BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF029F22

Length=726
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_008227415.1|  PREDICTED: probable methyltransferase PMT26        347   3e-110   Prunus mume [ume]
ref|XP_007214544.1|  hypothetical protein PRUPE_ppa001471mg             347   4e-110   Prunus persica
gb|KJB48927.1|  hypothetical protein B456_008G094300                    344   3e-109   Gossypium raimondii
ref|XP_007048444.1|  S-adenosyl-L-methionine-dependent methyltran...    343   7e-109   
ref|XP_009771172.1|  PREDICTED: probable methyltransferase PMT26        343   1e-108   Nicotiana sylvestris
gb|KHG06416.1|  hypothetical protein F383_32222                         342   3e-108   Gossypium arboreum [tree cotton]
emb|CAN60873.1|  hypothetical protein VITISV_030591                     322   4e-108   Vitis vinifera
ref|XP_004288094.1|  PREDICTED: probable methyltransferase PMT26        341   5e-108   Fragaria vesca subsp. vesca
ref|XP_010270332.1|  PREDICTED: probable methyltransferase PMT26 ...    340   2e-107   Nelumbo nucifera [Indian lotus]
ref|XP_010270331.1|  PREDICTED: probable methyltransferase PMT26 ...    340   2e-107   Nelumbo nucifera [Indian lotus]
gb|AGE09593.1|  DehydRP-like protein                                    319   8e-107   Eucalyptus cladocalyx
ref|XP_009590749.1|  PREDICTED: probable methyltransferase PMT26        337   1e-106   Nicotiana tomentosiformis
ref|XP_002516311.1|  ATP binding protein, putative                      337   3e-106   Ricinus communis
ref|XP_008394175.1|  PREDICTED: probable methyltransferase PMT26 ...    336   3e-106   
gb|KDO51659.1|  hypothetical protein CISIN_1g003776mg                   336   4e-106   Citrus sinensis [apfelsine]
ref|XP_008394173.1|  PREDICTED: probable methyltransferase PMT26 ...    337   4e-106   
ref|XP_006432154.1|  hypothetical protein CICLE_v10000328mg             336   4e-106   Citrus clementina [clementine]
ref|XP_008781596.1|  PREDICTED: probable methyltransferase PMT26        336   2e-105   Phoenix dactylifera
ref|XP_010930722.1|  PREDICTED: probable methyltransferase PMT26        336   3e-105   Elaeis guineensis
ref|XP_010090820.1|  putative methyltransferase PMT26                   334   3e-105   Morus notabilis
ref|XP_009355841.1|  PREDICTED: probable methyltransferase PMT26        334   5e-105   Pyrus x bretschneideri [bai li]
ref|XP_011099715.1|  PREDICTED: probable methyltransferase PMT26        333   9e-105   Sesamum indicum [beniseed]
ref|XP_004239625.1|  PREDICTED: probable methyltransferase PMT26        331   3e-104   Solanum lycopersicum
ref|XP_003602637.1|  Ankyrin-like protein                               330   4e-104   Medicago truncatula
emb|CDP04655.1|  unnamed protein product                                330   5e-104   Coffea canephora [robusta coffee]
ref|XP_006345748.1|  PREDICTED: probable methyltransferase PMT26-...    331   6e-104   Solanum tuberosum [potatoes]
gb|KDO36646.1|  hypothetical protein CISIN_1g027471mg                   312   7e-104   Citrus sinensis [apfelsine]
ref|XP_011022921.1|  PREDICTED: probable methyltransferase PMT26        331   9e-104   Populus euphratica
ref|XP_004502956.1|  PREDICTED: probable methyltransferase PMT26-...    329   2e-103   Cicer arietinum [garbanzo]
gb|EYU23728.1|  hypothetical protein MIMGU_mgv1a001484mg                329   2e-103   Erythranthe guttata [common monkey flower]
ref|XP_010674444.1|  PREDICTED: probable methyltransferase PMT26        329   3e-103   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011078779.1|  PREDICTED: probable methyltransferase PMT26        328   6e-103   Sesamum indicum [beniseed]
ref|XP_002309924.1|  dehydration-responsive family protein              328   9e-103   
ref|XP_004503920.1|  PREDICTED: probable methyltransferase PMT26-...    328   1e-102   Cicer arietinum [garbanzo]
emb|CDY31339.1|  BnaA02g34020D                                          326   1e-102   Brassica napus [oilseed rape]
ref|XP_008360714.1|  PREDICTED: probable methyltransferase PMT26        328   1e-102   
gb|KDP39437.1|  hypothetical protein JCGZ_03719                         328   2e-102   Jatropha curcas
ref|XP_002306259.2|  dehydration-responsive family protein              326   2e-102   
ref|XP_006580338.1|  PREDICTED: probable methyltransferase PMT26-...    327   3e-102   Glycine max [soybeans]
ref|XP_009130433.1|  PREDICTED: probable methyltransferase PMT26        325   3e-102   Brassica rapa
gb|KHN34092.1|  Putative methyltransferase PMT26                        327   4e-102   Glycine soja [wild soybean]
ref|XP_006394213.1|  hypothetical protein EUTSA_v10003654mg             326   4e-102   Eutrema salsugineum [saltwater cress]
emb|CBI37509.3|  unnamed protein product                                325   4e-102   Vitis vinifera
dbj|BAB10271.1|  ankyrin-like protein                                   325   7e-102   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006281931.1|  hypothetical protein CARUB_v10028139mg             325   8e-102   Capsella rubella
ref|NP_201208.2|  putative methyltransferase PMT26                      325   1e-101   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002266357.1|  PREDICTED: probable methyltransferase PMT26        325   1e-101   Vitis vinifera
emb|CDY39830.1|  BnaC02g42880D                                          323   1e-101   Brassica napus [oilseed rape]
ref|XP_010461320.1|  PREDICTED: probable methyltransferase PMT26        325   1e-101   
ref|XP_009410679.1|  PREDICTED: probable methyltransferase PMT26        324   1e-101   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010277710.1|  PREDICTED: probable methyltransferase PMT24        325   2e-101   Nelumbo nucifera [Indian lotus]
ref|XP_010484172.1|  PREDICTED: probable methyltransferase PMT26        324   2e-101   Camelina sativa [gold-of-pleasure]
gb|KJB40479.1|  hypothetical protein B456_007G066000                    325   3e-101   Gossypium raimondii
ref|XP_010444329.1|  PREDICTED: probable methyltransferase PMT26        323   7e-101   Camelina sativa [gold-of-pleasure]
ref|XP_007137790.1|  hypothetical protein PHAVU_009G155600g             323   7e-101   Phaseolus vulgaris [French bean]
ref|XP_008462649.1|  PREDICTED: probable methyltransferase PMT26        323   8e-101   Cucumis melo [Oriental melon]
ref|XP_010027631.1|  PREDICTED: probable methyltransferase PMT26        322   8e-101   Eucalyptus grandis [rose gum]
gb|ACF86376.1|  unknown                                                 310   9e-101   Zea mays [maize]
ref|XP_011031158.1|  PREDICTED: probable methyltransferase PMT26 ...    322   1e-100   Populus euphratica
ref|XP_011031160.1|  PREDICTED: probable methyltransferase PMT26 ...    322   1e-100   Populus euphratica
emb|CDX84478.1|  BnaC03g50220D                                          323   1e-100   
ref|XP_011031161.1|  PREDICTED: probable methyltransferase PMT26 ...    322   1e-100   Populus euphratica
ref|XP_011031157.1|  PREDICTED: probable methyltransferase PMT26 ...    322   1e-100   Populus euphratica
ref|XP_003526869.1|  PREDICTED: probable methyltransferase PMT26-...    322   2e-100   Glycine max [soybeans]
ref|XP_011031156.1|  PREDICTED: probable methyltransferase PMT26 ...    322   2e-100   Populus euphratica
gb|KHN09623.1|  Putative methyltransferase PMT26                        322   2e-100   Glycine soja [wild soybean]
emb|CDY43782.1|  BnaA06g23180D                                          321   2e-100   Brassica napus [oilseed rape]
ref|XP_010530222.1|  PREDICTED: probable methyltransferase PMT25        305   3e-100   Tarenaya hassleriana [spider flower]
gb|KDO36645.1|  hypothetical protein CISIN_1g027471mg                   303   3e-100   Citrus sinensis [apfelsine]
ref|XP_004166405.1|  PREDICTED: LOW QUALITY PROTEIN: probable met...    321   4e-100   
gb|KHN16949.1|  Putative methyltransferase PMT26                        321   4e-100   Glycine soja [wild soybean]
ref|XP_004143348.1|  PREDICTED: probable methyltransferase PMT26-...    321   4e-100   Cucumis sativus [cucumbers]
ref|XP_008805853.1|  PREDICTED: probable methyltransferase PMT26        320   6e-100   Phoenix dactylifera
ref|XP_006584650.1|  PREDICTED: probable methyltransferase PMT26-...    321   7e-100   Glycine max [soybeans]
ref|XP_010521110.1|  PREDICTED: probable methyltransferase PMT26        321   7e-100   Tarenaya hassleriana [spider flower]
ref|XP_007159858.1|  hypothetical protein PHAVU_002G273700g             320   9e-100   Phaseolus vulgaris [French bean]
emb|CDM85080.1|  unnamed protein product                                319   2e-99    Triticum aestivum [Canadian hard winter wheat]
ref|XP_002864883.1|  hypothetical protein ARALYDRAFT_496597             319   2e-99    
ref|XP_009150474.1|  PREDICTED: probable methyltransferase PMT26        322   2e-99    Brassica rapa
ref|XP_006645134.1|  PREDICTED: probable methyltransferase PMT26-...    318   3e-99    Oryza brachyantha
gb|EMT17461.1|  hypothetical protein F775_31288                         318   4e-99    
ref|XP_003523221.1|  PREDICTED: probable methyltransferase PMT26-...    318   4e-99    Glycine max [soybeans]
gb|EMS53293.1|  putative methyltransferase PMT26                        320   6e-99    Triticum urartu
ref|XP_008783335.1|  PREDICTED: probable methyltransferase PMT26        317   6e-99    Phoenix dactylifera
ref|XP_002520274.1|  ATP binding protein, putative                      317   9e-99    Ricinus communis
ref|XP_010908928.1|  PREDICTED: probable methyltransferase PMT26        317   9e-99    Elaeis guineensis
ref|XP_010911089.1|  PREDICTED: probable methyltransferase PMT26        317   1e-98    Elaeis guineensis
ref|XP_009414612.1|  PREDICTED: probable methyltransferase PMT24        317   2e-98    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006434317.1|  hypothetical protein CICLE_v10000311mg             316   2e-98    
ref|XP_004959929.1|  PREDICTED: probable methyltransferase PMT26-...    314   2e-98    Setaria italica
ref|XP_010546331.1|  PREDICTED: probable methyltransferase PMT26        317   3e-98    Tarenaya hassleriana [spider flower]
emb|CDY43336.1|  BnaC03g59080D                                          297   3e-98    Brassica napus [oilseed rape]
ref|XP_003630288.1|  Ankyrin-like protein                               316   4e-98    Medicago truncatula
ref|XP_002307464.2|  hypothetical protein POPTR_0005s20670g             316   4e-98    
ref|XP_009411900.1|  PREDICTED: probable methyltransferase PMT26        313   5e-98    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006472883.1|  PREDICTED: probable methyltransferase PMT25-...    315   6e-98    Citrus sinensis [apfelsine]
ref|XP_003564784.1|  PREDICTED: probable methyltransferase PMT26        315   6e-98    Brachypodium distachyon [annual false brome]
gb|EPS72708.1|  hypothetical protein M569_02045                         309   9e-98    Genlisea aurea
ref|XP_011006302.1|  PREDICTED: probable methyltransferase PMT24 ...    315   1e-97    Populus euphratica
ref|XP_011006303.1|  PREDICTED: probable methyltransferase PMT24 ...    314   1e-97    Populus euphratica
ref|NP_001151565.1|  ankyrin-like protein                               310   1e-97    Zea mays [maize]
ref|XP_010112029.1|  putative methyltransferase PMT24                   311   2e-97    Morus notabilis
gb|EMT26912.1|  hypothetical protein F775_10259                         311   3e-97    
ref|XP_002300957.2|  hypothetical protein POPTR_0002s07640g             313   3e-97    Populus trichocarpa [western balsam poplar]
dbj|BAD82580.1|  ankyrin-like protein                                   313   3e-97    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001045015.1|  Os01g0883900                                       313   4e-97    
gb|EAY76734.1|  hypothetical protein OsI_04689                          312   4e-97    Oryza sativa Indica Group [Indian rice]
ref|XP_004970814.1|  PREDICTED: probable methyltransferase PMT26-...    312   4e-97    Setaria italica
ref|XP_002447385.1|  hypothetical protein SORBIDRAFT_06g034130          310   4e-97    Sorghum bicolor [broomcorn]
gb|KDP32896.1|  hypothetical protein JCGZ_12188                         313   4e-97    Jatropha curcas
emb|CBI18946.3|  unnamed protein product                                306   6e-97    Vitis vinifera
ref|XP_008371274.1|  PREDICTED: probable methyltransferase PMT24        297   6e-97    
gb|KHG15143.1|  hypothetical protein F383_09666                         313   9e-97    Gossypium arboreum [tree cotton]
dbj|BAJ85194.1|  predicted protein                                      308   1e-96    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004978303.1|  PREDICTED: probable methyltransferase PMT26-...    315   1e-96    
ref|XP_009414876.1|  PREDICTED: probable methyltransferase PMT26        306   3e-96    
ref|XP_011027424.1|  PREDICTED: probable methyltransferase PMT24        307   4e-96    Populus euphratica
ref|XP_006303155.1|  hypothetical protein CARUB_v10008372mg             308   6e-96    
ref|XP_002285889.2|  PREDICTED: probable methyltransferase PMT24        310   1e-95    Vitis vinifera
ref|XP_008338454.1|  PREDICTED: probable methyltransferase PMT24        298   1e-95    
ref|XP_009779710.1|  PREDICTED: probable methyltransferase PMT26        307   2e-95    Nicotiana sylvestris
gb|KJB71369.1|  hypothetical protein B456_011G118900                    312   2e-95    Gossypium raimondii
gb|AAX96340.1|  Putative methyltransferase                              290   2e-95    Oryza sativa Japonica Group [Japonica rice]
gb|ACN28572.1|  unknown                                                 307   3e-95    Zea mays [maize]
ref|XP_010478312.1|  PREDICTED: probable methyltransferase PMT24 ...    306   4e-95    Camelina sativa [gold-of-pleasure]
ref|XP_010460728.1|  PREDICTED: probable methyltransferase PMT24        306   5e-95    Camelina sativa [gold-of-pleasure]
ref|XP_002458871.1|  hypothetical protein SORBIDRAFT_03g041910          307   5e-95    Sorghum bicolor [broomcorn]
ref|XP_010527657.1|  PREDICTED: probable methyltransferase PMT24        306   6e-95    Tarenaya hassleriana [spider flower]
ref|XP_010906388.1|  PREDICTED: probable methyltransferase PMT24        309   8e-95    Elaeis guineensis
ref|XP_004237701.1|  PREDICTED: probable methyltransferase PMT24        305   9e-95    Solanum lycopersicum
ref|XP_009602526.1|  PREDICTED: probable methyltransferase PMT24        305   1e-94    Nicotiana tomentosiformis
ref|XP_007019267.1|  S-adenosyl-L-methionine-dependent methyltran...    306   1e-94    
gb|AAG51752.1|AC068667_31  unknown protein; 55790-52851                 305   2e-94    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002893569.1|  hypothetical protein ARALYDRAFT_473159             305   2e-94    
dbj|BAE99079.1|  hypothetical protein                                   305   2e-94    Arabidopsis thaliana [mouse-ear cress]
ref|NP_174240.2|  putative methyltransferase PMT24                      305   2e-94    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006365916.1|  PREDICTED: probable methyltransferase PMT24-...    305   2e-94    Solanum tuberosum [potatoes]
emb|CDY48339.1|  BnaA09g26820D                                          304   2e-94    Brassica napus [oilseed rape]
emb|CDX99828.1|  BnaC05g22500D                                          304   3e-94    
gb|EMS56319.1|  putative methyltransferase PMT26                        308   3e-94    Triticum urartu
ref|XP_007199628.1|  hypothetical protein PRUPE_ppa001750mg             304   3e-94    
ref|XP_006847154.1|  hypothetical protein AMTR_s00017p00240980          305   6e-94    
ref|XP_009383568.1|  PREDICTED: probable methyltransferase PMT26        306   7e-94    
ref|XP_006828886.1|  hypothetical protein AMTR_s00001p00185010          306   9e-94    
ref|XP_010547883.1|  PREDICTED: probable methyltransferase PMT26        301   9e-94    Tarenaya hassleriana [spider flower]
ref|XP_008244575.1|  PREDICTED: probable methyltransferase PMT24        304   1e-93    Prunus mume [ume]
emb|CDX90190.1|  BnaA08g17940D                                          301   1e-93    
tpg|DAA55524.1|  TPA: hypothetical protein ZEAMMB73_749730              308   1e-93    
ref|XP_008674424.1|  PREDICTED: probable methyltransferase PMT26        308   1e-93    Zea mays [maize]
ref|XP_009115236.1|  PREDICTED: probable methyltransferase PMT24 ...    302   1e-93    Brassica rapa
ref|XP_009115237.1|  PREDICTED: probable methyltransferase PMT24 ...    301   1e-93    Brassica rapa
gb|AAP72961.1|  putative ankyrin-like protein                           301   1e-93    Lactuca sativa [cultivated lettuce]
ref|XP_002442915.1|  hypothetical protein SORBIDRAFT_08g004870          307   2e-93    
ref|XP_010271514.1|  PREDICTED: probable methyltransferase PMT27        306   2e-93    
ref|XP_010679252.1|  PREDICTED: probable methyltransferase PMT26        302   4e-93    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003580900.1|  PREDICTED: probable methyltransferase PMT26        300   5e-93    Brachypodium distachyon [annual false brome]
gb|EAY82457.1|  hypothetical protein OsI_37674                          304   6e-93    Oryza sativa Indica Group [Indian rice]
gb|ABA96619.1|  dehydration-responsive protein, putative                305   6e-93    Oryza sativa Japonica Group [Japonica rice]
gb|EAZ19833.1|  hypothetical protein OsJ_35417                          305   6e-93    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006415572.1|  hypothetical protein EUTSA_v10006884mg             301   6e-93    Eutrema salsugineum [saltwater cress]
ref|XP_009109665.1|  PREDICTED: probable methyltransferase PMT24        298   1e-92    
ref|XP_004171289.1|  PREDICTED: probable methyltransferase PMT27-...    286   1e-92    
ref|XP_010533385.1|  PREDICTED: probable methyltransferase PMT24        300   2e-92    Tarenaya hassleriana [spider flower]
ref|XP_009366818.1|  PREDICTED: probable methyltransferase PMT24        300   2e-92    Pyrus x bretschneideri [bai li]
gb|KHN44285.1|  Putative methyltransferase PMT25                        300   3e-92    Glycine soja [wild soybean]
ref|XP_009102852.1|  PREDICTED: probable methyltransferase PMT24        298   5e-92    Brassica rapa
ref|XP_006578951.1|  PREDICTED: probable methyltransferase PMT26-...    296   5e-92    Glycine max [soybeans]
ref|XP_002267515.2|  PREDICTED: probable methyltransferase PMT27        301   5e-92    Vitis vinifera
ref|XP_010263954.1|  PREDICTED: probable methyltransferase PMT27        301   5e-92    Nelumbo nucifera [Indian lotus]
ref|XP_010063906.1|  PREDICTED: probable methyltransferase PMT25 ...    299   6e-92    Eucalyptus grandis [rose gum]
emb|CDY44314.1|  BnaA07g07980D                                          298   6e-92    Brassica napus [oilseed rape]
gb|KHG22120.1|  hypothetical protein F383_28461                         300   7e-92    Gossypium arboreum [tree cotton]
emb|CDX94669.1|  BnaC07g09890D                                          297   9e-92    
ref|XP_006653085.1|  PREDICTED: probable methyltransferase PMT26-...    295   2e-91    Oryza brachyantha
gb|KHN46967.1|  Putative methyltransferase PMT25                        295   2e-91    Glycine soja [wild soybean]
ref|XP_009360657.1|  PREDICTED: probable methyltransferase PMT24        298   2e-91    Pyrus x bretschneideri [bai li]
ref|XP_006578949.1|  PREDICTED: probable methyltransferase PMT26-...    298   2e-91    Glycine max [soybeans]
gb|KJB59346.1|  hypothetical protein B456_009G250600                    298   3e-91    Gossypium raimondii
ref|XP_008669787.1|  PREDICTED: probable methyltransferase PMT26        299   3e-91    Zea mays [maize]
tpg|DAA38926.1|  TPA: hypothetical protein ZEAMMB73_582749              299   5e-91    
gb|EPS59022.1|  hypothetical protein M569_15788                         282   5e-91    Genlisea aurea
ref|XP_008811930.1|  PREDICTED: probable methyltransferase PMT24        299   7e-91    Phoenix dactylifera
ref|XP_003527960.1|  PREDICTED: probable methyltransferase PMT26-...    296   7e-91    Glycine max [soybeans]
ref|XP_006410572.1|  hypothetical protein EUTSA_v10016285mg             295   1e-90    Eutrema salsugineum [saltwater cress]
ref|XP_009398710.1|  PREDICTED: probable methyltransferase PMT27        298   2e-90    Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_180977.1|  putative methyltransferase PMT25                      294   2e-90    Arabidopsis thaliana [mouse-ear cress]
dbj|BAE99717.1|  hypothetical protein                                   294   2e-90    Arabidopsis thaliana [mouse-ear cress]
emb|CBI17424.3|  unnamed protein product                                295   3e-90    Vitis vinifera
ref|XP_002449126.1|  hypothetical protein SORBIDRAFT_05g005510          296   4e-90    Sorghum bicolor [broomcorn]
ref|XP_010515490.1|  PREDICTED: probable methyltransferase PMT27        296   4e-90    Camelina sativa [gold-of-pleasure]
ref|XP_010503787.1|  PREDICTED: probable methyltransferase PMT27        296   5e-90    Camelina sativa [gold-of-pleasure]
ref|XP_010426649.1|  PREDICTED: probable methyltransferase PMT27        296   5e-90    Camelina sativa [gold-of-pleasure]
gb|EEC78319.1|  hypothetical protein OsI_18053                          291   5e-90    Oryza sativa Indica Group [Indian rice]
gb|EEE61974.1|  hypothetical protein OsJ_16751                          291   5e-90    Oryza sativa Japonica Group [Japonica rice]
gb|KGN48886.1|  hypothetical protein Csa_6G504660                       296   7e-90    Cucumis sativus [cucumbers]
ref|XP_003576215.1|  PREDICTED: probable methyltransferase PMT24        295   8e-90    Brachypodium distachyon [annual false brome]
ref|XP_006403957.1|  hypothetical protein EUTSA_v10010109mg             295   9e-90    Eutrema salsugineum [saltwater cress]
ref|XP_007203224.1|  hypothetical protein PRUPE_ppa000863mg             296   1e-89    Prunus persica
ref|XP_008440784.1|  PREDICTED: probable methyltransferase PMT27        295   1e-89    Cucumis melo [Oriental melon]
ref|XP_002881329.1|  hypothetical protein ARALYDRAFT_482372             292   1e-89    
ref|XP_006295874.1|  hypothetical protein CARUB_v10025004mg             292   1e-89    Capsella rubella
ref|XP_007046783.1|  S-adenosyl-L-methionine-dependent methyltran...    295   1e-89    
ref|XP_004978888.1|  PREDICTED: probable methyltransferase PMT26-...    293   2e-89    
ref|XP_008337883.1|  PREDICTED: probable methyltransferase PMT27        295   2e-89    
ref|XP_009143789.1|  PREDICTED: probable methyltransferase PMT25        291   2e-89    Brassica rapa
emb|CDY17234.1|  BnaA05g09540D                                          291   2e-89    Brassica napus [oilseed rape]
ref|XP_010679237.1|  PREDICTED: probable methyltransferase PMT26 ...    291   3e-89    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009346291.1|  PREDICTED: probable methyltransferase PMT27        295   3e-89    Pyrus x bretschneideri [bai li]
emb|CDX84330.1|  BnaC04g10920D                                          290   3e-89    
ref|XP_004502550.1|  PREDICTED: probable methyltransferase PMT26-...    291   3e-89    Cicer arietinum [garbanzo]
ref|XP_003563554.1|  PREDICTED: probable methyltransferase PMT25        293   4e-89    
ref|XP_010679222.1|  PREDICTED: probable methyltransferase PMT25 ...    291   4e-89    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008241902.1|  PREDICTED: probable methyltransferase PMT27        294   5e-89    Prunus mume [ume]
ref|XP_010509773.1|  PREDICTED: probable methyltransferase PMT25        290   6e-89    Camelina sativa [gold-of-pleasure]
gb|KEH35375.1|  methyltransferase PMT26-like protein, putative          290   7e-89    Medicago truncatula
dbj|BAK08087.1|  predicted protein                                      292   7e-89    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001065922.2|  Os11g0186300                                       292   8e-89    
ref|XP_006662791.1|  PREDICTED: probable methyltransferase PMT26-...    291   1e-88    Oryza brachyantha
ref|XP_009149307.1|  PREDICTED: probable methyltransferase PMT27        292   1e-88    Brassica rapa
ref|NP_001054368.1|  Os04g0692400                                       287   1e-88    
gb|KHG04009.1|  hypothetical protein F383_29196                         290   1e-88    Gossypium arboreum [tree cotton]
ref|XP_004289881.1|  PREDICTED: probable methyltransferase PMT24        290   2e-88    Fragaria vesca subsp. vesca
ref|XP_008338020.1|  PREDICTED: probable methyltransferase PMT27        292   2e-88    
ref|XP_006383147.1|  dehydration-responsive family protein              291   3e-88    Populus trichocarpa [western balsam poplar]
ref|XP_007137499.1|  hypothetical protein PHAVU_009G132000g             290   3e-88    Phaseolus vulgaris [French bean]
ref|XP_002310282.2|  hypothetical protein POPTR_0007s13620g             290   3e-88    
gb|KJB40187.1|  hypothetical protein B456_007G049800                    291   4e-88    Gossypium raimondii
ref|XP_004149997.1|  PREDICTED: probable methyltransferase PMT27-...    290   4e-88    
