEVAERHMVVTGELVV  348



>ref|XP_002441107.1| hypothetical protein SORBIDRAFT_09g020550 [Sorghum bicolor]
 gb|EES19537.1| hypothetical protein SORBIDRAFT_09g020550 [Sorghum bicolor]
Length=479

 Score =   183 bits (464),  Expect(2) = 6e-67, Method: Compositional matrix adjust.
 Identities = 78/111 (70%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = -3

Query  555  PSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIGV  376
            PSD+HFWFGRP+I+L LIHFILFQNAFE+AFFFWIL+ YGF+SC M ++ F++PRLV+GV
Sbjct  352  PSDQHFWFGRPRIILHLIHFILFQNAFELAFFFWILMTYGFESCFMDNIGFLVPRLVLGV  411

Query  375  IIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            +IQ+LCSYSTLP+YAIVTQMG+++K  IF+EH+Q G++GWA+KAK+R G K
Sbjct  412  VIQLLCSYSTLPLYAIVTQMGSYYKMEIFNEHVQHGVLGWAEKAKKRSGFK  462


 Score = 99.0 bits (245),  Expect(2) = 6e-67, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 56/61 (92%), Gaps = 1/61 (2%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVA-IEGELV  563
            W+FVVIFLLLN+NGWHTYFW+AF+P +LLLAVGTKLEHVI QLA++VAEK  A IEG+LV
Sbjct  290  WIFVVIFLLLNVNGWHTYFWMAFLPLVLLLAVGTKLEHVIAQLAYDVAEKQTATIEGDLV  349

Query  562  V  560
            V
Sbjct  350  V  350



>ref|XP_008656279.1| PREDICTED: MLO-like protein 1 [Zea mays]
Length=491

 Score =   192 bits (488),  Expect(2) = 8e-67, Method: Compositional matrix adjust.
 Identities = 89/153 (58%), Positives = 116/153 (76%), Gaps = 5/153 (3%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + +PSD HFWFG+P+I+L+LIHFILFQN+FEIAFFFWIL  YGFD+C+M H++FIIPRLV
Sbjct  339  IVKPSDSHFWFGKPRIILYLIHFILFQNSFEIAFFFWILTTYGFDACMMEHLRFIIPRLV  398

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFG--  211
            +GV+IQ+LCSY TLP+YAIVTQMG+ +KK IF++H+Q G++ WAQK K RKGLK A    
Sbjct  399  MGVVIQLLCSYITLPLYAIVTQMGSCYKKEIFNDHVQKGVLVWAQKVKMRKGLKGALSKS  458

Query  210  -GINHGGALTDGSSTGVQMGGVGR--KESGSTD  121
                +  A   G S  ++M   G   K  G+T+
Sbjct  459  DSAKNNNADPAGPSVKIEMAKAGEDAKVVGNTE  491


 Score = 89.4 bits (220),  Expect(2) = 8e-67, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVVIFLLLN+NGWH YFWI+F+P +LLLAVGTKLEHVI QL H+VA+KH AI+G+++V
Sbjct  281  WIFVVIFLLLNVNGWHIYFWISFLPLLLLLAVGTKLEHVIAQLGHDVAKKHAAIDGDVIV  340



>ref|XP_006478537.1| PREDICTED: MLO-like protein 1-like [Citrus sinensis]
Length=487

 Score =   171 bits (432),  Expect(2) = 9e-67, Method: Compositional matrix adjust.
 Identities = 88/122 (72%), Positives = 100/122 (82%), Gaps = 0/122 (0%)
 Frame = -3

Query  558  QPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIG  379
            QPSD+HFWF RP+IVL LIH ILFQN+FE+AFFFWI VQYGFDSC MG V+FIIPRLVIG
Sbjct  349  QPSDDHFWFNRPRIVLILIHIILFQNSFELAFFFWIWVQYGFDSCTMGQVRFIIPRLVIG  408

Query  378  VIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGINH  199
              IQ LCSYSTLP+Y IVTQMG+ FKK+IFDEHIQ GLVGWA+ AK++   K A  G + 
Sbjct  409  CFIQFLCSYSTLPLYVIVTQMGSSFKKAIFDEHIQDGLVGWARMAKKKNTNKNAADGSSK  468

Query  198  GG  193
             G
Sbjct  469  VG  470


 Score =   110 bits (276),  Expect(2) = 9e-67, Method: Compositional matrix adjust.
 Identities = 52/60 (87%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVVIFLL+NI+GWHTYFWIAF+PFILLLAVGTKLEH+I QLAHEVAEKH+AIEG+LVV
Sbjct  289  WLFVVIFLLINIDGWHTYFWIAFVPFILLLAVGTKLEHIISQLAHEVAEKHIAIEGDLVV  348



>ref|XP_010065098.1| PREDICTED: MLO-like protein 1 [Eucalyptus grandis]
Length=516

 Score =   186 bits (471),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 91/149 (61%), Positives = 110/149 (74%), Gaps = 6/149 (4%)
 Frame = -3

Query  558  QPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIG  379
            QPSD+HFWF RP++VL LIH ILFQN+FE+AF F+I +QY F SCIMG V+FIIPRLVIG
Sbjct  345  QPSDDHFWFHRPRLVLVLIHIILFQNSFELAFLFFIWIQYRFKSCIMGEVRFIIPRLVIG  404

Query  378  VIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGINH  199
            V +Q+LCSYSTLP+YAIVTQMGT FKK+IFDEHIQ GLVGWA +AK+   L+        
Sbjct  405  VFVQLLCSYSTLPLYAIVTQMGTSFKKAIFDEHIQQGLVGWAWQAKKNNNLRKT---ATD  461

Query  198  GGALTDGS---STGVQMGGVGRKESGSTD  121
            G  +  GS   S GV++   GR  +   D
Sbjct  462  GSTVRTGSKQGSVGVELTKNGRDRTAMGD  490


 Score = 95.9 bits (237),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVV+FLLLN+ GWH YFWI+FIP  LLLAVGTKLEHVI QLA +VA++H+AI G+LVV
Sbjct  285  WLFVVVFLLLNVAGWHAYFWISFIPLTLLLAVGTKLEHVINQLAQDVAQRHIAIAGDLVV  344



>gb|EPS69013.1| hypothetical protein M569_05756 [Genlisea aurea]
Length=467

 Score =   179 bits (453),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 81/109 (74%), Positives = 94/109 (86%), Gaps = 0/109 (0%)
 Frame = -3

Query  558  QPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIG  379
            +PSD+ FWF RP +V  LIHFILFQNAFE+A+FFWI VQYGF+SCIMG V F+IPRLVI 
Sbjct  323  RPSDDLFWFHRPWVVFVLIHFILFQNAFEVAYFFWIWVQYGFNSCIMGQVGFVIPRLVIA  382

Query  378  VIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRK  232
            VIIQV+CSYSTLP+YA+VTQMG+HFKKSIFDEH+Q GLV WA+ AK   
Sbjct  383  VIIQVICSYSTLPLYALVTQMGSHFKKSIFDEHVQAGLVLWAENAKHNN  431


 Score =   102 bits (254),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 48/60 (80%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W FV+IFLLLNI+GWH+YFW+AF+PFILLLA+GTKLEHVI +LA EVAEKHVA+ GELVV
Sbjct  263  WCFVIIFLLLNIHGWHSYFWMAFVPFILLLAIGTKLEHVITELASEVAEKHVAVRGELVV  322



>ref|XP_006441984.1| hypothetical protein CICLE_v10020313mg [Citrus clementina]
 gb|ESR55224.1| hypothetical protein CICLE_v10020313mg [Citrus clementina]
Length=421

 Score =   171 bits (434),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 98/158 (62%), Positives = 113/158 (72%), Gaps = 20/158 (13%)
 Frame = -3

Query  558  QPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIG  379
            QPSD+HFWF RP+IVL LIH ILFQN+FE+AFFFWI VQYGFDSCIMG V+FIIPRLVIG
Sbjct  283  QPSDDHFWFNRPRIVLILIHIILFQNSFELAFFFWIWVQYGFDSCIMGRVRFIIPRLVIG  342

Query  378  VIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGINH  199
              IQ +CSYSTLP+Y IVTQMG+ FKK+IFDEHIQ GLVGWA+ AK++   K A      
Sbjct  343  CFIQFICSYSTLPLYVIVTQMGSSFKKAIFDEHIQDGLVGWARMAKKKNTNKNA------  396

Query  198  GGALTDGSSTGVQMGGVGRKESGSTDGASVRALQQMGG  85
                 DGSS       VG KE    +  SV  LQ++  
Sbjct  397  ----ADGSSK------VGHKE----EYPSVIQLQKLSN  420


 Score =   109 bits (273),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 52/60 (87%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVVIFLL+NI+GWHTYFWIAF PFILLLAVGTKLEH+I QLAHEVAEKH+AIEG+LVV
Sbjct  223  WLFVVIFLLINIDGWHTYFWIAFFPFILLLAVGTKLEHIISQLAHEVAEKHIAIEGDLVV  282



>ref|XP_011085087.1| PREDICTED: MLO-like protein 1 isoform X3 [Sesamum indicum]
Length=512

 Score =   179 bits (455),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 89/157 (57%), Positives = 111/157 (71%), Gaps = 15/157 (10%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + +PSD HFWF +P++VL LIH ILFQN+FEIA FFW+LV + FDSCIMGH ++IIPRL+
Sbjct  361  VVKPSDHHFWFSKPRLVLVLIHIILFQNSFEIAIFFWMLVMFQFDSCIMGHSRYIIPRLI  420

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQR-KGLKAAFGG  208
            IGV++Q LCSYSTLP+YAIV QMG+ F ++IF+EHIQ  L GWAQKAK+  KG + A GG
Sbjct  421  IGVLVQFLCSYSTLPLYAIVAQMGSSFNRAIFEEHIQEKLTGWAQKAKRNYKGQRKAMGG  480

Query  207  INHGGALTDGSSTGVQMGGVGRKESGSTDGASVRALQ  97
                     GSS       VG KES S      + L+
Sbjct  481  A--------GSSQ------VGNKESPSPAAPQAKGLE  503


 Score =   100 bits (250),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVV+FLLLN+ GWH YFWIAF+P ILLLAVGTKLEH+I QLA EVA++HVA+ GELVV
Sbjct  303  WIFVVVFLLLNVRGWHAYFWIAFVPLILLLAVGTKLEHIITQLAEEVAQRHVAVPGELVV  362



>gb|KDO49756.1| hypothetical protein CISIN_1g0113632mg, partial [Citrus sinensis]
Length=348

 Score =   170 bits (430),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 98/160 (61%), Positives = 113/160 (71%), Gaps = 20/160 (13%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + QPSD+HFWF RP+IVL LIH ILFQN+FE+AFFFWI VQYGFDSC MG V+FIIPRLV
Sbjct  208  VVQPSDDHFWFNRPRIVLILIHIILFQNSFELAFFFWIWVQYGFDSCTMGQVRFIIPRLV  267

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGI  205
            IG  IQ LCSYSTLP+Y IVTQMG+ FKK+IFDEHIQ GLVGWA+ AK++   K A    
Sbjct  268  IGCFIQFLCSYSTLPLYVIVTQMGSSFKKAIFDEHIQDGLVGWARMAKKKNTNKNA----  323

Query  204  NHGGALTDGSSTGVQMGGVGRKESGSTDGASVRALQQMGG  85
                   DGSS       VG KE    +  SV  LQ++  
Sbjct  324  ------ADGSSK------VGHKE----EYPSVIQLQKLSN  347


 Score =   110 bits (274),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 52/60 (87%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVVIFLL+NI+GWHTYFWIAF+PFILLLAVGTKLEH+I QLAHEVAEKH+AIEG+LVV
Sbjct  150  WLFVVIFLLINIDGWHTYFWIAFVPFILLLAVGTKLEHIISQLAHEVAEKHIAIEGDLVV  209



>ref|XP_011085085.1| PREDICTED: MLO-like protein 15 isoform X1 [Sesamum indicum]
Length=537

 Score =   179 bits (455),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 89/157 (57%), Positives = 111/157 (71%), Gaps = 15/157 (10%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + +PSD HFWF +P++VL LIH ILFQN+FEIA FFW+LV + FDSCIMGH ++IIPRL+
Sbjct  386  VVKPSDHHFWFSKPRLVLVLIHIILFQNSFEIAIFFWMLVMFQFDSCIMGHSRYIIPRLI  445

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQR-KGLKAAFGG  208
            IGV++Q LCSYSTLP+YAIV QMG+ F ++IF+EHIQ  L GWAQKAK+  KG + A GG
Sbjct  446  IGVLVQFLCSYSTLPLYAIVAQMGSSFNRAIFEEHIQEKLTGWAQKAKRNYKGQRKAMGG  505

Query  207  INHGGALTDGSSTGVQMGGVGRKESGSTDGASVRALQ  97
                     GSS       VG KES S      + L+
Sbjct  506  A--------GSSQ------VGNKESPSPAAPQAKGLE  528


 Score =   100 bits (250),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVV+FLLLN+ GWH YFWIAF+P ILLLAVGTKLEH+I QLA EVA++HVA+ GELVV
Sbjct  328  WIFVVVFLLLNVRGWHAYFWIAFVPLILLLAVGTKLEHIITQLAEEVAQRHVAVPGELVV  387



>ref|XP_011085086.1| PREDICTED: MLO-like protein 1 isoform X2 [Sesamum indicum]
Length=518

 Score =   179 bits (454),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 89/157 (57%), Positives = 111/157 (71%), Gaps = 15/157 (10%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + +PSD HFWF +P++VL LIH ILFQN+FEIA FFW+LV + FDSCIMGH ++IIPRL+
Sbjct  367  VVKPSDHHFWFSKPRLVLVLIHIILFQNSFEIAIFFWMLVMFQFDSCIMGHSRYIIPRLI  426

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQR-KGLKAAFGG  208
            IGV++Q LCSYSTLP+YAIV QMG+ F ++IF+EHIQ  L GWAQKAK+  KG + A GG
Sbjct  427  IGVLVQFLCSYSTLPLYAIVAQMGSSFNRAIFEEHIQEKLTGWAQKAKRNYKGQRKAMGG  486

Query  207  INHGGALTDGSSTGVQMGGVGRKESGSTDGASVRALQ  97
                     GSS       VG KES S      + L+
Sbjct  487  A--------GSSQ------VGNKESPSPAAPQAKGLE  509


 Score =   100 bits (250),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVV+FLLLN+ GWH YFWIAF+P ILLLAVGTKLEH+I QLA EVA++HVA+ GELVV
Sbjct  309  WIFVVVFLLLNVRGWHAYFWIAFVPLILLLAVGTKLEHIITQLAEEVAQRHVAVPGELVV  368



>ref|XP_002533335.1| Protein MLO, putative [Ricinus communis]
 gb|EEF29044.1| Protein MLO, putative, partial [Ricinus communis]
Length=507

 Score =   173 bits (439),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 92/155 (59%), Positives = 111/155 (72%), Gaps = 6/155 (4%)
 Frame = -3

Query  558  QPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIG  379
            QPSD+HFWF RP+IVL LIH ILFQN+FE+AFFFWI VQYGFDSCIM  V ++IPRL+IG
Sbjct  347  QPSDDHFWFHRPRIVLILIHIILFQNSFELAFFFWIWVQYGFDSCIMEEVGYLIPRLIIG  406

Query  378  VIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGINH  199
            V IQ +CSYSTLP+YAIVTQMG+ FKK+IFDEHIQ GLVGWA++ K++  L+ A  G   
Sbjct  407  VFIQFVCSYSTLPLYAIVTQMGSSFKKAIFDEHIQTGLVGWAKQVKKKMVLRKAANGSTQ  466

Query  198  GGALTDGSSTGVQMGGVGRKESGSTDGASVRALQQ  94
                 D        G V    +GS D   +R  Q+
Sbjct  467  VSKKEDSP------GSVQLSHAGSEDSEMMRKEQE  495


 Score =   104 bits (260),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 49/60 (82%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVVIFLLLN+ GWH YFWIAFIPF+LL+AVG KLEHVI QLAHEVAEKH+A+EG+LVV
Sbjct  287  WLFVVIFLLLNVAGWHAYFWIAFIPFVLLVAVGAKLEHVITQLAHEVAEKHIAVEGDLVV  346



>ref|XP_008383732.1| PREDICTED: MLO-like protein 1 [Malus domestica]
Length=540

 Score =   166 bits (421),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 92/159 (58%), Positives = 118/159 (74%), Gaps = 4/159 (3%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + QPSD+HFWF RP++VL L+H ILFQN+FE+AFFFWILVQY F SC+MG + ++IPRLV
Sbjct  343  VVQPSDDHFWFHRPRLVLLLVHIILFQNSFELAFFFWILVQYKFHSCMMGELGYVIPRLV  402

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGI  205
            IGV +Q +CSYSTLP+YAIVTQMG+ FKK+IF+EHIQ GLVGWA+ AK+ K L+ A    
Sbjct  403  IGVFVQFVCSYSTLPLYAIVTQMGSSFKKAIFEEHIQEGLVGWARSAKKNKALRNAANAN  462

Query  204  NHGGALTDGSSTGVQMG-GVGRKESGSTDGASVRALQQM  91
              G     GS+   Q+G GVG KE      A++   Q++
Sbjct  463  GSGSGAGAGST---QVGVGVGLKEKEKEASATLELAQKL  498


 Score =   110 bits (276),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 53/60 (88%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVVIFLLLN++GWH YFWIAFIPFILLLAVGTKLEHVI QLAHEVAEKH+AIEG+LVV
Sbjct  285  WIFVVIFLLLNVSGWHAYFWIAFIPFILLLAVGTKLEHVISQLAHEVAEKHIAIEGDLVV  344



>ref|XP_007020280.1| Seven transmembrane MLO family protein [Theobroma cacao]
 gb|EOY17505.1| Seven transmembrane MLO family protein [Theobroma cacao]
Length=489

 Score =   171 bits (433),  Expect(2) = 3e-65, Method: Compositional matrix adjust.
 Identities = 83/149 (56%), Positives = 107/149 (72%), Gaps = 4/149 (3%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + QPSD HFWF RP+++L LIH  LFQN+FE+AFF WI  QYGF SC+MG V+FIIPRLV
Sbjct  342  VVQPSDNHFWFNRPRLILRLIHITLFQNSFELAFFAWIWFQYGFKSCMMGQVRFIIPRLV  401

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQR---KGLKAAF  214
            IGV +Q +CSYSTLP+YA VTQMG+ +KK+IF+EHI+ GLVGWA+KAK+       K + 
Sbjct  402  IGVFVQFVCSYSTLPLYAFVTQMGSSYKKAIFEEHIREGLVGWARKAKKNTKGNAFKRSA  461

Query  213  GGINHGGALTDGSSTGVQMGGVGRKESGS  127
             G +  G   + S   ++M     KES +
Sbjct  462  NGSSQVGP-KEESPLVLEMVEAYGKESAA  489


 Score =   105 bits (262),  Expect(2) = 3e-65, Method: Compositional matrix adjust.
 Identities = 51/60 (85%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W FVVIFLLLN  GWHTYFWIAFIPFILLLAVGTKLEH+I QLA EVAE+H+A+EGELVV
Sbjct  284  WAFVVIFLLLNFVGWHTYFWIAFIPFILLLAVGTKLEHIITQLAQEVAERHIAVEGELVV  343



>gb|ABR16800.1| unknown [Picea sitchensis]
Length=483

 Score =   175 bits (443),  Expect(2) = 3e-65, Method: Compositional matrix adjust.
 Identities = 78/106 (74%), Positives = 90/106 (85%), Gaps = 0/106 (0%)
 Frame = -3

Query  552  SDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIGVI  373
            SDEHFWFG+P++VL+LIHFILFQNAFEI FFFWIL  YGFDSCIMG + +IIPRL +GVI
Sbjct  349  SDEHFWFGKPKLVLYLIHFILFQNAFEIGFFFWILTTYGFDSCIMGKIAYIIPRLAVGVI  408

Query  372  IQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQR  235
            IQVLCSYSTLP+Y +VTQMGT FK+ I +EHI  GL  W QKAK +
Sbjct  409  IQVLCSYSTLPLYVLVTQMGTSFKREILNEHIHEGLSVWHQKAKAK  454


 Score =   101 bits (251),  Expect(2) = 3e-65, Method: Compositional matrix adjust.
 Identities = 49/60 (82%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W FVVIFLLLNI GWHTYFWIAFIP ILLLAVG KLEH+I QLA EV EKH A+EG+LVV
Sbjct  287  WGFVVIFLLLNIEGWHTYFWIAFIPLILLLAVGAKLEHIITQLAQEVVEKHTAVEGDLVV  346



>ref|XP_010559056.1| PREDICTED: MLO-like protein 15 isoform X1 [Tarenaya hassleriana]
Length=535

 Score =   173 bits (439),  Expect(2) = 4e-65, Method: Compositional matrix adjust.
 Identities = 84/139 (60%), Positives = 108/139 (78%), Gaps = 1/139 (1%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + +PSD+ FWFG P++VLFLIHFILFQN+FE+AFFF+IL+Q+G+DSCIMG VKFIIPRLV
Sbjct  372  VVRPSDDLFWFGSPRLVLFLIHFILFQNSFELAFFFFILLQFGWDSCIMGQVKFIIPRLV  431