gb|KHG06183.1|  hypothetical protein F383_31802                         294   4e-88    Gossypium arboreum [tree cotton]
ref|NP_190676.1|  putative methyltransferase PMT27                      290   4e-88    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009115787.1|  PREDICTED: probable methyltransferase PMT27        290   4e-88    Brassica rapa
ref|XP_010469377.1|  PREDICTED: probable methyltransferase PMT25        288   6e-88    Camelina sativa [gold-of-pleasure]
ref|XP_006290554.1|  hypothetical protein CARUB_v10016641mg             291   6e-88    Capsella rubella
gb|KDP32665.1|  hypothetical protein JCGZ_13663                         289   7e-88    Jatropha curcas
ref|XP_011028617.1|  PREDICTED: probable methyltransferase PMT27        291   7e-88    Populus euphratica
ref|XP_011025891.1|  PREDICTED: LOW QUALITY PROTEIN: probable met...    292   7e-88    Populus euphratica
dbj|BAK05773.1|  predicted protein                                      290   1e-87    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB29128.1|  hypothetical protein B456_005G086100                    288   1e-87    Gossypium raimondii
ref|XP_011470976.1|  PREDICTED: probable methyltransferase PMT27        290   1e-87    Fragaria vesca subsp. vesca
ref|XP_002533655.1|  ATP binding protein, putative                      290   2e-87    Ricinus communis
gb|KJB29130.1|  hypothetical protein B456_005G086100                    288   2e-87    Gossypium raimondii
gb|KHG21530.1|  hypothetical protein F383_05601                         287   3e-87    Gossypium arboreum [tree cotton]
ref|XP_010413759.1|  PREDICTED: probable methyltransferase PMT25        286   3e-87    Camelina sativa [gold-of-pleasure]
gb|EEE51778.1|  hypothetical protein OsJ_33227                          287   4e-87    Oryza sativa Japonica Group [Japonica rice]
emb|CDP01948.1|  unnamed protein product                                286   5e-87    Coffea canephora [robusta coffee]
gb|EMT24893.1|  hypothetical protein F775_19481                         289   5e-87    
ref|XP_010030876.1|  PREDICTED: probable methyltransferase PMT27        288   7e-87    Eucalyptus grandis [rose gum]
gb|EAY80220.1|  hypothetical protein OsI_35397                          270   7e-87    Oryza sativa Indica Group [Indian rice]
gb|AFW75800.1|  hypothetical protein ZEAMMB73_544570                    286   2e-86    
ref|XP_008648870.1|  PREDICTED: probable methyltransferase PMT24        286   3e-86    
ref|XP_010063908.1|  PREDICTED: probable methyltransferase PMT25        283   6e-86    Eucalyptus grandis [rose gum]
ref|XP_011100953.1|  PREDICTED: probable methyltransferase PMT27        285   9e-86    Sesamum indicum [beniseed]
ref|XP_002437585.1|  hypothetical protein SORBIDRAFT_10g029820          284   2e-85    
ref|XP_009590098.1|  PREDICTED: probable methyltransferase PMT27        283   2e-85    Nicotiana tomentosiformis
ref|XP_010557710.1|  PREDICTED: probable methyltransferase PMT27        282   4e-85    Tarenaya hassleriana [spider flower]
ref|XP_009798747.1|  PREDICTED: probable methyltransferase PMT27        282   6e-85    Nicotiana sylvestris
gb|EMS61672.1|  putative methyltransferase PMT26                        281   3e-84    Triticum urartu
gb|EAZ02339.1|  hypothetical protein OsI_24442                          280   6e-84    Oryza sativa Indica Group [Indian rice]
gb|EEE66346.1|  hypothetical protein OsJ_22638                          280   9e-84    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010239480.1|  PREDICTED: probable methyltransferase PMT25        278   1e-83    
ref|XP_006657337.1|  PREDICTED: LOW QUALITY PROTEIN: probable met...    277   5e-83    
ref|XP_010679826.1|  PREDICTED: probable methyltransferase PMT27        276   1e-82    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010679267.1|  PREDICTED: probable methyltransferase PMT26        271   2e-82    Beta vulgaris subsp. vulgaris [field beet]
emb|CAE05785.2|  OSJNBb0020J19.14                                       271   4e-82    Oryza sativa Japonica Group [Japonica rice]
gb|EYU24085.1|  hypothetical protein MIMGU_mgv1a001214mg                271   5e-81    Erythranthe guttata [common monkey flower]
ref|XP_006340936.1|  PREDICTED: probable methyltransferase PMT27-...    268   8e-80    Solanum tuberosum [potatoes]
ref|XP_006856007.1|  hypothetical protein AMTR_s00059p00036620          250   9e-80    
ref|XP_004967286.1|  PREDICTED: probable methyltransferase PMT27-...    268   1e-79    
ref|XP_006425567.1|  hypothetical protein CICLE_v10024982mg             265   2e-79    
ref|XP_004233730.2|  PREDICTED: probable methyltransferase PMT27        265   3e-79    
ref|XP_006467154.1|  PREDICTED: probable methyltransferase PMT27-...    265   9e-79    Citrus sinensis [apfelsine]
gb|KDO71070.1|  hypothetical protein CISIN_1g002884mg                   263   4e-78    Citrus sinensis [apfelsine]
gb|KHN41938.1|  Putative methyltransferase PMT27                        258   6e-77    Glycine soja [wild soybean]
ref|XP_003538865.1|  PREDICTED: probable methyltransferase PMT27-...    258   9e-77    Glycine max [soybeans]
ref|XP_007158605.1|  hypothetical protein PHAVU_002G166600g             258   1e-76    Phaseolus vulgaris [French bean]
gb|EMT26126.1|  hypothetical protein F775_52504                         254   1e-75    
ref|XP_010501645.1|  PREDICTED: probable methyltransferase PMT24        252   5e-75    
ref|XP_001768084.1|  predicted protein                                  248   3e-74    
gb|KHN36073.1|  Putative methyltransferase PMT27                        251   5e-74    Glycine soja [wild soybean]
ref|XP_003516560.1|  PREDICTED: probable methyltransferase PMT27-...    251   5e-74    
ref|XP_010254848.1|  PREDICTED: probable methyltransferase PMT28        249   7e-74    
ref|XP_010942964.1|  PREDICTED: probable methyltransferase PMT28 ...    248   8e-74    
ref|XP_010942955.1|  PREDICTED: probable methyltransferase PMT28 ...    248   1e-73    
ref|XP_001754440.1|  predicted protein                                  244   1e-73    
ref|XP_003544411.1|  PREDICTED: probable methyltransferase PMT28-...    248   2e-73    
gb|KDO84547.1|  hypothetical protein CISIN_1g044932mg                   247   2e-73    
ref|XP_011083685.1|  PREDICTED: probable methyltransferase PMT28 ...    248   2e-73    
ref|XP_010942015.1|  PREDICTED: probable methyltransferase PMT28 ...    246   3e-73    
ref|XP_010942014.1|  PREDICTED: probable methyltransferase PMT28 ...    247   3e-73    
ref|XP_004499154.1|  PREDICTED: probable methyltransferase PMT28-...    248   3e-73    
ref|XP_001780682.1|  predicted protein                                  243   4e-73    
ref|XP_006473495.1|  PREDICTED: probable methyltransferase PMT28-...    248   5e-73    
ref|XP_008377397.1|  PREDICTED: probable methyltransferase PMT28        239   5e-73    
ref|XP_010942013.1|  PREDICTED: probable methyltransferase PMT28 ...    247   5e-73    
emb|CBI19694.3|  unnamed protein product                                247   7e-73    
gb|AES95041.2|  methyltransferase PMT16, putative                       248   8e-73    
ref|XP_009336328.1|  PREDICTED: probable methyltransferase PMT28        245   2e-72    
ref|XP_011024428.1|  PREDICTED: probable methyltransferase PMT28        245   4e-72    
ref|XP_003549433.1|  PREDICTED: probable methyltransferase PMT28-...    244   4e-72    
gb|KEH40140.1|  methyltransferase PMT16, putative                       244   5e-72    
ref|XP_008220897.1|  PREDICTED: probable methyltransferase PMT28        248   5e-72    
ref|XP_010060949.1|  PREDICTED: probable methyltransferase PMT28        244   6e-72    
ref|XP_008466568.1|  PREDICTED: probable methyltransferase PMT28 ...    244   9e-72    
ref|XP_008783495.1|  PREDICTED: probable methyltransferase PMT28 ...    243   1e-71    
ref|XP_010664689.1|  PREDICTED: probable methyltransferase PMT28        248   1e-71    
ref|XP_007017535.1|  S-adenosyl-L-methionine-dependent methyltran...    248   2e-71    
ref|XP_009403511.1|  PREDICTED: probable methyltransferase PMT28        242   2e-71    
gb|KDP38501.1|  hypothetical protein JCGZ_04426                         243   2e-71    
ref|XP_010684322.1|  PREDICTED: probable methyltransferase PMT28        242   4e-71    
ref|XP_003612083.1|  Ankyrin-like protein                               244   4e-71    
gb|KHN20981.1|  Putative methyltransferase PMT28                        245   5e-71    
ref|XP_009365659.1|  PREDICTED: probable methyltransferase PMT28        246   6e-71    
gb|EYU45155.1|  hypothetical protein MIMGU_mgv1a0020252mg               241   7e-71    
ref|XP_002510383.1|  ATP binding protein, putative                      241   7e-71    
gb|KFK44078.1|  hypothetical protein AALP_AA1G213200                    241   8e-71    
ref|XP_008388168.1|  PREDICTED: probable methyltransferase PMT28        244   2e-70    
ref|XP_002962298.1|  hypothetical protein SELMODRAFT_140935             236   2e-70    
ref|XP_009365956.1|  PREDICTED: probable methyltransferase PMT28        245   2e-70    
ref|XP_006416505.1|  hypothetical protein EUTSA_v10006932mg             239   3e-70    
gb|KJB58269.1|  hypothetical protein B456_009G202000                    239   3e-70    
ref|XP_002965218.1|  hypothetical protein SELMODRAFT_142980             236   3e-70    
ref|XP_004291877.2|  PREDICTED: probable methyltransferase PMT28        243   5e-70    
ref|XP_008787263.1|  PREDICTED: probable methyltransferase PMT28 ...    238   2e-69    
ref|XP_010533254.1|  PREDICTED: probable methyltransferase PMT28        238   2e-69    
ref|XP_004147784.1|  PREDICTED: probable methyltransferase PMT28-...    238   2e-69    
ref|XP_009801649.1|  PREDICTED: probable methyltransferase PMT28        238   2e-69    
ref|XP_004165240.1|  PREDICTED: LOW QUALITY PROTEIN: probable met...    237   2e-69    
emb|CDP07517.1|  unnamed protein product                                238   2e-69    
gb|KHG00805.1|  hypothetical protein F383_23598                         237   3e-69    
ref|XP_002893051.1|  hypothetical protein ARALYDRAFT_889384             236   5e-69    
ref|XP_006306888.1|  hypothetical protein CARUB_v10008443mg             236   8e-69    
ref|NP_001176817.1|  Os12g0178300                                       221   1e-68    
emb|CDY67390.1|  BnaA06g38510D                                          235   1e-68    
ref|XP_009149431.1|  PREDICTED: probable methyltransferase PMT28        235   1e-68    
emb|CDY26666.1|  BnaA06g13560D                                          235   1e-68    
tpg|DAA51680.1|  TPA: hypothetical protein ZEAMMB73_099003              235   2e-68    
ref|XP_004981591.1|  PREDICTED: probable methyltransferase PMT28-...    235   2e-68    
ref|XP_006341939.1|  PREDICTED: probable methyltransferase PMT28-...    235   3e-68    
ref|XP_001753452.1|  predicted protein                                  234   7e-68    
ref|XP_010477162.1|  PREDICTED: probable methyltransferase PMT28        233   8e-68    
ref|XP_010498361.1|  PREDICTED: probable methyltransferase PMT28        233   9e-68    
ref|XP_010459613.1|  PREDICTED: probable methyltransferase PMT28        233   1e-67    
ref|NP_564084.1|  putative methyltransferase PMT28                      233   1e-67    
ref|XP_006651862.1|  PREDICTED: probable methyltransferase PMT28-...    231   2e-67    
gb|KEH20400.1|  methyltransferase PMT16, putative                       234   2e-67    
ref|XP_002466374.1|  hypothetical protein SORBIDRAFT_01g006600          232   3e-67    
ref|XP_004238259.2|  PREDICTED: probable methyltransferase PMT28        236   3e-67    
ref|NP_001051428.1|  Os03g0775200                                       231   5e-67    
gb|EAY92017.1|  hypothetical protein OsI_13710                          231   5e-67    
ref|XP_007156094.1|  hypothetical protein PHAVU_003G258000g             232   6e-67    
gb|KHN00508.1|  Putative methyltransferase PMT27                        232   8e-67    
ref|XP_003519883.1|  PREDICTED: probable methyltransferase PMT27-...    232   8e-67    
ref|XP_008343307.1|  PREDICTED: probable methyltransferase PMT24        214   1e-66    
ref|XP_009594157.1|  PREDICTED: uncharacterized protein LOC104090695    235   1e-66    
ref|XP_003558618.2|  PREDICTED: uncharacterized protein LOC100846034    234   2e-66    
ref|XP_004509323.1|  PREDICTED: probable methyltransferase PMT27-...    230   4e-66    
gb|EPS70327.1|  hypothetical protein M569_04431                         228   6e-66    
ref|XP_007225452.1|  hypothetical protein PRUPE_ppa000321mg             228   2e-64    
ref|XP_006434984.1|  hypothetical protein CICLE_v10003946mg             228   3e-64    
ref|XP_002981388.1|  hypothetical protein SELMODRAFT_114169             221   3e-64    
emb|CAN75692.1|  hypothetical protein VITISV_038533                     228   5e-64    
ref|XP_002301867.2|  hypothetical protein POPTR_0002s26220g             227   6e-64    
ref|XP_002969911.1|  hypothetical protein SELMODRAFT_170913             220   7e-64    
ref|XP_008667905.1|  PREDICTED: uncharacterized protein LOC100273...    222   2e-62    
ref|XP_007160755.1|  hypothetical protein PHAVU_001G014500g             220   1e-61    
ref|XP_010530224.1|  PREDICTED: probable methyltransferase PMT24        201   2e-61    
gb|EMT09317.1|  tRNA wybutosine-synthesizing 1-like protein             218   8e-61    
ref|XP_002969525.1|  hypothetical protein SELMODRAFT_170677             211   4e-60    
ref|XP_007141740.1|  hypothetical protein PHAVU_008G221500g             210   7e-60    
ref|XP_011084874.1|  PREDICTED: probable methyltransferase PMT23        209   6e-59    
ref|XP_007163573.1|  hypothetical protein PHAVU_001G245500g             207   8e-59    
ref|XP_002986762.1|  hypothetical protein SELMODRAFT_20660              205   9e-59    
gb|KHN48584.1|  Putative methyltransferase PMT23                        205   3e-58    
gb|KGN50684.1|  hypothetical protein Csa_5G211570                       204   5e-58    
ref|XP_009613322.1|  PREDICTED: probable methyltransferase PMT23        205   6e-58    
ref|XP_004148176.1|  PREDICTED: probable methyltransferase PMT23-...    204   8e-58    
gb|EPS67794.1|  hypothetical protein M569_06980                         194   2e-57    
ref|NP_001170010.1|  uncharacterized protein LOC100383917               194   3e-57    
gb|EEE52864.1|  hypothetical protein OsJ_35419                          189   4e-57    
ref|XP_009758520.1|  PREDICTED: probable methyltransferase PMT23        202   6e-57    
gb|ABA96622.1|  dehydration-responsive protein, putative                191   9e-57    
gb|KHN38532.1|  Putative methyltransferase PMT23                        201   9e-57    
ref|XP_003519422.1|  PREDICTED: probable methyltransferase PMT23-...    201   9e-57    
gb|KDO68879.1|  hypothetical protein CISIN_1g017983mg                   194   9e-57    
ref|XP_003545223.1|  PREDICTED: probable methyltransferase PMT23-...    201   1e-56    
ref|XP_009631455.1|  PREDICTED: probable methyltransferase PMT23        201   1e-56    
ref|XP_008656388.1|  PREDICTED: probable methyltransferase PMT23 ...    195   1e-56    
gb|AES99641.2|  methyltransferase PMT16, putative                       200   3e-56    
gb|KHN04781.1|  Putative methyltransferase PMT23                        200   3e-56    
ref|XP_003537495.1|  PREDICTED: probable methyltransferase PMT23-...    200   3e-56    
ref|XP_003616683.1|  hypothetical protein MTR_5g083150                  200   3e-56    
ref|XP_009769140.1|  PREDICTED: probable methyltransferase PMT23        200   5e-56    
emb|CDP13980.1|  unnamed protein product                                199   5e-56    
ref|XP_006353441.1|  PREDICTED: probable methyltransferase PMT22-...    200   6e-56    
gb|KDO68877.1|  hypothetical protein CISIN_1g017983mg                   194   6e-56    
ref|XP_004491015.1|  PREDICTED: probable methyltransferase PMT23-...    199   8e-56    
ref|XP_010257058.1|  PREDICTED: probable methyltransferase PMT23 ...    196   9e-56    
ref|XP_008656387.1|  PREDICTED: probable methyltransferase PMT23 ...    194   1e-55    
ref|XP_006847414.1|  hypothetical protein AMTR_s00153p00060550          199   2e-55    
ref|XP_008454816.1|  PREDICTED: probable methyltransferase PMT23        198   2e-55    
emb|CDY66535.1|  BnaA09g54660D                                          199   2e-55    
ref|XP_004500572.1|  PREDICTED: probable methyltransferase PMT23-...    197   3e-55    
ref|XP_010264561.1|  PREDICTED: probable methyltransferase PMT23 ...    197   3e-55    
ref|XP_007008884.1|  S-adenosyl-L-methionine-dependent methyltran...    197   3e-55    
ref|XP_004241111.1|  PREDICTED: probable methyltransferase PMT22        197   4e-55    
ref|XP_010257056.1|  PREDICTED: probable methyltransferase PMT23 ...    197   6e-55    
gb|AES71217.2|  methyltransferase PMT16, putative                       197   7e-55    
ref|XP_003600966.1|  hypothetical protein MTR_3g071530                  197   8e-55    
gb|KJB67515.1|  hypothetical protein B456_010G195400                    196   8e-55    
gb|KCW65706.1|  hypothetical protein EUGRSUZ_G03084                     193   1e-54    
gb|KJB76216.1|  hypothetical protein B456_012G078800                    195   2e-54    
ref|XP_011035889.1|  PREDICTED: probable methyltransferase PMT23        195   2e-54    
ref|XP_010087523.1|  putative methyltransferase PMT23                   195   3e-54    
ref|XP_002315142.2|  hypothetical protein POPTR_0010s19240g             195   4e-54    
emb|CDP13979.1|  unnamed protein product                                194   4e-54    
ref|XP_008777700.1|  PREDICTED: probable methyltransferase PMT23        192   4e-54    
ref|XP_011076659.1|  PREDICTED: probable methyltransferase PMT23        194   4e-54    
ref|XP_006435799.1|  hypothetical protein CICLE_v10030978mg             194   5e-54    
gb|KHG22665.1|  hypothetical protein F383_10369                         194   8e-54    
ref|XP_004961776.1|  PREDICTED: probable methyltransferase PMT23-...    189   9e-54    
ref|XP_010067556.1|  PREDICTED: probable methyltransferase PMT23        193   1e-53    
ref|XP_004307681.1|  PREDICTED: probable methyltransferase PMT23        192   2e-53    
ref|XP_010554685.1|  PREDICTED: probable methyltransferase PMT22        192   3e-53    
gb|EYU43436.1|  hypothetical protein MIMGU_mgv1a006166mg                189   4e-53    
ref|NP_001055814.1|  Os05g0472200                                       189   7e-53    
ref|XP_010922608.1|  PREDICTED: probable methyltransferase PMT23 ...    191   7e-53    
ref|XP_002520775.1|  ATP binding protein, putative                      191   7e-53    
ref|NP_565926.1|  putative methyltransferase PMT23                      191   8e-53    
ref|XP_010922607.1|  PREDICTED: probable methyltransferase PMT23 ...    191   1e-52    
ref|XP_009133427.1|  PREDICTED: probable methyltransferase PMT23        190   1e-52    
ref|XP_002441250.1|  hypothetical protein SORBIDRAFT_09g023140          191   1e-52    
ref|XP_008369289.1|  PREDICTED: probable methyltransferase PMT23        190   1e-52    
ref|XP_009345335.1|  PREDICTED: probable methyltransferase PMT23        190   2e-52    
ref|XP_004239948.1|  PREDICTED: probable methyltransferase PMT23        190   2e-52    
gb|EAY98391.1|  hypothetical protein OsI_20304                          190   2e-52    
ref|XP_009369208.1|  PREDICTED: probable methyltransferase PMT23        189   2e-52    
gb|EEE64058.1|  hypothetical protein OsJ_18888                          189   2e-52    
ref|XP_007220560.1|  hypothetical protein PRUPE_ppa003289mg             189   3e-52    
ref|XP_008233802.1|  PREDICTED: probable methyltransferase PMT23        189   3e-52    
gb|KFK34851.1|  hypothetical protein AALP_AA5G201400                    189   3e-52    
gb|EMS51937.1|  putative methyltransferase PMT23                        187   4e-52    
gb|AAT93959.1|  unknown protein                                         189   5e-52    
ref|XP_006411284.1|  hypothetical protein EUTSA_v10016421mg             188   7e-52    
emb|CDY24913.1|  BnaC03g22590D                                          189   9e-52    
ref|XP_006655400.1|  PREDICTED: probable methyltransferase PMT23-...    188   1e-51    
gb|EMT10514.1|  hypothetical protein F775_15734                         183   1e-51    
ref|XP_002273466.1|  PREDICTED: probable methyltransferase PMT23        187   1e-51    
ref|XP_006355647.1|  PREDICTED: probable methyltransferase PMT23-...    187   2e-51    
ref|XP_006293840.1|  hypothetical protein CARUB_v10022824mg             187   2e-51    
emb|CAN73341.1|  hypothetical protein VITISV_042403                     186   3e-51    
ref|XP_006292224.1|  hypothetical protein CARUB_v10018430mg             186   4e-51    
ref|XP_008362733.1|  PREDICTED: probable methyltransferase PMT23        186   5e-51    
ref|XP_008354164.1|  PREDICTED: LOW QUALITY PROTEIN: probable met...    186   5e-51    
gb|EMS51988.1|  putative methyltransferase PMT27                        186   6e-51    
ref|XP_006644942.1|  PREDICTED: probable methyltransferase PMT23-...    185   2e-50    
ref|XP_010508886.1|  PREDICTED: probable methyltransferase PMT23        184   2e-50    
tpg|DAA57016.1|  TPA: hypothetical protein ZEAMMB73_561931              176   2e-50    
ref|XP_003564520.1|  PREDICTED: probable methyltransferase PMT23        184   4e-50    
emb|CDM84813.1|  unnamed protein product                                184   4e-50    
ref|XP_010427415.1|  PREDICTED: probable methyltransferase PMT22        184   4e-50    
ref|XP_006403024.1|  hypothetical protein EUTSA_v10005845mg             183   4e-50    
ref|XP_010517446.1|  PREDICTED: probable methyltransferase PMT23        183   6e-50    
gb|KFK36919.1|  hypothetical protein AALP_AA4G189700                    182   6e-50    
gb|EMT22580.1|  hypothetical protein F775_04635                         183   1e-49    
gb|EEE55614.1|  hypothetical protein OsJ_03940                          182   2e-49    
ref|NP_001044685.1|  Os01g0828300                                       182   2e-49    
gb|EEC71735.1|  hypothetical protein OsI_04288                          182   2e-49    
ref|XP_002456576.1|  hypothetical protein SORBIDRAFT_03g038660          182   2e-49    
ref|XP_002881711.1|  dehydration-responsive family protein              181   4e-49    
ref|XP_010554680.1|  PREDICTED: probable methyltransferase PMT23 ...    181   4e-49    
ref|NP_567033.2|  probable methyltransferase PMT22                      181   4e-49    
ref|XP_010516207.1|  PREDICTED: probable methyltransferase PMT22        181   4e-49    
ref|XP_010693057.1|  PREDICTED: probable methyltransferase PMT23        180   6e-49    
ref|XP_009139122.1|  PREDICTED: probable methyltransferase PMT22        180   7e-49    
emb|CDY43341.1|  BnaC04g25150D                                          180   9e-49    
ref|XP_009397093.1|  PREDICTED: probable methyltransferase PMT23        180   1e-48    
gb|KHG30668.1|  hypothetical protein F383_12718                         182   1e-48    
ref|XP_008783496.1|  PREDICTED: probable methyltransferase PMT28 ...    178   5e-48    
emb|CDX76062.1|  BnaA04g03260D                                          178   6e-48    
ref|XP_008674868.1|  PREDICTED: probable methyltransferase PMT23 ...    176   2e-47    
ref|XP_008674871.1|  PREDICTED: probable methyltransferase PMT23 ...    176   2e-47    
ref|XP_002878065.1|  hypothetical protein ARALYDRAFT_907046             174   1e-46    
gb|KDP44715.1|  hypothetical protein JCGZ_01215                         172   4e-46    
gb|EMS56590.1|  putative methyltransferase PMT23                        173   8e-46    
gb|AIU48593.1|  quasimodo 3                                             167   2e-44    
gb|ABR16825.1|  unknown                                                 157   6e-44    
ref|XP_010091551.1|  putative methyltransferase PMT13                   165   1e-43    
gb|KHN29412.1|  Putative methyltransferase PMT13                        164   1e-43    
ref|XP_008655089.1|  PREDICTED: ankyrin like protein isoform X1         166   1e-43    
ref|NP_001151799.1|  ankyrin like protein                               166   1e-43    
gb|AFW81456.1|  ankyrin like protein                                    166   1e-43    
ref|XP_004229834.1|  PREDICTED: probable methyltransferase PMT13        165   1e-43    
ref|XP_006339458.1|  PREDICTED: probable methyltransferase PMT13-...    165   1e-43    
ref|XP_009122211.1|  PREDICTED: probable methyltransferase PMT12        164   4e-43    
ref|XP_008373610.1|  PREDICTED: probable methyltransferase PMT14        159   4e-43    
ref|XP_001767424.1|  predicted protein                                  163   5e-43    
ref|XP_003534594.1|  PREDICTED: probable methyltransferase PMT13-...    164   6e-43    
ref|XP_010427357.1|  PREDICTED: probable methyltransferase PMT13        163   7e-43    
ref|XP_010419629.1|  PREDICTED: probable methyltransferase PMT13        163   1e-42    
gb|KJB22349.1|  hypothetical protein B456_004G042500                    162   1e-42    



>ref|XP_008227415.1| PREDICTED: probable methyltransferase PMT26 [Prunus mume]
Length=819

 Score =   347 bits (891),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 154/191 (81%), Positives = 176/191 (92%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGKPAPEDF ADY+HW RVVTKSYLNGMGINWS+VRNVMDM AVYGGFAAALKDLK
Sbjct  629  QVGVYGKPAPEDFTADYEHWKRVVTKSYLNGMGINWSSVRNVMDMRAVYGGFAAALKDLK  688

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            +WVMN+V++DSPDTLPIIYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSK+K++CNL+
Sbjct  689  IWVMNVVSVDSPDTLPIIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSKLKKRCNLV  748

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             +V EVDRILRPEGKLIVRD  ET+ ELEN++KSM +++RMTYS   EGLLCVQK++WRP
Sbjct  749  AVVAEVDRILRPEGKLIVRDDVETINELENMVKSMQWEVRMTYSKDKEGLLCVQKSLWRP  808

Query  185  KEVQTLAYAIA  153
            KE +TL YAIA
Sbjct  809  KESETLKYAIA  819



>ref|XP_007214544.1| hypothetical protein PRUPE_ppa001471mg [Prunus persica]
 gb|EMJ15743.1| hypothetical protein PRUPE_ppa001471mg [Prunus persica]
Length=819

 Score =   347 bits (890),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 154/191 (81%), Positives = 175/191 (92%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGKPAPEDF ADY+HW RVVTKSYLNGMGINWS+VRNVMDM AVYGGFAAALKDLK
Sbjct  629  QVGVYGKPAPEDFTADYEHWKRVVTKSYLNGMGINWSSVRNVMDMRAVYGGFAAALKDLK  688

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            +WVMN+V++DSPDTLPIIYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSK+K++CNL 
Sbjct  689  IWVMNVVSVDSPDTLPIIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSKLKKRCNLA  748

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             +V EVDRILRPEGKLIVRD  ET+ ELEN++KSM +++RMTYS   EGLLCVQK++WRP
Sbjct  749  AVVAEVDRILRPEGKLIVRDDVETINELENMVKSMQWEVRMTYSKDKEGLLCVQKSLWRP  808

Query  185  KEVQTLAYAIA  153
            KE +TL YAIA
Sbjct  809  KESETLKYAIA  819



>gb|KJB48927.1| hypothetical protein B456_008G094300 [Gossypium raimondii]
 gb|KJB48929.1| hypothetical protein B456_008G094300 [Gossypium raimondii]
 gb|KJB48930.1| hypothetical protein B456_008G094300 [Gossypium raimondii]
Length=813

 Score =   344 bits (883),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 155/191 (81%), Positives = 175/191 (92%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGK APEDFAAD +HW RVVTKSYLNGMGI+WS+VRNVMDMNAVYGGFAAALKDL 
Sbjct  623  QVGVYGKAAPEDFAADNEHWKRVVTKSYLNGMGISWSSVRNVMDMNAVYGGFAAALKDLS  682

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            +WVMN+V IDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSK+ ++CNL+
Sbjct  683  LWVMNVVPIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKLNKRCNLV  742

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             +V EVDRILRPEGKLIVRD+ ET+ ELEN+LKSM +++RMTYS   EGLLCVQK+MWRP
Sbjct  743  AIVAEVDRILRPEGKLIVRDNVETINELENMLKSMQWEVRMTYSKDKEGLLCVQKSMWRP  802

Query  185  KEVQTLAYAIA  153
            KEV+T+ YAIA
Sbjct  803  KEVETIKYAIA  813



>ref|XP_007048444.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
 gb|EOX92601.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
Length=815

 Score =   343 bits (881),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 151/191 (79%), Positives = 178/191 (93%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGK APEDFAAD++HW RVVTKSY+NGMGINWS+VRNVMDM AVYGGFAAALKDL 
Sbjct  625  QVGVYGKAAPEDFAADHEHWKRVVTKSYINGMGINWSSVRNVMDMRAVYGGFAAALKDLN  684

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            +WV+N+V+IDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSK+K++CNL+
Sbjct  685  LWVLNVVSIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKVKKRCNLL  744

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++ EVDR+LRPEGKLIVRD+ ET+TELEN+L+SM +++RMTY+   EGLLCVQK+MWRP
Sbjct  745  AVIAEVDRVLRPEGKLIVRDNVETITELENMLRSMQWEVRMTYTKDTEGLLCVQKSMWRP  804

Query  185  KEVQTLAYAIA  153
            KEV+T+ YAIA
Sbjct  805  KEVETITYAIA  815



>ref|XP_009771172.1| PREDICTED: probable methyltransferase PMT26 [Nicotiana sylvestris]
 ref|XP_009771173.1| PREDICTED: probable methyltransferase PMT26 [Nicotiana sylvestris]
Length=807

 Score =   343 bits (879),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 154/191 (81%), Positives = 170/191 (89%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGKPAPEDF ADY+HW  VV  SY+NGMGINWSTVRNVMDM A+YGGFAAAL+DL 
Sbjct  617  QVGVYGKPAPEDFTADYEHWKHVVKNSYINGMGINWSTVRNVMDMRAIYGGFAAALRDLN  676

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMNIV++D+PDTLPIIYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSKIK KC L 
Sbjct  677  VWVMNIVSVDAPDTLPIIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSKIKTKCGLP  736

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             +V EVDRILRPEGKLIVRD  E +TELE++ KSMHY+IRMTYS   EGLLCVQKTMWRP
Sbjct  737  AIVAEVDRILRPEGKLIVRDKVEAVTELESMFKSMHYEIRMTYSKDKEGLLCVQKTMWRP  796

Query  185  KEVQTLAYAIA  153
            KEV+TL YA+A
Sbjct  797  KEVETLTYALA  807



>gb|KHG06416.1| hypothetical protein F383_32222 [Gossypium arboreum]
Length=820

 Score =   342 bits (877),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 154/191 (81%), Positives = 174/191 (91%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGK APEDFAAD +HW RVVTKSYLNGMGI+WS+VRNVMDMNAVYGGFAAALKDL 
Sbjct  630  QVGVYGKAAPEDFAADNEHWKRVVTKSYLNGMGISWSSVRNVMDMNAVYGGFAAALKDLS  689

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            +WVMN+V IDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSK+ ++CNL+
Sbjct  690  LWVMNVVPIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKLNKRCNLV  749

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             +V EVDRILRPEGKLIVRD+ ET+ ELEN+LKSM +++RMTYS   EGLLCVQK+MWRP
Sbjct  750  AIVAEVDRILRPEGKLIVRDNVETINELENMLKSMQWEVRMTYSKDKEGLLCVQKSMWRP  809

Query  185  KEVQTLAYAIA  153
             EV+T+ YAIA
Sbjct  810  TEVETIKYAIA  820



>emb|CAN60873.1| hypothetical protein VITISV_030591 [Vitis vinifera]
Length=201

 Score =   322 bits (825),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 170/191 (89%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYG+ APEDF ADY+HW RVV +SYLNG+GI+WS+VRNVMDM AVYGGFAAAL+DL 
Sbjct  11   QVGVYGRAAPEDFTADYEHWKRVVAQSYLNGIGISWSSVRNVMDMRAVYGGFAAALRDLN  70

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V+IDSPDTLPIIYERGLFG+YH+WCESF+TYPRSYDLLHADH+FSK K+KCNL+
Sbjct  71   VWVMNVVSIDSPDTLPIIYERGLFGIYHNWCESFNTYPRSYDLLHADHIFSKTKKKCNLV  130

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++ E DRILRPEGKLIVRD  ETL ++EN+L+SMH++IRMTYS   EGLLC QKTMWRP
Sbjct  131  AVIAEADRILRPEGKLIVRDDVETLGQVENMLRSMHWEIRMTYSKEKEGLLCAQKTMWRP  190

Query  185  KEVQTLAYAIA  153
            KE++ +  AIA
Sbjct  191  KEMEIIKSAIA  201



>ref|XP_004288094.1| PREDICTED: probable methyltransferase PMT26 [Fragaria vesca subsp. 
vesca]
Length=800

 Score =   341 bits (874),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 154/191 (81%), Positives = 173/191 (91%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            +TGVYGKPAPEDF ADY+HW RVV KSYLNGMGINWS+VRNVMDM +VYGGFAAALKDLK
Sbjct  610  QTGVYGKPAPEDFTADYEHWKRVVDKSYLNGMGINWSSVRNVMDMRSVYGGFAAALKDLK  669

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            +WVMNIV IDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFS +K++C L+
Sbjct  670  LWVMNIVTIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSLLKKRCKLV  729

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             +V EVDRILRPEGKLIVRD  ET+ ELE++LKSM +++RMTYS   EGLLCVQK+MWRP
Sbjct  730  AVVAEVDRILRPEGKLIVRDTVETINELESMLKSMQWEVRMTYSKDKEGLLCVQKSMWRP  789

Query  185  KEVQTLAYAIA  153
            KE +T+ YAIA
Sbjct  790  KETETVKYAIA  800



>ref|XP_010270332.1| PREDICTED: probable methyltransferase PMT26 isoform X2 [Nelumbo 
nucifera]
Length=807

 Score =   340 bits (872),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 150/191 (79%), Positives = 176/191 (92%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            +TGVYGKPAP+DFAADY+HW RVVTKSYL GMGINWS++RNVMDM +VYGGFAAALKDLK
Sbjct  617  QTGVYGKPAPDDFAADYEHWKRVVTKSYLKGMGINWSSIRNVMDMRSVYGGFAAALKDLK  676

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V IDSPDTLPIIYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSK+K++CNL+
Sbjct  677  VWVMNVVPIDSPDTLPIIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSKLKKRCNLV  736

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             +V EVDRILRPEGKLIVRD+ ET+ EL N+ +S+ ++IRMTYS  +EGLLC+QKT+WRP
Sbjct  737  AVVAEVDRILRPEGKLIVRDNVETIGELSNMARSLQWEIRMTYSQDNEGLLCLQKTVWRP  796

Query  185  KEVQTLAYAIA  153
             E +T++YAIA
Sbjct  797  TEQETISYAIA  807



>ref|XP_010270331.1| PREDICTED: probable methyltransferase PMT26 isoform X1 [Nelumbo 
nucifera]
Length=808