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGI  205
            IGV++Q+LCSYSTLP+YA+VTQMG+ FK +IF+E  Q  LVGWA+ AK R   K +    
Sbjct  432  IGVMVQLLCSYSTLPLYALVTQMGSSFKAAIFNEQTQQQLVGWAKMAK-RGVKKGSTHAS  490

Query  204  NHGGALTDGSSTGVQMGGV  148
            +  G  T  S   VQ+  +
Sbjct  491  SSHGVETTPSPRSVQLQAL  509


 Score =   102 bits (254),  Expect(2) = 4e-65, Method: Compositional matrix adjust.
 Identities = 49/60 (82%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            WVFVVIFLLLN+  WH YFW+AFIP ILLLAVGTKLEH+I +LAH VAEKHVA+EGELVV
Sbjct  314  WVFVVIFLLLNVAAWHIYFWLAFIPLILLLAVGTKLEHIITELAHRVAEKHVAVEGELVV  373



>gb|EMT10343.1| MLO-like protein 1 [Aegilops tauschii]
Length=526

 Score =   186 bits (473),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 97/156 (62%), Positives = 121/156 (78%), Gaps = 2/156 (1%)
 Frame = -3

Query  570  NWLCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPR  391
            + + +PSD+HFWFGRP+I+LFLIHFILFQNAFEIAFFFWIL  YGF+SCIMG V FI+PR
Sbjct  372  DLIVKPSDDHFWFGRPRIILFLIHFILFQNAFEIAFFFWILTTYGFNSCIMGQVGFIVPR  431

Query  390  LVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFG  211
            LVIG+IIQ+LCSYSTLP+YAIVTQMG+ +KK IF+EH+Q G++GWAQKAK +KG K + G
Sbjct  432  LVIGLIIQLLCSYSTLPLYAIVTQMGSFYKKEIFNEHVQQGVLGWAQKAKMKKGFKKSNG  491

Query  210  GINHGGALTD-GSSTGVQMGGVGRKESGSTDGASVR  106
                   +   G ST V+M     +E G+  G S+ 
Sbjct  492  AAQSTSPVDSVGPSTKVEMVRRPARE-GNDAGESIE  526


 Score = 89.4 bits (220),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -2

Query  715  LLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            L N NGWHTYFWIAFIP ILLLAVGTKLEHVI QLA +VAEKH A+EG+L+V
Sbjct  324  LANGNGWHTYFWIAFIPLILLLAVGTKLEHVIAQLAQDVAEKHSAVEGDLIV  375



>ref|XP_006295922.1| hypothetical protein CARUB_v10025059mg [Capsella rubella]
 gb|EOA28820.1| hypothetical protein CARUB_v10025059mg [Capsella rubella]
Length=490

 Score =   174 bits (441),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 81/134 (60%), Positives = 108/134 (81%), Gaps = 0/134 (0%)
 Frame = -3

Query  570  NWLCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPR  391
            + + +PSD+ FWF  P++VLFLIHFILFQN+FE+A+FF+IL QYG+DSCIMGHVKFIIPR
Sbjct  324  DLVVRPSDDLFWFQSPRLVLFLIHFILFQNSFELAYFFFILFQYGWDSCIMGHVKFIIPR  383

Query  390  LVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFG  211
            L+IGV++Q+LCSYSTLP+YA+VTQMG+ FK +IF+E  Q  LVGWA+ AK+     +   
Sbjct  384  LIIGVLVQLLCSYSTLPLYALVTQMGSSFKGAIFNEQTQQQLVGWAKMAKKGVKKGSTHA  443

Query  210  GINHGGALTDGSST  169
            G +HGG+    ++T
Sbjct  444  GSSHGGSPNPLAAT  457


 Score =   101 bits (252),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 48/60 (80%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            WVFVV+FLLLNI  WH YFW+AFIP ILLLAVGTKLEH+I  LAHEVAEKH+A+EG+LVV
Sbjct  268  WVFVVLFLLLNIAAWHVYFWLAFIPLILLLAVGTKLEHIITDLAHEVAEKHIAVEGDLVV  327



>ref|XP_009757992.1| PREDICTED: MLO-like protein 1 [Nicotiana sylvestris]
Length=505

 Score =   174 bits (441),  Expect(2) = 6e-65, Method: Compositional matrix adjust.
 Identities = 95/160 (59%), Positives = 114/160 (71%), Gaps = 4/160 (3%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + +PSD+HFWF RP++VL LIH ILFQN+FEIAFFFWI  QY F+SCIMG V +IIPRLV
Sbjct  347  VVKPSDDHFWFHRPRLVLLLIHIILFQNSFEIAFFFWIWAQYHFNSCIMGQVGYIIPRLV  406

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGI  205
            IGV +Q LCSYSTLP+YAIVTQMG+ FKK IFDEHIQ GLV WA+KAK+R    AA G  
Sbjct  407  IGVFVQFLCSYSTLPLYAIVTQMGSSFKKEIFDEHIQDGLVFWAKKAKRR----AANGSS  462

Query  204  NHGGALTDGSSTGVQMGGVGRKESGSTDGASVRALQQMGG  85
              G   +  S   VQ+  V  +ES   +G +  A  Q+  
Sbjct  463  QVGHKESSPSPMAVQLSQVEIQESAMEEGNARPATNQLNS  502


 Score =   101 bits (251),  Expect(2) = 6e-65, Method: Compositional matrix adjust.
 Identities = 49/60 (82%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            WVFVV+FLLLN++GWH YFWIAF+PF LLLAVGTKLEHVI QLA EVA KHVA+EG+LVV
Sbjct  289  WVFVVLFLLLNVHGWHAYFWIAFVPFGLLLAVGTKLEHVITQLAGEVAAKHVAVEGDLVV  348



>ref|XP_009366270.1| PREDICTED: MLO-like protein 1 [Pyrus x bretschneideri]
Length=546

 Score =   165 bits (417),  Expect(2) = 6e-65, Method: Compositional matrix adjust.
 Identities = 79/114 (69%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + QPSD+HFWF RP++VL L+H ILFQN+FE+AFFFWILVQY F SC+MG + ++IPRLV
Sbjct  343  VVQPSDDHFWFHRPRLVLLLVHIILFQNSFELAFFFWILVQYKFHSCMMGELGYVIPRLV  402

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            IGV +Q +CSYSTLP+YAIVTQMG+ FKK+IF+EHIQ GLVGWA+ AK+ K L+
Sbjct  403  IGVFVQFVCSYSTLPLYAIVTQMGSSFKKAIFEEHIQEGLVGWARSAKKNKALR  456


 Score =   110 bits (275),  Expect(2) = 6e-65, Method: Compositional matrix adjust.
 Identities = 53/60 (88%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVVIFLLLN++GWH YFWIAFIPFILLLAVGTKLEHVI QLAHEVAEKH+AIEG+LVV
Sbjct  285  WIFVVIFLLLNVSGWHAYFWIAFIPFILLLAVGTKLEHVISQLAHEVAEKHIAIEGDLVV  344



>ref|XP_006397586.1| hypothetical protein EUTSA_v10001415mg [Eutrema salsugineum]
 gb|ESQ39039.1| hypothetical protein EUTSA_v10001415mg [Eutrema salsugineum]
Length=505

 Score =   172 bits (436),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 84/156 (54%), Positives = 114/156 (73%), Gaps = 3/156 (2%)
 Frame = -3

Query  570  NWLCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPR  391
            + + +PSD+ FWF  P++VLFLIHFILFQN+FE+AF F+I V+YGFDSCIMG VKFIIPR
Sbjct  338  DLVVRPSDDLFWFKSPRLVLFLIHFILFQNSFELAFIFFIFVEYGFDSCIMGQVKFIIPR  397

Query  390  LVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFG  211
            LVIGV++Q+LCSYSTLP+YA+VTQMG+ +K +IF+E  Q  +VGWA+ AK+     ++  
Sbjct  398  LVIGVLVQLLCSYSTLPLYALVTQMGSSYKGAIFNEQTQQQIVGWAKMAKKGVKKGSSHA  457

Query  210  GINHGGA---LTDGSSTGVQMGGVGRKESGSTDGAS  112
            G +HGG+   L   S   +Q+  +  K S   +  S
Sbjct  458  GTSHGGSPNPLATPSPRSIQLQSLLGKGSSQQNHHS  493


 Score =   102 bits (254),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 49/60 (82%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            WVFVV+FLLLNI  WH YFWIAFIP ILLLAVGTKLEH+I  LAHEVAEKH+A+EG+LVV
Sbjct  282  WVFVVLFLLLNIAAWHIYFWIAFIPLILLLAVGTKLEHIITDLAHEVAEKHIAVEGDLVV  341



>ref|XP_010508339.1| PREDICTED: MLO-like protein 15 [Camelina sativa]
Length=503

 Score =   173 bits (438),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 77/134 (57%), Positives = 107/134 (80%), Gaps = 0/134 (0%)
 Frame = -3

Query  570  NWLCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPR  391
            + + +PSD+ FWF  P+++LFLIHFILFQN+FE+A+FF+IL QYG+DSCIMGHVKFIIPR
Sbjct  337  DLVVRPSDDLFWFQSPRLILFLIHFILFQNSFELAYFFFILFQYGWDSCIMGHVKFIIPR  396

Query  390  LVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFG  211
            L+IG ++Q+LCSYSTLP+YA+VTQMG+ +K +IF+E  Q  LVGWA+ A++     +   
Sbjct  397  LIIGALVQLLCSYSTLPLYALVTQMGSSYKGAIFNEQTQQQLVGWAKTARKEVKKSSTQA  456

Query  210  GINHGGALTDGSST  169
            G +HGG+    ++T
Sbjct  457  GSSHGGSPNPLAAT  470


 Score =   101 bits (252),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 49/60 (82%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            WVFVV FLLLNI  WH YFWIAFIP ILLLAVGTKLEH+I  LAH+VAEKHVA+EG+LVV
Sbjct  281  WVFVVFFLLLNIAAWHVYFWIAFIPLILLLAVGTKLEHIITDLAHDVAEKHVAVEGDLVV  340



>ref|XP_009413424.1| PREDICTED: MLO-like protein 1 [Musa acuminata subsp. malaccensis]
Length=490

 Score =   174 bits (440),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 82/128 (64%), Positives = 99/128 (77%), Gaps = 3/128 (2%)
 Frame = -3

Query  555  PSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIGV  376
            PSD  FWF RPQIV+FLIHFILFQNAFEIA+FFWIL  YGFDSCIMG V FI+PRLVI V
Sbjct  341  PSDHLFWFHRPQIVIFLIHFILFQNAFEIAYFFWILTTYGFDSCIMGEVGFIVPRLVISV  400

Query  375  IIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGINHG  196
            + Q+LCSYSTLP+YAIVTQMG+ F K+IFD ++Q GL+ WA+ AK+ K  +   G     
Sbjct  401  LSQLLCSYSTLPLYAIVTQMGSFFNKAIFDANVQAGLLDWARGAKKNKKTRIVNG---EN  457

Query  195  GALTDGSS  172
             + T+G+ 
Sbjct  458  ASRTEGAE  465


 Score =   100 bits (249),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FV+IFLLLN+ GWH YFWI+F+P +LLLA+GTKLEH+I QLA EVAEKH AIEG+LVV
Sbjct  280  WIFVMIFLLLNVEGWHAYFWISFLPLVLLLAIGTKLEHIITQLAQEVAEKHSAIEGDLVV  339



>ref|XP_010517997.1| PREDICTED: MLO-like protein 15 isoform X2 [Camelina sativa]
Length=464

 Score =   173 bits (438),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 110/132 (83%), Gaps = 4/132 (3%)
 Frame = -3

Query  558  QPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIG  379
            +PSD+ FWF  P+++LFLIHFILFQN+FE+A+FF+IL QYG+DSCIMGHVKFIIPRL+IG
Sbjct  302  RPSDDLFWFQSPRLILFLIHFILFQNSFELAYFFFILFQYGWDSCIMGHVKFIIPRLIIG  361

Query  378  VIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQ--RKGLKAAFGGI  205
            V++Q+LCSYSTLP+YA+VTQMG+ +K +IF+E  Q  LVGWA+ A++  +KG+  A  G 
Sbjct  362  VLVQLLCSYSTLPLYALVTQMGSSYKGAIFNEQTQQQLVGWAKTARKEVKKGITHA--GS  419

Query  204  NHGGALTDGSST  169
            +HGG+    ++T
Sbjct  420  SHGGSPNPLAAT  431


 Score =   101 bits (251),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 48/60 (80%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            WVFVV FLLLNI  WH YFWIAFIP ILLLAVGTKLEH+I  LAH+VAEKH+A+EG+LVV
Sbjct  242  WVFVVFFLLLNIAAWHVYFWIAFIPLILLLAVGTKLEHIITDLAHDVAEKHIAVEGDLVV  301



>ref|XP_010517996.1| PREDICTED: MLO-like protein 15 isoform X1 [Camelina sativa]
Length=503

 Score =   172 bits (437),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 81/136 (60%), Positives = 112/136 (82%), Gaps = 4/136 (3%)
 Frame = -3

Query  570  NWLCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPR  391
            + + +PSD+ FWF  P+++LFLIHFILFQN+FE+A+FF+IL QYG+DSCIMGHVKFIIPR
Sbjct  337  DLVVRPSDDLFWFQSPRLILFLIHFILFQNSFELAYFFFILFQYGWDSCIMGHVKFIIPR  396

Query  390  LVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQ--RKGLKAA  217
            L+IGV++Q+LCSYSTLP+YA+VTQMG+ +K +IF+E  Q  LVGWA+ A++  +KG+  A
Sbjct  397  LIIGVLVQLLCSYSTLPLYALVTQMGSSYKGAIFNEQTQQQLVGWAKTARKEVKKGITHA  456

Query  216  FGGINHGGALTDGSST  169
              G +HGG+    ++T
Sbjct  457  --GSSHGGSPNPLAAT  470


 Score =   101 bits (251),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 48/60 (80%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            WVFVV FLLLNI  WH YFWIAFIP ILLLAVGTKLEH+I  LAH+VAEKH+A+EG+LVV
Sbjct  281  WVFVVFFLLLNIAAWHVYFWIAFIPLILLLAVGTKLEHIITDLAHDVAEKHIAVEGDLVV  340



>emb|CDP19084.1| unnamed protein product [Coffea canephora]
Length=537

 Score =   183 bits (464),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 88/146 (60%), Positives = 108/146 (74%), Gaps = 15/146 (10%)
 Frame = -3

Query  558  QPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIG  379
            +PSD+HFWF RP++VL LIH ILFQNAFEIA FFW   QY FDSCIMG V F+IPRLV+G
Sbjct  356  RPSDDHFWFNRPKLVLHLIHIILFQNAFEIAIFFWTWAQYKFDSCIMGAVGFVIPRLVLG  415

Query  378  VIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGINH  199
              +Q +CSYSTLP+YAIVTQMG+ FKK+IF+EH+Q GLVGWAQKA++ KG++        
Sbjct  416  AFVQFICSYSTLPLYAIVTQMGSTFKKAIFEEHVQEGLVGWAQKARKNKGMR--------  467

Query  198  GGALTDGSSTGVQMGGVGRKESGSTD  121
               + + SST      VG KES S +
Sbjct  468  --KVVNASST-----QVGPKESPSVE  486


 Score = 90.1 bits (222),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = -2

Query  709  NINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            N+ GWHTYFWI+FIPF LLLAVGTKLEHVI QLA EVAEKHVA++GELVV
Sbjct  306  NVYGWHTYFWISFIPFALLLAVGTKLEHVISQLAQEVAEKHVAVQGELVV  355



>ref|XP_010913228.1| PREDICTED: MLO-like protein 13 isoform X1 [Elaeis guineensis]
Length=526

 Score =   184 bits (467),  Expect(2) = 8e-64, Method: Compositional matrix adjust.
 Identities = 88/156 (56%), Positives = 110/156 (71%), Gaps = 2/156 (1%)
 Frame = -3

Query  558  QPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIG  379
            +PSD HFWF RP I+L+LIHFILFQN+FEIAFFFWI   YGFDSCIMG + +IIPRL+IG
Sbjct  346  KPSDHHFWFRRPGIILYLIHFILFQNSFEIAFFFWIWSTYGFDSCIMGKIGYIIPRLIIG  405

Query  378  VIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRK--GLKAAFGGI  205
            V +QVLCSYSTLP+YAIVTQMG  FKK+IFDE +++ L GWA+ A++RK  G+ +     
Sbjct  406  VTVQVLCSYSTLPLYAIVTQMGDMFKKAIFDEQLRLTLHGWAEGARKRKRPGISSFLKKF  465

Query  204  NHGGALTDGSSTGVQMGGVGRKESGSTDGASVRALQ  97
            +      D S   VQM  +  + S     A   AL+
Sbjct  466  SSKSKRQDKSGNEVQMQTMASEASAVIPNALPAALE  501


 Score = 87.4 bits (215),  Expect(2) = 8e-64, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 49/63 (78%), Gaps = 1/63 (2%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV-AIEGELV  563
            W+FV+IFLLLN+NGWHTYFW++F+P I LLAVGTKLEH+I +L  E AEKH    E   V
Sbjct  286  WLFVIIFLLLNVNGWHTYFWLSFLPLIPLLAVGTKLEHIITRLTQEAAEKHADEQEAPSV  345

Query  562  VPT  554
             P+
Sbjct  346  KPS  348



>gb|KFK37229.1| hypothetical protein AALP_AA4G230500 [Arabis alpina]
Length=507

 Score =   169 bits (428),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 86/165 (52%), Positives = 112/165 (68%), Gaps = 11/165 (7%)
 Frame = -3

Query  570  NWLCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPR  391
            + + +PSD+ FWF  P++VLFLIHFILFQN+FE+AF F+I V+YGFDSCIMG VKFIIPR
Sbjct  337  DLVVRPSDDLFWFKSPRLVLFLIHFILFQNSFELAFLFFIFVEYGFDSCIMGQVKFIIPR  396

Query  390  LVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFG  211
            L+IGV++Q+LCSYSTLP+YA+VTQMG+ FK +IF++  Q  + GWA+ AK  KG+K    
Sbjct  397  LIIGVLVQLLCSYSTLPLYALVTQMGSSFKGAIFNDQTQQQIAGWAKMAK--KGVKK---  451

Query  210  GINHGGALTDGSSTGVQMGGVGRKESGSTDGASVRALQQMGGDGS  76
            G  H G     +S G     +      S        LQ + G GS
Sbjct  452  GTTHAGTAHASTSHGESPNPLATPSPRSVQ------LQSLLGKGS  490


 Score =   102 bits (254),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 49/60 (82%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            WVFVV+FLLLNI  WH YFW+AFIP ILLLAVGTKLEH+I  LAHEVAEKHVA+EG+LVV
Sbjct  281  WVFVVLFLLLNIAAWHVYFWLAFIPLILLLAVGTKLEHIITDLAHEVAEKHVAVEGDLVV  340



>ref|XP_010913229.1| PREDICTED: MLO-like protein 13 isoform X2 [Elaeis guineensis]
Length=501

 Score =   184 bits (467),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 88/156 (56%), Positives = 110/156 (71%), Gaps = 2/156 (1%)
 Frame = -3

Query  558  QPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIG  379
            +PSD HFWF RP I+L+LIHFILFQN+FEIAFFFWI   YGFDSCIMG + +IIPRL+IG
Sbjct  321  KPSDHHFWFRRPGIILYLIHFILFQNSFEIAFFFWIWSTYGFDSCIMGKIGYIIPRLIIG  380

Query  378  VIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRK--GLKAAFGGI  205
            V +QVLCSYSTLP+YAIVTQMG  FKK+IFDE +++ L GWA+ A++RK  G+ +     
Sbjct  381  VTVQVLCSYSTLPLYAIVTQMGDMFKKAIFDEQLRLTLHGWAEGARKRKRPGISSFLKKF  440

Query  204  NHGGALTDGSSTGVQMGGVGRKESGSTDGASVRALQ  97
            +      D S   VQM  +  + S     A   AL+
Sbjct  441  SSKSKRQDKSGNEVQMQTMASEASAVIPNALPAALE  476


 Score = 87.0 bits (214),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 49/63 (78%), Gaps = 1/63 (2%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV-AIEGELV  563
            W+FV+IFLLLN+NGWHTYFW++F+P I LLAVGTKLEH+I +L  E AEKH    E   V
Sbjct  261  WLFVIIFLLLNVNGWHTYFWLSFLPLIPLLAVGTKLEHIITRLTQEAAEKHADEQEAPSV  320

Query  562  VPT  554
             P+
Sbjct  321  KPS  323



>ref|XP_010913234.1| PREDICTED: MLO-like protein 1 isoform X6 [Elaeis guineensis]
Length=355

 Score =   183 bits (465),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 88/156 (56%), Positives = 110/156 (71%), Gaps = 2/156 (1%)
 Frame = -3

Query  558  QPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIG  379
            +PSD HFWF RP I+L+LIHFILFQN+FEIAFFFWI   YGFDSCIMG + +IIPRL+IG
Sbjct  175  KPSDHHFWFRRPGIILYLIHFILFQNSFEIAFFFWIWSTYGFDSCIMGKIGYIIPRLIIG  234

Query  378  VIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRK--GLKAAFGGI  205
            V +QVLCSYSTLP+YAIVTQMG  FKK+IFDE +++ L GWA+ A++RK  G+ +     
Sbjct  235  VTVQVLCSYSTLPLYAIVTQMGDMFKKAIFDEQLRLTLHGWAEGARKRKRPGISSFLKKF  294