 Score =   340 bits (872),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 150/191 (79%), Positives = 176/191 (92%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            +TGVYGKPAP+DFAADY+HW RVVTKSYL GMGINWS++RNVMDM +VYGGFAAALKDLK
Sbjct  618  QTGVYGKPAPDDFAADYEHWKRVVTKSYLKGMGINWSSIRNVMDMRSVYGGFAAALKDLK  677

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V IDSPDTLPIIYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSK+K++CNL+
Sbjct  678  VWVMNVVPIDSPDTLPIIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSKLKKRCNLV  737

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             +V EVDRILRPEGKLIVRD+ ET+ EL N+ +S+ ++IRMTYS  +EGLLC+QKT+WRP
Sbjct  738  AVVAEVDRILRPEGKLIVRDNVETIGELSNMARSLQWEIRMTYSQDNEGLLCLQKTVWRP  797

Query  185  KEVQTLAYAIA  153
             E +T++YAIA
Sbjct  798  TEQETISYAIA  808



>gb|AGE09593.1| DehydRP-like protein, partial [Eucalyptus cladocalyx]
Length=217

 Score =   319 bits (818),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 141/191 (74%), Positives = 173/191 (91%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGK APEDFA D KHW RVVTKSYL+G+GI+WSTVR+VMDM A+YGGFAAALKDL 
Sbjct  27   QVGVYGKSAPEDFALDNKHWKRVVTKSYLSGIGIDWSTVRSVMDMRAIYGGFAAALKDLN  86

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V++D+PDTLPIIYERGLFG+YHDWCESFSTYPRSYDLLH+DHLFSKIK++CNL+
Sbjct  87   VWVMNVVSVDAPDTLPIIYERGLFGIYHDWCESFSTYPRSYDLLHSDHLFSKIKKRCNLV  146

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             LV EVDRILRP GKLIVRD  ET+ E+E+++++M +++R+TYS  +EGLLCVQK+MWRP
Sbjct  147  ALVAEVDRILRPGGKLIVRDDVETINEVESMVRAMQWEVRLTYSKDNEGLLCVQKSMWRP  206

Query  185  KEVQTLAYAIA  153
             + +T++YAIA
Sbjct  207  SKSETVSYAIA  217



>ref|XP_009590749.1| PREDICTED: probable methyltransferase PMT26 [Nicotiana tomentosiformis]
 ref|XP_009590750.1| PREDICTED: probable methyltransferase PMT26 [Nicotiana tomentosiformis]
Length=807

 Score =   337 bits (865),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 153/191 (80%), Positives = 169/191 (88%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGKPAPEDF ADY+HW  VV  SYL+GMGINWSTVRNVMDM A+YGGFAAAL+DL 
Sbjct  617  QVGVYGKPAPEDFTADYEHWKHVVKNSYLSGMGINWSTVRNVMDMRAIYGGFAAALRDLN  676

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMNIV++D+PDTLPIIYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSKIK KC L 
Sbjct  677  VWVMNIVSVDAPDTLPIIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSKIKTKCGLP  736

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             +V EVDRILRPEGKLIVRD  E +TELE++ KSMHY+IRMTYS   EGLLCVQKTMWRP
Sbjct  737  VIVAEVDRILRPEGKLIVRDKVEAVTELESMFKSMHYEIRMTYSKDKEGLLCVQKTMWRP  796

Query  185  KEVQTLAYAIA  153
             EV+TL YA+A
Sbjct  797  TEVETLTYALA  807



>ref|XP_002516311.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF46058.1| ATP binding protein, putative [Ricinus communis]
Length=814

 Score =   337 bits (864),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 148/189 (78%), Positives = 175/189 (93%), Gaps = 0/189 (0%)
 Frame = -2

Query  719  GVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLKVW  540
            GVYGKP PEDFAADY+HW RVV+KSYLNG+GI WS+VRNVMDM ++YGGFAAALKD+ VW
Sbjct  626  GVYGKPEPEDFAADYEHWKRVVSKSYLNGIGIKWSSVRNVMDMRSIYGGFAAALKDINVW  685

Query  539  VMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGL  360
            VMN+V +DSPDTLPIIYERGLFG+YHDWCESF+TYPR+YDLLHADHLFSKIK++CNL+ +
Sbjct  686  VMNVVPVDSPDTLPIIYERGLFGIYHDWCESFNTYPRTYDLLHADHLFSKIKKRCNLVAV  745

Query  359  VVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKE  180
            +VEVDRILRPEGKLIVRD+ ET+TELENIL+SMH+++RMTYS   EGLL V+K+MWRPKE
Sbjct  746  IVEVDRILRPEGKLIVRDNVETVTELENILRSMHWEVRMTYSKEKEGLLYVEKSMWRPKE  805

Query  179  VQTLAYAIA  153
             +T+ YAIA
Sbjct  806  SETITYAIA  814



>ref|XP_008394175.1| PREDICTED: probable methyltransferase PMT26 isoform X2 [Malus 
domestica]
Length=807

 Score =   336 bits (862),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 149/191 (78%), Positives = 172/191 (90%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGKPAPEDF +D +HW RVVTKSYLNGMGINW +VRNVMDM AVYGGFAAALKDLK
Sbjct  617  QVGVYGKPAPEDFTSDNEHWKRVVTKSYLNGMGINWKSVRNVMDMRAVYGGFAAALKDLK  676

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            +WVMN+V++DSPDTLPIIYERGLFGMYHDWCESF+TYPRSYDLLHADHLFSK+K++CNL+
Sbjct  677  IWVMNVVSVDSPDTLPIIYERGLFGMYHDWCESFNTYPRSYDLLHADHLFSKLKKRCNLV  736

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             +V EVDRILRPEGKLIVRD  ET+ ELEN+ +SM +++ +TYS   EGLLCVQK+MWRP
Sbjct  737  AVVAEVDRILRPEGKLIVRDDVETIYELENMARSMQWEVSLTYSKDKEGLLCVQKSMWRP  796

Query  185  KEVQTLAYAIA  153
            KE +TL YAIA
Sbjct  797  KESETLKYAIA  807



>gb|KDO51659.1| hypothetical protein CISIN_1g003776mg [Citrus sinensis]
 gb|KDO51660.1| hypothetical protein CISIN_1g003776mg [Citrus sinensis]
Length=796

 Score =   336 bits (861),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 147/191 (77%), Positives = 174/191 (91%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGK APEDF ADY+HW RVV+KSYLNGMGINWSTVRNVMDM +VYGGFAAA+KD+ 
Sbjct  606  QVGVYGKSAPEDFTADYEHWKRVVSKSYLNGMGINWSTVRNVMDMRSVYGGFAAAMKDIS  665

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+++IDSPDTLPIIYERGLFG+YHDWCESFSTYPR+YDLLHADHLFSKIK++CNL+
Sbjct  666  VWVMNVISIDSPDTLPIIYERGLFGIYHDWCESFSTYPRTYDLLHADHLFSKIKKRCNLV  725

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             +V EVDRILRPEGKLIVRD  ET+ ELE+++K M +++RMTYS   EGLLCV+K+MWRP
Sbjct  726  AVVAEVDRILRPEGKLIVRDDVETINELESMVKGMQWEVRMTYSKDKEGLLCVEKSMWRP  785

Query  185  KEVQTLAYAIA  153
            KE++T+ YAIA
Sbjct  786  KELETIKYAIA  796



>ref|XP_008394173.1| PREDICTED: probable methyltransferase PMT26 isoform X1 [Malus 
domestica]
 ref|XP_008394174.1| PREDICTED: probable methyltransferase PMT26 isoform X1 [Malus 
domestica]
Length=820

 Score =   337 bits (863),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 149/191 (78%), Positives = 172/191 (90%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGKPAPEDF +D +HW RVVTKSYLNGMGINW +VRNVMDM AVYGGFAAALKDLK
Sbjct  630  QVGVYGKPAPEDFTSDNEHWKRVVTKSYLNGMGINWKSVRNVMDMRAVYGGFAAALKDLK  689

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            +WVMN+V++DSPDTLPIIYERGLFGMYHDWCESF+TYPRSYDLLHADHLFSK+K++CNL+
Sbjct  690  IWVMNVVSVDSPDTLPIIYERGLFGMYHDWCESFNTYPRSYDLLHADHLFSKLKKRCNLV  749

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             +V EVDRILRPEGKLIVRD  ET+ ELEN+ +SM +++ +TYS   EGLLCVQK+MWRP
Sbjct  750  AVVAEVDRILRPEGKLIVRDDVETIYELENMARSMQWEVSLTYSKDKEGLLCVQKSMWRP  809

Query  185  KEVQTLAYAIA  153
            KE +TL YAIA
Sbjct  810  KESETLKYAIA  820



>ref|XP_006432154.1| hypothetical protein CICLE_v10000328mg [Citrus clementina]
 ref|XP_006465082.1| PREDICTED: probable methyltransferase PMT26-like [Citrus sinensis]
 gb|ESR45394.1| hypothetical protein CICLE_v10000328mg [Citrus clementina]
Length=796

 Score =   336 bits (861),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 147/191 (77%), Positives = 174/191 (91%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGK APEDF ADY+HW RVV+KSYLNGMGINWSTVRNVMDM +VYGGFAAA+KD+ 
Sbjct  606  QVGVYGKSAPEDFTADYEHWKRVVSKSYLNGMGINWSTVRNVMDMRSVYGGFAAAMKDIS  665

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+++IDSPDTLPIIYERGLFG+YHDWCESFSTYPR+YDLLHADHLFSKIK++CNL+
Sbjct  666  VWVMNVISIDSPDTLPIIYERGLFGIYHDWCESFSTYPRTYDLLHADHLFSKIKKRCNLV  725

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             +V EVDRILRPEGKLIVRD  ET+ ELE+++K M +++RMTYS   EGLLCV+K+MWRP
Sbjct  726  AVVAEVDRILRPEGKLIVRDDVETINELESMVKGMQWEVRMTYSKDKEGLLCVEKSMWRP  785

Query  185  KEVQTLAYAIA  153
            KE++T+ YAIA
Sbjct  786  KELETIKYAIA  796



>ref|XP_008781596.1| PREDICTED: probable methyltransferase PMT26 [Phoenix dactylifera]
Length=886

 Score =   336 bits (862),  Expect = 2e-105, Method: Composition-based stats.
 Identities = 145/191 (76%), Positives = 172/191 (90%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            E GVYGKPAPEDFA DY+HW RVV+KSYLNGMGINW+TVRNVMDM +VYGGFAAAL+D K
Sbjct  696  EVGVYGKPAPEDFAVDYEHWRRVVSKSYLNGMGINWTTVRNVMDMRSVYGGFAAALRDKK  755

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V+IDSPDTLP+IYERG FGMYHDWCESFSTYPR+YDLLHADHLFS++K++C L+
Sbjct  756  VWVMNVVSIDSPDTLPVIYERGFFGMYHDWCESFSTYPRTYDLLHADHLFSRLKKRCKLL  815

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++VEVDRILRPEGKL+VRD+ E + E+E+I KS+H++IRMTYS  +EGLLCVQKTMWRP
Sbjct  816  PVIVEVDRILRPEGKLLVRDNAEIINEVESIAKSLHWEIRMTYSKNNEGLLCVQKTMWRP  875

Query  185  KEVQTLAYAIA  153
            KEV +    I+
Sbjct  876  KEVASSTTPIS  886



>ref|XP_010930722.1| PREDICTED: probable methyltransferase PMT26 [Elaeis guineensis]
Length=887

 Score =   336 bits (861),  Expect = 3e-105, Method: Composition-based stats.
 Identities = 144/191 (75%), Positives = 172/191 (90%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGKPAPEDFA DY+HW RVV+KSYLNGMGINW+ VRNVMDM +VYGGFAAAL+D K
Sbjct  697  QVGVYGKPAPEDFAVDYEHWKRVVSKSYLNGMGINWTIVRNVMDMRSVYGGFAAALRDKK  756

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V+IDSPDTLP+IYERGLFGMYHDWCESFSTYPR+YDLLHADHLFS++K++C L+
Sbjct  757  VWVMNVVSIDSPDTLPVIYERGLFGMYHDWCESFSTYPRTYDLLHADHLFSRLKKRCKLL  816

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++VEVDRILRPEGKL+VRD+ E + E+E+I KS+H++IRMTYS  DEGLLCVQKT+WRP
Sbjct  817  PVIVEVDRILRPEGKLLVRDNAEIINEVESIAKSLHWEIRMTYSKNDEGLLCVQKTIWRP  876

Query  185  KEVQTLAYAIA  153
            KEV +    I+
Sbjct  877  KEVASSTTPIS  887



>ref|XP_010090820.1| putative methyltransferase PMT26 [Morus notabilis]
 gb|EXB40945.1| putative methyltransferase PMT26 [Morus notabilis]
Length=816

 Score =   334 bits (856),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 147/190 (77%), Positives = 172/190 (91%), Gaps = 0/190 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGKPAPEDF ADY+HW RVV+KSYL+GMGINWS+VRNVMDM +VYGGFAAALKDL 
Sbjct  625  QVGVYGKPAPEDFDADYQHWKRVVSKSYLSGMGINWSSVRNVMDMRSVYGGFAAALKDLN  684

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V++DSPDTLPIIYERGLFGMYHDWCES+STYPR+YDLLHADHLFSK+K +CNL+
Sbjct  685  VWVMNVVSVDSPDTLPIIYERGLFGMYHDWCESYSTYPRTYDLLHADHLFSKLKTRCNLV  744

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             +V EVDR+LRPEGKLIVRD  E + ELEN++KSM +++RMTYS  +EGLLCVQK+MWRP
Sbjct  745  AVVAEVDRLLRPEGKLIVRDSVEIINELENMVKSMQWEVRMTYSKENEGLLCVQKSMWRP  804

Query  185  KEVQTLAYAI  156
             E +TL YAI
Sbjct  805  NESETLKYAI  814



>ref|XP_009355841.1| PREDICTED: probable methyltransferase PMT26 [Pyrus x bretschneideri]
 ref|XP_009355842.1| PREDICTED: probable methyltransferase PMT26 [Pyrus x bretschneideri]
Length=820

 Score =   334 bits (856),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 147/191 (77%), Positives = 172/191 (90%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGKPAPEDF +D +HW RVVTKSYLNGMGINW +VRNVMDM AVYGGFAAALKDLK
Sbjct  630  QVGVYGKPAPEDFTSDNEHWKRVVTKSYLNGMGINWKSVRNVMDMRAVYGGFAAALKDLK  689

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            +WVMN+V++DSPDTLPIIYERGLFGMYHDWCESF+TYPRSYDLLHADHLFSK+K++CNL+
Sbjct  690  IWVMNVVSVDSPDTLPIIYERGLFGMYHDWCESFNTYPRSYDLLHADHLFSKLKKRCNLV  749

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             +V EVDRILRPEGKLIVRD  ET+ ELEN+ +SM +++ +TYS   EGLLCVQK+MWRP
Sbjct  750  AVVAEVDRILRPEGKLIVRDDVETIYELENMARSMQWEVSLTYSKDKEGLLCVQKSMWRP  809

Query  185  KEVQTLAYAIA  153
            +E ++L YAIA
Sbjct  810  EESESLKYAIA  820



>ref|XP_011099715.1| PREDICTED: probable methyltransferase PMT26 [Sesamum indicum]
Length=818

 Score =   333 bits (853),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 151/191 (79%), Positives = 168/191 (88%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            E GVYGKPAPEDF ADY+HW RVV+ SYLNG+GINWSTVRNVMDM AVYGG AAAL++L 
Sbjct  628  EVGVYGKPAPEDFVADYEHWKRVVSNSYLNGLGINWSTVRNVMDMRAVYGGLAAALRELN  687

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMNIV+ID+PDTLPIIYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSKIK+KCN M
Sbjct  688  VWVMNIVSIDAPDTLPIIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSKIKKKCNFM  747

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             LV EVDRILRPEGK+IVRD  E ++ELENI KSM +++RMTYS   EGLL VQKTMWRP
Sbjct  748  ALVAEVDRILRPEGKIIVRDKVEIISELENIFKSMQWEVRMTYSKDKEGLLYVQKTMWRP  807

Query  185  KEVQTLAYAIA  153
             E + + YAIA
Sbjct  808  TEQEKITYAIA  818



>ref|XP_004239625.1| PREDICTED: probable methyltransferase PMT26 [Solanum lycopersicum]
 ref|XP_010321299.1| PREDICTED: probable methyltransferase PMT26 [Solanum lycopersicum]
Length=813

 Score =   331 bits (849),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 151/191 (79%), Positives = 168/191 (88%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGKPAPEDF ADY+HW  VVT SYLNGMGINWSTVRNVMDM A+YGGFAAAL+DL 
Sbjct  623  QVGVYGKPAPEDFTADYEHWKHVVTNSYLNGMGINWSTVRNVMDMRAIYGGFAAALRDLN  682

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V++D+PDTLPIIYERGLFG+YHDWCESFSTYPRSYDL+HADHLFSKIK KC L 
Sbjct  683  VWVMNVVSVDAPDTLPIIYERGLFGIYHDWCESFSTYPRSYDLVHADHLFSKIKTKCGLP  742

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             +V EVDRILRP GKLIVRD  ET+TELE++LKSM Y+I MTYS   EGLL  QKTMWRP
Sbjct  743  AIVAEVDRILRPGGKLIVRDKEETITELESMLKSMQYEINMTYSKDKEGLLYCQKTMWRP  802

Query  185  KEVQTLAYAIA  153
            K+V+TL YAIA
Sbjct  803  KDVETLTYAIA  813



>ref|XP_003602637.1| Ankyrin-like protein [Medicago truncatula]
 gb|AES72888.1| methyltransferase PMT26-like protein, putative [Medicago truncatula]
Length=789

 Score =   330 bits (847),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 146/190 (77%), Positives = 169/190 (89%), Gaps = 0/190 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGKPAPEDFAAD KHW RVV+KSYLNG+GI WS VRNVMDMN++YGGFAAALKDL 
Sbjct  599  QVGVYGKPAPEDFAADNKHWKRVVSKSYLNGLGIQWSNVRNVMDMNSIYGGFAAALKDLN  658

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            +WVMN+V+IDS DTLPIIYERGLFG+YHDWCESFSTYPR+YDLLHADHLFSK++++CNL 
Sbjct  659  IWVMNVVSIDSADTLPIIYERGLFGIYHDWCESFSTYPRTYDLLHADHLFSKVQKRCNLA  718

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             LV EVDRILRPEGKLIVRD  E + ELE+++KSM +++RMTYS   EGLLCVQK+ WRP
Sbjct  719  SLVAEVDRILRPEGKLIVRDTVEVINELESMVKSMQWEVRMTYSKDKEGLLCVQKSTWRP  778

Query  185  KEVQTLAYAI  156
            KE +TL YAI
Sbjct  779  KETETLKYAI  788



>emb|CDP04655.1| unnamed protein product [Coffea canephora]
Length=766

 Score =   330 bits (845),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 147/191 (77%), Positives = 165/191 (86%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGKPAPEDFA D+KHW RVVT SY  G+GINWSTVRNVMDM AVYGGFAAALKD+ 
Sbjct  576  QVGVYGKPAPEDFAVDFKHWKRVVTNSYAKGLGINWSTVRNVMDMRAVYGGFAAALKDMN  635

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMNIV+ID+PDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSK+K KCN  
Sbjct  636  VWVMNIVSIDAPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKVKNKCNFN  695

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
              V EVDR LRPEGK+IVRD  E + ELE+I KS+H++IRMTYS   EGLLC QKT+WRP
Sbjct  696  AFVAEVDRTLRPEGKIIVRDKVEMINELESIFKSLHWEIRMTYSKDKEGLLCAQKTVWRP  755

Query  185  KEVQTLAYAIA  153
            KE + ++YA+A
Sbjct  756  KESEIVSYALA  766



>ref|XP_006345748.1| PREDICTED: probable methyltransferase PMT26-like [Solanum tuberosum]
Length=813

 Score =   331 bits (848),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 149/191 (78%), Positives = 169/191 (88%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGKPAPEDF ADY+HW  V+T SYLNGMGINWSTVRNVMDM A+YGGFAAAL+DL 
Sbjct  623  QAGVYGKPAPEDFTADYEHWKHVLTNSYLNGMGINWSTVRNVMDMRAIYGGFAAALRDLN  682

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V++D+PDTLPIIYERGLFG+YHDWCESFSTYPRSYDL+HADHLFSKIK KC L+
Sbjct  683  VWVMNVVSVDAPDTLPIIYERGLFGIYHDWCESFSTYPRSYDLVHADHLFSKIKTKCGLL  742

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             +V EVDRILRP GKLIVRD  ET++ELE++LKSM Y+I MTYS   EGLL  QKTMWRP
Sbjct  743  AIVAEVDRILRPGGKLIVRDKEETISELESMLKSMQYEINMTYSKDKEGLLYCQKTMWRP  802

Query  185  KEVQTLAYAIA  153
            K+V+TL YAIA
Sbjct  803  KDVETLTYAIA  813



>gb|KDO36646.1| hypothetical protein CISIN_1g027471mg [Citrus sinensis]
Length=223

 Score =   312 bits (800),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 139/190 (73%), Positives = 167/190 (88%), Gaps = 0/190 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            E GVYGK APEDF ADY+HW  VV+KSYLNGMGINWS VRNVMDM AVYGGFAAALKDLK
Sbjct  33   EAGVYGKAAPEDFTADYQHWKNVVSKSYLNGMGINWSFVRNVMDMRAVYGGFAAALKDLK  92