Query  204  NHGGALTDGSSTGVQMGGVGRKESGSTDGASVRALQ  97
            +      D S   VQM  +  + S     A   AL+
Sbjct  295  SSKSKRQDKSGNEVQMQTMASEASAVIPNALPAALE  330


 Score = 87.4 bits (215),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 49/63 (78%), Gaps = 1/63 (2%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV-AIEGELV  563
            W+FV+IFLLLN+NGWHTYFW++F+P I LLAVGTKLEH+I +L  E AEKH    E   V
Sbjct  115  WLFVIIFLLLNVNGWHTYFWLSFLPLIPLLAVGTKLEHIITRLTQEAAEKHADEQEAPSV  174

Query  562  VPT  554
             P+
Sbjct  175  KPS  177



>ref|XP_010913230.1| PREDICTED: MLO-like protein 13 isoform X3 [Elaeis guineensis]
Length=461

 Score =   183 bits (465),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 88/156 (56%), Positives = 110/156 (71%), Gaps = 2/156 (1%)
 Frame = -3

Query  558  QPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIG  379
            +PSD HFWF RP I+L+LIHFILFQN+FEIAFFFWI   YGFDSCIMG + +IIPRL+IG
Sbjct  281  KPSDHHFWFRRPGIILYLIHFILFQNSFEIAFFFWIWSTYGFDSCIMGKIGYIIPRLIIG  340

Query  378  VIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRK--GLKAAFGGI  205
            V +QVLCSYSTLP+YAIVTQMG  FKK+IFDE +++ L GWA+ A++RK  G+ +     
Sbjct  341  VTVQVLCSYSTLPLYAIVTQMGDMFKKAIFDEQLRLTLHGWAEGARKRKRPGISSFLKKF  400

Query  204  NHGGALTDGSSTGVQMGGVGRKESGSTDGASVRALQ  97
            +      D S   VQM  +  + S     A   AL+
Sbjct  401  SSKSKRQDKSGNEVQMQTMASEASAVIPNALPAALE  436


 Score = 87.4 bits (215),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 49/63 (78%), Gaps = 1/63 (2%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV-AIEGELV  563
            W+FV+IFLLLN+NGWHTYFW++F+P I LLAVGTKLEH+I +L  E AEKH    E   V
Sbjct  221  WLFVIIFLLLNVNGWHTYFWLSFLPLIPLLAVGTKLEHIITRLTQEAAEKHADEQEAPSV  280

Query  562  VPT  554
             P+
Sbjct  281  KPS  283



>ref|XP_010506316.1| PREDICTED: MLO-like protein 15 [Camelina sativa]
Length=499

 Score =   168 bits (426),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 79/139 (57%), Positives = 106/139 (76%), Gaps = 2/139 (1%)
 Frame = -3

Query  570  NWLCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPR  391
            + + +PSD+ FWF  P+++LFLIHFILFQN+FE+A+FF+IL QYG+DSCIMGHVKFIIPR
Sbjct  337  DLVVRPSDDLFWFQSPRLILFLIHFILFQNSFELAYFFFILFQYGWDSCIMGHVKFIIPR  396

Query  390  LVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQ--RKGLKAA  217
            L+IG ++Q+LCSYSTLP+YA+VTQMG+ +K +IF+E  Q  LVGWA+ A++  +KG   A
Sbjct  397  LIIGALVQLLCSYSTLPLYALVTQMGSSYKGAIFNEQTQQQLVGWAKTARKEVKKGTTHA  456

Query  216  FGGINHGGALTDGSSTGVQ  160
                N   A     S  +Q
Sbjct  457  GSSPNPLAATPSPRSVQLQ  475


 Score =   102 bits (253),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 48/60 (80%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            WVFVV+FLLLNI  WH YFWIAFIP ILLLAVGTKLEH+I  LAH+VAEKH+A+EG+LVV
Sbjct  281  WVFVVLFLLLNIAAWHVYFWIAFIPLILLLAVGTKLEHIITDLAHDVAEKHIAVEGDLVV  340



>ref|XP_011005242.1| PREDICTED: MLO-like protein 1 [Populus euphratica]
Length=480

 Score =   177 bits (449),  Expect(2) = 4e-63, Method: Compositional matrix adjust.
 Identities = 89/140 (64%), Positives = 108/140 (77%), Gaps = 0/140 (0%)
 Frame = -3

Query  558  QPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIG  379
             PSD+HFWF +P+IVL LIH ILFQN+FE+AFFFWI +QYGFDSCIMG V +IIPRLVIG
Sbjct  341  HPSDDHFWFNKPKIVLILIHIILFQNSFEMAFFFWIWLQYGFDSCIMGQVSYIIPRLVIG  400

Query  378  VIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGINH  199
              IQ+LCSYSTLP+YAIVTQMG+ FKK+IFDEH+Q GLVGWA++AK++  L+ A     H
Sbjct  401  AFIQLLCSYSTLPLYAIVTQMGSSFKKAIFDEHVQEGLVGWAKQAKKKTVLRKAANESTH  460

Query  198  GGALTDGSSTGVQMGGVGRK  139
               +    S  +QM   G K
Sbjct  461  NQVVHREESPLIQMAKAGSK  480


 Score = 92.0 bits (227),  Expect(2) = 4e-63, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = -2

Query  709  NINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            N+ GWH YFWIAFIPFILLLAVGTKLEHVI QLAHEVAEKHVA++G+LVV
Sbjct  291  NVAGWHAYFWIAFIPFILLLAVGTKLEHVISQLAHEVAEKHVAVQGDLVV  340



>ref|XP_002309708.1| hypothetical protein POPTR_0007s00240g [Populus trichocarpa]
 gb|EEE90158.1| hypothetical protein POPTR_0007s00240g [Populus trichocarpa]
Length=481

 Score =   177 bits (449),  Expect(2) = 4e-63, Method: Compositional matrix adjust.
 Identities = 89/140 (64%), Positives = 108/140 (77%), Gaps = 0/140 (0%)
 Frame = -3

Query  558  QPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIG  379
             PSD+HFWF +P+IVL LIH ILFQN+FE+AFFFWI +QYGFDSCIMG V +IIPRLVIG
Sbjct  342  HPSDDHFWFNKPKIVLILIHIILFQNSFEMAFFFWIWLQYGFDSCIMGQVSYIIPRLVIG  401

Query  378  VIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGINH  199
              IQ+LCSYSTLP+YAIVTQMG+ FKK+IFDEH+Q GLVGWA++AK++  L+ A     H
Sbjct  402  AFIQLLCSYSTLPLYAIVTQMGSSFKKAIFDEHVQEGLVGWAKQAKKKTVLRKAANESTH  461

Query  198  GGALTDGSSTGVQMGGVGRK  139
               +    S  +QM   G K
Sbjct  462  NQVVHREESPLIQMAKAGSK  481


 Score = 92.0 bits (227),  Expect(2) = 4e-63, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = -2

Query  709  NINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            N+ GWH YFWIAFIPFILLLAVGTKLEHVI QLAHEVAEKHVA++G+LVV
Sbjct  292  NVAGWHAYFWIAFIPFILLLAVGTKLEHVISQLAHEVAEKHVAVQGDLVV  341



>ref|XP_009615189.1| PREDICTED: MLO-like protein 1 isoform X2 [Nicotiana tomentosiformis]
Length=504

 Score =   169 bits (428),  Expect(2) = 5e-63, Method: Compositional matrix adjust.
 Identities = 93/151 (62%), Positives = 111/151 (74%), Gaps = 4/151 (3%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + +PSD+HFWF RP+IVL LIH ILFQN+FEIAFFFWI  QY F+SCIMG V +IIPRLV
Sbjct  343  VVKPSDDHFWFHRPRIVLLLIHIILFQNSFEIAFFFWIWAQYHFNSCIMGQVGYIIPRLV  402

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGI  205
            IGV +Q LCSYSTLP+YAIVTQMG+ FKK IFDEHIQ GLV WA+KAK+R    A  G  
Sbjct  403  IGVFVQFLCSYSTLPLYAIVTQMGSSFKKEIFDEHIQDGLVFWAKKAKRR----AVNGSS  458

Query  204  NHGGALTDGSSTGVQMGGVGRKESGSTDGAS  112
              G   +  S+  VQ+  V  +ES   +G +
Sbjct  459  QVGHKESSPSTMAVQLSQVEIQESAMEEGNA  489


 Score =   100 bits (248),  Expect(2) = 5e-63, Method: Compositional matrix adjust.
 Identities = 47/60 (78%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            WVFVV+FLLLN++GWHTYFWIAF+PF LL+ VGTKLEHVI QLA EVA KH+A+EG+LVV
Sbjct  285  WVFVVLFLLLNVHGWHTYFWIAFVPFGLLVGVGTKLEHVITQLAGEVAAKHIAVEGDLVV  344



>ref|XP_009615188.1| PREDICTED: MLO-like protein 1 isoform X1 [Nicotiana tomentosiformis]
Length=508

 Score =   169 bits (428),  Expect(2) = 5e-63, Method: Compositional matrix adjust.
 Identities = 93/151 (62%), Positives = 111/151 (74%), Gaps = 4/151 (3%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + +PSD+HFWF RP+IVL LIH ILFQN+FEIAFFFWI  QY F+SCIMG V +IIPRLV
Sbjct  347  VVKPSDDHFWFHRPRIVLLLIHIILFQNSFEIAFFFWIWAQYHFNSCIMGQVGYIIPRLV  406

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGI  205
            IGV +Q LCSYSTLP+YAIVTQMG+ FKK IFDEHIQ GLV WA+KAK+R    A  G  
Sbjct  407  IGVFVQFLCSYSTLPLYAIVTQMGSSFKKEIFDEHIQDGLVFWAKKAKRR----AVNGSS  462

Query  204  NHGGALTDGSSTGVQMGGVGRKESGSTDGAS  112
              G   +  S+  VQ+  V  +ES   +G +
Sbjct  463  QVGHKESSPSTMAVQLSQVEIQESAMEEGNA  493


 Score =   100 bits (248),  Expect(2) = 5e-63, Method: Compositional matrix adjust.
 Identities = 47/60 (78%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            WVFVV+FLLLN++GWHTYFWIAF+PF LL+ VGTKLEHVI QLA EVA KH+A+EG+LVV
Sbjct  289  WVFVVLFLLLNVHGWHTYFWIAFVPFGLLVGVGTKLEHVITQLAGEVAAKHIAVEGDLVV  348



>ref|NP_973686.1| MLO-like protein 15 [Arabidopsis thaliana]
 gb|AEC10377.1| MLO-like protein 15 [Arabidopsis thaliana]
Length=497

 Score =   168 bits (425),  Expect(2) = 8e-63, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 105/133 (79%), Gaps = 5/133 (4%)
 Frame = -3

Query  570  NWLCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPR  391
            + + +PSD+ FWF  P++VLFLIHFILFQN+FEIA+FF+IL Q+G+DSCIM HVKF+IPR
Sbjct  338  DLVVRPSDDLFWFQSPRLVLFLIHFILFQNSFEIAYFFFILFQFGWDSCIMDHVKFVIPR  397

Query  390  LVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFG  211
            LVIGVIIQ+LCSYSTLP+YA+VTQMG+ FK +IF+E  Q  LVGWA+ AK  +G+K    
Sbjct  398  LVIGVIIQLLCSYSTLPLYALVTQMGSSFKGAIFNEQTQEHLVGWAKMAK--RGVKK---  452

Query  210  GINHGGALTDGSS  172
            G    G   D +S
Sbjct  453  GATQVGTSHDATS  465


 Score =   100 bits (249),  Expect(2) = 8e-63, Method: Compositional matrix adjust.
 Identities = 48/60 (80%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            WVFVV+FLLLNI  WH YFW+AFIP ILLLAVGTKLEH+I  LAHEVAEKH+A+EG+LVV
Sbjct  282  WVFVVLFLLLNIVAWHVYFWLAFIPLILLLAVGTKLEHIITDLAHEVAEKHIAVEGDLVV  341



>ref|NP_181939.1| MLO-like protein 15 [Arabidopsis thaliana]
 sp|O80580.1|MLO15_ARATH RecName: Full=MLO-like protein 15; Short=AtMlo15 [Arabidopsis 
thaliana]
 gb|AAK53808.1|AF369576_1 membrane protein Mlo15 [Arabidopsis thaliana]
 gb|AAC23431.1| similar to Mlo proteins from H. vulgare [Arabidopsis thaliana]
 gb|AEC10376.1| MLO-like protein 15 [Arabidopsis thaliana]
Length=496

 Score =   168 bits (425),  Expect(2) = 9e-63, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 105/133 (79%), Gaps = 5/133 (4%)
 Frame = -3

Query  570  NWLCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPR  391
            + + +PSD+ FWF  P++VLFLIHFILFQN+FEIA+FF+IL Q+G+DSCIM HVKF+IPR
Sbjct  337  DLVVRPSDDLFWFQSPRLVLFLIHFILFQNSFEIAYFFFILFQFGWDSCIMDHVKFVIPR  396

Query  390  LVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFG  211
            LVIGVIIQ+LCSYSTLP+YA+VTQMG+ FK +IF+E  Q  LVGWA+ AK  +G+K    
Sbjct  397  LVIGVIIQLLCSYSTLPLYALVTQMGSSFKGAIFNEQTQEHLVGWAKMAK--RGVKK---  451

Query  210  GINHGGALTDGSS  172
            G    G   D +S
Sbjct  452  GATQVGTSHDATS  464


 Score =   100 bits (249),  Expect(2) = 9e-63, Method: Compositional matrix adjust.
 Identities = 48/60 (80%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            WVFVV+FLLLNI  WH YFW+AFIP ILLLAVGTKLEH+I  LAHEVAEKH+A+EG+LVV
Sbjct  281  WVFVVLFLLLNIVAWHVYFWLAFIPLILLLAVGTKLEHIITDLAHEVAEKHIAVEGDLVV  340



>ref|XP_010069191.1| PREDICTED: MLO-like protein 1 isoform X1 [Eucalyptus grandis]
 gb|KCW57460.1| hypothetical protein EUGRSUZ_H00239 [Eucalyptus grandis]
Length=501

 Score =   163 bits (413),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 89/158 (56%), Positives = 109/158 (69%), Gaps = 1/158 (1%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + QPSD+HFWF  P+IVL LIH +LFQNAFE+AFFF+I VQYGFDSCIMG V FIIPRLV
Sbjct  345  VVQPSDDHFWFHSPRIVLLLIHILLFQNAFELAFFFFIWVQYGFDSCIMGQVGFIIPRLV  404

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGI  205
            IGV++Q +CSYSTLP+YAIVTQMG+ FKK+IF+EHIQ GL  W Q AK +K  +    G 
Sbjct  405  IGVLVQFMCSYSTLPLYAIVTQMGSSFKKAIFEEHIQEGLSIWTQHAKMKKNARMTATGT  464

Query  204  NHGGALTDGSSTGVQMGGVGRKESGSTDGASVRALQQM  91
                   D   T    GG   +     D  S++  ++M
Sbjct  465  GSTTLPMDPKETSQSHGGPTEEAEIQYD-PSIQGPKEM  501


 Score =   104 bits (260),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 49/60 (82%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVVIFLLLN++GW  YFWI+FIPF+LLLAVGTKLEHVI QLAHEVAEKH A+EG+LVV
Sbjct  287  WIFVVIFLLLNVHGWQAYFWISFIPFLLLLAVGTKLEHVINQLAHEVAEKHAAVEGDLVV  346



>ref|XP_007026460.1| Seven transmembrane MLO family protein [Theobroma cacao]
 gb|EOY06962.1| Seven transmembrane MLO family protein [Theobroma cacao]
Length=491

 Score =   160 bits (406),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 80/108 (74%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = -3

Query  558  QPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIG  379
            QPSD+HFWF RPQIVL LIH ILFQN+FE+A FFWILVQY FDSCIMG V ++IPRLVIG
Sbjct  345  QPSDDHFWFHRPQIVLLLIHIILFQNSFELACFFWILVQYHFDSCIMGEVGYVIPRLVIG  404

Query  378  VIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQR  235
            VI+Q LCSYSTLP+YAIVTQMG+ FKK+IF+EH+Q G+  WA++AK +
Sbjct  405  VIVQFLCSYSTLPLYAIVTQMGSSFKKAIFEEHVQEGIAIWARRAKSK  452


 Score =   107 bits (267),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 52/60 (87%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVV FLLLNI+GWH YFWIAFIPF+LLLAVGT+LEHVI QLAHEVAEKHVAIEG+LVV
Sbjct  285  WLFVVAFLLLNIHGWHAYFWIAFIPFMLLLAVGTQLEHVITQLAHEVAEKHVAIEGDLVV  344



>ref|XP_008649648.1| PREDICTED: MLO-like protein 1 isoform X2 [Zea mays]
Length=466

 Score =   188 bits (477),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 80/111 (72%), Positives = 102/111 (92%), Gaps = 0/111 (0%)
 Frame = -3

Query  555  PSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIGV  376
            PSD+HFWFGRP+I+L LIHFILFQNAFE+AFFFWIL+ YG +SC M H+ F++PRLV+GV
Sbjct  341  PSDQHFWFGRPRIILHLIHFILFQNAFELAFFFWILMTYGLESCFMDHIGFLVPRLVLGV  400

Query  375  IIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            +IQ+LCSYSTLP+YAIVTQMG+++KK IF+EH+Q G++GWAQKAK+R G+K
Sbjct  401  VIQLLCSYSTLPLYAIVTQMGSYYKKEIFNEHVQQGVLGWAQKAKKRSGVK  451


 Score = 79.7 bits (195),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = -2

Query  709  NINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
             +NG H YFWIAF+P +LLLAVGTKLEHVI QLA++VAEK  AIEG+LVV
Sbjct  290  RLNGLHAYFWIAFLPLVLLLAVGTKLEHVIAQLAYDVAEKQTAIEGDLVV  339



>gb|EMT27451.1| MLO-like protein 1 [Aegilops tauschii]
Length=573

 Score =   159 bits (401),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 94/152 (62%), Gaps = 39/152 (26%)
 Frame = -3

Query  558  QPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIG  379
             PSDEHFW G+P+++L+LIHFILFQNAFEIA FFWIL  YGF+SCIM HV FI+PRLVIG
Sbjct  402  NPSDEHFWCGKPRVILYLIHFILFQNAFEIALFFWILTTYGFNSCIMDHVPFIVPRLVIG  461

Query  378  ---------------------------------------VIIQVLCSYSTLPIYAIVTQM  316
                                                   V+IQ+LCSYSTLP+YAIV QM
Sbjct  462  WVAIHRLTLLIMKKKKQANSHVFQVQAQRQLLVLPFACRVVIQLLCSYSTLPLYAIVAQM  521

Query  315  GTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKA  220
            GT F K IFDEHIQ GLVG  +  + R+ L A
Sbjct  522  GTFFNKEIFDEHIQQGLVGRGRTHQARRVLPA  553


 Score =   108 bits (270),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 50/60 (83%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVVIF+LLN+NGWHTYFWI+F+P ILLLAVGTKLEHVI QLAH+VAEKH AIEG+LVV
Sbjct  342  WIFVVIFMLLNVNGWHTYFWISFLPLILLLAVGTKLEHVIAQLAHDVAEKHSAIEGDLVV  401



>gb|KDO49761.1| hypothetical protein CISIN_1g044857mg, partial [Citrus sinensis]
Length=387

 Score =   161 bits (408),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 79/146 (54%), Positives = 101/146 (69%), Gaps = 10/146 (7%)
 Frame = -3

Query  558  QPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIG  379
            +PSD+HFWF +P++VL LIH ILFQN+          VQY F SCIMG   +IIPRL+IG
Sbjct  236  KPSDDHFWFRKPRLVLVLIHIILFQNS----------VQYKFHSCIMGPYGYIIPRLIIG  285

Query  378  VIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGINH  199
            + +Q  CSYSTLP+YAIVTQMG+ FKKSIFDEHIQ GLVGWA++AK+  GL+ A    ++
Sbjct  286  LFVQFFCSYSTLPLYAIVTQMGSSFKKSIFDEHIQEGLVGWAKQAKKNMGLRKAAAKGSN  345

Query  198  GGALTDGSSTGVQMGGVGRKESGSTD  121
                 D SS   QM  V  +++ + D
Sbjct  346  QVVHKDDSSASTQMTNVQSEQNSAID  371


 Score =   105 bits (263),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 50/60 (83%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            WVFVV+FLLLN++ WH YFWI+FIPFILLLAVGTKLEH+I QLAHEVAEKHVAIEG+L V
Sbjct  176  WVFVVVFLLLNVHNWHAYFWISFIPFILLLAVGTKLEHIITQLAHEVAEKHVAIEGDLYV  235



>ref|XP_004287195.1| PREDICTED: MLO-like protein 15 [Fragaria vesca subsp. vesca]
Length=536

 Score =   158 bits (399),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = -3

Query  558  QPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIG  379
            QPSD+HFWF RP++VL LIH ILFQN+FE+A FFWI +QY FDSC+MG + ++IPRLVIG
Sbjct  360  QPSDDHFWFRRPRLVLLLIHIILFQNSFELALFFWIWIQYKFDSCMMGKIGYVIPRLVIG  419

Query  378  VIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKG  229
              +Q +CSYSTLP+YAIVTQMGT FK +IFDEH+QVGL GWA+ AK+ + 
Sbjct  420  AFVQFVCSYSTLPLYAIVTQMGTSFKNAIFDEHVQVGLAGWAKSAKKHQA  469