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V I+SPDTLPIIYERGLFG+YHDWCESF+TYPR+YDLLHADHLFS IK++C+L 
Sbjct  93   VWVMNVVPIESPDTLPIIYERGLFGLYHDWCESFNTYPRTYDLLHADHLFSTIKKRCSLK  152

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             +V EVDRILRP+G LI+RD  ET+ E+E+++KS+H+D+RM Y+N ++G+LCV KT WRP
Sbjct  153  AVVAEVDRILRPDGNLILRDDAETIVEVEDLVKSLHWDVRMIYTNDNQGMLCVHKTYWRP  212

Query  185  KEVQTLAYAI  156
            KE +T+  A+
Sbjct  213  KETETILSAM  222



>ref|XP_011022921.1| PREDICTED: probable methyltransferase PMT26 [Populus euphratica]
Length=840

 Score =   331 bits (848),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 170/191 (89%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGKPAPEDF ADY+HW RVV+ SYLNG+GINWS+VRN MDM +VYGGFAAALKDL 
Sbjct  650  QVGVYGKPAPEDFTADYEHWKRVVSNSYLNGIGINWSSVRNAMDMRSVYGGFAAALKDLN  709

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN++ +DSPDTLPIIYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSK+K++C+++
Sbjct  710  VWVMNVITVDSPDTLPIIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSKVKKRCSMV  769

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             +  EVDRILRPEGKLIVRD+ ET+ ELEN+ +SM +++RMTYS   EGLLCVQK+MWRP
Sbjct  770  AVFAEVDRILRPEGKLIVRDNVETINELENMARSMQWEVRMTYSKDKEGLLCVQKSMWRP  829

Query  185  KEVQTLAYAIA  153
             E +TL YAIA
Sbjct  830  SESETLTYAIA  840



>ref|XP_004502956.1| PREDICTED: probable methyltransferase PMT26-like [Cicer arietinum]
Length=803

 Score =   329 bits (844),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 145/190 (76%), Positives = 169/190 (89%), Gaps = 0/190 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGKPAPEDF ADYKHW+ VV+KSYL+GMGI WS VRNVMDMN++YGGFAAALKDL 
Sbjct  613  QVGVYGKPAPEDFTADYKHWTHVVSKSYLSGMGIQWSNVRNVMDMNSIYGGFAAALKDLN  672

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            +WVMN+V+IDS DTLPII+ERGLFG+YHDWCESFSTYPR+YDLLHADHLFSKIK++C + 
Sbjct  673  IWVMNVVSIDSADTLPIIFERGLFGIYHDWCESFSTYPRTYDLLHADHLFSKIKKRCTVA  732

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             LV EVDRILRPEGKLIVRD  E + ELEN+++SM +++RMTYS   EGLLCVQK+ WRP
Sbjct  733  ALVAEVDRILRPEGKLIVRDTVEIIDELENLVRSMQWEVRMTYSKDKEGLLCVQKSKWRP  792

Query  185  KEVQTLAYAI  156
            KEV+TL YAI
Sbjct  793  KEVETLQYAI  802



>gb|EYU23728.1| hypothetical protein MIMGU_mgv1a001484mg [Erythranthe guttata]
Length=810

 Score =   329 bits (844),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 146/191 (76%), Positives = 166/191 (87%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            E GVYGKPAPEDFA DY+HW RVV  SY +G+GINWSTVRN MDM AVYGG AAA+K+L 
Sbjct  620  EVGVYGKPAPEDFATDYEHWKRVVKNSYQSGLGINWSTVRNAMDMRAVYGGLAAAMKELN  679

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMNIV+ID+PDTLPIIYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSKIK KCN+M
Sbjct  680  VWVMNIVSIDAPDTLPIIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSKIKTKCNIM  739

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             LV EVDRILRPEGK+I+RD  E + E+E++ +SMH+DIRMTYS   EGLLC QK+MWRP
Sbjct  740  ALVAEVDRILRPEGKIIIRDTVEIINEMESVFRSMHWDIRMTYSKDKEGLLCAQKSMWRP  799

Query  185  KEVQTLAYAIA  153
             EV+T+ YAI 
Sbjct  800  TEVETVTYAIG  810



>ref|XP_010674444.1| PREDICTED: probable methyltransferase PMT26 [Beta vulgaris subsp. 
vulgaris]
Length=811

 Score =   329 bits (843),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 145/190 (76%), Positives = 169/190 (89%), Gaps = 0/190 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYG+ APEDF AD +HW RVV++SYLNGMGI+WS VRNVMDM AVYGGFAAAL+DLK
Sbjct  621  QVGVYGRSAPEDFTADNEHWKRVVSQSYLNGMGISWSNVRNVMDMRAVYGGFAAALRDLK  680

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            +WVMN+V +DSPDTLPIIYERGLFG+YHDWCESF+TYPRSYDLLHADHLFSKIK+KCN+ 
Sbjct  681  IWVMNVVTVDSPDTLPIIYERGLFGIYHDWCESFNTYPRSYDLLHADHLFSKIKKKCNMP  740

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             LVVEVDRILRPEGK+I+RD+ E + ELE + +SMH++IRMTYS   EGLLC QKT WRP
Sbjct  741  ALVVEVDRILRPEGKIIIRDNVEIINELETMFRSMHWEIRMTYSKDKEGLLCAQKTFWRP  800

Query  185  KEVQTLAYAI  156
             EV+TLAYA+
Sbjct  801  NEVETLAYAL  810



>ref|XP_011078779.1| PREDICTED: probable methyltransferase PMT26 [Sesamum indicum]
Length=817

 Score =   328 bits (841),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 148/191 (77%), Positives = 167/191 (87%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            E GVYGKPAPEDFAADY HW RVV KSYLNG+GINWSTVRNVMDM AVYGGFAAAL++L 
Sbjct  627  EVGVYGKPAPEDFAADYAHWKRVVKKSYLNGLGINWSTVRNVMDMRAVYGGFAAALRELN  686

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            +WVMN+V ID+PDTLPIIYERGLFG+YHDWCESFSTYPR+YDLLHADHLFSK K KCN  
Sbjct  687  LWVMNVVPIDAPDTLPIIYERGLFGIYHDWCESFSTYPRTYDLLHADHLFSKTKNKCNFK  746

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             +V EVDRILRPEGK+IVRD  ET++ELEN+ KS+ ++IRMTYS  +EGLL  QKTMWRP
Sbjct  747  AVVSEVDRILRPEGKIIVRDTVETISELENLFKSLQWEIRMTYSKDNEGLLYAQKTMWRP  806

Query  185  KEVQTLAYAIA  153
            KE + + YAIA
Sbjct  807  KEEEIVTYAIA  817



>ref|XP_002309924.1| dehydration-responsive family protein [Populus trichocarpa]
 gb|EEE90374.1| dehydration-responsive family protein [Populus trichocarpa]
Length=824

 Score =   328 bits (840),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 142/191 (74%), Positives = 170/191 (89%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGKPAPEDF ADY+HW RVV+ SYLNG+GINWS+VRN MDM +VYGGFAAALK+L 
Sbjct  634  QVGVYGKPAPEDFTADYEHWKRVVSNSYLNGIGINWSSVRNAMDMRSVYGGFAAALKELN  693

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN++ +DSPDTLPIIYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSK+K++C+++
Sbjct  694  VWVMNVITVDSPDTLPIIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSKVKKRCSMV  753

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             +  EVDRILRPEGKLIVRD+ ET+ ELEN+ +SM +++RMTYS   EGLLCVQK+ WRP
Sbjct  754  AVFAEVDRILRPEGKLIVRDNVETMNELENMARSMQWEVRMTYSKDKEGLLCVQKSKWRP  813

Query  185  KEVQTLAYAIA  153
            +E +TL YAIA
Sbjct  814  RESETLTYAIA  824



>ref|XP_004503920.1| PREDICTED: probable methyltransferase PMT26-like isoform X1 [Cicer 
arietinum]
 ref|XP_004503921.1| PREDICTED: probable methyltransferase PMT26-like isoform X2 [Cicer 
arietinum]
Length=819

 Score =   328 bits (840),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 166/191 (87%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGKPAPEDF ADY+HW RVV+KSYLNG+GI WS VRNVMDM +VYGGFAAALKDL 
Sbjct  629  DVGVYGKPAPEDFTADYEHWKRVVSKSYLNGLGIQWSNVRNVMDMRSVYGGFAAALKDLN  688

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            +WVMN+V +DSPDTLPIIYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSK+K++C   
Sbjct  689  IWVMNVVPVDSPDTLPIIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSKLKKRCKFE  748

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             +V EVDRILRPEGKLIVRD +E + ELE++ KSM +++RMTYS   EG LCVQK+MWRP
Sbjct  749  AVVAEVDRILRPEGKLIVRDTSEIINELESLAKSMQWEVRMTYSKDTEGFLCVQKSMWRP  808

Query  185  KEVQTLAYAIA  153
            KE +T+ YAI 
Sbjct  809  KESETVDYAIG  819



>emb|CDY31339.1| BnaA02g34020D [Brassica napus]
Length=764

 Score =   326 bits (836),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 146/191 (76%), Positives = 171/191 (90%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            +TGVYGK APEDF+ADY+HW RVVTKSYL G+GINW TVRNVMDM AVYGGFAAAL+++K
Sbjct  573  QTGVYGKAAPEDFSADYEHWKRVVTKSYLKGLGINWGTVRNVMDMKAVYGGFAAALREMK  632

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V IDSPDTL IIYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSK+K++CNL 
Sbjct  633  VWVMNVVPIDSPDTLAIIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSKLKQRCNLT  692

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             +V EVDR+LRPEGKLIVRD  ET+ E+E I+K+M +++RMTYS   EGLL VQK++WRP
Sbjct  693  AVVAEVDRVLRPEGKLIVRDDAETIQEVEAIVKAMKWEVRMTYSKEKEGLLSVQKSIWRP  752

Query  185  KEVQTLAYAIA  153
            +EV+TL YAIA
Sbjct  753  EEVETLTYAIA  763



>ref|XP_008360714.1| PREDICTED: probable methyltransferase PMT26 [Malus domestica]
Length=840

 Score =   328 bits (840),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 170/191 (89%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGKPAPEDF AD +HW  VVTKSYLNGMGINW++VRNVMDM AVYGGFAAA+KDLK
Sbjct  650  QVGVYGKPAPEDFTADNEHWKHVVTKSYLNGMGINWTSVRNVMDMRAVYGGFAAAVKDLK  709

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            +WVMN+V +DSPDTLPIIYERGL+GMYHDWCESFSTYPRSYDL+H+DHLFSK+K++CNL+
Sbjct  710  IWVMNVVTVDSPDTLPIIYERGLYGMYHDWCESFSTYPRSYDLIHSDHLFSKLKKRCNLV  769

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             +V EVDRILRPEG LIVRD   T+ ELEN+++SM +++RMTYS   EGLLC +K++WRP
Sbjct  770  AVVAEVDRILRPEGTLIVRDEVGTINELENMVRSMQWEVRMTYSKDKEGLLCXKKSIWRP  829

Query  185  KEVQTLAYAIA  153
            KE +TL YAIA
Sbjct  830  KESETLQYAIA  840



>gb|KDP39437.1| hypothetical protein JCGZ_03719 [Jatropha curcas]
Length=850

 Score =   328 bits (840),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 144/189 (76%), Positives = 172/189 (91%), Gaps = 0/189 (0%)
 Frame = -2

Query  719  GVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLKVW  540
            GVYGKP P+DF  DY+HW RVV+KSYLNG+GI W +VRNVMDM ++YGGFAAAL+DL VW
Sbjct  661  GVYGKPEPKDFTYDYEHWKRVVSKSYLNGIGIKWQSVRNVMDMRSIYGGFAAALRDLNVW  720

Query  539  VMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGL  360
            VMN+V IDSPDTLPIIYERGLFG+YHDWCESF+TYPRSYDLLHADHLFSKIK++CNL+ +
Sbjct  721  VMNVVPIDSPDTLPIIYERGLFGIYHDWCESFNTYPRSYDLLHADHLFSKIKKRCNLVAV  780

Query  359  VVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKE  180
            VVEVDRILRPEGKLIVRD+ ET++ELE+IL+SMH+++RMTYS   EGLL V+K++WRPKE
Sbjct  781  VVEVDRILRPEGKLIVRDNVETISELESILRSMHWEVRMTYSKDKEGLLYVEKSIWRPKE  840

Query  179  VQTLAYAIA  153
             +T+ YAIA
Sbjct  841  FETITYAIA  849



>ref|XP_002306259.2| dehydration-responsive family protein [Populus trichocarpa]
 gb|EEE93255.2| dehydration-responsive family protein [Populus trichocarpa]
Length=796

 Score =   326 bits (836),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 167/191 (87%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGKPAPEDF ADY+HW RVV+ SYLNG+G+NWS+VRN MDM +VYGGFAAALK+L 
Sbjct  606  QVGVYGKPAPEDFTADYEHWKRVVSNSYLNGIGLNWSSVRNAMDMRSVYGGFAAALKELN  665

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V  DSPDTLPIIYERGLFG+YHDWCESF+TYPRSYDLLHADHLFSK+K++CNL 
Sbjct  666  VWVMNVVTADSPDTLPIIYERGLFGIYHDWCESFNTYPRSYDLLHADHLFSKVKKRCNLA  725

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             +  EVDRILRPEGKLIVRD  E + ELEN+ +SM +++RMTYS   EGLLCVQK+MWRP
Sbjct  726  AVFAEVDRILRPEGKLIVRDKVEIINELENMARSMQWEVRMTYSKDKEGLLCVQKSMWRP  785

Query  185  KEVQTLAYAIA  153
            KE +T+ YAIA
Sbjct  786  KESETINYAIA  796



>ref|XP_006580338.1| PREDICTED: probable methyltransferase PMT26-like isoform X1 [Glycine 
max]
 ref|XP_006580339.1| PREDICTED: probable methyltransferase PMT26-like isoform X2 [Glycine 
max]
Length=831

 Score =   327 bits (837),  Expect = 3e-102, Method: Composition-based stats.
 Identities = 141/191 (74%), Positives = 168/191 (88%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGKPAPEDF ADY+HW R+V+KSYLNG+GINWS VRNVMDM +VYGGFAAALKDL 
Sbjct  641  QVGVYGKPAPEDFTADYEHWKRIVSKSYLNGIGINWSNVRNVMDMRSVYGGFAAALKDLN  700

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            +WVMN+V+++S DTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHAD+LFS IK +CNL 
Sbjct  701  IWVMNVVSVNSADTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADNLFSNIKNRCNLK  760

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             +V E+DRILRPEGKLIVRD  E ++E+E+++KSM +++RMTYS    G LCVQK+MWRP
Sbjct  761  AVVAEIDRILRPEGKLIVRDTVEIISEIESMVKSMKWEVRMTYSKDKVGFLCVQKSMWRP  820

Query  185  KEVQTLAYAIA  153
            KE++TL YAI 
Sbjct  821  KELETLEYAIG  831



>ref|XP_009130433.1| PREDICTED: probable methyltransferase PMT26 [Brassica rapa]
 ref|XP_009130434.1| PREDICTED: probable methyltransferase PMT26 [Brassica rapa]
Length=764

 Score =   325 bits (833),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 145/191 (76%), Positives = 171/191 (90%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            +TGVYGK APEDF+ADY+HW RVVTKSYL G+GINW TVRNVMDM AVYGGFAAAL+++K
Sbjct  573  QTGVYGKAAPEDFSADYEHWKRVVTKSYLKGLGINWGTVRNVMDMKAVYGGFAAALREMK  632

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V IDSPDTL IIYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSK+K++CNL 
Sbjct  633  VWVMNVVPIDSPDTLAIIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSKLKQRCNLT  692

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             +V EVDR+LRPEGKLIVRD  ET+ E+E ++K+M +++RMTYS   EGLL VQK++WRP
Sbjct  693  AVVAEVDRVLRPEGKLIVRDDAETIQEVEAMVKAMKWEVRMTYSKEKEGLLSVQKSIWRP  752

Query  185  KEVQTLAYAIA  153
            +EV+TL YAIA
Sbjct  753  EEVETLTYAIA  763



>gb|KHN34092.1| Putative methyltransferase PMT26 [Glycine soja]
Length=849

 Score =   327 bits (838),  Expect = 4e-102, Method: Composition-based stats.
 Identities = 141/191 (74%), Positives = 168/191 (88%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGKPAPEDF ADY+HW R+V+KSYLNG+GINWS VRNVMDM +VYGGFAAALKDL 
Sbjct  659  QVGVYGKPAPEDFTADYEHWKRIVSKSYLNGIGINWSNVRNVMDMRSVYGGFAAALKDLN  718

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            +WVMN+V+++S DTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHAD+LFS IK +CNL 
Sbjct  719  IWVMNVVSVNSADTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADNLFSNIKNRCNLK  778

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             +V E+DRILRPEGKLIVRD  E ++E+E+++KSM +++RMTYS    G LCVQK+MWRP
Sbjct  779  AVVAEIDRILRPEGKLIVRDTVEIISEIESMVKSMKWEVRMTYSKDKVGFLCVQKSMWRP  838

Query  185  KEVQTLAYAIA  153
            KE++TL YAI 
Sbjct  839  KELETLEYAIG  849



>ref|XP_006394213.1| hypothetical protein EUTSA_v10003654mg [Eutrema salsugineum]
 gb|ESQ31499.1| hypothetical protein EUTSA_v10003654mg [Eutrema salsugineum]
Length=831

 Score =   326 bits (836),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 146/191 (76%), Positives = 172/191 (90%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            +TGVYGK APEDF+ADY+HW RVVTKSYL G+GINW++VRNVMDM AVYGGFAAALK+LK
Sbjct  641  QTGVYGKAAPEDFSADYEHWKRVVTKSYLKGLGINWASVRNVMDMRAVYGGFAAALKELK  700

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V IDSPDTL IIYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSK+K++CNL 
Sbjct  701  VWVMNVVPIDSPDTLAIIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSKLKQRCNLT  760

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             +V EVDR+LRPEGKLIVRD  ET+ E+E ++K+M +++RMTYS   EGLL V+K++WRP
Sbjct  761  AVVAEVDRVLRPEGKLIVRDDAETIQEVEAMVKAMKWEVRMTYSKDKEGLLSVKKSIWRP  820

Query  185  KEVQTLAYAIA  153
            KEV+TL YAIA
Sbjct  821  KEVETLTYAIA  831



>emb|CBI37509.3| unnamed protein product [Vitis vinifera]
Length=761

 Score =   325 bits (832),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 170/191 (89%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYG+ APEDF ADY+HW RVV +SYLNG+GI+WS+VRNVMDM AVYGGFAAAL+DL 
Sbjct  571  QVGVYGRAAPEDFTADYEHWKRVVAQSYLNGIGISWSSVRNVMDMRAVYGGFAAALRDLN  630

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V+IDSPDTLPIIYERGLFG+YH+WCESF+TYPRSYDLLHADH+FSK K+KCNL+
Sbjct  631  VWVMNVVSIDSPDTLPIIYERGLFGIYHNWCESFNTYPRSYDLLHADHIFSKTKKKCNLV  690

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++ E DRILRPEGKLIVRD  ETL ++EN+L+SMH++IRMTYS   EGLLC QKTMWRP
Sbjct  691  AVIAEADRILRPEGKLIVRDDVETLGQVENMLRSMHWEIRMTYSKEKEGLLCAQKTMWRP  750

Query  185  KEVQTLAYAIA  153
            KE++ +  AIA
Sbjct  751  KEMEIIKSAIA  761



>dbj|BAB10271.1| ankyrin-like protein [Arabidopsis thaliana]
Length=786

 Score =   325 bits (832),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 171/191 (90%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            +TGVYGK APEDF+ADY+HW RVVTKSYLNG+GINW++VRNVMDM AVYGGFAAAL+DLK
Sbjct  596  QTGVYGKAAPEDFSADYEHWKRVVTKSYLNGLGINWASVRNVMDMRAVYGGFAAALRDLK  655

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V IDSPDTL IIYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSK+K++CNL 
Sbjct  656  VWVMNVVPIDSPDTLAIIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSKLKQRCNLT  715

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++ EVDR+LRPEGKLIVRD  ET+ ++E ++K+M +++RMTYS   EGLL VQK++WRP
Sbjct  716  AVIAEVDRVLRPEGKLIVRDDAETIQQVEGMVKAMKWEVRMTYSKEKEGLLSVQKSIWRP  775

Query  185  KEVQTLAYAIA  153
             EV+TL YAI 
Sbjct  776  SEVETLTYAIG  786



>ref|XP_006281931.1| hypothetical protein CARUB_v10028139mg [Capsella rubella]
 gb|EOA14829.1| hypothetical protein CARUB_v10028139mg [Capsella rubella]
Length=817

 Score =   325 bits (833),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 171/191 (90%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            +TGVYGK APEDF+ADY+HW RVVTKSYL G+GINW++VRNVMDM AVYGGFAAAL+DLK
Sbjct  627  QTGVYGKAAPEDFSADYEHWKRVVTKSYLKGLGINWASVRNVMDMRAVYGGFAAALRDLK  686