 Score =   108 bits (270),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 51/60 (85%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVV+FLLLN+ GWH YFWIAF+PFILLLAVGTKLEHVIIQLAH+VAEKH+AIEG+LVV
Sbjct  300  WMFVVLFLLLNVAGWHAYFWIAFVPFILLLAVGTKLEHVIIQLAHDVAEKHIAIEGDLVV  359



>ref|XP_004242449.1| PREDICTED: MLO-like protein 1 [Solanum lycopersicum]
Length=511

 Score =   154 bits (389),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 89/102 (87%), Gaps = 0/102 (0%)
 Frame = -3

Query  555  PSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIGV  376
            PSD HFWF  PQI+L LIHFILFQNAFEIAFFFWIL QYGF SCIMG   F+IPRLVIGV
Sbjct  369  PSDNHFWFDNPQIILLLIHFILFQNAFEIAFFFWILFQYGFHSCIMGKYVFVIPRLVIGV  428

Query  375  IIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQ  250
            IIQVLCSYSTLP+YA+VTQMG+H+KKS+FD H+Q  LV WA+
Sbjct  429  IIQVLCSYSTLPLYALVTQMGSHYKKSMFDNHVQTCLVEWAE  470


 Score =   112 bits (280),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 53/60 (88%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FV++FLLLNINGWHTYFWIAF PFILLL+VGTKLEHVI+QLAHE+AEKHVAIEGELVV
Sbjct  308  WIFVILFLLLNINGWHTYFWIAFFPFILLLSVGTKLEHVILQLAHEIAEKHVAIEGELVV  367



>ref|XP_009620916.1| PREDICTED: MLO-like protein 1 [Nicotiana tomentosiformis]
Length=313

 Score =   163 bits (412),  Expect(2) = 5e-62, Method: Compositional matrix adjust.
 Identities = 91/151 (60%), Positives = 109/151 (72%), Gaps = 4/151 (3%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + +PSD+HFWF RP+IVL LIH IL QN+FEIAFFFWI  QY F+SCIMG V +IIPRLV
Sbjct  152  VVKPSDDHFWFHRPRIVLLLIHIILIQNSFEIAFFFWIWAQYHFNSCIMGQVGYIIPRLV  211

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGI  205
            IGV +Q LCSYSTLP+YAIVTQMG+ FKK IFDEHIQ GLV WA+KAK+R    A  G  
Sbjct  212  IGVFVQFLCSYSTLPLYAIVTQMGSSFKKEIFDEHIQDGLVFWAKKAKRR----AVNGSS  267

Query  204  NHGGALTDGSSTGVQMGGVGRKESGSTDGAS  112
              G   +  S+  VQ+  V  +E    +G +
Sbjct  268  QVGHKESSPSTMAVQLSQVEIQEFALEEGNA  298


 Score =   102 bits (255),  Expect(2) = 5e-62, Method: Compositional matrix adjust.
 Identities = 50/60 (83%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            WVFVV+FLLLN++GWHTYFWIAF+PF LLLAVGTKLEHVI QLA EVA KHVA+EG+LVV
Sbjct  94   WVFVVLFLLLNVHGWHTYFWIAFVPFGLLLAVGTKLEHVITQLAGEVAAKHVAVEGDLVV  153



>gb|KGN46257.1| hypothetical protein Csa_6G078520 [Cucumis sativus]
Length=464

 Score =   155 bits (393),  Expect(2) = 5e-62, Method: Compositional matrix adjust.
 Identities = 71/95 (75%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = -3

Query  558  QPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIG  379
            QPSD+HFWF RP+IVLFLIHFILFQNAFEI FFFWI VQYGFDSCIMG V++IIPRL+IG
Sbjct  360  QPSDDHFWFQRPRIVLFLIHFILFQNAFEIGFFFWIWVQYGFDSCIMGQVRYIIPRLIIG  419

Query  378  VIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQ  274
            V +QVLCSYSTLP+YAIVTQ+G   +K+   + I+
Sbjct  420  VFVQVLCSYSTLPLYAIVTQLGNVMRKASAPQEIK  454


 Score =   110 bits (274),  Expect(2) = 5e-62, Method: Compositional matrix adjust.
 Identities = 51/60 (85%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVV+FL LN++GWHTYFWIAFIPF+LLLAVGTKLEHVI QLAHEVAEKH+AIEG+LVV
Sbjct  300  WIFVVVFLFLNVSGWHTYFWIAFIPFVLLLAVGTKLEHVITQLAHEVAEKHIAIEGDLVV  359



>ref|XP_006857534.1| hypothetical protein AMTR_s00061p00034560 [Amborella trichopoda]
 gb|ERN19001.1| hypothetical protein AMTR_s00061p00034560 [Amborella trichopoda]
Length=528

 Score =   178 bits (451),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 87/163 (53%), Positives = 111/163 (68%), Gaps = 6/163 (4%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + +PSDEHFWF RP  VL+LIHFILFQN+FEIAFFFWI   YGFDSCIM  V +I+PRL+
Sbjct  357  VVKPSDEHFWFDRPNAVLYLIHFILFQNSFEIAFFFWIWSTYGFDSCIMEKVGYIVPRLI  416

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRK-----GLKA  220
             GVIIQVLCSYSTLP+YA+VTQMG+ FK +IF EH+Q+GL+GWA+ AK+++     GL +
Sbjct  417  FGVIIQVLCSYSTLPLYALVTQMGSTFKSAIFHEHMQLGLLGWAENAKKKRTRGSHGLFS  476

Query  219  AFGGINHGGALTDGSSTGVQMGGVGRKESGSTDGASVRALQQM  91
               G      L +  +  + +      E  +T      A Q M
Sbjct  477  LLKG-KKKEDLREKQTENMTINTAHHVEHQATSDGIAEASQLM  518


 Score = 86.7 bits (213),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 51/63 (81%), Gaps = 1/63 (2%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEK-HVAIEGELV  563
            W FVVIFLLLNI+GWHTYFWI+F+P ILLLAVGTKLEH+I +LA EV EK    +E  +V
Sbjct  299  WAFVVIFLLLNIDGWHTYFWISFLPLILLLAVGTKLEHIITRLAQEVEEKWKPGLEELVV  358

Query  562  VPT  554
             P+
Sbjct  359  KPS  361



>gb|KDO49428.1| hypothetical protein CISIN_1g0104501mg, partial [Citrus sinensis]
Length=437

 Score =   154 bits (388),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 69/80 (86%), Positives = 76/80 (95%), Gaps = 0/80 (0%)
 Frame = -3

Query  558  QPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIG  379
            QPSD+HFWF RPQIVLFLIHFILFQN+FEIAFFFWIL+QYGFDSCIMG V +I+PRL+IG
Sbjct  358  QPSDQHFWFNRPQIVLFLIHFILFQNSFEIAFFFWILIQYGFDSCIMGQVCYIVPRLIIG  417

Query  378  VIIQVLCSYSTLPIYAIVTQ  319
            V IQVLCSYSTLP+YAIVTQ
Sbjct  418  VFIQVLCSYSTLPLYAIVTQ  437


 Score =   110 bits (276),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 55/60 (92%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVVIFLLLNIN WHTYFWIAFIPFILLLAVG KLEHVI QLAHEVAEKH+AIEGELVV
Sbjct  298  WIFVVIFLLLNINEWHTYFWIAFIPFILLLAVGAKLEHVISQLAHEVAEKHIAIEGELVV  357



>ref|XP_002441108.1| hypothetical protein SORBIDRAFT_09g020560 [Sorghum bicolor]
 gb|EES19538.1| hypothetical protein SORBIDRAFT_09g020560 [Sorghum bicolor]
Length=458

 Score =   171 bits (433),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 76/112 (68%), Positives = 96/112 (86%), Gaps = 0/112 (0%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + +PSDEHFWFG+P+I+L+LIHFILFQN+FEIAFFFWIL  YGFDSCIM  V FI  RLV
Sbjct  347  IVKPSDEHFWFGKPRIILYLIHFILFQNSFEIAFFFWILTTYGFDSCIMESVGFIATRLV  406

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKG  229
            +GV+IQ++CSY TLP+YAIVTQMG+ +KK IF++H+Q G++ WA+K K R G
Sbjct  407  MGVVIQLICSYVTLPLYAIVTQMGSCYKKEIFNDHVQKGVLVWAEKVKTRGG  458


 Score = 93.6 bits (231),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVVIFL LN++GWH YFWI+F+P ILLLAVGTKLEH+I +L H+VA+KH AIE +++V
Sbjct  289  WIFVVIFLFLNVDGWHVYFWISFLPLILLLAVGTKLEHIIAELVHDVAKKHTAIEDDVIV  348



>gb|KDO49429.1| hypothetical protein CISIN_1g0104501mg, partial [Citrus sinensis]
Length=379

 Score =   153 bits (387),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 69/80 (86%), Positives = 76/80 (95%), Gaps = 0/80 (0%)
 Frame = -3

Query  558  QPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIG  379
            QPSD+HFWF RPQIVLFLIHFILFQN+FEIAFFFWIL+QYGFDSCIMG V +I+PRL+IG
Sbjct  300  QPSDQHFWFNRPQIVLFLIHFILFQNSFEIAFFFWILIQYGFDSCIMGQVCYIVPRLIIG  359

Query  378  VIIQVLCSYSTLPIYAIVTQ  319
            V IQVLCSYSTLP+YAIVTQ
Sbjct  360  VFIQVLCSYSTLPLYAIVTQ  379


 Score =   110 bits (276),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 55/60 (92%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVVIFLLLNIN WHTYFWIAFIPFILLLAVG KLEHVI QLAHEVAEKH+AIEGELVV
Sbjct  240  WIFVVIFLLLNINEWHTYFWIAFIPFILLLAVGAKLEHVISQLAHEVAEKHIAIEGELVV  299



>ref|XP_002523965.1| calmodulin binding protein, putative [Ricinus communis]
 gb|EEF38333.1| calmodulin binding protein, putative [Ricinus communis]
Length=458

 Score =   152 bits (385),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 82/97 (85%), Gaps = 0/97 (0%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + +PSD+HFWF +P IVLF IHFILFQNAFEIAFFFWI VQYGFDSCIMG VK+I+PRL+
Sbjct  353  IVKPSDDHFWFHKPHIVLFFIHFILFQNAFEIAFFFWIWVQYGFDSCIMGQVKYIVPRLI  412

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQ  274
            IGV IQ+LCSYSTLP+YAIVTQ+G   + +   E IQ
Sbjct  413  IGVFIQILCSYSTLPLYAIVTQLGRIGRNASTPEEIQ  449


 Score =   110 bits (276),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 52/60 (87%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVV+FLLLN+NGWHTYFWIAFIPF LLLAVGTKLEHVI QLAH+VAEKHVAIEG+L+V
Sbjct  295  WIFVVVFLLLNVNGWHTYFWIAFIPFALLLAVGTKLEHVISQLAHDVAEKHVAIEGDLIV  354



>ref|XP_007208676.1| hypothetical protein PRUPE_ppa024581mg [Prunus persica]
 gb|EMJ09875.1| hypothetical protein PRUPE_ppa024581mg [Prunus persica]
Length=463

 Score =   156 bits (394),  Expect(2) = 8e-61, Method: Compositional matrix adjust.
 Identities = 80/141 (57%), Positives = 105/141 (74%), Gaps = 4/141 (3%)
 Frame = -3

Query  558  QPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIG  379
            QPSD  FWF RP+++LFLIH ILFQN+F++A+FFW+  QY FDSCIMG V +IIPRL+IG
Sbjct  318  QPSDNQFWFHRPRLILFLIHIILFQNSFQLAYFFWLWYQYSFDSCIMGKVAYIIPRLIIG  377

Query  378  VIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGINH  199
              IQ +CSYST P+YAIVTQMG+ FKK+IF+EHIQ GL+GWA+ AK+ K L+     ++ 
Sbjct  378  AFIQFVCSYSTFPLYAIVTQMGSSFKKAIFEEHIQEGLIGWARSAKRNKPLR----RVDP  433

Query  198  GGALTDGSSTGVQMGGVGRKE  136
              A    + + V++G  G  E
Sbjct  434  KEACATVNESSVEVGTTGEIE  454


 Score =   105 bits (262),  Expect(2) = 8e-61, Method: Compositional matrix adjust.
 Identities = 52/60 (87%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVVIFLLLN+ GWH+YFWIAFIP ILLLAVGTKLEHVI QLA+EVAEKHVAIEG+LVV
Sbjct  258  WIFVVIFLLLNVWGWHSYFWIAFIPLILLLAVGTKLEHVITQLANEVAEKHVAIEGDLVV  317



>ref|XP_008227254.1| PREDICTED: MLO-like protein 1 [Prunus mume]
Length=463

 Score =   155 bits (393),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 80/141 (57%), Positives = 106/141 (75%), Gaps = 4/141 (3%)
 Frame = -3

Query  558  QPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIG  379
            QPSD+ FWF RP+++LFLIH ILFQN+F++A+FFW+  QY FDSCIMG V +IIPRL+IG
Sbjct  318  QPSDDQFWFHRPRLILFLIHIILFQNSFQLAYFFWLWYQYSFDSCIMGKVGYIIPRLIIG  377

Query  378  VIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGINH  199
              IQ +CSYST P+YAIVTQMG+ FKK+IF+EHIQ GL+GWA+ AK+ K L+     ++ 
Sbjct  378  AFIQFVCSYSTFPLYAIVTQMGSSFKKAIFEEHIQEGLIGWARSAKRNKPLRR----VDP  433

Query  198  GGALTDGSSTGVQMGGVGRKE  136
              A    + + V++G  G  E
Sbjct  434  KEACVTVNESSVEVGTTGEIE  454


 Score =   104 bits (260),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 51/60 (85%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVVIFLLLN+ GWH+YFWIAFIP ILLLAVGTKLEHVI QLA+EVAEKH+AIEG+LVV
Sbjct  258  WIFVVIFLLLNVWGWHSYFWIAFIPLILLLAVGTKLEHVITQLANEVAEKHIAIEGDLVV  317



>ref|XP_010251437.1| PREDICTED: MLO-like protein 1 isoform X1 [Nelumbo nucifera]
 ref|XP_010251438.1| PREDICTED: MLO-like protein 1 isoform X1 [Nelumbo nucifera]
Length=484

 Score =   160 bits (404),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 85/146 (58%), Positives = 106/146 (73%), Gaps = 8/146 (5%)
 Frame = -3

Query  555  PSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIGV  376
            PSD+ FWF +P+IVL LIH ILFQN+FEIA FFWI VQYGF SCIMGH+ +I PRLVIG 
Sbjct  345  PSDDLFWFRKPKIVLLLIHLILFQNSFEIALFFWIWVQYGFKSCIMGHIGYIFPRLVIGG  404

Query  375  IIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGINHG  196
             +QVLCSYSTLP+YAIVTQMG+H+K +IF+EHIQ  L+ WA+KAK+++ +          
Sbjct  405  FVQVLCSYSTLPLYAIVTQMGSHYKMAIFEEHIQHTLLNWAEKAKRKQRVAPDLS-----  459

Query  195  GALTDGSSTGVQMGGVGRKESGSTDG  118
               T   + GVQ+G    KES   +G
Sbjct  460  ---TGKPTEGVQLGKTRSKESEMEEG  482


 Score = 99.8 bits (247),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 48/60 (80%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FV IFLLLN++GW+TYFW+AFIPFILLL VGTKLE+VI QLAH+VAEKH AIEG+LVV
Sbjct  284  WLFVFIFLLLNVHGWNTYFWLAFIPFILLLVVGTKLEYVITQLAHKVAEKHYAIEGDLVV  343



>ref|XP_009794451.1| PREDICTED: MLO-like protein 1 isoform X2 [Nicotiana sylvestris]
Length=430

 Score =   145 bits (365),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 68/81 (84%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = -3

Query  558  QPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIG  379
            QPSD HFWF RPQIVLFLIHFILFQNAFEIAFFFWIL QYGF SCIMG   F+ PRLVIG
Sbjct  350  QPSDSHFWFDRPQIVLFLIHFILFQNAFEIAFFFWILFQYGFYSCIMGKYVFVAPRLVIG  409

Query  378  VIIQVLCSYSTLPIYAIVTQM  316
            V IQVLCSYSTLP+YA+VTQ+
Sbjct  410  VFIQVLCSYSTLPLYALVTQL  430


 Score =   114 bits (286),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 55/60 (92%), Positives = 60/60 (100%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FV++FLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHE+AEKHVA+EGELVV
Sbjct  290  WIFVILFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEIAEKHVAVEGELVV  349



>ref|XP_010054950.1| PREDICTED: MLO-like protein 1 [Eucalyptus grandis]
Length=506

 Score =   157 bits (396),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 84/150 (56%), Positives = 102/150 (68%), Gaps = 0/150 (0%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + QPSD+HFWF RP+IVL LIH +LFQNAFE+AFFF+I VQY  DSCIMG V FIIPRLV
Sbjct  350  VVQPSDDHFWFHRPRIVLLLIHILLFQNAFELAFFFFICVQYSSDSCIMGQVGFIIPRLV  409

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGI  205
            IGV +Q +CSYSTLP+YAIVTQMG+ FKK+IF+EHI  GL  W Q AK +K  +    G 
Sbjct  410  IGVSVQFMCSYSTLPLYAIVTQMGSSFKKAIFEEHIHEGLSVWTQHAKMKKNARMTATGT  469

Query  204  NHGGALTDGSSTGVQMGGVGRKESGSTDGA  115
                   D   T   +G   ++     D +
Sbjct  470  GSTTLPVDPKVTSQSLGEPTKEAEIQYDPS  499


 Score =   102 bits (254),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 48/60 (80%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVVIFLLLN  GWH YFWI+FIPF+LLLAVGTKLEHVI QLA +VAEKH A+EG+LVV
Sbjct  292  WIFVVIFLLLNYAGWHAYFWISFIPFLLLLAVGTKLEHVINQLAQDVAEKHAAVEGDLVV  351



>ref|XP_010040938.1| PREDICTED: MLO-like protein 1, partial [Eucalyptus grandis]
Length=309

 Score =   164 bits (415),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 89/142 (63%), Positives = 108/142 (76%), Gaps = 11/142 (8%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + QPSD+HFWF RP+++L LIH ILFQN+FE+AF  +IL++Y F  CIMG V FIIPRLV
Sbjct  159  VVQPSDDHFWFHRPRLILVLIHIILFQNSFELAFLLFILIRYKFKYCIMGEVHFIIPRLV  218

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGI  205
            IGV +Q+LCSYSTLP+YAIVTQMGT FKK+IFDEHIQ GLVGWA++AK+   L+      
Sbjct  219  IGVFVQLLCSYSTLPLYAIVTQMGTSFKKAIFDEHIQQGLVGWARQAKKNHNLRK-----  273

Query  204  NHGGALTDGSS--TGVQMGGVG  145
                  TDGSS  TG + G VG
Sbjct  274  ----TATDGSSVQTGSKQGLVG  291


 Score = 95.1 bits (235),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVV+FLLLN+ GWH YFWI+FIP  LLLAVGTKLEHVI +LA +VA++H+AI G+LVV
Sbjct  101  WLFVVVFLLLNVAGWHAYFWISFIPLTLLLAVGTKLEHVITRLAQDVAQRHIAIAGDLVV  160



>ref|XP_010251439.1| PREDICTED: MLO-like protein 1 isoform X2 [Nelumbo nucifera]
Length=477

 Score =   159 bits (403),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 85/146 (58%), Positives = 106/146 (73%), Gaps = 8/146 (5%)
 Frame = -3

Query  555  PSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIGV  376
            PSD+ FWF +P+IVL LIH ILFQN+FEIA FFWI VQYGF SCIMGH+ +I PRLVIG 
Sbjct  338  PSDDLFWFRKPKIVLLLIHLILFQNSFEIALFFWIWVQYGFKSCIMGHIGYIFPRLVIGG  397

Query  375  IIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGINHG  196
             +QVLCSYSTLP+YAIVTQMG+H+K +IF+EHIQ  L+ WA+KAK+++ +          
Sbjct  398  FVQVLCSYSTLPLYAIVTQMGSHYKMAIFEEHIQHTLLNWAEKAKRKQRVAPDLS-----  452

Query  195  GALTDGSSTGVQMGGVGRKESGSTDG  118
               T   + GVQ+G    KES   +G
Sbjct  453  ---TGKPTEGVQLGKTRSKESEMEEG  475


 Score = 99.8 bits (247),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 48/60 (80%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FV IFLLLN++GW+TYFW+AFIPFILLL VGTKLE+VI QLAH+VAEKH AIEG+LVV
Sbjct  277  WLFVFIFLLLNVHGWNTYFWLAFIPFILLLVVGTKLEYVITQLAHKVAEKHYAIEGDLVV  336



>ref|XP_004970845.1| PREDICTED: MLO-like protein 1-like isoform X2 [Setaria italica]
Length=487

 Score =   200 bits (509),  Expect(2) = 5e-59, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = -3

Query  570  NWLCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPR  391
            + +  PSDEHFWFGRP+IVL+LIHFILFQNAFEIAFFFWIL  YGF+SCIM HV FI+PR
Sbjct  330  DLVVNPSDEHFWFGRPKIVLYLIHFILFQNAFEIAFFFWILTTYGFNSCIMDHVPFIVPR  389

Query  390  LVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            LV+G  IQ++CSYSTLP+YAIVTQMGT FKK IFDEH+Q  LVGWAQKAK+RK LK
Sbjct  390  LVVGATIQLVCSYSTLPLYAIVTQMGTFFKKEIFDEHVQQSLVGWAQKAKKRKALK  445