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V IDSPDTL IIYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSK+K++CNL 
Sbjct  687  VWVMNVVPIDSPDTLAIIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSKLKQRCNLT  746

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++ EVDR+LRPEGKLIVRD  ET+ ++E+++K+M +++RMTYS   EGLL VQK+ WRP
Sbjct  747  AVIAEVDRVLRPEGKLIVRDDAETIQQVESMVKAMKWEVRMTYSKDKEGLLSVQKSFWRP  806

Query  185  KEVQTLAYAIA  153
             EV+TL YAIA
Sbjct  807  NEVETLTYAIA  817



>ref|NP_201208.2| putative methyltransferase PMT26 [Arabidopsis thaliana]
 sp|Q8L7V3.1|PMTQ_ARATH RecName: Full=Probable methyltransferase PMT26 [Arabidopsis thaliana]
 gb|AAM78114.1| AT5g64030/MBM17_13 [Arabidopsis thaliana]
 gb|AAO23578.1| At5g64030/MBM17_13 [Arabidopsis thaliana]
 gb|AED97831.1| putative methyltransferase PMT26 [Arabidopsis thaliana]
Length=829

 Score =   325 bits (833),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 171/191 (90%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            +TGVYGK APEDF+ADY+HW RVVTKSYLNG+GINW++VRNVMDM AVYGGFAAAL+DLK
Sbjct  639  QTGVYGKAAPEDFSADYEHWKRVVTKSYLNGLGINWASVRNVMDMRAVYGGFAAALRDLK  698

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V IDSPDTL IIYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSK+K++CNL 
Sbjct  699  VWVMNVVPIDSPDTLAIIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSKLKQRCNLT  758

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++ EVDR+LRPEGKLIVRD  ET+ ++E ++K+M +++RMTYS   EGLL VQK++WRP
Sbjct  759  AVIAEVDRVLRPEGKLIVRDDAETIQQVEGMVKAMKWEVRMTYSKEKEGLLSVQKSIWRP  818

Query  185  KEVQTLAYAIA  153
             EV+TL YAI 
Sbjct  819  SEVETLTYAIG  829



>ref|XP_002266357.1| PREDICTED: probable methyltransferase PMT26 [Vitis vinifera]
Length=825

 Score =   325 bits (833),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 170/191 (89%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYG+ APEDF ADY+HW RVV +SYLNG+GI+WS+VRNVMDM AVYGGFAAAL+DL 
Sbjct  635  QVGVYGRAAPEDFTADYEHWKRVVAQSYLNGIGISWSSVRNVMDMRAVYGGFAAALRDLN  694

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V+IDSPDTLPIIYERGLFG+YH+WCESF+TYPRSYDLLHADH+FSK K+KCNL+
Sbjct  695  VWVMNVVSIDSPDTLPIIYERGLFGIYHNWCESFNTYPRSYDLLHADHIFSKTKKKCNLV  754

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++ E DRILRPEGKLIVRD  ETL ++EN+L+SMH++IRMTYS   EGLLC QKTMWRP
Sbjct  755  AVIAEADRILRPEGKLIVRDDVETLGQVENMLRSMHWEIRMTYSKEKEGLLCAQKTMWRP  814

Query  185  KEVQTLAYAIA  153
            KE++ +  AIA
Sbjct  815  KEMEIIKSAIA  825



>emb|CDY39830.1| BnaC02g42880D [Brassica napus]
Length=772

 Score =   323 bits (829),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 145/191 (76%), Positives = 171/191 (90%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            +TGVYGK APEDF+ADY+HW RVVTKSYL G+GINW TVRNVMDM AVYGGFAAAL+++K
Sbjct  581  QTGVYGKAAPEDFSADYEHWKRVVTKSYLKGLGINWGTVRNVMDMKAVYGGFAAALREMK  640

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V IDSPDTL IIYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSK+K++CNL 
Sbjct  641  VWVMNVVPIDSPDTLAIIYERGLFGVYHDWCESFSTYPRSYDLLHADHLFSKLKQRCNLT  700

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             +V EVDR+LRPEGKLIVRD  ET+ E+E ++K+M +++RMTYS   EGLL VQK++WRP
Sbjct  701  AVVAEVDRVLRPEGKLIVRDDAETIQEVEAMVKAMKWEVRMTYSKEKEGLLSVQKSIWRP  760

Query  185  KEVQTLAYAIA  153
            +EV+TL YAIA
Sbjct  761  EEVETLTYAIA  771



>ref|XP_010461320.1| PREDICTED: probable methyltransferase PMT26 [Camelina sativa]
Length=819

 Score =   325 bits (832),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 145/191 (76%), Positives = 170/191 (89%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            +TGVYGK APEDF+ADY+HW RVVTKSYL G+GINW++VRNVMDM AVYGGFAAAL+DLK
Sbjct  629  QTGVYGKAAPEDFSADYEHWKRVVTKSYLKGLGINWASVRNVMDMRAVYGGFAAALRDLK  688

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V IDSPDTL IIYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSK+K++CNL 
Sbjct  689  VWVMNVVPIDSPDTLAIIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSKLKQRCNLT  748

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++ EVDR+LRPEGKLIVRD  ET+ E+E ++K+M +++RMTYS   EGLL VQK+ WRP
Sbjct  749  AVIAEVDRVLRPEGKLIVRDDAETIQEVEAMVKAMKWEVRMTYSKEKEGLLAVQKSFWRP  808

Query  185  KEVQTLAYAIA  153
             EV+TL YAIA
Sbjct  809  NEVETLTYAIA  819



>ref|XP_009410679.1| PREDICTED: probable methyltransferase PMT26 [Musa acuminata subsp. 
malaccensis]
Length=797

 Score =   324 bits (831),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 140/191 (73%), Positives = 173/191 (91%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            +TGVYGKPAPEDF ADY+HW ++V KSY+NGMGINWSTVRNVMDM +VYGGFAAAL+D+K
Sbjct  607  QTGVYGKPAPEDFQADYEHWKQIVGKSYVNGMGINWSTVRNVMDMRSVYGGFAAALRDMK  666

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMNIV+IDSPDTLPIIYERGLFGMYHDWCESFSTYPR+YDLLHADHLFSK+K++C L+
Sbjct  667  VWVMNIVSIDSPDTLPIIYERGLFGMYHDWCESFSTYPRTYDLLHADHLFSKLKKRCRLL  726

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++ EVDR+LRPEGKLIVRD  + ++E+EN+ KS+H++I +TYSN +EGLLCVQKTMWRP
Sbjct  727  PVIAEVDRVLRPEGKLIVRDDADVISEIENMAKSLHWEITLTYSNDNEGLLCVQKTMWRP  786

Query  185  KEVQTLAYAIA  153
            ++ +    +++
Sbjct  787  QDTEASMSSLS  797



>ref|XP_010277710.1| PREDICTED: probable methyltransferase PMT24 [Nelumbo nucifera]
Length=866

 Score =   325 bits (834),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 143/190 (75%), Positives = 166/190 (87%), Gaps = 0/190 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            +TGVYGKPAPEDF  DY+HW RVVTKSYL GM INWS+VRNVMDM ++YGGFAAAL+DL 
Sbjct  676  QTGVYGKPAPEDFKVDYEHWKRVVTKSYLKGMSINWSSVRNVMDMRSIYGGFAAALRDLN  735

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V IDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDL+HADHLFSK K++C L+
Sbjct  736  VWVMNVVTIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLVHADHLFSKAKKRCTLV  795

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             +V EVDRILRPEGKLIVRD+ ET+ ELEN+ +S+ +DIR+ YS   EGLLCVQKT+WRP
Sbjct  796  AVVAEVDRILRPEGKLIVRDNIETIVELENMARSLQWDIRLKYSQDKEGLLCVQKTLWRP  855

Query  185  KEVQTLAYAI  156
             + + + YAI
Sbjct  856  TQQEMITYAI  865



>ref|XP_010484172.1| PREDICTED: probable methyltransferase PMT26 [Camelina sativa]
 ref|XP_010484174.1| PREDICTED: probable methyltransferase PMT26 [Camelina sativa]
Length=821

 Score =   324 bits (831),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 145/191 (76%), Positives = 170/191 (89%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            +TGVYGK APEDF+ADY+HW RVVTKSYL G+GINW++VRNVMDM AVYGGFAAAL+DLK
Sbjct  631  QTGVYGKAAPEDFSADYEHWKRVVTKSYLKGLGINWASVRNVMDMRAVYGGFAAALRDLK  690

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V IDSPDTL IIYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSK+K++CNL 
Sbjct  691  VWVMNVVPIDSPDTLAIIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSKLKQRCNLT  750

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++ EVDR+LRPEGKLIVRD  ET+ E+E ++K+M +++RMTYS   EGLL VQK+ WRP
Sbjct  751  AVIAEVDRVLRPEGKLIVRDDAETIQEVEAMVKAMKWEVRMTYSKEKEGLLAVQKSFWRP  810

Query  185  KEVQTLAYAIA  153
             EV+TL YAIA
Sbjct  811  NEVETLTYAIA  821



>gb|KJB40479.1| hypothetical protein B456_007G066000 [Gossypium raimondii]
Length=899

 Score =   325 bits (834),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 141/191 (74%), Positives = 170/191 (89%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGK APED AAD +HW +VVTKSY+ GMGINWS+VRNVMDM AVYGGFAAALKD+ 
Sbjct  709  QVGVYGKAAPEDLAADNEHWKQVVTKSYMQGMGINWSSVRNVMDMKAVYGGFAAALKDMN  768

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            +WVMN++ +DSPDTLPIIYERGLFG+YHDWCESFSTYPRSYDLLHADH+FS++K++CN +
Sbjct  769  LWVMNVIPVDSPDTLPIIYERGLFGIYHDWCESFSTYPRSYDLLHADHIFSRVKKRCNFV  828

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             +V EVDRILRP GKLI RD  ET+TELEN+++SMH+++R++YS   EGLLCVQK+MWRP
Sbjct  829  AVVAEVDRILRPGGKLIARDDVETITELENMVRSMHWEVRLSYSKDKEGLLCVQKSMWRP  888

Query  185  KEVQTLAYAIA  153
             EV+TL YAIA
Sbjct  889  TEVETLTYAIA  899



>ref|XP_010444329.1| PREDICTED: probable methyltransferase PMT26 [Camelina sativa]
Length=822

 Score =   323 bits (827),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 170/191 (89%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            +TGVYGK APEDF+ADY+HW RVVTKSYL G+GINW++VRNVMDM AVYGGFAAAL+DLK
Sbjct  632  QTGVYGKAAPEDFSADYEHWKRVVTKSYLKGLGINWASVRNVMDMRAVYGGFAAALRDLK  691

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V IDSPDTL IIYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSK+K++CNL 
Sbjct  692  VWVMNVVPIDSPDTLAIIYERGLFGVYHDWCESFSTYPRSYDLLHADHLFSKLKQRCNLT  751

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++ EVDR+LRPEGKLIVRD  ET+ E+E ++K+M +++RMTY    EGLL VQK++WRP
Sbjct  752  AVIAEVDRVLRPEGKLIVRDDAETIQEVEAMVKAMKWEVRMTYLKEKEGLLAVQKSLWRP  811

Query  185  KEVQTLAYAIA  153
             EV+TL YAIA
Sbjct  812  NEVETLTYAIA  822



>ref|XP_007137790.1| hypothetical protein PHAVU_009G155600g [Phaseolus vulgaris]
 gb|ESW09784.1| hypothetical protein PHAVU_009G155600g [Phaseolus vulgaris]
Length=818

 Score =   323 bits (827),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 139/190 (73%), Positives = 168/190 (88%), Gaps = 0/190 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGKPAPEDF+ADY+HW RVV+KSYLNGMGI WS VRNVMDM ++YGGFAAAL+DL 
Sbjct  628  QVGVYGKPAPEDFSADYEHWKRVVSKSYLNGMGIQWSNVRNVMDMRSIYGGFAAALRDLN  687

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V+IDSPDTLPIIYERGLFG+YHDWCESFSTYPR+YDLLHADHLFS+++++CNL 
Sbjct  688  VWVMNVVSIDSPDTLPIIYERGLFGIYHDWCESFSTYPRTYDLLHADHLFSRLQKRCNLA  747

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++ E DRILRPEGKLIVRD  E + E+E++++S+ + +RMTYS   EGLLCVQK+MWRP
Sbjct  748  AVLAEADRILRPEGKLIVRDTVEIIEEVESMVRSLQWKVRMTYSKDKEGLLCVQKSMWRP  807

Query  185  KEVQTLAYAI  156
            KE + L YAI
Sbjct  808  KEQEKLEYAI  817



>ref|XP_008462649.1| PREDICTED: probable methyltransferase PMT26 [Cucumis melo]
Length=822

 Score =   323 bits (827),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 170/191 (89%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYG+ APEDF AD+KHW+RVVTKSYL+GMGI+WSTVRNVMDM AVYGGFAAALK+LK
Sbjct  632  QVGVYGRAAPEDFTADHKHWNRVVTKSYLSGMGIDWSTVRNVMDMRAVYGGFAAALKNLK  691

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V+IDS DTLPII+ERGLFG+YHDWCESF+TYPRSYDLLHADHLFSK+K +CN+ 
Sbjct  692  VWVMNVVSIDSADTLPIIFERGLFGIYHDWCESFNTYPRSYDLLHADHLFSKVKTRCNIA  751

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             LV E DRILRPEGKLIVRD++ET+ ELE++ KSM +++R TY   +E LLCVQK+MWRP
Sbjct  752  ALVAETDRILRPEGKLIVRDNSETVNELESMFKSMKWEVRFTYFKDNEALLCVQKSMWRP  811

Query  185  KEVQTLAYAIA  153
             E +TL YAIA
Sbjct  812  NESETLQYAIA  822



>ref|XP_010027631.1| PREDICTED: probable methyltransferase PMT26 [Eucalyptus grandis]
 gb|KCW54199.1| hypothetical protein EUGRSUZ_I00186 [Eucalyptus grandis]
Length=814

 Score =   322 bits (826),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 140/191 (73%), Positives = 173/191 (91%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGK APEDFA D KHW RVVTKSYL+G+GI+WSTVR+VMDM A+YGGFAAALKDL 
Sbjct  624  QVGVYGKSAPEDFALDNKHWKRVVTKSYLSGIGIDWSTVRSVMDMRAIYGGFAAALKDLN  683

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V++D+PDTLPIIYERGLFG+YHDWCESFSTYPRSYDLLH+DHLFSKIK++CNL+
Sbjct  684  VWVMNVVSVDAPDTLPIIYERGLFGIYHDWCESFSTYPRSYDLLHSDHLFSKIKKRCNLV  743

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             LV EVDRILRP GKLI+RD  ET+ E+E+++++M +++R+TYS  +EGLLCVQK+MWRP
Sbjct  744  ALVAEVDRILRPGGKLIIRDDVETINEVESMVRAMQWEVRLTYSKDNEGLLCVQKSMWRP  803

Query  185  KEVQTLAYAIA  153
             + +T++YAIA
Sbjct  804  SKSETVSYAIA  814



>gb|ACF86376.1| unknown [Zea mays]
Length=378

 Score =   310 bits (794),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 136/185 (74%), Positives = 165/185 (89%), Gaps = 0/185 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            E GVYGKPAPEDF ADY+HW RVV+ SY+NG+GI+WSTVRNVMDM AVY GFAAAL+DLK
Sbjct  192  EAGVYGKPAPEDFQADYEHWKRVVSNSYMNGLGIDWSTVRNVMDMKAVYAGFAAALRDLK  251

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V IDSPDTLPIIYERGLFG+YHDWCESFSTYPR+YDL+HA+HLFSK+K++C L+
Sbjct  252  VWVMNVVPIDSPDTLPIIYERGLFGLYHDWCESFSTYPRTYDLVHANHLFSKVKKRCELL  311

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++VEVDR+LRP+G+LIVRD+ ET +E+ENILKS+H+++RM+Y    EGLL VQKT WRP
Sbjct  312  PVIVEVDRVLRPQGRLIVRDNIETTSEVENILKSLHWEVRMSYFQEKEGLLLVQKTTWRP  371

Query  185  KEVQT  171
             E + 
Sbjct  372  NETEA  376



>ref|XP_011031158.1| PREDICTED: probable methyltransferase PMT26 isoform X3 [Populus 
euphratica]
 ref|XP_011031159.1| PREDICTED: probable methyltransferase PMT26 isoform X4 [Populus 
euphratica]
Length=830

 Score =   322 bits (826),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 141/191 (74%), Positives = 166/191 (87%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGKPAPEDF ADY+HW RVV+ SYLNG+G+NWS+VRN MDM +VYGGFAAALK+L 
Sbjct  640  QVGVYGKPAPEDFTADYEHWKRVVSNSYLNGIGLNWSSVRNAMDMRSVYGGFAAALKELN  699

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V  DSPDTLPIIYERGLFG+YHDWCESF+TYPRSYDLLHADHLFSK+K++CNL 
Sbjct  700  VWVMNVVTADSPDTLPIIYERGLFGIYHDWCESFNTYPRSYDLLHADHLFSKVKKRCNLA  759

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             +  EVDRILRPEGKLIVRD  E + ELEN+ +SM +++ MT+S   EGLLCVQK+MWRP
Sbjct  760  AVFAEVDRILRPEGKLIVRDKVEIINELENMARSMKWEVSMTFSKDKEGLLCVQKSMWRP  819

Query  185  KEVQTLAYAIA  153
            KE +T+ YAIA
Sbjct  820  KESETINYAIA  830



>ref|XP_011031160.1| PREDICTED: probable methyltransferase PMT26 isoform X5 [Populus 
euphratica]
Length=828

 Score =   322 bits (826),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 141/191 (74%), Positives = 166/191 (87%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGKPAPEDF ADY+HW RVV+ SYLNG+G+NWS+VRN MDM +VYGGFAAALK+L 
Sbjct  638  QVGVYGKPAPEDFTADYEHWKRVVSNSYLNGIGLNWSSVRNAMDMRSVYGGFAAALKELN  697

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V  DSPDTLPIIYERGLFG+YHDWCESF+TYPRSYDLLHADHLFSK+K++CNL 
Sbjct  698  VWVMNVVTADSPDTLPIIYERGLFGIYHDWCESFNTYPRSYDLLHADHLFSKVKKRCNLA  757

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             +  EVDRILRPEGKLIVRD  E + ELEN+ +SM +++ MT+S   EGLLCVQK+MWRP
Sbjct  758  AVFAEVDRILRPEGKLIVRDKVEIINELENMARSMKWEVSMTFSKDKEGLLCVQKSMWRP  817

Query  185  KEVQTLAYAIA  153
            KE +T+ YAIA
Sbjct  818  KESETINYAIA  828



>emb|CDX84478.1| BnaC03g50220D [Brassica napus]
Length=840

 Score =   323 bits (827),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 142/191 (74%), Positives = 172/191 (90%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            +TGVYGK AP+DF+ADY+HW RVVTKSYLNG+GINW++VRNVMDM AVYGGFAAAL+DLK
Sbjct  649  QTGVYGKAAPDDFSADYEHWKRVVTKSYLNGLGINWASVRNVMDMKAVYGGFAAALRDLK  708

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V IDSPDTL IIYERGLFG+YHDWCESFSTYPRSYDL+HADHL SK+K++CNL 
Sbjct  709  VWVMNVVPIDSPDTLAIIYERGLFGIYHDWCESFSTYPRSYDLVHADHLLSKLKQRCNLT  768

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++ EVDR+LRPEGKLIVRD  +T+ E+E ++K+M +++ MTYS G EGLL VQK++WRP
Sbjct  769  AVIAEVDRVLRPEGKLIVRDDAKTVQEVEAMVKAMKWEVHMTYSKGKEGLLSVQKSIWRP  828

Query  185  KEVQTLAYAIA  153
            ++VQTL YAIA
Sbjct  829  EDVQTLTYAIA  839



>ref|XP_011031161.1| PREDICTED: probable methyltransferase PMT26 isoform X6 [Populus 
euphratica]
Length=828

 Score =   322 bits (826),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 141/191 (74%), Positives = 166/191 (87%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGKPAPEDF ADY+HW RVV+ SYLNG+G+NWS+VRN MDM +VYGGFAAALK+L 
Sbjct  638  QVGVYGKPAPEDFTADYEHWKRVVSNSYLNGIGLNWSSVRNAMDMRSVYGGFAAALKELN  697

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V  DSPDTLPIIYERGLFG+YHDWCESF+TYPRSYDLLHADHLFSK+K++CNL 
Sbjct  698  VWVMNVVTADSPDTLPIIYERGLFGIYHDWCESFNTYPRSYDLLHADHLFSKVKKRCNLA  757

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             +  EVDRILRPEGKLIVRD  E + ELEN+ +SM +++ MT+S   EGLLCVQK+MWRP
Sbjct  758  AVFAEVDRILRPEGKLIVRDKVEIINELENMARSMKWEVSMTFSKDKEGLLCVQKSMWRP  817

Query  185  KEVQTLAYAIA  153
            KE +T+ YAIA
Sbjct  818  KESETINYAIA  828



>ref|XP_011031157.1| PREDICTED: probable methyltransferase PMT26 isoform X2 [Populus 
euphratica]
Length=836