 Score = 55.5 bits (132),  Expect(2) = 5e-59, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 35/43 (81%), Gaps = 2/43 (5%)
 Frame = -2

Query  688  YFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            +F I F+   LLLAVGTKLEHVI QLA EVAEKH AIEG+LVV
Sbjct  293  HFLICFVQ--LLLAVGTKLEHVITQLAIEVAEKHSAIEGDLVV  333



>ref|XP_006478540.1| PREDICTED: MLO-like protein 1-like [Citrus sinensis]
Length=498

 Score =   169 bits (427),  Expect(2) = 5e-59, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 95/117 (81%), Gaps = 0/117 (0%)
 Frame = -3

Query  558  QPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIG  379
            +PSD+HFW  +P++VL LIH ILFQN+FE+A FFWILVQYGF SCIMG V++IIPRLVIG
Sbjct  354  KPSDDHFWLHKPKLVLTLIHIILFQNSFELAVFFWILVQYGFHSCIMGSVEYIIPRLVIG  413

Query  378  VIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGG  208
            V +QVLCSYS LP+YAIV QMG+ FKK+IF E+IQ GL+ WA+KA++    +    G
Sbjct  414  VFVQVLCSYSILPLYAIVVQMGSKFKKAIFKENIQEGLIHWAKKARKNNERRNRLDG  470


 Score = 86.7 bits (213),  Expect(2) = 5e-59, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            WV VVIFLL N+   H YFWI+F+P ILL+ VGTKL+H++ QLA +VAEKH+A+EG+LVV
Sbjct  294  WVIVVIFLLANVQDLHAYFWISFVPLILLICVGTKLQHILTQLAQDVAEKHMAVEGDLVV  353



>ref|XP_008649647.1| PREDICTED: MLO-like protein 1 isoform X1 [Zea mays]
Length=467

 Score =   188 bits (477),  Expect(2) = 8e-59, Method: Compositional matrix adjust.
 Identities = 80/111 (72%), Positives = 102/111 (92%), Gaps = 0/111 (0%)
 Frame = -3

Query  555  PSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIGV  376
            PSD+HFWFGRP+I+L LIHFILFQNAFE+AFFFWIL+ YG +SC M H+ F++PRLV+GV
Sbjct  342  PSDQHFWFGRPRIILHLIHFILFQNAFELAFFFWILMTYGLESCFMDHIGFLVPRLVLGV  401

Query  375  IIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            +IQ+LCSYSTLP+YAIVTQMG+++KK IF+EH+Q G++GWAQKAK+R G+K
Sbjct  402  VIQLLCSYSTLPLYAIVTQMGSYYKKEIFNEHVQQGVLGWAQKAKKRSGVK  452


 Score = 67.0 bits (162),  Expect(2) = 8e-59, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 43/60 (72%), Gaps = 11/60 (18%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVVIFLLLN+N              LLLAVGTKLEHVI QLA++VAEK  AIEG+LVV
Sbjct  292  WIFVVIFLLLNVNA-----------STLLLAVGTKLEHVIAQLAYDVAEKQTAIEGDLVV  340



>ref|XP_009399302.1| PREDICTED: MLO-like protein 1 [Musa acuminata subsp. malaccensis]
Length=495

 Score =   155 bits (391),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 80/125 (64%), Positives = 101/125 (81%), Gaps = 2/125 (2%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            +  PSD++FWF RP+I+LFLIH ILFQNAF+IAF FW+   YG DSCI  H  F +PRLV
Sbjct  355  IVMPSDDYFWFHRPRILLFLIHLILFQNAFDIAFIFWLFTPYGLDSCITDHFGFAVPRLV  414

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKA--AFG  211
            IG+I+Q+LCSYSTLP+YAIVTQMGTHFKK++FD++++ GL  WAQKAK+R  LK    FG
Sbjct  415  IGIIVQILCSYSTLPLYAIVTQMGTHFKKTVFDDNVRGGLEDWAQKAKKRLSLKEDNEFG  474

Query  210  GINHG  196
            G ++G
Sbjct  475  GSSNG  479


 Score = 97.8 bits (242),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W +V+IFLLLNINGWHTYFWIAF+P ILLL+VGTKLEHVI ++AH VAEK+ AI G+L+V
Sbjct  297  WAYVIIFLLLNINGWHTYFWIAFVPLILLLSVGTKLEHVITEIAHNVAEKYFAIGGDLIV  356



>ref|XP_006441978.1| hypothetical protein CICLE_v10023336mg, partial [Citrus clementina]
 gb|ESR55218.1| hypothetical protein CICLE_v10023336mg, partial [Citrus clementina]
Length=474

 Score =   166 bits (421),  Expect(2) = 5e-58, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 95/117 (81%), Gaps = 0/117 (0%)
 Frame = -3

Query  558  QPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIG  379
            +PSD+HFW  +P++VL LIH ILFQN+FE+A FFWILVQYGF SCIMG V++IIPRLVIG
Sbjct  354  KPSDDHFWLHKPKLVLTLIHIILFQNSFELAVFFWILVQYGFHSCIMGSVEYIIPRLVIG  413

Query  378  VIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGG  208
            V +QVLCSYS LP+YAIV QMG+ FKK+IF E+IQ GL+ WA+KA++    +    G
Sbjct  414  VFVQVLCSYSILPLYAIVVQMGSKFKKAIFKENIQEGLIHWAKKARKNIERRNRLDG  470


 Score = 85.9 bits (211),  Expect(2) = 5e-58, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            WV V+IFLL N+   H YFWI+F+P ILL+ VGTKL+H++ QLA +VAEKH+A+EG+LVV
Sbjct  294  WVIVIIFLLANVQDLHAYFWISFVPLILLICVGTKLQHILTQLAQDVAEKHMAVEGDLVV  353



>ref|XP_011460878.1| PREDICTED: MLO-like protein 1 isoform X2 [Fragaria vesca subsp. 
vesca]
Length=485

 Score =   148 bits (374),  Expect(2) = 8e-58, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 94/110 (85%), Gaps = 0/110 (0%)
 Frame = -3

Query  558  QPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIG  379
            +PSD+HFW  RP++VL LIH ILFQN+FE+AF FWI VQY FDSC+MG + ++IPRLVIG
Sbjct  306  RPSDDHFWLRRPRLVLLLIHIILFQNSFELAFCFWIWVQYNFDSCMMGKIGYVIPRLVIG  365

Query  378  VIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKG  229
            V +Q +CSYSTLP+YAIVTQMGT FKK+IFDEH+Q GLVGWA+ A++ + 
Sbjct  366  VFVQFVCSYSTLPLYAIVTQMGTSFKKAIFDEHVQEGLVGWAKSARKHQA  415


 Score =   103 bits (256),  Expect(2) = 8e-58, Method: Compositional matrix adjust.
 Identities = 47/60 (78%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVV+FLLLN+ GWH YFW +F+PF LLLAVGTKLEHVIIQLAH+VA+KH+AIEG+LVV
Sbjct  246  WIFVVLFLLLNVAGWHIYFWTSFVPFFLLLAVGTKLEHVIIQLAHDVADKHMAIEGDLVV  305



>ref|XP_004294225.1| PREDICTED: MLO-like protein 15 isoform X1 [Fragaria vesca subsp. 
vesca]
Length=524

 Score =   148 bits (374),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 94/110 (85%), Gaps = 0/110 (0%)
 Frame = -3

Query  558  QPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIG  379
            +PSD+HFW  RP++VL LIH ILFQN+FE+AF FWI VQY FDSC+MG + ++IPRLVIG
Sbjct  345  RPSDDHFWLRRPRLVLLLIHIILFQNSFELAFCFWIWVQYNFDSCMMGKIGYVIPRLVIG  404

Query  378  VIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKG  229
            V +Q +CSYSTLP+YAIVTQMGT FKK+IFDEH+Q GLVGWA+ A++ + 
Sbjct  405  VFVQFVCSYSTLPLYAIVTQMGTSFKKAIFDEHVQEGLVGWAKSARKHQA  454


 Score =   102 bits (255),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 47/60 (78%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVV+FLLLN+ GWH YFW +F+PF LLLAVGTKLEHVIIQLAH+VA+KH+AIEG+LVV
Sbjct  285  WIFVVLFLLLNVAGWHIYFWTSFVPFFLLLAVGTKLEHVIIQLAHDVADKHMAIEGDLVV  344



>ref|XP_011469571.1| PREDICTED: MLO-like protein 1 [Fragaria vesca subsp. vesca]
Length=463

 Score =   150 bits (379),  Expect(2) = 9e-57, Method: Compositional matrix adjust.
 Identities = 72/115 (63%), Positives = 85/115 (74%), Gaps = 4/115 (3%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            L +PSD+HFWFGRP  VLFLIHFILFQNAFE+AFF WI  QYGF SCIMG  ++I PR++
Sbjct  336  LVKPSDQHFWFGRPSFVLFLIHFILFQNAFEMAFFLWIWAQYGFRSCIMGKAEYIFPRIL  395

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDE----HIQVGLVGWAQKAKQRK  232
            IG  IQ L SYSTLP+YAIVTQMG++FKK IF E      +     W+  A +RK
Sbjct  396  IGTFIQFLTSYSTLPLYAIVTQMGSNFKKEIFVEGSVHTTRRNQSNWSHIATRRK  450


 Score = 97.8 bits (242),  Expect(2) = 9e-57, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVV FLL+NI+G H YFW+AFIPF LLLA GTKL+H+I QLAHEVAEKHVA+EG+L+V
Sbjct  278  WIFVVFFLLINIDGVHAYFWLAFIPFFLLLATGTKLQHIITQLAHEVAEKHVAVEGDLLV  337



>ref|XP_010930330.1| PREDICTED: MLO-like protein 1 [Elaeis guineensis]
Length=496

 Score =   156 bits (395),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 88/111 (79%), Gaps = 0/111 (0%)
 Frame = -3

Query  552  SDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIGVI  373
            SD  FWF RP+IVL LIHFILFQNA  IA FFW+ + +GF SCI G + F I RLVIGV 
Sbjct  336  SDNLFWFHRPRIVLILIHFILFQNALGIALFFWLWMTFGFASCINGPLGFNITRLVIGVT  395

Query  372  IQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKA  220
            +Q+LCSYSTLP+YAI+TQMG+ FKK IFDEHIQ GLVGW Q+A+ R G +A
Sbjct  396  VQILCSYSTLPLYAIITQMGSSFKKVIFDEHIQEGLVGWVQEARLRVGQRA  446


 Score = 91.3 bits (225),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVVIFL++NI+GW TYF+++F P +LLLAVGTKL HV+ QLA EVAEKH AIEG+LV+
Sbjct  274  WIFVVIFLVMNIHGWRTYFYVSFSPLVLLLAVGTKLVHVMTQLAKEVAEKHSAIEGDLVI  333



>ref|XP_009600155.1| PREDICTED: MLO-like protein 1 isoform X1 [Nicotiana tomentosiformis]
Length=554

 Score =   186 bits (471),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 98/144 (68%), Positives = 112/144 (78%), Gaps = 2/144 (1%)
 Frame = -3

Query  558  QPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIG  379
            QPSD HFWF RPQIVLFLIHFILFQNAFEIAFFFWIL QYGF SCIMG   F+ PRLVIG
Sbjct  411  QPSDSHFWFDRPQIVLFLIHFILFQNAFEIAFFFWILFQYGFYSCIMGKYVFVTPRLVIG  470

Query  378  VIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGINH  199
            V IQVLCSYSTLP+YA+VTQMG+H+KKS+FD+H+Q  L+ WA+K K++K  KAA  G NH
Sbjct  471  VFIQVLCSYSTLPLYALVTQMGSHYKKSMFDDHVQACLIEWAEKVKKKKAQKAARDGSNH  530

Query  198  GGALTDGSSTGVQMGGVGRKESGS  127
                 DG + G  M   G KES +
Sbjct  531  ST--DDGFTIGSPMSVHGSKESPN  552


 Score = 62.0 bits (149),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 31/34 (91%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = -2

Query  661  ILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            +LLLAVGTKLEHVIIQLAHE+AEKHVA+EGELVV
Sbjct  377  LLLLAVGTKLEHVIIQLAHEIAEKHVAVEGELVV  410


 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLA  647
            W+FV++FLLLNINGWHTYFWIAFIPFI ++ 
Sbjct  290  WIFVILFLLLNINGWHTYFWIAFIPFIDMIT  320



>ref|XP_010066114.1| PREDICTED: MLO-like protein 1 [Eucalyptus grandis]
Length=491

 Score =   157 bits (396),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 85/140 (61%), Positives = 104/140 (74%), Gaps = 11/140 (8%)
 Frame = -3

Query  558  QPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIG  379
            QPSD+HFWF RP ++L LIH ILFQN+FE+AF  +I ++Y  +SC+M  + FIIPRLVIG
Sbjct  318  QPSDDHFWFHRPCLILVLIHIILFQNSFELAFLLFISIRYKLNSCMMREIHFIIPRLVIG  377

Query  378  VIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGINH  199
            V +Q+LCSYSTLP+YAIVTQMGT FKK+IFDEHIQ GLVGWAQ+AK+   L+        
Sbjct  378  VFVQLLCSYSTLPLYAIVTQMGTSFKKAIFDEHIQQGLVGWAQQAKKNNNLRK-------  430

Query  198  GGALTDGSS--TGVQMGGVG  145
                TDGSS  T  + G VG
Sbjct  431  --PATDGSSVQTSSKQGLVG  448


 Score = 90.1 bits (222),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FV +FLLL++ GWH +FWI+FIP  LLLAVGTKLEHVI +LA +VA++H+AI G+LVV
Sbjct  258  WLFVAVFLLLSVAGWHAHFWISFIPLTLLLAVGTKLEHVITRLAQDVAQRHIAIAGDLVV  317



>ref|XP_008806171.1| PREDICTED: MLO-like protein 13 isoform X2 [Phoenix dactylifera]
Length=552

 Score =   176 bits (446),  Expect(2) = 5e-56, Method: Compositional matrix adjust.
 Identities = 85/150 (57%), Positives = 106/150 (71%), Gaps = 2/150 (1%)
 Frame = -3

Query  558  QPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIG  379
            +PSD  FWF RP IVL+LIHFILFQN+FEIAFFFWI   YGFDSCIM  + +IIPRL+IG
Sbjct  375  KPSDHLFWFHRPGIVLYLIHFILFQNSFEIAFFFWIWSTYGFDSCIMEKIGYIIPRLIIG  434

Query  378  VIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRK--GLKAAFGGI  205
            V++QVLCSYSTLP+YAIVTQMG  FKK+IFD H+++ L GWA+ A++RK  G+ +     
Sbjct  435  VMVQVLCSYSTLPLYAIVTQMGDMFKKAIFDVHLRLTLHGWAEGARKRKRPGISSFLNKF  494

Query  204  NHGGALTDGSSTGVQMGGVGRKESGSTDGA  115
            +      D S   VQM  +  + S     A
Sbjct  495  SSKSKRQDKSGNEVQMQKMASEASAGFQNA  524


 Score = 69.7 bits (169),  Expect(2) = 5e-56, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 50/63 (79%), Gaps = 1/63 (2%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV-AIEGELV  563
            W+FV+IFLLLN+NGWH+YFW++F+P ILLLAVGTKLEH+I +L+ E AEK     E   V
Sbjct  315  WLFVIIFLLLNVNGWHSYFWLSFLPLILLLAVGTKLEHIITRLSQEAAEKPADEQEAPRV  374

Query  562  VPT  554
             P+
Sbjct  375  KPS  377



>ref|XP_008806170.1| PREDICTED: MLO-like protein 13 isoform X1 [Phoenix dactylifera]
Length=565

 Score =   176 bits (446),  Expect(2) = 5e-56, Method: Compositional matrix adjust.
 Identities = 85/150 (57%), Positives = 106/150 (71%), Gaps = 2/150 (1%)
 Frame = -3

Query  558  QPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIG  379
            +PSD  FWF RP IVL+LIHFILFQN+FEIAFFFWI   YGFDSCIM  + +IIPRL+IG
Sbjct  388  KPSDHLFWFHRPGIVLYLIHFILFQNSFEIAFFFWIWSTYGFDSCIMEKIGYIIPRLIIG  447

Query  378  VIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRK--GLKAAFGGI  205
            V++QVLCSYSTLP+YAIVTQMG  FKK+IFD H+++ L GWA+ A++RK  G+ +     
Sbjct  448  VMVQVLCSYSTLPLYAIVTQMGDMFKKAIFDVHLRLTLHGWAEGARKRKRPGISSFLNKF  507

Query  204  NHGGALTDGSSTGVQMGGVGRKESGSTDGA  115
            +      D S   VQM  +  + S     A
Sbjct  508  SSKSKRQDKSGNEVQMQKMASEASAGFQNA  537


 Score = 69.7 bits (169),  Expect(2) = 5e-56, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 50/63 (79%), Gaps = 1/63 (2%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV-AIEGELV  563
            W+FV+IFLLLN+NGWH+YFW++F+P ILLLAVGTKLEH+I +L+ E AEK     E   V
Sbjct  328  WLFVIIFLLLNVNGWHSYFWLSFLPLILLLAVGTKLEHIITRLSQEAAEKPADEQEAPRV  387

Query  562  VPT  554
             P+
Sbjct  388  KPS  390



>gb|EAY86311.1| hypothetical protein OsI_07684 [Oryza sativa Indica Group]
Length=449

 Score =   152 bits (385),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 70/101 (69%), Positives = 81/101 (80%), Gaps = 0/101 (0%)
 Frame = -3

Query  558  QPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIG  379
             PSDE FWF RP+IVL LIH +LFQNAFEIAFFFW+LV YGF SCIMG+  ++I RLVI 
Sbjct  301  SPSDELFWFHRPKIVLLLIHIVLFQNAFEIAFFFWLLVTYGFKSCIMGNKGYVIARLVIS  360

Query  378  VIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGW  256
            VI Q+LC YSTLP+YAIV+ MGT FKK IFDE++  GL  W
Sbjct  361  VISQLLCGYSTLPLYAIVSHMGTSFKKVIFDENVAEGLANW  401


 Score = 90.9 bits (224),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W  ++IFLLLN+ GW+ Y WI+ +PF++LL VGTKLEH+I +LAH+VAEKH AIEGELVV
Sbjct  241  WAMLIIFLLLNVQGWYVYIWISAVPFVMLLVVGTKLEHIITELAHQVAEKHTAIEGELVV  300



>ref|XP_011460879.1| PREDICTED: MLO-like protein 1 [Fragaria vesca subsp. vesca]
Length=200

 Score =   154 bits (388),  Expect(2) = 9e-55, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 93/112 (83%), Gaps = 0/112 (0%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + +PSD+HFWF RP++ L LIH ILFQN+FE+A FFWI +QY FDSC+MG + ++IPRLV
Sbjct  66   VVRPSDDHFWFRRPRLSLLLIHIILFQNSFELALFFWIWIQYKFDSCMMGKIGYVIPRLV  125

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKG  229
            IG  +Q +CSYSTLP+YAIVTQMGT FKK+IFDEH+Q GLVGW + A++ + 
Sbjct  126  IGAFVQFVCSYSTLPLYAIVTQMGTSFKKAIFDEHVQEGLVGWDKSARKHQA  177


 Score = 87.8 bits (216),  Expect(2) = 9e-55, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = -2

Query  709  NINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            N+ GWH YFW++F+PF LLLAVGTKLEHVIIQLAH+VAEKH+ IEG+LVV
Sbjct  18   NVAGWHAYFWMSFVPFFLLLAVGTKLEHVIIQLAHDVAEKHITIEGDLVV  67



>gb|EEE57203.1| hypothetical protein OsJ_07160 [Oryza sativa Japonica Group]
Length=497

 Score =   151 bits (381),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 70/103 (68%), Positives = 82/103 (80%), Gaps = 0/103 (0%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            +  PSDE FWF RP+IVL LIH +LFQNAFEIAFFFW+LV YGF SCIMG+  ++I RLV
Sbjct  347  VVSPSDELFWFHRPKIVLLLIHIVLFQNAFEIAFFFWLLVTYGFKSCIMGNKGYVIARLV  406

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGW  256
            I VI Q+LC YSTLP+YAIV+ MGT FKK IFDE++  GL  W
Sbjct  407  ISVISQLLCGYSTLPLYAIVSHMGTSFKKVIFDENVVEGLANW  449


 Score = 90.5 bits (223),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W  ++IFLLLN+ GW+ Y WI+ +PF++LL VGTKLEH+I +LAH+VAEKH AIEGELVV
Sbjct  289  WAMLIIFLLLNVQGWYVYIWISAVPFVMLLVVGTKLEHIITELAHQVAEKHTAIEGELVV  348



>emb|CDY30455.1| BnaA04g25560D [Brassica napus]
Length=672

 Score =   160 bits (404),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 99/127 (78%), Gaps = 0/127 (0%)
 Frame = -3

Query  570  NWLCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPR  391
            + + +PSD+ FWF  P++VLFLIHFILFQN+FE+AF F+I  QYGFDSCIMG VKFIIPR
Sbjct  337  DLVVRPSDDLFWFKSPRLVLFLIHFILFQNSFELAFIFFIFAQYGFDSCIMGQVKFIIPR  396

Query  390  LVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFG  211
            LVIGV++Q+LCSYSTLP+YA+V QMG+ FK +IF +  Q  + GWA+ AK  K   +   
Sbjct  397  LVIGVLVQLLCSYSTLPLYALVAQMGSSFKGAIFTDQAQQQIAGWAKSAKMAKKKGSTHA  456

Query  210  GINHGGA  190
            G +HGG+
Sbjct  457  GSSHGGS  463


 Score = 81.3 bits (199),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            WVFVV+FLLLNI  WH YFW+AF+P ILLLAVG KLEH+I  LAHEVAEKH+A+EG+LVV
Sbjct  281  WVFVVLFLLLNIAAWHVYFWLAFLPLILLLAVGMKLEHIITDLAHEVAEKHIAVEGDLVV  340



>gb|EYU36622.1| hypothetical protein MIMGU_mgv1a005184mg [Erythranthe guttata]
Length=494

 Score =   146 bits (368),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 72/103 (70%), Positives = 89/103 (86%), Gaps = 0/103 (0%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + +PSD+ FWF +P++VL LIH +LFQNAFEIA FFW+LV YGF+SCIMG V F+IPRL+
Sbjct  343  VVKPSDDLFWFRKPRLVLLLIHVLLFQNAFEIAIFFWMLVMYGFNSCIMGSVGFVIPRLI  402

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGW  256
            IGVI+Q+LCSYSTLPIYAIV QMG+ F  +IF++ IQVGLVGW
Sbjct  403  IGVIVQLLCSYSTLPIYAIVAQMGSSFNSAIFEDRIQVGLVGW  445


 Score = 94.7 bits (234),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FV++FLL+N+ GWH YFWI+FIP ++LLAVGTKLEH+I QLA EVAEKH+A+ G++VV
Sbjct  285  WLFVILFLLVNVTGWHAYFWISFIPLLILLAVGTKLEHIISQLAQEVAEKHIAVAGDVVV  344



>emb|CDY23418.1| BnaC04g49460D [Brassica napus]
Length=511

 Score =   159 bits (401),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 77/123 (63%), Positives = 97/123 (79%), Gaps = 0/123 (0%)
 Frame = -3

Query  558  QPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIG  379
            +PSD+ FWF  P++VLFLIHFILFQN+FE+AF F+I  QYGFDSCIMG VKFIIPRLVIG
Sbjct  341  RPSDDLFWFKSPRLVLFLIHFILFQNSFELAFIFFIFAQYGFDSCIMGQVKFIIPRLVIG  400

Query  378  VIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGINH  199
            V++Q+LCSYSTLP+YA+V QMG+ FK +IF +  Q  + GWA+ AK  K   +   G +H
Sbjct  401  VLVQLLCSYSTLPLYALVAQMGSSFKGAIFTDQAQQQIAGWAKSAKMAKKKGSTHAGSSH  460

Query  198  GGA  190
            GG+
Sbjct  461  GGS  463


 Score = 81.3 bits (199),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            WVFVV+FLLLNI  WH YFW+AF+P ILLLAVG KLEH+I  LAHEVAEKH+A+EG+LVV
Sbjct  281  WVFVVLFLLLNIAAWHVYFWLAFLPLILLLAVGMKLEHIITDLAHEVAEKHIAVEGDLVV  340



>ref|XP_011026717.1| PREDICTED: endoglucanase 25-like isoform X3 [Populus euphratica]
Length=1093

 Score =   156 bits (394),  Expect(2) = 2e-54, Method: Composition-based stats.
 Identities = 75/150 (50%), Positives = 97/150 (65%), Gaps = 0/150 (0%)
 Frame = -3

Query  558   QPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIG  379
             +PSDEHFW  +P IVL LI FILFQN+FEIAFFFWI   YGF SCIM  V +I+PRL++G
Sbjct  943   KPSDEHFWLEKPAIVLDLIQFILFQNSFEIAFFFWIWSTYGFRSCIMERVGYIVPRLIMG  1002

Query  378   VIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGINH  199
             +++QVLCSYSTLP+YA+V+QMGT F+K +F E ++  +  WA  AK ++      G    
Sbjct  1003  LVVQVLCSYSTLPLYALVSQMGTRFRKGMFGEDMEAAIEIWAGGAKGKRDPSENHGARMD  1062

Query  198   GGALTDGSSTGVQMGGVGRKESGSTDGASV  109
               A     S   +M  +G  E  S   A V
Sbjct  1063  KLATESSHSAAQEMVIIGGTELSSVTQAPV  1092


 Score = 84.0 bits (206),  Expect(2) = 2e-54, Method: Composition-based stats.
 Identities = 34/62 (55%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+F+V+FLL+N+ GWHT+FW++F+P ILLL VG KLEH+I  L H VAE  V ++   V 
Sbjct  884  WLFIVMFLLMNVEGWHTFFWLSFLPVILLLLVGAKLEHIITSLGHRVAEMPVPVDEARVK  943

Query  559  PT  554
            P+
Sbjct  944  PS  945



>ref|XP_009142246.1| PREDICTED: MLO-like protein 15 [Brassica rapa]
Length=502

 Score =   159 bits (401),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 99/127 (78%), Gaps = 0/127 (0%)
 Frame = -3

Query  570  NWLCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPR  391
            + + +PSD+ FWF  P++VLFLIHFILFQN+FE+AF F+I  QYGFDSCIMG VKFIIPR
Sbjct  337  DLVVRPSDDLFWFKSPRLVLFLIHFILFQNSFELAFIFFIFAQYGFDSCIMGQVKFIIPR  396

Query  390  LVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFG  211
            LVIGV++Q+LCSYSTLP+YA+V QMG+ FK +IF +  Q  + GWA+ AK  K   +   
Sbjct  397  LVIGVLVQLLCSYSTLPLYALVAQMGSSFKGAIFTDQAQQQIAGWAKSAKMAKKKGSTHA  456

Query  210  GINHGGA  190
            G +HGG+
Sbjct  457  GSSHGGS  463


 Score = 81.3 bits (199),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            WVFVV+FLLLNI  WH YFW+AF+P ILLLAVG KLEH+I  LAHEVAEKH+A+EG+LVV
Sbjct  281  WVFVVLFLLLNIAAWHVYFWLAFLPLILLLAVGMKLEHIITDLAHEVAEKHIAVEGDLVV  340



>gb|EYU22367.1| hypothetical protein MIMGU_mgv1a0228202mg, partial [Erythranthe 
guttata]
Length=319

 Score =   145 bits (366),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 72/103 (70%), Positives = 89/103 (86%), Gaps = 0/103 (0%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + +PSD+ FWF +P++VL LIH +LFQNAFEIA FFW+LV YGF+SCIMG V F+IPRL+
Sbjct  168  VVKPSDDLFWFRKPRLVLLLIHVLLFQNAFEIAIFFWMLVMYGFNSCIMGSVGFVIPRLI  227

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGW  256
            IGVI+Q+LCSYSTLPIYAIV QMG+ F  +IF++ IQVGLVGW
Sbjct  228  IGVIVQLLCSYSTLPIYAIVAQMGSSFNSAIFEDRIQVGLVGW  270


 Score = 94.4 bits (233),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FV++FLL+N+ GWH YFWI+FIP ++LLAVGTKLEH+I QLA EVAEKH+A+ G++VV
Sbjct  110  WLFVILFLLVNVTGWHAYFWISFIPLLILLAVGTKLEHIISQLAQEVAEKHIAVAGDVVV  169



>gb|EMT25264.1| MLO-like protein 1 [Aegilops tauschii]
Length=291

 Score =   155 bits (392),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 69/106 (65%), Positives = 86/106 (81%), Gaps = 0/106 (0%)
 Frame = -3

Query  555  PSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIGV  376
            PSD+ FWF RP++VL LIH ++FQNAFEIAFFFW+LV YGF SCIMG   ++I R+VI V
Sbjct  168  PSDDFFWFHRPKLVLLLIHIVVFQNAFEIAFFFWLLVTYGFKSCIMGKPAYVITRVVISV  227

Query  375  IIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQ  238
            I Q +C YSTLP+YAIV+QMG  FKKSI DE++  GLV WA+KA++
Sbjct  228  ISQFICGYSTLPLYAIVSQMGNSFKKSIIDENVNEGLVNWAEKARR  273


 Score = 84.0 bits (206),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W  ++IFLLLN+ GW+ Y WI+ +PFI+LL VG+K+EH+I +LA+EVA+KH AI GELVV
Sbjct  107  WTVLMIFLLLNVQGWYVYIWISVVPFIMLLVVGSKMEHIITELAYEVAQKHTAICGELVV  166



>ref|XP_008802140.1| PREDICTED: MLO-like protein 1 [Phoenix dactylifera]
Length=498

 Score =   144 bits (364),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 86/139 (62%), Positives = 101/139 (73%), Gaps = 7/139 (5%)
 Frame = -3

Query  558  QPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWI----LVQYGFDSCIMGHVKFIIPR  391
            +PSD  FWF RP+++L LIHF+LF N+ EIA FFWI    L  +GFDSCI G V F I R
Sbjct  330  KPSDNLFWFQRPRLILILIHFLLFLNSLEIALFFWIWVGSLSGFGFDSCINGSVGFNIAR  389

Query  390  LVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAF-  214
            LVIGV +Q+LCSYSTLP+YAI+TQMGT FKK IFDEHIQ GLVGWAQ+AK R G +A   
Sbjct  390  LVIGVTVQLLCSYSTLPLYAIITQMGTSFKKVIFDEHIQEGLVGWAQQAKMRVGQRADNY  449

Query  213  -GGINHGGALTDGSSTGVQ  160
              G +H G   DG+   VQ
Sbjct  450  QTGPSHVGP-KDGTLVAVQ  467


 Score = 94.7 bits (234),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVVIFL+LNI+GWHTYF++AF P +LLLAVGTKL HV+ QLA  VAEKH AIEG+LV+
Sbjct  270  WIFVVIFLMLNIHGWHTYFYVAFGPLVLLLAVGTKLAHVMTQLAKAVAEKHSAIEGDLVI  329



>ref|XP_002299404.2| hypothetical protein POPTR_0001s11880g [Populus trichocarpa]
 gb|EEE84209.2| hypothetical protein POPTR_0001s11880g [Populus trichocarpa]
Length=488

 Score =   156 bits (394),  Expect(2) = 8e-54, Method: Compositional matrix adjust.
 Identities = 76/150 (51%), Positives = 97/150 (65%), Gaps = 0/150 (0%)
 Frame = -3

Query  558  QPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIG  379
            +PSDEHFW  +P IVL LI FILFQN+FEIAFFFWI   YGF SCIM  V +I+PRL++G
Sbjct  338  KPSDEHFWLEKPAIVLDLIQFILFQNSFEIAFFFWIWSTYGFRSCIMERVGYIVPRLIMG  397

Query  378  VIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGINH  199
            +++QVLCSYSTLP+YA+V+QMGT F+K +F E ++  +  WA  AK ++      G   H
Sbjct  398  LVVQVLCSYSTLPLYALVSQMGTSFRKGMFGEDVETAIGIWAGGAKDKRDPSENHGARMH  457

Query  198  GGALTDGSSTGVQMGGVGRKESGSTDGASV  109
              A     S   +M   G  E  S   A V
Sbjct  458  KLATESSHSAAQEMVIDGGTELSSVTQAPV  487


 Score = 82.4 bits (202),  Expect(2) = 8e-54, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+F+V+FLL+N+ GWHT+FW++F+P ILLL VG KLEH+I  L H VAEK V I+   V 
Sbjct  279  WLFIVMFLLMNVEGWHTFFWLSFLPVILLLLVGAKLEHIITSLGHRVAEKTVPIDEARVK  338

Query  559  PT  554
            P+
Sbjct  339  PS  340



>ref|XP_006648751.1| PREDICTED: MLO-like protein 1-like [Oryza brachyantha]
Length=496

 Score =   145 bits (365),  Expect(2) = 5e-53, Method: Compositional matrix adjust.
 Identities = 80/134 (60%), Positives = 98/134 (73%), Gaps = 3/134 (2%)
 Frame = -3

Query  555  PSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIGV  376
            PSDE FWF RP++VL LIH +LFQNAFEIAFFFW+LV YGF+SCIMG+  ++I RLVI V
Sbjct  349  PSDELFWFHRPKLVLLLIHIVLFQNAFEIAFFFWLLVTYGFNSCIMGNKGYVIARLVISV  408

Query  375  IIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGINHG  196
            + Q+LC YS+LP+YAIV+ MGT FKK IFDE++  GL  WAQKA  R   +      N G
Sbjct  409  VSQLLCGYSSLPLYAIVSHMGTSFKKVIFDENVAEGLANWAQKA--RNNARGGARTQNVG  466

Query  195  GALTDGSSTG-VQM  157
             +  D S+ G VQM
Sbjct  467  DSPVDESNGGAVQM  480


 Score = 90.5 bits (223),  Expect(2) = 5e-53, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W  ++IFLLLN+ GW+ Y WI+ +PF++LL VGTKLEH+I +LAH+VAEKH AIEGELVV
Sbjct  288  WAMLIIFLLLNVQGWYVYIWISAVPFVMLLVVGTKLEHIITELAHQVAEKHTAIEGELVV  347



>ref|XP_010672534.1| PREDICTED: MLO-like protein 15 [Beta vulgaris subsp. vulgaris]
Length=537

 Score =   154 bits (388),  Expect(2) = 5e-53, Method: Compositional matrix adjust.
 Identities = 78/143 (55%), Positives = 99/143 (69%), Gaps = 0/143 (0%)
 Frame = -3

Query  555  PSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIGV  376
            PSD+HFWF +P+++L LIH ILFQN+FE+AFFFWI VQYGFDSCIMG + + +PRLVI  
Sbjct  337  PSDDHFWFHKPRLLLLLIHIILFQNSFEVAFFFWIWVQYGFDSCIMGSIGYTVPRLVIAA  396

Query  375  IIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGINHG  196
             +Q +CSYSTLP+YAIVTQMG+ F K+IF+++IQ GL+ WAQKAK+ K   +A       
Sbjct  397  FVQFVCSYSTLPLYAIVTQMGSSFNKAIFEDYIQEGLISWAQKAKKTKTTLSAHTTTKQS  456

Query  195  GALTDGSSTGVQMGGVGRKESGS  127
                   S    M     K S S
Sbjct  457  AFTKRTRSMPAAMKLFDNKGSTS  479


 Score = 81.6 bits (200),  Expect(2) = 5e-53, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIE  575
            W+FVV+FL LN+NG+H YFWIAFIP ILL  VGTKLEH+IIQLA +VA+     E
Sbjct  274  WLFVVVFLFLNVNGYHAYFWIAFIPLILLFGVGTKLEHIIIQLAKQVAQSRRQSE  328



>ref|XP_004952743.1| PREDICTED: MLO-like protein 1-like [Setaria italica]
Length=497

 Score =   154 bits (388),  Expect(2) = 9e-53, Method: Compositional matrix adjust.
 Identities = 85/148 (57%), Positives = 106/148 (72%), Gaps = 7/148 (5%)
 Frame = -3

Query  555  PSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIGV  376
            PSDE FWF RP++VL LIH ILFQNAFEIAFFFW+LV YGF SCIMG   ++I RLVI V
Sbjct  354  PSDELFWFHRPKLVLLLIHIILFQNAFEIAFFFWLLVIYGFKSCIMGKPAYVITRLVISV  413

Query  375  IIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGINHG  196
            I Q+LC YSTLP+YAI++QMG+ FKK++FD++I  GL  WAQ A+QRK + A     N G
Sbjct  414  ISQLLCGYSTLPLYAIISQMGSSFKKAMFDQNISEGLTNWAQNARQRKRMPAT----NVG  469

Query  195  GALTDGSSTGVQMGGVGRKESGSTDGAS  112
             +  DG   G+QM    R+ S   +G +
Sbjct  470  DSSPDGE--GIQMVN-ARRVSAMEEGTA  494


 Score = 81.3 bits (199),  Expect(2) = 9e-53, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W  ++IFLLLN++GW+ Y W++ +PF+ LL VG+KLEH+I +LA EVA+KH AIEG+LVV
Sbjct  293  WALLMIFLLLNVHGWYVYIWLSVVPFLALLVVGSKLEHIITELALEVAQKHTAIEGDLVV  352



>ref|XP_011026716.1| PREDICTED: MLO-like protein 13 isoform X2 [Populus euphratica]
Length=488

 Score =   155 bits (391),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 75/150 (50%), Positives = 97/150 (65%), Gaps = 0/150 (0%)
 Frame = -3

Query  558  QPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIG  379
            +PSDEHFW  +P IVL LI FILFQN+FEIAFFFWI   YGF SCIM  V +I+PRL++G
Sbjct  338  KPSDEHFWLEKPAIVLDLIQFILFQNSFEIAFFFWIWSTYGFRSCIMERVGYIVPRLIMG  397

Query  378  VIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGINH  199
            +++QVLCSYSTLP+YA+V+QMGT F+K +F E ++  +  WA  AK ++      G    
Sbjct  398  LVVQVLCSYSTLPLYALVSQMGTRFRKGMFGEDMEAAIEIWAGGAKGKRDPSENHGARMD  457

Query  198  GGALTDGSSTGVQMGGVGRKESGSTDGASV  109
              A     S   +M  +G  E  S   A V
Sbjct  458  KLATESSHSAAQEMVIIGGTELSSVTQAPV  487


 Score = 79.3 bits (194),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+F+V+FLL+N+ GWHT+FW++F+P ILLL VG KLEH+I  L H VAE  V ++   V 
Sbjct  279  WLFIVMFLLMNVEGWHTFFWLSFLPVILLLLVGAKLEHIITSLGHRVAEMPVPVDEARVK  338

Query  559  PT  554
            P+
Sbjct  339  PS  340



>gb|EYU33241.1| hypothetical protein MIMGU_mgv1a017858mg, partial [Erythranthe 
guttata]
Length=460

 Score =   153 bits (387),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = -3

Query  552  SDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIGVI  373
            SDE FWF RP +VL+LIHFILFQN+FEIAFFFWI   YGF SCIM  + FIIPRLVIGVI
Sbjct  349  SDELFWFHRPTLVLYLIHFILFQNSFEIAFFFWIWTTYGFKSCIMEGLNFIIPRLVIGVI  408

Query  372  IQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAK  241
            +QVLCSYSTLP+YA+VTQMG+ FK+++FDE     ++ WA+  K
Sbjct  409  VQVLCSYSTLPLYALVTQMGSMFKQTVFDEFTHDLILTWAKDRK  452


 Score = 80.9 bits (198),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEG  572
            W+FVVIFLL+NI GWH YFW++F+P ILLL VG KLEH+I QLA + AE+   +EG
Sbjct  288  WMFVVIFLLMNIAGWHAYFWMSFLPLILLLIVGAKLEHIITQLAKDAAERSGDVEG  343



>ref|XP_011026715.1| PREDICTED: MLO-like protein 13 isoform X1 [Populus euphratica]
Length=510

 Score =   154 bits (390),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 75/150 (50%), Positives = 97/150 (65%), Gaps = 0/150 (0%)
 Frame = -3

Query  558  QPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIG  379
            +PSDEHFW  +P IVL LI FILFQN+FEIAFFFWI   YGF SCIM  V +I+PRL++G
Sbjct  360  KPSDEHFWLEKPAIVLDLIQFILFQNSFEIAFFFWIWSTYGFRSCIMERVGYIVPRLIMG  419

Query  378  VIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGINH  199
            +++QVLCSYSTLP+YA+V+QMGT F+K +F E ++  +  WA  AK ++      G    
Sbjct  420  LVVQVLCSYSTLPLYALVSQMGTRFRKGMFGEDMEAAIEIWAGGAKGKRDPSENHGARMD  479

Query  198  GGALTDGSSTGVQMGGVGRKESGSTDGASV  109
              A     S   +M  +G  E  S   A V
Sbjct  480  KLATESSHSAAQEMVIIGGTELSSVTQAPV  509


 Score = 79.3 bits (194),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+F+V+FLL+N+ GWHT+FW++F+P ILLL VG KLEH+I  L H VAE  V ++   V 
Sbjct  301  WLFIVMFLLMNVEGWHTFFWLSFLPVILLLLVGAKLEHIITSLGHRVAEMPVPVDEARVK  360

Query  559  PT  554
            P+
Sbjct  361  PS  362



>gb|KJB56407.1| hypothetical protein B456_009G118700 [Gossypium raimondii]
Length=484

 Score =   152 bits (384),  Expect(2) = 5e-52, Method: Compositional matrix adjust.
 Identities = 72/116 (62%), Positives = 86/116 (74%), Gaps = 3/116 (3%)
 Frame = -3

Query  558  QPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIG  379
            +PSDEHFWF  P+IV FLIHFILFQNAFE+AFFFWIL  YGF SCIM  + +II RL++G
Sbjct  332  KPSDEHFWFKNPRIVFFLIHFILFQNAFELAFFFWILCTYGFHSCIMEKLGYIITRLIMG  391

Query  378  VIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQ---RKGLKA  220
            VI+QVLCSY TLP+Y +VTQMG+ FK+ IF EHI   L  W    +    R+G  A
Sbjct  392  VIVQVLCSYITLPLYVLVTQMGSCFKEGIFKEHIHSTLTTWRSGPRDQGSRRGSSA  447


 Score = 80.1 bits (196),  Expect(2) = 5e-52, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVVIFLLLN+ GW+TYFW++F+P +LLL VGTKLEH+II+LA E++E     E   V 
Sbjct  273  WLFVVIFLLLNVKGWNTYFWLSFLPVVLLLIVGTKLEHIIIRLAQEMSEMKERGETAQVK  332