 Score =   322 bits (826),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 141/191 (74%), Positives = 166/191 (87%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGKPAPEDF ADY+HW RVV+ SYLNG+G+NWS+VRN MDM +VYGGFAAALK+L 
Sbjct  646  QVGVYGKPAPEDFTADYEHWKRVVSNSYLNGIGLNWSSVRNAMDMRSVYGGFAAALKELN  705

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V  DSPDTLPIIYERGLFG+YHDWCESF+TYPRSYDLLHADHLFSK+K++CNL 
Sbjct  706  VWVMNVVTADSPDTLPIIYERGLFGIYHDWCESFNTYPRSYDLLHADHLFSKVKKRCNLA  765

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             +  EVDRILRPEGKLIVRD  E + ELEN+ +SM +++ MT+S   EGLLCVQK+MWRP
Sbjct  766  AVFAEVDRILRPEGKLIVRDKVEIINELENMARSMKWEVSMTFSKDKEGLLCVQKSMWRP  825

Query  185  KEVQTLAYAIA  153
            KE +T+ YAIA
Sbjct  826  KESETINYAIA  836



>ref|XP_003526869.1| PREDICTED: probable methyltransferase PMT26-like isoform X1 [Glycine 
max]
 ref|XP_006581774.1| PREDICTED: probable methyltransferase PMT26-like isoform X2 [Glycine 
max]
Length=806

 Score =   322 bits (824),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 141/191 (74%), Positives = 165/191 (86%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGKPAP+DF ADY+HW RVV+KSYL+GMGI WS VRNVMDM ++YGGFAAAL+DL 
Sbjct  616  QVGVYGKPAPQDFTADYEHWKRVVSKSYLDGMGIKWSNVRNVMDMRSIYGGFAAALRDLN  675

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V IDSPDTLPIIYERGLFG+YHDWCESFSTYPR+YDLLHADHLFSK+K++CNL 
Sbjct  676  VWVMNVVTIDSPDTLPIIYERGLFGIYHDWCESFSTYPRTYDLLHADHLFSKLKKRCNLA  735

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             +V E DRILRPEGKLIVRD  E + ELE++ +SM + +RMTYS   EGLLCV+K+ WRP
Sbjct  736  AVVAEADRILRPEGKLIVRDTVEIIEELESMARSMQWKVRMTYSKDKEGLLCVEKSKWRP  795

Query  185  KEVQTLAYAIA  153
            KE + L YAIA
Sbjct  796  KEQEKLEYAIA  806



>ref|XP_011031156.1| PREDICTED: probable methyltransferase PMT26 isoform X1 [Populus 
euphratica]
Length=846

 Score =   322 bits (826),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 141/191 (74%), Positives = 166/191 (87%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGKPAPEDF ADY+HW RVV+ SYLNG+G+NWS+VRN MDM +VYGGFAAALK+L 
Sbjct  656  QVGVYGKPAPEDFTADYEHWKRVVSNSYLNGIGLNWSSVRNAMDMRSVYGGFAAALKELN  715

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V  DSPDTLPIIYERGLFG+YHDWCESF+TYPRSYDLLHADHLFSK+K++CNL 
Sbjct  716  VWVMNVVTADSPDTLPIIYERGLFGIYHDWCESFNTYPRSYDLLHADHLFSKVKKRCNLA  775

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             +  EVDRILRPEGKLIVRD  E + ELEN+ +SM +++ MT+S   EGLLCVQK+MWRP
Sbjct  776  AVFAEVDRILRPEGKLIVRDKVEIINELENMARSMKWEVSMTFSKDKEGLLCVQKSMWRP  835

Query  185  KEVQTLAYAIA  153
            KE +T+ YAIA
Sbjct  836  KESETINYAIA  846



>gb|KHN09623.1| Putative methyltransferase PMT26 [Glycine soja]
Length=806

 Score =   322 bits (824),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 141/191 (74%), Positives = 165/191 (86%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGKPAP+DF ADY+HW RVV+KSYL+GMGI WS VRNVMDM ++YGGFAAAL+DL 
Sbjct  616  QVGVYGKPAPQDFTADYEHWKRVVSKSYLDGMGIKWSNVRNVMDMRSIYGGFAAALRDLN  675

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V IDSPDTLPIIYERGLFG+YHDWCESFSTYPR+YDLLHADHLFSK+K++CNL 
Sbjct  676  VWVMNVVTIDSPDTLPIIYERGLFGIYHDWCESFSTYPRTYDLLHADHLFSKLKKRCNLA  735

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             +V E DRILRPEGKLIVRD  E + ELE++ +SM + +RMTYS   EGLLCV+K+ WRP
Sbjct  736  AVVAEADRILRPEGKLIVRDTVEIIEELESMARSMQWKVRMTYSKDKEGLLCVEKSKWRP  795

Query  185  KEVQTLAYAIA  153
            KE + L YAIA
Sbjct  796  KEQEKLEYAIA  806



>emb|CDY43782.1| BnaA06g23180D [Brassica napus]
Length=799

 Score =   321 bits (823),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 142/191 (74%), Positives = 171/191 (90%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            +TGVYGK AP+DF+ADY+HW RVVTKSYLNG+GINW++VRNVMDM AVYGGFAAAL+DLK
Sbjct  608  QTGVYGKAAPDDFSADYEHWKRVVTKSYLNGLGINWASVRNVMDMKAVYGGFAAALRDLK  667

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V IDSPDTL IIYERGLFG+YHDWCESFSTYPRSYDL+HADHL SK+K++CNL 
Sbjct  668  VWVMNVVPIDSPDTLAIIYERGLFGIYHDWCESFSTYPRSYDLVHADHLLSKLKQRCNLT  727

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             +V EVDR+LRPEG LIVRD  +T+ E+E ++K+M +++ MTYS G EGLL VQK++WRP
Sbjct  728  AVVAEVDRVLRPEGTLIVRDDAKTVQEVEAMVKAMKWEVHMTYSKGKEGLLSVQKSIWRP  787

Query  185  KEVQTLAYAIA  153
            ++VQTL YAIA
Sbjct  788  EDVQTLTYAIA  798



>ref|XP_010530222.1| PREDICTED: probable methyltransferase PMT25 [Tarenaya hassleriana]
 ref|XP_010530223.1| PREDICTED: probable methyltransferase PMT25 [Tarenaya hassleriana]
Length=288

 Score =   305 bits (782),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 137/191 (72%), Positives = 163/191 (85%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGKPA EDF  DY+ W  +V+KSYLNGMGI+WS+VRNVMDM AVYGGFAAALKDLK
Sbjct  98   QEGVYGKPAEEDFNTDYERWKTIVSKSYLNGMGIDWSSVRNVMDMRAVYGGFAAALKDLK  157

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            +WVMN+V IDS DTLPIIYERGLFGMYHDWCESF+TYPR+YDLLHADHLFS +K++CNL+
Sbjct  158  LWVMNVVPIDSADTLPIIYERGLFGMYHDWCESFNTYPRTYDLLHADHLFSALKKRCNLI  217

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++ EVDRILRP+G  IVRD  ET+ E+E + KSM +++RMTYS  +EGLL VQKT WRP
Sbjct  218  SVMAEVDRILRPQGTFIVRDDVETVGEVERMAKSMKWEVRMTYSKDNEGLLSVQKTFWRP  277

Query  185  KEVQTLAYAIA  153
            KE +T+  AIA
Sbjct  278  KEAETIKSAIA  288



>gb|KDO36645.1| hypothetical protein CISIN_1g027471mg [Citrus sinensis]
Length=221

 Score =   303 bits (775),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 138/190 (73%), Positives = 165/190 (87%), Gaps = 2/190 (1%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            E GVYGK APEDF ADY+HW  VV+KSYLNGMGINWS VRNVMDM AVYGGFAAALKDLK
Sbjct  33   EAGVYGKAAPEDFTADYQHWKNVVSKSYLNGMGINWSFVRNVMDMRAVYGGFAAALKDLK  92

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V I+SPDTLPIIYERGLFG+YHDWCESF+TYPR+YDLLHADHLFS IK+  +L 
Sbjct  93   VWVMNVVPIESPDTLPIIYERGLFGLYHDWCESFNTYPRTYDLLHADHLFSTIKK--SLK  150

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             +V EVDRILRP+G LI+RD  ET+ E+E+++KS+H+D+RM Y+N ++G+LCV KT WRP
Sbjct  151  AVVAEVDRILRPDGNLILRDDAETIVEVEDLVKSLHWDVRMIYTNDNQGMLCVHKTYWRP  210

Query  185  KEVQTLAYAI  156
            KE +T+  A+
Sbjct  211  KETETILSAM  220



>ref|XP_004166405.1| PREDICTED: LOW QUALITY PROTEIN: probable methyltransferase PMT26-like 
[Cucumis sativus]
Length=829

 Score =   321 bits (823),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 170/191 (89%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYG+ APEDF AD+KHW+RVVTKSYL+GMGI+WSTVRNVMDM AVYGGFAAALK+LK
Sbjct  639  QVGVYGRAAPEDFTADHKHWNRVVTKSYLSGMGIDWSTVRNVMDMRAVYGGFAAALKNLK  698

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V+IDS DTLPII+ERGLFG+YHDWCESF+TYPRSYDLLHADHLFSK+K +CN+ 
Sbjct  699  VWVMNVVSIDSADTLPIIFERGLFGIYHDWCESFNTYPRSYDLLHADHLFSKVKTRCNIA  758

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             LV E DRILRP+GKLIVRD++ET+ ELE++ KSM +++R TY   +E LLCVQK+MWRP
Sbjct  759  ALVAETDRILRPDGKLIVRDNSETVNELESMFKSMKWEVRFTYFKDNEALLCVQKSMWRP  818

Query  185  KEVQTLAYAIA  153
             E +TL YAIA
Sbjct  819  SESETLQYAIA  829



>gb|KHN16949.1| Putative methyltransferase PMT26 [Glycine soja]
Length=832

 Score =   321 bits (823),  Expect = 4e-100, Method: Composition-based stats.
 Identities = 138/191 (72%), Positives = 166/191 (87%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGKPAPEDF ADY HW R+V+KSYLNG+GINWS +RNVMDM +VYGGFAAALKDL 
Sbjct  642  QVGVYGKPAPEDFTADYGHWKRIVSKSYLNGIGINWSNMRNVMDMRSVYGGFAAALKDLN  701

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            +WVMN+V+++S DTLP+IYERGLFGMYHDWCESFSTYPRSYDLLHAD+LFS IK +C+L 
Sbjct  702  IWVMNVVSVNSADTLPLIYERGLFGMYHDWCESFSTYPRSYDLLHADNLFSNIKNRCSLK  761

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             +V E+DRILRPEGKLIVRD  E + E+E+++KSM +++RMTYS    G LCVQK+MWRP
Sbjct  762  AVVAEIDRILRPEGKLIVRDTVEIINEMESMVKSMQWEVRMTYSKDKVGFLCVQKSMWRP  821

Query  185  KEVQTLAYAIA  153
            KE++TL YAI 
Sbjct  822  KELETLEYAIG  832



>ref|XP_004143348.1| PREDICTED: probable methyltransferase PMT26-like [Cucumis sativus]
 gb|KGN48314.1| hypothetical protein Csa_6G476050 [Cucumis sativus]
Length=830

 Score =   321 bits (822),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 170/191 (89%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYG+ APEDF AD+KHW+RVVTKSYL+GMGI+WSTVRNVMDM AVYGGFAAALK+LK
Sbjct  640  QVGVYGRAAPEDFTADHKHWNRVVTKSYLSGMGIDWSTVRNVMDMRAVYGGFAAALKNLK  699

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V+IDS DTLPII+ERGLFG+YHDWCESF+TYPRSYDLLHADHLFSK+K +CN+ 
Sbjct  700  VWVMNVVSIDSADTLPIIFERGLFGIYHDWCESFNTYPRSYDLLHADHLFSKVKTRCNIA  759

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             LV E DRILRP+GKLIVRD++ET+ ELE++ KSM +++R TY   +E LLCVQK+MWRP
Sbjct  760  ALVAETDRILRPDGKLIVRDNSETVNELESMFKSMKWEVRFTYFKDNEALLCVQKSMWRP  819

Query  185  KEVQTLAYAIA  153
             E +TL YAIA
Sbjct  820  SESETLQYAIA  830



>ref|XP_008805853.1| PREDICTED: probable methyltransferase PMT26 [Phoenix dactylifera]
 ref|XP_008805854.1| PREDICTED: probable methyltransferase PMT26 [Phoenix dactylifera]
Length=806

 Score =   320 bits (820),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 142/191 (74%), Positives = 170/191 (89%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGKPAP+DF ADY+HW RVV+KSY+NG+GINWS VRNVMDM +VYGGFAAAL+ +K
Sbjct  616  QVGVYGKPAPKDFEADYEHWKRVVSKSYVNGIGINWSHVRNVMDMRSVYGGFAAALRGMK  675

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMNIV+IDS DTLPIIYERGLFGMYHDWCESFSTYPR+YDLLHADHLFSK+K++C L 
Sbjct  676  VWVMNIVSIDSADTLPIIYERGLFGMYHDWCESFSTYPRTYDLLHADHLFSKLKKRCELP  735

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++ EVDRILRPEGKLIVRD+ ET+ E+EN+ KS+H++IRMTYS   EGLLCVQKT+WRP
Sbjct  736  PVIAEVDRILRPEGKLIVRDNAETINEIENMAKSLHWEIRMTYSKDHEGLLCVQKTIWRP  795

Query  185  KEVQTLAYAIA  153
            KE +  A +++
Sbjct  796  KEQEARASSMS  806



>ref|XP_006584650.1| PREDICTED: probable methyltransferase PMT26-like isoform X1 [Glycine 
max]
 ref|XP_006584651.1| PREDICTED: probable methyltransferase PMT26-like isoform X2 [Glycine 
max]
 ref|XP_006584652.1| PREDICTED: probable methyltransferase PMT26-like isoform X3 [Glycine 
max]
Length=842

 Score =   321 bits (822),  Expect = 7e-100, Method: Composition-based stats.
 Identities = 138/191 (72%), Positives = 166/191 (87%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGKPAPEDF ADY HW R+V+KSYLNG+GINWS +RNVMDM +VYGGFAAALKDL 
Sbjct  652  QVGVYGKPAPEDFTADYGHWKRIVSKSYLNGIGINWSNMRNVMDMRSVYGGFAAALKDLN  711

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            +WVMN+V+++S DTLP+IYERGLFGMYHDWCESFSTYPRSYDLLHAD+LFS IK +C+L 
Sbjct  712  IWVMNVVSVNSADTLPLIYERGLFGMYHDWCESFSTYPRSYDLLHADNLFSNIKNRCSLK  771

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             +V E+DRILRPEGKLIVRD  E + E+E+++KSM +++RMTYS    G LCVQK+MWRP
Sbjct  772  AVVAEIDRILRPEGKLIVRDTVEIINEMESMVKSMQWEVRMTYSKDKVGFLCVQKSMWRP  831

Query  185  KEVQTLAYAIA  153
            KE++TL YAI 
Sbjct  832  KELETLEYAIG  842



>ref|XP_010521110.1| PREDICTED: probable methyltransferase PMT26 [Tarenaya hassleriana]
 ref|XP_010521118.1| PREDICTED: probable methyltransferase PMT26 [Tarenaya hassleriana]
Length=861

 Score =   321 bits (823),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 142/191 (74%), Positives = 169/191 (88%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            +TGVYGK APEDF  DY+HW RVVTKSY+ G+GINW+ VRNVMDM AVYGGFAAAL+++ 
Sbjct  671  QTGVYGKSAPEDFTVDYEHWKRVVTKSYIKGLGINWANVRNVMDMRAVYGGFAAALREMN  730

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V IDSPDTL IIYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSK+K++CNL 
Sbjct  731  VWVMNVVPIDSPDTLAIIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSKLKQRCNLT  790

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             +VVEVDR+LRPEGKLI+RD  ET+ ++E + KSM +++RMTYS   EG+LC+QK+MWRP
Sbjct  791  AVVVEVDRMLRPEGKLILRDDAETIQQVEMMAKSMKWEVRMTYSKEKEGILCLQKSMWRP  850

Query  185  KEVQTLAYAIA  153
             EV+TLAYAIA
Sbjct  851  AEVETLAYAIA  861



>ref|XP_007159858.1| hypothetical protein PHAVU_002G273700g [Phaseolus vulgaris]
 gb|ESW31852.1| hypothetical protein PHAVU_002G273700g [Phaseolus vulgaris]
Length=832

 Score =   320 bits (820),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 140/189 (74%), Positives = 162/189 (86%), Gaps = 0/189 (0%)
 Frame = -2

Query  719  GVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLKVW  540
            GVYGKPAPEDF  DY+HW R+V+KSYLNG+GI WS VRNVMDM +VYGGFAAALKDL +W
Sbjct  640  GVYGKPAPEDFTVDYEHWKRIVSKSYLNGIGIKWSNVRNVMDMRSVYGGFAAALKDLNIW  699

Query  539  VMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGL  360
            VMN++ +++PDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHAD LFS IK +CNL  +
Sbjct  700  VMNVIPVNAPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADRLFSNIKNRCNLRAV  759

Query  359  VVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKE  180
            V EVDRILRPEGKLIVRD  + + E+E I+KSMH+D+RMTYS    G LCVQK+MWRPKE
Sbjct  760  VAEVDRILRPEGKLIVRDTVDIINEIEAIVKSMHWDVRMTYSKDKVGFLCVQKSMWRPKE  819

Query  179  VQTLAYAIA  153
             +TL Y+I 
Sbjct  820  FETLEYSIG  828



>emb|CDM85080.1| unnamed protein product [Triticum aestivum]
Length=803

 Score =   319 bits (817),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 141/183 (77%), Positives = 163/183 (89%), Gaps = 0/183 (0%)
 Frame = -2

Query  719  GVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLKVW  540
            GVYGKPA EDF ADY HW RVV+KSY+NGMGI+WS VRNVMDM AVYGGFAAAL+D KVW
Sbjct  619  GVYGKPANEDFEADYAHWKRVVSKSYVNGMGIDWSKVRNVMDMRAVYGGFAAALRDQKVW  678

Query  539  VMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGL  360
            VMNIV IDSPDTLPI+YERGLFGMYHDWCESFSTYPR+YDLLHADHLFSK+K++C L+G+
Sbjct  679  VMNIVPIDSPDTLPIVYERGLFGMYHDWCESFSTYPRTYDLLHADHLFSKLKKRCKLLGV  738

Query  359  VVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKE  180
              EVDRILRPEGKLIVRD+ ET++ELE + KS+ +++RMTY+   EGLLCVQKT WRPKE
Sbjct  739  FAEVDRILRPEGKLIVRDNAETISELEGMAKSLQWEVRMTYAKDKEGLLCVQKTTWRPKE  798

Query  179  VQT  171
            ++ 
Sbjct  799  IEA  801



>ref|XP_002864883.1| hypothetical protein ARALYDRAFT_496597 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41142.1| hypothetical protein ARALYDRAFT_496597 [Arabidopsis lyrata subsp. 
lyrata]
Length=821

 Score =   319 bits (817),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 141/191 (74%), Positives = 169/191 (88%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            +TGVYGK APEDF+ADY+HW RVV+KSYL G+GINW++VRNVMDM AVYGGFAAAL++LK
Sbjct  631  QTGVYGKAAPEDFSADYEHWKRVVSKSYLKGLGINWASVRNVMDMRAVYGGFAAALRELK  690

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V IDSPDTL IIYERGLFG+YHDWCESFSTYPRSYDLLHADHLFS++K++CNL 
Sbjct  691  VWVMNVVPIDSPDTLAIIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSRLKQRCNLT  750

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++ EVDR+LRPEGKLIVRD  ET+ E+E ++K+M +++RMTYS   EGLL VQK+ WRP
Sbjct  751  AVIAEVDRVLRPEGKLIVRDDAETIQEVEAMVKAMKWEVRMTYSREKEGLLSVQKSFWRP  810

Query  185  KEVQTLAYAIA  153
             EV+TL YAI 
Sbjct  811  NEVETLTYAIG  821



>ref|XP_009150474.1| PREDICTED: probable methyltransferase PMT26 [Brassica rapa]
Length=975

 Score =   322 bits (825),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 142/191 (74%), Positives = 171/191 (90%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            +TGVYGK AP+DF+ADY+HW RVVTKSYLNG+GINW++VRNVMDM AVYGGFAAAL+DLK
Sbjct  784  QTGVYGKAAPDDFSADYEHWKRVVTKSYLNGLGINWASVRNVMDMKAVYGGFAAALRDLK  843

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V IDSPDTL IIYERGLFG+YHDWCESFSTYPRSYDL+HADHL SK+K++CNL 
Sbjct  844  VWVMNVVPIDSPDTLAIIYERGLFGIYHDWCESFSTYPRSYDLVHADHLLSKLKQRCNLT  903

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             +V EVDR+LRPEG LIVRD  +T+ E+E ++K+M +++ MTYS G EGLL VQK++WRP
Sbjct  904  AVVAEVDRVLRPEGTLIVRDDAKTVQEVEAMVKAMKWEVHMTYSKGKEGLLSVQKSIWRP  963

Query  185  KEVQTLAYAIA  153
            ++VQTL YAIA
Sbjct  964  EDVQTLTYAIA  974