Query  559  PT  554
            P+
Sbjct  333  PS  334



>ref|XP_008678707.1| PREDICTED: MLO-like protein 1 [Zea mays]
Length=479

 Score =   153 bits (387),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 79/148 (53%), Positives = 105/148 (71%), Gaps = 7/148 (5%)
 Frame = -3

Query  555  PSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIGV  376
            PSDE FWF RP++VL LIH ILFQNAFEIAFFFW+LV YGF+SCIMG   ++I R+VI V
Sbjct  336  PSDELFWFHRPKLVLLLIHIILFQNAFEIAFFFWLLVTYGFNSCIMGKPAYVITRVVISV  395

Query  375  IIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGINHG  196
            I QVLC YSTLP+YA+++QMG+ FKK+IFDE++  GL+ WA+ A++R  +  + G  +  
Sbjct  396  ISQVLCGYSTLPLYALISQMGSSFKKAIFDENVSEGLINWAENARRRNRMPTSVGDNSPV  455

Query  195  GALTDGSSTGVQMGGVGRKESGSTDGAS  112
            G        G+QM    ++ES    G +
Sbjct  456  GE-------GIQMSNQTQRESSMEQGTA  476


 Score = 77.8 bits (190),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W  ++IFLLLN++GW+ Y WI+ IPFILLL +G+K+EH+I +LA EV +KH AIEG LVV
Sbjct  275  WGMLMIFLLLNVHGWYVYIWISVIPFILLLVLGSKMEHIITELALEVIQKHTAIEGVLVV  334



>dbj|BAJ24153.1| seven trans-membrane protein [Triticum aestivum]
Length=492

 Score =   145 bits (367),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 79/155 (51%), Positives = 101/155 (65%), Gaps = 8/155 (5%)
 Frame = -3

Query  576  RVNWLCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFII  397
            R + +  PSD  FWF RP++VL LIH +LFQNAFEIAFFFW+LV YGF SCIMG   ++I
Sbjct  336  RGDLVVSPSDNFFWFHRPKLVLLLIHIVLFQNAFEIAFFFWLLVTYGFKSCIMGKPAYVI  395

Query  396  PRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAA  217
             R+VI VI QVLC YSTLP+YA+V+ MG  FKK+IFDE++  GLV WA+KA++       
Sbjct  396  TRVVISVICQVLCGYSTLPLYAVVSHMGNSFKKTIFDENVTEGLVNWAEKARR-------  448

Query  216  FGGINHGGALTDGSSTGVQMGGVGRKESGSTDGAS  112
             G        TD SS+ +     G  +  +T   S
Sbjct  449  -GTRTPNKITTDASSSPIDEANGGAVQMTNTRANS  482


 Score = 84.3 bits (207),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W  ++IFLLLN+ GW+ Y WI  +PFI+LL VG+K+EH+I +LA+EVA+KH AI G+LVV
Sbjct  282  WAMLMIFLLLNVEGWYVYIWITLVPFIMLLMVGSKMEHIITELAYEVAQKHTAIRGDLVV  341



>ref|XP_007023831.1| Glycosyl hydrolase 9A1 [Theobroma cacao]
 gb|EOY26453.1| Glycosyl hydrolase 9A1 [Theobroma cacao]
Length=1080

 Score =   156 bits (394),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 78/157 (50%), Positives = 98/157 (62%), Gaps = 15/157 (10%)
 Frame = -3

Query  558   QPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIG  379
             +PSDEHFWFGRP IVL LIHFILFQN+FE+AFFFWIL  YGF SCIM  V +IIPRL++G
Sbjct  921   KPSDEHFWFGRPGIVLHLIHFILFQNSFELAFFFWILCTYGFRSCIMEKVGYIIPRLIMG  980

Query  378   VIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGINH  199
             V++QVLCSY TLP+Y +VTQMG+ FK+ +FD+ +   L  W Q  +              
Sbjct  981   VMVQVLCSYITLPLYVLVTQMGSKFKEGMFDDFVVESLGKWRQGRR--------------  1026

Query  198   GGALTDGSSTGVQMGGVGRKESGSTDGASVRALQQMG  88
              G  + G S+   +G V R    S     +   Q M 
Sbjct  1027  -GETSMGGSSSAHVGQVHRITKESCQSIQIEEKQTMN  1062


 Score = 73.9 bits (180),  Expect(2) = 2e-51, Method: Composition-based stats.
 Identities = 38/62 (61%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVV+FLLLN+ GWHTYFW++F+P +LLL VG KLEH+II+LA +V EK    EG  V 
Sbjct  862  WLFVVVFLLLNVKGWHTYFWLSFLPVVLLLLVGAKLEHIIIRLAQDVIEKRERGEGAQVK  921

Query  559  PT  554
            P+
Sbjct  922  PS  923



>gb|EYU29404.1| hypothetical protein MIMGU_mgv1a004805mg [Erythranthe guttata]
Length=509

 Score =   152 bits (385),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 93/111 (84%), Gaps = 0/111 (0%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + +PSD HFWF +P++VL LIH +LFQN+FEIA FFW+LV YGF+SCIMG V +IIPRLV
Sbjct  343  VVKPSDHHFWFRKPRLVLILIHILLFQNSFEIAIFFWMLVMYGFNSCIMGQVGYIIPRLV  402

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRK  232
            IGV++Q +CSYSTLP+YAIVTQMG+ F ++IF E IQV L GWAQK K+ K
Sbjct  403  IGVLVQFVCSYSTLPLYAIVTQMGSSFNRAIFGEDIQVKLTGWAQKVKKNK  453


 Score = 77.8 bits (190),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+ VV+FL+LN++GWH YFWIAF+P ILLL VGTKLEH+I +LA EVA++HVA+ GELVV
Sbjct  285  WIVVVVFLVLNVHGWHAYFWIAFLPLILLLIVGTKLEHIITELAQEVAQRHVAVTGELVV  344



>ref|XP_003575162.1| PREDICTED: MLO-like protein 1 [Brachypodium distachyon]
Length=495

 Score =   145 bits (366),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 78/150 (52%), Positives = 100/150 (67%), Gaps = 2/150 (1%)
 Frame = -3

Query  555  PSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIGV  376
            PSD+ FWF RP++VL LIH +LFQNAFEIAFF W+LV YGF SCIMG   + I R+VI V
Sbjct  346  PSDDFFWFHRPKLVLLLIHIVLFQNAFEIAFFLWLLVTYGFKSCIMGKPAYAITRVVISV  405

Query  375  IIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGINHG  196
            + Q+LC YSTLP+YAIV+QMG  FKKSIFDE++  GLV WA+KA++R  +      +   
Sbjct  406  VSQLLCGYSTLPLYAIVSQMGNSFKKSIFDENVTEGLVNWAEKARRRTRIPNN-SSVGAS  464

Query  195  GALTDGSSTG-VQMGGVGRKESGSTDGASV  109
             +  DG + G +QM       S     A +
Sbjct  465  SSPIDGVNGGAIQMANTQANSSAEEGTARL  494


 Score = 84.3 bits (207),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W  ++IFLLLN++GW+ Y WI+ +PFI+LL VG+K+EH+I +LA+EVA+KH AI+G+LVV
Sbjct  285  WAMLMIFLLLNVHGWYVYIWISVVPFIMLLLVGSKMEHIITELAYEVAQKHTAIQGDLVV  344



>gb|EMT22302.1| MLO-like protein 1 [Aegilops tauschii]
Length=418

 Score =   146 bits (368),  Expect(2) = 4e-51, Method: Compositional matrix adjust.
 Identities = 83/143 (58%), Positives = 99/143 (69%), Gaps = 11/143 (8%)
 Frame = -3

Query  552  SDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIGVI  373
            SDE FWF RP++VL LIH ILFQNAFEIAFFFW+LV YGF SCIMG   + I RLVI VI
Sbjct  284  SDEFFWFHRPKLVLLLIHIILFQNAFEIAFFFWLLVTYGFKSCIMGKPAYAIARLVISVI  343

Query  372  IQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGINHGG  193
             Q+LC YSTLP+YA+++QMG+ FKK++FDE I  GL  WA KA++R    AA  G     
Sbjct  344  GQLLCGYSTLPLYALISQMGSSFKKAMFDESISEGLANWAHKARKRNTKPAASVG-----  398

Query  192  ALTDGSSTG--VQMGGVGRKESG  130
               D SS G  +QM    R+ES 
Sbjct  399  ---DNSSVGEEIQMTN-ARRESA  417


 Score = 83.2 bits (204),  Expect(2) = 4e-51, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W  ++IFLLLN++GWH Y WI+  PFILLL VG+KLEH+I +LA +VA+K+ AIEGELVV
Sbjct  222  WAMLMIFLLLNVHGWHVYIWISIAPFILLLLVGSKLEHIITELAIDVAQKNTAIEGELVV  281



>gb|EMT12340.1| MLO-like protein 1 [Aegilops tauschii]
Length=551

 Score =   144 bits (364),  Expect(2) = 4e-51, Method: Compositional matrix adjust.
 Identities = 78/155 (50%), Positives = 101/155 (65%), Gaps = 8/155 (5%)
 Frame = -3

Query  576  RVNWLCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFII  397
            R + +  PSD  FWF RP++VL LIH +LFQNAFEIAFFFW+LV YGF SCIMG   ++I
Sbjct  395  RGDLVVSPSDNFFWFHRPKLVLLLIHIVLFQNAFEIAFFFWLLVTYGFKSCIMGKPAYVI  454

Query  396  PRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAA  217
             R+VI VI QVLC YSTLP+YA+V+ MG  FKK+IFD+++  GLV WA+KA++       
Sbjct  455  TRVVISVICQVLCGYSTLPLYAVVSHMGNSFKKTIFDDNVTEGLVNWAEKARR-------  507

Query  216  FGGINHGGALTDGSSTGVQMGGVGRKESGSTDGAS  112
             G        TD SS+ +     G  +  +T   S
Sbjct  508  -GTRTPNKITTDASSSPIDEANGGAVQMTNTRANS  541


 Score = 84.7 bits (208),  Expect(2) = 4e-51, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W  ++IFLLLN+ GW+ Y WI  +PFI+LL VG+K+EH+I +LA+EVA+KH AI G+LVV
Sbjct  341  WAMLMIFLLLNVEGWYVYIWITLVPFIMLLVVGSKMEHIITELAYEVAQKHTAIRGDLVV  400



>ref|XP_008798739.1| PREDICTED: MLO-like protein 13 [Phoenix dactylifera]
Length=529

 Score =   169 bits (427),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 80/132 (61%), Positives = 98/132 (74%), Gaps = 4/132 (3%)
 Frame = -3

Query  558  QPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIG  379
            +PSDEHFWF RP IVL+LIHFILFQNAFEIAFFFWI   YGF SCIM  V +++PRLV G
Sbjct  355  KPSDEHFWFNRPDIVLYLIHFILFQNAFEIAFFFWIWTTYGFKSCIMESVGYLVPRLVFG  414

Query  378  VIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRK----GLKAAFG  211
            VIIQ+LCSYSTLP+YAIV+QMG  FK++IF E + + L GW + A++RK    GL +  G
Sbjct  415  VIIQLLCSYSTLPLYAIVSQMGDMFKRAIFAERLHLLLHGWVEGARKRKRAGPGLSSVLG  474

Query  210  GINHGGALTDGS  175
               H    ++ S
Sbjct  475  WFGHKDKKSNHS  486


 Score = 58.9 bits (141),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAH  605
            W+FVVIFLLLN++GWHTYFW++F+P ILLL VG KLEH+I +LAH
Sbjct  295  WLFVVIFLLLNVHGWHTYFWLSFLPLILLLVVGAKLEHIITRLAH  339



>ref|XP_010913231.1| PREDICTED: MLO-like protein 13 isoform X4 [Elaeis guineensis]
Length=431

 Score =   141 bits (355),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = -3

Query  558  QPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIG  379
            +PSD HFWF RP I+L+LIHFILFQN+FEIAFFFWI   YGFDSCIMG + +IIPRL+IG
Sbjct  346  KPSDHHFWFRRPGIILYLIHFILFQNSFEIAFFFWIWSTYGFDSCIMGKIGYIIPRLIIG  405

Query  378  VIIQVLCSYSTLPIYAIVTQM  316
            V +QVLCSYSTLP+YAIVTQ+
Sbjct  406  VTVQVLCSYSTLPLYAIVTQL  426


 Score = 86.7 bits (213),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 49/63 (78%), Gaps = 1/63 (2%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV-AIEGELV  563
            W+FV+IFLLLN+NGWHTYFW++F+P I LLAVGTKLEH+I +L  E AEKH    E   V
Sbjct  286  WLFVIIFLLLNVNGWHTYFWLSFLPLIPLLAVGTKLEHIITRLTQEAAEKHADEQEAPSV  345

Query  562  VPT  554
             P+
Sbjct  346  KPS  348



>ref|XP_002454019.1| hypothetical protein SORBIDRAFT_04g023170 [Sorghum bicolor]
 gb|EES06995.1| hypothetical protein SORBIDRAFT_04g023170 [Sorghum bicolor]
Length=533

 Score =   148 bits (374),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 78/150 (52%), Positives = 103/150 (69%), Gaps = 10/150 (7%)
 Frame = -3

Query  555  PSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIGV  376
            PSDE FWF RP++VL LIH ILFQNAFEIA FFW+LV YGF+SCIMG   + I R+VI V
Sbjct  389  PSDELFWFHRPKLVLLLIHIILFQNAFEIALFFWLLVTYGFNSCIMGEPAYAIIRVVISV  448

Query  375  IIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGINHG  196
            I Q+LC YSTLP+YA+++QMG+ FKK+IFDE+I  GL  WA+ A++R  +          
Sbjct  449  ISQLLCGYSTLPLYALISQMGSSFKKAIFDENISEGLTNWAENARRRNRMATT-------  501

Query  195  GALTDGSS--TGVQMGGVGRKESGSTDGAS  112
             +++D S    G+QM    ++ES    G +
Sbjct  502  -SVSDNSPIGEGIQMSNKAQRESAMEQGTA  530


 Score = 79.0 bits (193),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W  ++IFLLLN++GW+ Y W++  PFILLL +G+K+EH+I +LA EVA+KH AIEG LVV
Sbjct  328  WAMLMIFLLLNVHGWYVYIWLSVAPFILLLVLGSKMEHIITELALEVAQKHTAIEGVLVV  387



>dbj|BAJ91124.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=487

 Score =   143 bits (360),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 76/151 (50%), Positives = 101/151 (67%), Gaps = 6/151 (4%)
 Frame = -3

Query  576  RVNWLCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFII  397
            R + +  PSD+ FWF RP++VL LIH +LFQNAFEIAFFFW+LV YGF SCIMG   ++I
Sbjct  335  RGDLVVAPSDDFFWFHRPKLVLLLIHVVLFQNAFEIAFFFWLLVTYGFKSCIMGKPAYVI  394

Query  396  PRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQ--RKGLK  223
             R+VI VI Q+LC YSTLP+YAIV+ MG  FKK+IFD+++  GLV WA+KA++  R+  K
Sbjct  395  TRIVISVICQLLCGYSTLPLYAIVSHMGNSFKKTIFDDNVSEGLVNWAEKARRGARRPNK  454

Query  222  AAFGGINHGGA----LTDGSSTGVQMGGVGR  142
                 I+        +T+  +      G  R
Sbjct  455  TTIEPIDEANVGAVQMTNTRTNSSVEKGTAR  485


 Score = 84.3 bits (207),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W  ++IFLLLN+ GW+ Y WI  +PFI+LL VG+K+EH+I +LA+EVA+KH AI G+LVV
Sbjct  281  WAMLMIFLLLNVQGWYVYIWITLVPFIMLLVVGSKMEHIITELAYEVAQKHTAIRGDLVV  340



>ref|XP_010247041.1| PREDICTED: MLO-like protein 13 isoform X2 [Nelumbo nucifera]
Length=525

 Score =   154 bits (389),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 74/146 (51%), Positives = 98/146 (67%), Gaps = 1/146 (1%)
 Frame = -3

Query  558  QPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIG  379
            +PSDEHFWFGRPQIVL+LIHFILF+NAFEIAFF WI   +GF SC++  + ++IPR++IG
Sbjct  344  KPSDEHFWFGRPQIVLYLIHFILFENAFEIAFFAWIWCTFGFKSCMVEKLGYVIPRIIIG  403

Query  378  VIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGINH  199
            V +QVLCSYSTLP++AIVTQMG+ FKK IF  H++  +VGWA   +  +       G N 
Sbjct  404  VAVQVLCSYSTLPLFAIVTQMGSAFKKGIFS-HLEDDIVGWAATRRMTRRTSTVKSGGNT  462

Query  198  GGALTDGSSTGVQMGGVGRKESGSTD  121
                    ++ ++ G     E  S  
Sbjct  463  TDEREPSRTSTMKHGRNTMSEPSSNS  488


 Score = 72.0 bits (175),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKH  587
            W+FVVIFLLLN +GWHT+FW++F P ILLL VG KLEH+I +LA +V +++
Sbjct  284  WLFVVIFLLLNEHGWHTFFWLSFSPLILLLLVGAKLEHIITRLAEDVEQRN  334



>dbj|BAJ94381.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=487

 Score =   143 bits (360),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 76/151 (50%), Positives = 101/151 (67%), Gaps = 6/151 (4%)
 Frame = -3

Query  576  RVNWLCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFII  397
            R + +  PSD+ FWF RP++VL LIH +LFQNAFEIAFFFW+LV YGF SCIMG   ++I
Sbjct  335  RGDLVVAPSDDFFWFHRPKLVLLLIHVVLFQNAFEIAFFFWLLVTYGFKSCIMGKPAYVI  394

Query  396  PRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQ--RKGLK  223
             R+VI VI Q+LC YSTLP+YAIV+ MG  FKK+IFD+++  GLV WA+KA++  R+  K
Sbjct  395  TRIVISVICQLLCGYSTLPLYAIVSHMGNSFKKTIFDDNVSEGLVNWAEKARRGARRPNK  454

Query  222  AAFGGINHGGA----LTDGSSTGVQMGGVGR  142
                 I+        +T+  +      G  R
Sbjct  455  TTIEPIDEANVGAVQMTNTRTNSSVEKGTAR  485


 Score = 83.2 bits (204),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W  ++IFLLLN  GW+ Y WI  +PFI+LL VG+K+EH+I +LA+EVA+KH AI G+LVV
Sbjct  281  WAMLMIFLLLNAQGWYVYIWITLVPFIMLLVVGSKMEHIITELAYEVAQKHTAIRGDLVV  340



>ref|XP_010247040.1| PREDICTED: MLO-like protein 13 isoform X1 [Nelumbo nucifera]
Length=529

 Score =   154 bits (389),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 74/146 (51%), Positives = 98/146 (67%), Gaps = 1/146 (1%)
 Frame = -3

Query  558  QPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIG  379
            +PSDEHFWFGRPQIVL+LIHFILF+NAFEIAFF WI   +GF SC++  + ++IPR++IG
Sbjct  348  KPSDEHFWFGRPQIVLYLIHFILFENAFEIAFFAWIWCTFGFKSCMVEKLGYVIPRIIIG  407

Query  378  VIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGINH  199
            V +QVLCSYSTLP++AIVTQMG+ FKK IF  H++  +VGWA   +  +       G N 
Sbjct  408  VAVQVLCSYSTLPLFAIVTQMGSAFKKGIFS-HLEDDIVGWAATRRMTRRTSTVKSGGNT  466

Query  198  GGALTDGSSTGVQMGGVGRKESGSTD  121
                    ++ ++ G     E  S  
Sbjct  467  TDEREPSRTSTMKHGRNTMSEPSSNS  492


 Score = 72.0 bits (175),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKH  587
            W+FVVIFLLLN +GWHT+FW++F P ILLL VG KLEH+I +LA +V +++
Sbjct  288  WLFVVIFLLLNEHGWHTFFWLSFSPLILLLLVGAKLEHIITRLAEDVEQRN  338



>gb|AAK38341.1| seven transmembrane protein Mlo5, partial [Zea mays]
Length=149

 Score =   172 bits (437),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 85/137 (62%), Positives = 98/137 (72%), Gaps = 3/137 (2%)
 Frame = -3

Query  504  IHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIGVIIQVLCSYSTLPIYAIV  325
            IHFILFQNAFEIAFFFWIL  YGF+SCIM HV FI+PRLV+G IIQ+LCSYSTLP+YAIV
Sbjct  1    IHFILFQNAFEIAFFFWILTTYGFNSCIMDHVPFIVPRLVVGAIIQLLCSYSTLPLYAIV  60

Query  324  TQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGINHGGALTDGSSTGVQMGGVG  145
            TQMGT FKK IFDEH+Q  L+GWAQKAK+RK L+    G N   A +   S   ++  + 
Sbjct  61   TQMGTFFKKEIFDEHVQQSLLGWAQKAKKRKALRNNGNGSNGAAAGSSHPSATARLELMR  120

Query  144  RK---ESGSTDGASVRA  103
            R    E GS  G    A
Sbjct  121  RAVALEEGSAGGNGSEA  137



>gb|AAS93431.1| Mlo3 [Hordeum vulgare subsp. vulgare]
Length=491

 Score =   145 bits (365),  Expect(2) = 5e-50, Method: Compositional matrix adjust.
 Identities = 78/155 (50%), Positives = 102/155 (66%), Gaps = 8/155 (5%)
 Frame = -3

Query  576  RVNWLCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFII  397
            R + +  PSD+ FWF RP++VL LIH +LFQNAF+IAFFFW+LV YGF SCIMG   ++I
Sbjct  335  RGDLVVAPSDDFFWFHRPKLVLLLIHIVLFQNAFQIAFFFWLLVTYGFKSCIMGKPAYVI  394

Query  396  PRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAA  217
             R+VI VI Q+LC YSTLP+YAIV+ MG  FKK+IFDE++  GLV WA+KA++       
Sbjct  395  TRVVISVICQILCGYSTLPLYAIVSHMGNSFKKTIFDENVTEGLVNWAEKARR-------  447

Query  216  FGGINHGGALTDGSSTGVQMGGVGRKESGSTDGAS  112
             G        TD SS+ +     G  +  +T   S
Sbjct  448  -GTRTPNKITTDASSSPIDEANGGIVQMTNTRANS  481


 Score = 80.9 bits (198),  Expect(2) = 5e-50, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W  ++IFLLLN+ GW+ Y WI  +PFI+LL V +K+EH+I +LA+EVA KH AI G+LVV
Sbjct  281  WAMLMIFLLLNVEGWYVYIWITLVPFIMLLVVASKMEHIITELAYEVAHKHTAIRGDLVV  340



>ref|XP_010913978.1| PREDICTED: MLO-like protein 13 [Elaeis guineensis]
Length=424

 Score =   166 bits (421),  Expect(2) = 5e-50, Method: Compositional matrix adjust.
 Identities = 84/156 (54%), Positives = 104/156 (67%), Gaps = 17/156 (11%)
 Frame = -3

Query  558  QPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIG  379
            +PSDEHFWF RP I+L+LIHFILFQNAFEIAFFFWI   YGF SCIM  V ++IPRLV G
Sbjct  253  KPSDEHFWFNRPGIMLYLIHFILFQNAFEIAFFFWIWSTYGFHSCIMESVGYLIPRLVFG  312

Query  378  VIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGINH  199
            ++IQVLCSYSTLP+YAIVTQMG  FK++IF EH+Q+ L GW +  ++RK  +A F     
Sbjct  313  IMIQVLCSYSTLPLYAIVTQMGDMFKRAIFAEHMQLLLHGWVEGVRKRK--RAGFSAFR-  369

Query  198  GGALTDGSSTGVQMGGVGRKESGSTDGASVRALQQM  91
                          G  GRK+   +       +Q+M
Sbjct  370  --------------GFFGRKDKKRSPSGRDIPMQRM  391


 Score = 59.3 bits (142),  Expect(2) = 5e-50, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAE  593
            W+FVVIFLLLN++GWHTYFW++F+P +LLL VG KLEH+I +LA ++AE
Sbjct  192  WLFVVIFLLLNVHGWHTYFWLSFLPLVLLLIVGAKLEHIITRLALDLAE  240



>ref|XP_011087587.1| PREDICTED: MLO-like protein 13 [Sesamum indicum]
Length=485

 Score =   159 bits (402),  Expect(2) = 6e-50, Method: Compositional matrix adjust.
 Identities = 74/106 (70%), Positives = 88/106 (83%), Gaps = 0/106 (0%)
 Frame = -3

Query  558  QPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIG  379
            +PSDE FWF RP IVL+LIHFILFQN+FEIAFFFWI   YGF SCIM  + FIIPRLVIG
Sbjct  329  RPSDELFWFHRPAIVLYLIHFILFQNSFEIAFFFWIWATYGFRSCIMEGLHFIIPRLVIG  388

Query  378  VIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAK  241
            VI+QVLCSYSTLP+YA+VTQMG+ FK+++FDE  Q  +  WA+ +K
Sbjct  389  VIVQVLCSYSTLPLYALVTQMGSMFKQTVFDEFTQELIRTWAKDSK  434


 Score = 66.2 bits (160),  Expect(2) = 6e-50, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVVIFLLLNI GWH YFW++F+P +LLL VG KLEH+I +LA + AE+    EG  V 
Sbjct  270  WLFVVIFLLLNIAGWHAYFWLSFLPLVLLLIVGAKLEHIITELAQDAAERAGDAEGTPVR  329

Query  559  PT  554
            P+
Sbjct  330  PS  331



>gb|AFW81913.1| hypothetical protein ZEAMMB73_691352 [Zea mays]
Length=439

 Score =   135 bits (341),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 71/153 (46%), Positives = 92/153 (60%), Gaps = 32/153 (21%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + +PSD HFWFG+P+I+L+LIHFILFQN+FEIAFFFWIL                     
Sbjct  314  IVKPSDSHFWFGKPRIILYLIHFILFQNSFEIAFFFWIL---------------------  352

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFG--  211
                  +LCSY TLP+YAIVTQMG+ +KK IF++H+Q G++ WAQK K RKGLK A    
Sbjct  353  ------LLCSYITLPLYAIVTQMGSCYKKEIFNDHVQKGVLVWAQKVKMRKGLKGALSKS  406

Query  210  -GINHGGALTDGSSTGVQMGGVGR--KESGSTD  121
                +  A   G S  ++M   G   K  G+T+
Sbjct  407  DSAKNNNADPAGPSVKIEMAKAGEDAKVVGNTE  439


 Score = 89.0 bits (219),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVVIFLLLN+NGWH YFWI+F+P +LLLAVGTKLEHVI QL H+VA+KH AI+G+++V
Sbjct  256  WIFVVIFLLLNVNGWHIYFWISFLPLLLLLAVGTKLEHVIAQLGHDVAKKHAAIDGDVIV  315



>ref|XP_002266927.3| PREDICTED: endoglucanase 25 [Vitis vinifera]
Length=1061

 Score =   162 bits (411),  Expect(2) = 2e-49, Method: Composition-based stats.
 Identities = 68/103 (66%), Positives = 86/103 (83%), Gaps = 0/103 (0%)
 Frame = -3

Query  558   QPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIG  379
             +PSDEHFWF RP IVL+LIHFILFQN+FEIAFFFWI   YGF+SCIM  + +IIPRL++G
Sbjct  954   KPSDEHFWFRRPSIVLYLIHFILFQNSFEIAFFFWIWSTYGFNSCIMEKLGYIIPRLLMG  1013

Query  378   VIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQ  250
              ++QVLCSYSTLP+Y IVTQMG+ FK+ +F +H+   ++GWA 
Sbjct  1014  ALVQVLCSYSTLPLYVIVTQMGSMFKEGMFHQHVHQSILGWAH  1056


 Score = 61.2 bits (147),  Expect(2) = 2e-49, Method: Composition-based stats.
 Identities = 34/50 (68%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEK  590
            W+FVV FLLL++ GWHTYFW+AF+P ILLL VG KLEH+I +LA EV E+
Sbjct  895  WLFVVFFLLLDVEGWHTYFWLAFLPLILLLLVGAKLEHIITRLAQEVDEE  944



>ref|XP_010521421.1| PREDICTED: MLO-like protein 13 isoform X2 [Tarenaya hassleriana]
Length=478

 Score =   154 bits (389),  Expect(2) = 3e-49, Method: Compositional matrix adjust.
 Identities = 70/108 (65%), Positives = 85/108 (79%), Gaps = 0/108 (0%)
 Frame = -3

Query  558  QPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIG  379
            +PSDE FWF RP IVL LIHFILFQN+FEIAFFFWIL  YG  SCIM  + F+IPRLV+G
Sbjct  336  KPSDELFWFHRPSIVLSLIHFILFQNSFEIAFFFWILFTYGIKSCIMERLGFLIPRLVMG  395

Query  378  VIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQR  235
            V++QVLCSYSTLP+YA+VTQMG+ FKK IFDE +   +  W +  + +
Sbjct  396  VLVQVLCSYSTLPLYALVTQMGSKFKKGIFDELVHSAIDLWVEDTRNK  443


 Score = 68.9 bits (167),  Expect(2) = 3e-49, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKH  587
            W+FVV+FLLL++ GW+TYFW++F+P ILL+ VG KLE++I  LA +V+EK 
Sbjct  275  WLFVVVFLLLDVGGWNTYFWLSFLPLILLVMVGAKLENIISSLALDVSEKR  325



>ref|XP_010521420.1| PREDICTED: MLO-like protein 13 isoform X1 [Tarenaya hassleriana]
Length=480

 Score =   154 bits (388),  Expect(2) = 4e-49, Method: Compositional matrix adjust.
 Identities = 70/108 (65%), Positives = 85/108 (79%), Gaps = 0/108 (0%)
 Frame = -3

Query  558  QPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIG  379
            +PSDE FWF RP IVL LIHFILFQN+FEIAFFFWIL  YG  SCIM  + F+IPRLV+G
Sbjct  338  KPSDELFWFHRPSIVLSLIHFILFQNSFEIAFFFWILFTYGIKSCIMERLGFLIPRLVMG  397

Query  378  VIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQR  235
            V++QVLCSYSTLP+YA+VTQMG+ FKK IFDE +   +  W +  + +
Sbjct  398  VLVQVLCSYSTLPLYALVTQMGSKFKKGIFDELVHSAIDLWVEDTRNK  445


 Score = 68.9 bits (167),  Expect(2) = 4e-49, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKH  587
            W+FVV+FLLL++ GW+TYFW++F+P ILL+ VG KLE++I  LA +V+EK 
Sbjct  277  WLFVVVFLLLDVGGWNTYFWLSFLPLILLVMVGAKLENIISSLALDVSEKR  327



>ref|XP_008345009.1| PREDICTED: MLO-like protein 1 isoform X2 [Malus domestica]
Length=457

 Score =   110 bits (275),  Expect(3) = 5e-49, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + QPSD+HFWFG+P+ VLFLIHFILFQNAFE+AFFFWI VQYGF SCIMG V +I+PRLV
Sbjct  350  IVQPSDKHFWFGKPKFVLFLIHFILFQNAFEMAFFFWIWVQYGFTSCIMGKVXYIVPRLV  409

Query  384  IG  379
            IG
Sbjct  410  IG  411


 Score =   105 bits (263),  Expect(3) = 5e-49, Method: Compositional matrix adjust.
 Identities = 48/60 (80%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVV+F+LLN++GWH YFWIAF+PF LLLAVGTKL+HVI QLAHEVAEKH+AIEGEL+V
Sbjct  292  WIFVVLFMLLNVDGWHAYFWIAFVPFFLLLAVGTKLQHVITQLAHEVAEKHIAIEGELIV  351


 Score = 26.9 bits (58),  Expect(3) = 5e-49, Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 24/51 (47%), Gaps = 7/51 (14%)
 Frame = -1

Query  317  WEPISRNRYLMSTSKLGSSVGLRRRNKGRD*KRHLVASITGGL*RMVPRRE  165
            WEPISR +  M        VGL+ + +GR    HL  +       +VP RE
Sbjct  412  WEPISRKQCSMRIYAQDLLVGLKXQREGRRASTHLNLA-------LVPLRE  455



>dbj|BAJ97456.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=489

 Score =   137 bits (346),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 97/152 (64%), Gaps = 4/152 (3%)
 Frame = -3

Query  558  QPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIG  379
             PSD+ FWF  P+I+L L+HFILFQNAFE A+ FW +  +G++SCIM  + + + R+ I 
Sbjct  342  DPSDDLFWFRSPRILLILVHFILFQNAFEFAYLFWTIAMFGYNSCIMDKLGYSVSRIAIC  401

Query  378  VIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGINH  199
            V++QVLCSYSTLP+YAIV+ MG+ FK ++F + +   L  WA  A++R G     GG   
Sbjct  402  VVVQVLCSYSTLPLYAIVSHMGSSFKSAVFADDVVEHLRSWANDARER-GRGTDGGGCLG  460

Query  198  GGALTDGSSTGVQMGGVGRKESGSTDGASVRA  103
             GA   GSS   + G   + +  + + A+ R+
Sbjct  461  AGATATGSS---REGSRTQPQDKAEEPAAERS  489


 Score = 83.2 bits (204),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 49/61 (80%), Gaps = 1/61 (2%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIE-GELV  563
            W+FV+IFLL+N+ GWH+YFWI+ +P  LLL +GTKLEH+I Q+A+EV  K  A+E G++ 
Sbjct  281  WIFVMIFLLINVTGWHSYFWISLVPLTLLLVIGTKLEHIITQMAYEVNRKRAAVEAGDIA  340

Query  562  V  560
            V
Sbjct  341  V  341



>ref|XP_010097666.1| MLO-like protein 1 [Morus notabilis]
 gb|EXB70621.1| MLO-like protein 1 [Morus notabilis]
Length=432

 Score =   159 bits (402),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 85/155 (55%), Positives = 98/155 (63%), Gaps = 38/155 (25%)
 Frame = -3

Query  564  LCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLV  385
            + QPSDEHFWFG PQIVLFLIHFILFQNAFEIAFFFWI V                    
Sbjct  296  VVQPSDEHFWFGHPQIVLFLIHFILFQNAFEIAFFFWIWV--------------------  335

Query  384  IGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGG-  208
                   LCSYSTLP+YAIVTQMG+ FKK+IF+EH+QVGLVGWAQK K++KGLKAA  G 
Sbjct  336  -------LCSYSTLPLYAIVTQMGSSFKKAIFEEHVQVGLVGWAQKVKRKKGLKAAADGS  388

Query  207  ----------INHGGALTDGSSTGVQMGGVGRKES  133
                       N G      S+TG+Q+G +  K +
Sbjct  389  GSGSGADQQSSNDGSTSATTSATGIQLGRLVNKAT  423


 Score = 60.8 bits (146),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -2

Query  658  LLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            LLLAVGTKLEHVI QLAHEVAEKH+AIEGELVV
Sbjct  265  LLLAVGTKLEHVITQLAHEVAEKHIAIEGELVV  297



>ref|XP_004959126.1| PREDICTED: MLO-like protein 1-like [Setaria italica]
Length=479

 Score =   157 bits (396),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 77/135 (57%), Positives = 96/135 (71%), Gaps = 7/135 (5%)
 Frame = -3

Query  555  PSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIGV  376
            PSD+ FWF +P++VL LIH +LFQNAFEIAFFFW+LV +GF SCIMG   + I RLVI V
Sbjct  345  PSDDFFWFHQPKLVLHLIHIVLFQNAFEIAFFFWLLVTFGFKSCIMGKPGYAISRLVISV  404

Query  375  IIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGINHG  196
            I Q+LC YSTLP+YAIV+ MG  FKK+IFD+++  GLV WAQ A++RKG        N  
Sbjct  405  ISQLLCGYSTLPLYAIVSHMGNSFKKAIFDDNVSEGLVTWAQNARRRKGK-------NTT  457

Query  195  GALTDGSSTGVQMGG  151
             A +  SS   + GG
Sbjct  458  NADSSASSVDGRYGG  472


 Score = 63.5 bits (153),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -2

Query  709  NINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            N++GW+ Y W+   PFILLL VG+K+EH+I +LA +VA+KH AIEG++VV
Sbjct  294  NVHGWYVYIWLTLAPFILLLVVGSKMEHIITELAVQVAQKHTAIEGDVVV  343



>gb|KDO49759.1| hypothetical protein CISIN_1g0474502mg, partial [Citrus sinensis]
Length=178

 Score =   169 bits (427),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 76/121 (63%), Positives = 97/121 (80%), Gaps = 0/121 (0%)
 Frame = -3

Query  570  NWLCQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPR  391
            + + +PSD+HFW  +P++VL LIH ILFQN+FE+A FFWILVQYGF SCIMG V++IIPR
Sbjct  30   DLVVKPSDDHFWLHKPKLVLTLIHIILFQNSFELAVFFWILVQYGFHSCIMGSVEYIIPR  89

Query  390  LVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFG  211
            LVIGV +QVLCSYS LP+YAIV QMG+ FKK+IF E+IQ GL+ WA+KA++    +    
Sbjct  90   LVIGVFVQVLCSYSILPLYAIVVQMGSKFKKAIFKENIQEGLIHWAKKARKNIERRNRLD  149

Query  210  G  208
            G
Sbjct  150  G  150


 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  658  LLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            LL+ VGTKL+H++ QLA +VAEKH+A+EG+LVV
Sbjct  1    LLICVGTKLQHILTQLAQDVAEKHMAVEGDLVV  33



>ref|XP_006283629.1| hypothetical protein CARUB_v10004686mg [Capsella rubella]
 gb|EOA16527.1| hypothetical protein CARUB_v10004686mg [Capsella rubella]
Length=487

 Score =   156 bits (395),  Expect(2) = 4e-48, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 85/107 (79%), Gaps = 0/107 (0%)
 Frame = -3

Query  555  PSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIGV  376
            PSDE FWF RP IVL LIHFILFQN+FEIAFFFWIL  YG  SCIM  + F+IPRLV+GV
Sbjct  351  PSDELFWFHRPGIVLQLIHFILFQNSFEIAFFFWILFTYGIHSCIMEKLGFLIPRLVMGV  410

Query  375  IIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQR  235
            ++QVLCSYSTLP+YA+VTQMG+ FKK IFD  +Q  L GW +  + R
Sbjct  411  LVQVLCSYSTLPLYALVTQMGSKFKKGIFDNLVQSTLEGWLEDTRNR  457


 Score = 63.2 bits (152),  Expect(2) = 4e-48, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVV+FLLLN+ GW+TYFW++F+P ILLL VGTKLE++I  LA +V+EK    E  ++ 
Sbjct  291  WLFVVVFLLLNVGGWNTYFWLSFLPLILLLMVGTKLEYIISSLALDVSEKRKRAEEAVIT  350

Query  559  PT  554
            P+
Sbjct  351  PS  352



>ref|XP_009392166.1| PREDICTED: MLO-like protein 13 isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=537

 Score =   156 bits (394),  Expect(2) = 5e-48, Method: Compositional matrix adjust.
 Identities = 76/145 (52%), Positives = 101/145 (70%), Gaps = 0/145 (0%)
 Frame = -3

Query  552  SDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIGVI  373
            S+EHFWF +P IVL+LI FILFQN+FEIAFFFWI   YGF SCIM  + ++IPRLVIGVI
Sbjct  375  SNEHFWFKKPGIVLYLIQFILFQNSFEIAFFFWIWSTYGFHSCIMEGLGYLIPRLVIGVI  434

Query  372  IQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGINHGG  193
            IQVLCSYSTLP+YAIVTQMG  FK+SIF+  +Q  L  WA + K+++  +  F    +  
Sbjct  435  IQVLCSYSTLPLYAIVTQMGEGFKESIFNATVQHTLHDWATQVKEKRKHQYGFLSFLNFH  494

Query  192  ALTDGSSTGVQMGGVGRKESGSTDG  118
                 ++  +QM  +  + + ++ G
Sbjct  495  RKDKKNNNEIQMQTLASRAAEASHG  519


 Score = 62.8 bits (151),  Expect(2) = 5e-48, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGE  569
            W+FVVIFLL+N++GWHTYFW++F+P ILLL VG KL+H+I +LA E+ EK    +GE
Sbjct  312  WLFVVIFLLMNVHGWHTYFWLSFLPLILLLVVGAKLDHIITKLALELQEKPRGPKGE  368



>gb|ACN35418.1| unknown [Zea mays]
 tpg|DAA56447.1| TPA: hypothetical protein ZEAMMB73_710218 [Zea mays]
Length=342

 Score =   113 bits (283),  Expect(2) = 5e-48, Method: Compositional matrix adjust.
 Identities = 49/60 (82%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = -3

Query  558  QPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIG  379
             PSD+HFWFGRP+IVL+LIHFILFQNAFEIAFFFWIL  YGF+SCIM HV FI+PRLV+G
Sbjct  283  NPSDDHFWFGRPKIVLYLIHFILFQNAFEIAFFFWILTTYGFNSCIMDHVPFIVPRLVVG  342


 Score =   105 bits (262),  Expect(2) = 5e-48, Method: Compositional matrix adjust.
 Identities = 49/60 (82%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVV+F+LLNINGWHTYFWI+FIP +LLLAVGTKLEHVI QLA EVAEKH A+EG+LVV
Sbjct  223  WIFVVVFMLLNINGWHTYFWISFIPLLLLLAVGTKLEHVITQLAQEVAEKHSAVEGDLVV  282



>ref|XP_010439065.1| PREDICTED: MLO-like protein 13 [Camelina sativa]
Length=491

 Score =   157 bits (396),  Expect(2) = 7e-48, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 86/107 (80%), Gaps = 0/107 (0%)
 Frame = -3

Query  555  PSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIGV  376
            PSDE FWF RP IVL LIHFILFQN+FEIAFFFWIL  YG  SCIM  + F+IPRLV+GV
Sbjct  355  PSDELFWFHRPGIVLQLIHFILFQNSFEIAFFFWILFTYGIHSCIMEKLGFLIPRLVMGV  414

Query  375  IIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQR  235
            ++QVLCSYSTLP+YA+VTQMG+ FKK IFD  +Q  L GW + ++ R
Sbjct  415  LVQVLCSYSTLPLYALVTQMGSKFKKGIFDNLVQSTLEGWLEDSRNR  461


 Score = 61.2 bits (147),  Expect(2) = 7e-48, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = -2

Query  739  WVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVV  560
            W+FVV+FLLLN+ GW+TYFW++F+P ILLL VG KLE++I  LA +V+EK    E  ++ 
Sbjct  295  WLFVVVFLLLNVGGWNTYFWLSFLPLILLLMVGAKLEYIISSLALDVSEKRSRAEEAVIT  354

Query  559  PT  554
            P+
Sbjct  355  PS  356



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1354032766515