>ref|XP_006645134.1| PREDICTED: probable methyltransferase PMT26-like [Oryza brachyantha]
Length=798

 Score =   318 bits (814),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 139/183 (76%), Positives = 164/183 (90%), Gaps = 0/183 (0%)
 Frame = -2

Query  719  GVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLKVW  540
            GVYGKP  EDF ADY HW RVV+KSY+NGMGI+WS VRNVMDM AVYGGFAAAL+D KVW
Sbjct  614  GVYGKPGNEDFEADYAHWKRVVSKSYVNGMGIDWSKVRNVMDMRAVYGGFAAALRDQKVW  673

Query  539  VMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGL  360
            VMNIV IDSPDTLPI+YERGLFGMYHDWCESFSTYPR+YDLLHADHLFSK+K++C L+ +
Sbjct  674  VMNIVPIDSPDTLPIVYERGLFGMYHDWCESFSTYPRTYDLLHADHLFSKLKKRCKLLPV  733

Query  359  VVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKE  180
              EVDRILRPEGKLIVRD+ ET+ EL+ ++KS+ +++RMTY+ G+EGLLCVQK+MWRPKE
Sbjct  734  FAEVDRILRPEGKLIVRDNAETINELQGMVKSLQWEVRMTYTKGNEGLLCVQKSMWRPKE  793

Query  179  VQT  171
            ++ 
Sbjct  794  IEA  796



>gb|EMT17461.1| hypothetical protein F775_31288 [Aegilops tauschii]
Length=795

 Score =   318 bits (814),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 141/183 (77%), Positives = 163/183 (89%), Gaps = 0/183 (0%)
 Frame = -2

Query  719  GVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLKVW  540
            GVYGKPA EDF ADY HW RVV+KSY+NGMGI+WS VRNVMDM AVYGGFAAAL+D KVW
Sbjct  611  GVYGKPANEDFEADYAHWKRVVSKSYVNGMGIDWSKVRNVMDMRAVYGGFAAALRDQKVW  670

Query  539  VMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGL  360
            VMNIV IDS DTLPI+YERGLFGMYHDWCESFSTYPR+YDLLHADHLFSK+K++C L+G+
Sbjct  671  VMNIVPIDSADTLPIVYERGLFGMYHDWCESFSTYPRTYDLLHADHLFSKLKKRCKLLGV  730

Query  359  VVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKE  180
              EVDRILRPEGKLIVRD  ET++ELE++ KS+ +++RMTY+ G EGLLCVQKT WRPKE
Sbjct  731  FAEVDRILRPEGKLIVRDDAETISELESMAKSLQWEVRMTYAKGKEGLLCVQKTTWRPKE  790

Query  179  VQT  171
            ++ 
Sbjct  791  IEA  793



>ref|XP_003523221.1| PREDICTED: probable methyltransferase PMT26-like isoform X1 [Glycine 
max]
 ref|XP_006578784.1| PREDICTED: probable methyltransferase PMT26-like isoform X2 [Glycine 
max]
 gb|KHN31166.1| Putative methyltransferase PMT26 [Glycine soja]
Length=810

 Score =   318 bits (815),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 139/190 (73%), Positives = 164/190 (86%), Gaps = 0/190 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGKPAPEDF ADY+HW RVV++SYL+GMGI WS VRNVMDM ++YGGFAAAL+DL 
Sbjct  620  QVGVYGKPAPEDFTADYEHWKRVVSQSYLDGMGIKWSNVRNVMDMRSIYGGFAAALRDLN  679

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V IDSPDTLPII+ERGLFG+YHDWCESFSTYPR+YDLLHADHLFSK+K++CNL 
Sbjct  680  VWVMNVVTIDSPDTLPIIFERGLFGIYHDWCESFSTYPRTYDLLHADHLFSKLKKRCNLA  739

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             +V E DRILRPEGKLIVRD  E + ELE++ +SM + +RMTYS   EGLLCV+K+ WRP
Sbjct  740  AVVAEADRILRPEGKLIVRDTVEIVEELESMARSMQWKVRMTYSKDKEGLLCVEKSKWRP  799

Query  185  KEVQTLAYAI  156
            KE + L YAI
Sbjct  800  KEQEKLEYAI  809



>gb|EMS53293.1| putative methyltransferase PMT26 [Triticum urartu]
Length=946

 Score =   320 bits (821),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 142/183 (78%), Positives = 164/183 (90%), Gaps = 0/183 (0%)
 Frame = -2

Query  719  GVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLKVW  540
            GVYGKPA EDF ADY HW RVV+KSY+NGMGI+WS VRNVMDM AVYGGFAAAL+D KVW
Sbjct  762  GVYGKPANEDFEADYAHWKRVVSKSYVNGMGIDWSKVRNVMDMRAVYGGFAAALRDQKVW  821

Query  539  VMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGL  360
            VMNIV IDSPDTLPI+YERGLFGMYHDWCESFSTYPR+YDLLHADHLFSK+K++C L+G+
Sbjct  822  VMNIVPIDSPDTLPIVYERGLFGMYHDWCESFSTYPRTYDLLHADHLFSKLKKRCKLLGV  881

Query  359  VVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKE  180
              EVDRILRPEGKLIVRD  ET++ELE++ KS+ +++RMTY+ G EGLLCVQKT WRPKE
Sbjct  882  FAEVDRILRPEGKLIVRDDAETISELESMAKSLQWEVRMTYARGKEGLLCVQKTTWRPKE  941

Query  179  VQT  171
            ++ 
Sbjct  942  IEA  944



>ref|XP_008783335.1| PREDICTED: probable methyltransferase PMT26 [Phoenix dactylifera]
Length=807

 Score =   317 bits (813),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 141/183 (77%), Positives = 165/183 (90%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            E GVYGKPA EDF  DY+HW RVV KSY++GMGINWS VRNVMDM +VYGGFAAAL+D+K
Sbjct  617  EVGVYGKPALEDFEVDYEHWKRVVGKSYVHGMGINWSHVRNVMDMRSVYGGFAAALRDMK  676

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMNI++IDSPDTLPIIYERGLFGMYHDWCESFSTYPR+YDLLHADHLFSK+K++C L+
Sbjct  677  VWVMNIISIDSPDTLPIIYERGLFGMYHDWCESFSTYPRTYDLLHADHLFSKLKKRCKLL  736

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++ EVDRILRPEG LIVRD+ E + E+EN+ KS+H++IRMTYS  +EGLLCVQKTMWRP
Sbjct  737  PVIAEVDRILRPEGNLIVRDNVEIINEIENMAKSLHWEIRMTYSKNNEGLLCVQKTMWRP  796

Query  185  KEV  177
            KE+
Sbjct  797  KEL  799



>ref|XP_002520274.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF42060.1| ATP binding protein, putative [Ricinus communis]
Length=802

 Score =   317 bits (812),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 141/190 (74%), Positives = 165/190 (87%), Gaps = 0/190 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGK APEDF ADY HW  VV++SYLNGMGI+WSTVRN MDM AVYGGFAAALKDLK
Sbjct  612  QVGVYGKAAPEDFTADYNHWKHVVSQSYLNGMGIDWSTVRNAMDMRAVYGGFAAALKDLK  671

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN V IDSPDTLPIIYERGLFGMYHDWCESF+TYPR+YDLLHADHLFS +K++CNL+
Sbjct  672  VWVMNTVPIDSPDTLPIIYERGLFGMYHDWCESFNTYPRTYDLLHADHLFSSLKKRCNLV  731

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             +V EVDRILRPEGKLIVRD+ + + E+E++ KS+ ++IRM Y+  DEGLLCV+KTMWRP
Sbjct  732  AVVAEVDRILRPEGKLIVRDNVDIIGEIESMAKSLKWEIRMIYTKDDEGLLCVRKTMWRP  791

Query  185  KEVQTLAYAI  156
             E +T+  AI
Sbjct  792  TEAETIKSAI  801



>ref|XP_010908928.1| PREDICTED: probable methyltransferase PMT26 [Elaeis guineensis]
Length=800

 Score =   317 bits (811),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 140/180 (78%), Positives = 165/180 (92%), Gaps = 0/180 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGKPAP+DF  DY++W +VV+KSYLNGMGINWS VRNVMDM +VYGGFAAAL+D+K
Sbjct  618  QVGVYGKPAPKDFEVDYEYWKQVVSKSYLNGMGINWSHVRNVMDMRSVYGGFAAALRDMK  677

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWV+NIV+IDSPDTLPIIYERGLFGMYHDWCESFSTYPR+YDLLHADHLFSK+K++C L+
Sbjct  678  VWVLNIVSIDSPDTLPIIYERGLFGMYHDWCESFSTYPRTYDLLHADHLFSKLKKRCKLL  737

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++ EVDRILRPEGKLIVRD+ ET+ E+EN+ KS+H++IRMTYS   EGLLCVQKTMWRP
Sbjct  738  PVIAEVDRILRPEGKLIVRDNVETINEVENMAKSLHWEIRMTYSKDREGLLCVQKTMWRP  797



>ref|XP_010911089.1| PREDICTED: probable methyltransferase PMT26 [Elaeis guineensis]
 ref|XP_010911096.1| PREDICTED: probable methyltransferase PMT26 [Elaeis guineensis]
Length=799

 Score =   317 bits (811),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 140/182 (77%), Positives = 163/182 (90%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGKPA EDF ADY+HW RVV+KSY++GMGINWS VRNVMDM +VYGGFA AL+D+K
Sbjct  618  QAGVYGKPAVEDFEADYQHWKRVVSKSYVSGMGINWSHVRNVMDMRSVYGGFATALRDMK  677

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMNIV+IDSPDTLP+IYERGLFG YHDWCESFSTYPR+YDLLHADHLFSK+K++C L 
Sbjct  678  VWVMNIVSIDSPDTLPVIYERGLFGTYHDWCESFSTYPRTYDLLHADHLFSKLKKRCKLQ  737

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++ EVDRILRPEG LIVRD+ E + E+ENI KS+H++IRMTYS  +EGLLCVQKTMWRP
Sbjct  738  PVIAEVDRILRPEGNLIVRDNVEIINEIENIAKSLHWEIRMTYSKDNEGLLCVQKTMWRP  797

Query  185  KE  180
            KE
Sbjct  798  KE  799



>ref|XP_009414612.1| PREDICTED: probable methyltransferase PMT24 [Musa acuminata subsp. 
malaccensis]
Length=817

 Score =   317 bits (811),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 139/185 (75%), Positives = 166/185 (90%), Gaps = 0/185 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGKPAPEDF +DY+HW RVV+KSY+ GMGINWSTVRNVMDM +VYGGFAAAL+D+K
Sbjct  630  QPGVYGKPAPEDFVSDYEHWKRVVSKSYVGGMGINWSTVRNVMDMRSVYGGFAAALRDMK  689

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMNIV+IDSPDTLP+IYERGLFGMYHDWCESFSTYPR+YDLLHADHLFSKIK++C L 
Sbjct  690  VWVMNIVSIDSPDTLPVIYERGLFGMYHDWCESFSTYPRTYDLLHADHLFSKIKKRCQLR  749

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++VEVDRI RP GKLIVRD   T++E+E  +KS+ ++IR+TYS  +EGLLC +KTMWRP
Sbjct  750  PVIVEVDRITRPGGKLIVRDDVNTISEIETTVKSLQWEIRLTYSKDNEGLLCAEKTMWRP  809

Query  185  KEVQT  171
            K+V+T
Sbjct  810  KQVET  814



>ref|XP_006434317.1| hypothetical protein CICLE_v10000311mg [Citrus clementina]
 ref|XP_006434318.1| hypothetical protein CICLE_v10000311mg [Citrus clementina]
 gb|ESR47557.1| hypothetical protein CICLE_v10000311mg [Citrus clementina]
 gb|ESR47558.1| hypothetical protein CICLE_v10000311mg [Citrus clementina]
Length=808

 Score =   316 bits (809),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 139/190 (73%), Positives = 167/190 (88%), Gaps = 0/190 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            E GVYGK APEDF ADY+HW  VV+KSYLNGMGINWS VRNVMDM AVYGGFAAALKDLK
Sbjct  618  EAGVYGKAAPEDFTADYQHWKNVVSKSYLNGMGINWSFVRNVMDMRAVYGGFAAALKDLK  677

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V I+SPDTLPIIYERGLFG+YHDWCESF+TYPR+YDLLHADHLFS IK++C+L 
Sbjct  678  VWVMNVVPIESPDTLPIIYERGLFGLYHDWCESFNTYPRTYDLLHADHLFSTIKKRCSLK  737

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             +V EVDRILRP+G LI+RD  ET+ E+E+++KS+H+D+RM Y+N ++G+LCV KT WRP
Sbjct  738  AVVAEVDRILRPDGNLILRDDAETIVEVEDLVKSLHWDVRMIYTNDNQGMLCVHKTYWRP  797

Query  185  KEVQTLAYAI  156
            KE +T+  A+
Sbjct  798  KETETILSAM  807



>ref|XP_004959929.1| PREDICTED: probable methyltransferase PMT26-like [Setaria italica]
Length=737

 Score =   314 bits (805),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 137/185 (74%), Positives = 166/185 (90%), Gaps = 0/185 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            E GVYGKPAPEDF  DY+HW RVV+ SY+NG+G++WS VRNVMDM AVYGGFAAAL DLK
Sbjct  551  EAGVYGKPAPEDFQVDYEHWKRVVSNSYMNGLGVDWSAVRNVMDMKAVYGGFAAALHDLK  610

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN++ IDSPDTLPIIYERGLFG+YHDWCESFSTYPR+YDLLHA+HLFSK+K++C L+
Sbjct  611  VWVMNVIPIDSPDTLPIIYERGLFGLYHDWCESFSTYPRTYDLLHANHLFSKVKKRCELL  670

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             +VVEVDR+LRPEG+LIVRD+ ET++E+ENI+KS+H+++RM+YS   EGLL VQKT WRP
Sbjct  671  PVVVEVDRVLRPEGRLIVRDNIETISEVENIVKSLHWEVRMSYSQDKEGLLFVQKTSWRP  730

Query  185  KEVQT  171
             EV+ 
Sbjct  731  NEVEA  735



>ref|XP_010546331.1| PREDICTED: probable methyltransferase PMT26 [Tarenaya hassleriana]
Length=838

 Score =   317 bits (811),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 141/191 (74%), Positives = 167/191 (87%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            +TGVYGK APEDF +DY+HW RVVTKSYL G+GINW+ VRNVMDM AVYGGFAAAL++L 
Sbjct  648  QTGVYGKAAPEDFTSDYEHWKRVVTKSYLKGLGINWANVRNVMDMRAVYGGFAAALRELN  707

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V IDSPDTL IIYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSK+K++CN+ 
Sbjct  708  VWVMNVVPIDSPDTLSIIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSKLKQRCNVT  767

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             +V EVDR+LRPEGKLIVRD  ET+ ELE+++KSM +++RMT+S   EGLL V K+ WRP
Sbjct  768  AVVAEVDRMLRPEGKLIVRDDAETIQELESMVKSMKWEVRMTFSKDKEGLLSVHKSTWRP  827

Query  185  KEVQTLAYAIA  153
             +V+TL YAIA
Sbjct  828  TQVETLTYAIA  838



>emb|CDY43336.1| BnaC03g59080D, partial [Brassica napus]
Length=192

 Score =   297 bits (760),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 133/191 (70%), Positives = 164/191 (86%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGKPA EDF AD++ W  +V+KSYLNGMGI+WS VRNVMDM AVYGGFAAALKDLK
Sbjct  2    QEGVYGKPAQEDFTADHERWKNIVSKSYLNGMGIDWSYVRNVMDMRAVYGGFAAALKDLK  61

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            +WVMN+V +DS DTLPIIYERGLFG+YHDWCESFSTYPR+YDLLHADHLFS +K++C+L+
Sbjct  62   LWVMNVVPVDSADTLPIIYERGLFGIYHDWCESFSTYPRTYDLLHADHLFSPLKKRCSLV  121

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++ EVDRILRP+G  IVRD +ET+ E+E ++KSM +++ MT+S G EGLL VQK+ WRP
Sbjct  122  SVMAEVDRILRPQGTFIVRDDSETIGEIEKMVKSMKWNMTMTHSKGGEGLLSVQKSWWRP  181

Query  185  KEVQTLAYAIA  153
             EV+T+  AIA
Sbjct  182  TEVETITSAIA  192



>ref|XP_003630288.1| Ankyrin-like protein [Medicago truncatula]
 gb|AET04764.1| methyltransferase PMT26-like protein, putative [Medicago truncatula]
Length=826

 Score =   316 bits (809),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 137/191 (72%), Positives = 166/191 (87%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            E GVYGKPAPEDF AD++HW RVV+KSYLNG+GI WS VRNVMDM +VYGGFAAAL DLK
Sbjct  629  EVGVYGKPAPEDFTADHEHWKRVVSKSYLNGIGIQWSNVRNVMDMRSVYGGFAAALMDLK  688

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            +WVMN+V +DSPDTLPIIYERGLFG+YHDWCESFSTYPRSYDL+HADHLFSK+K++C   
Sbjct  689  IWVMNVVPVDSPDTLPIIYERGLFGIYHDWCESFSTYPRSYDLVHADHLFSKLKKRCKFE  748

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             +V EVDRILRPEGKLIVRD  ET+ ELE+++ +M +++RMTY+   +G+L VQK+MWRP
Sbjct  749  AVVAEVDRILRPEGKLIVRDTAETINELESLVTAMQWEVRMTYTKDLQGILSVQKSMWRP  808

Query  185  KEVQTLAYAIA  153
             E++T+ YAI 
Sbjct  809  TELETVEYAIG  819



>ref|XP_002307464.2| hypothetical protein POPTR_0005s20670g [Populus trichocarpa]
 gb|EEE94460.2| hypothetical protein POPTR_0005s20670g [Populus trichocarpa]
Length=826

 Score =   316 bits (809),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 141/190 (74%), Positives = 165/190 (87%), Gaps = 0/190 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGK APEDFAADY HW  VV+KSYLNGMGINWS+VRN+MDM AVYGGFAAALKDLK
Sbjct  636  QVGVYGKAAPEDFAADYGHWKNVVSKSYLNGMGINWSSVRNIMDMRAVYGGFAAALKDLK  695

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V IDS DTLPIIYERGLFGMYHDWCESF+TYPR+YDLLHADHLFS + ++CNL+
Sbjct  696  VWVMNVVPIDSADTLPIIYERGLFGMYHDWCESFNTYPRTYDLLHADHLFSSLTKRCNLV  755

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++ EVDRILRPEG LIVRD+ E + E+E++ KS+++DIRM YS  +EGLLCV KTMWRP
Sbjct  756  AVIAEVDRILRPEGNLIVRDNVEIIGEIESLAKSLNWDIRMIYSKDNEGLLCVHKTMWRP  815

Query  185  KEVQTLAYAI  156
             E +T+  AI
Sbjct  816  TEPETITSAI  825



>ref|XP_009411900.1| PREDICTED: probable methyltransferase PMT26 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009411901.1| PREDICTED: probable methyltransferase PMT26 [Musa acuminata subsp. 
malaccensis]
Length=750

 Score =   313 bits (803),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 137/185 (74%), Positives = 167/185 (90%), Gaps = 0/185 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGKPAP+DFAADY+HW  VV++SYLNGMGINWS VRNVMDM ++YGGFAAAL+D+K
Sbjct  563  QIGVYGKPAPQDFAADYEHWKHVVSRSYLNGMGINWSAVRNVMDMRSIYGGFAAALRDMK  622

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMNIV+ID+PDTLPIIYERGLFGMYHDWCESFSTYPR+YDLLHADHLFSK+K++C LM
Sbjct  623  VWVMNIVSIDAPDTLPIIYERGLFGMYHDWCESFSTYPRTYDLLHADHLFSKLKKRCQLM  682

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++VEVDRILRP G  IVRD+  T++E+EN+ KS+H++IR+TYS  +EGLL  QK+MWRP
Sbjct  683  PVIVEVDRILRPGGNFIVRDNVGTISEIENLAKSLHWEIRLTYSKDNEGLLYAQKSMWRP  742

Query  185  KEVQT  171
             +V+T
Sbjct  743  TDVET  747



>ref|XP_006472883.1| PREDICTED: probable methyltransferase PMT25-like [Citrus sinensis]
Length=808

 Score =   315 bits (807),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 139/190 (73%), Positives = 166/190 (87%), Gaps = 0/190 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            E GVYGK APEDF ADY+HW  VV+ SYLNGMGINWS VRNVMDM AVYGGFAAALKDLK
Sbjct  618  EAGVYGKAAPEDFTADYQHWKNVVSNSYLNGMGINWSFVRNVMDMRAVYGGFAAALKDLK  677

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V IDSPDTLPIIYERGLFG+YHDWCESF+TYPR+YDLLHADHLFS IK++C+L 
Sbjct  678  VWVMNVVPIDSPDTLPIIYERGLFGLYHDWCESFNTYPRTYDLLHADHLFSTIKKRCSLK  737

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             +V EVDRILRP+G LI+RD  ET+ E+E+++KS+H+D+RM Y+N ++G+LCV KT WRP
Sbjct  738  AVVAEVDRILRPDGNLILRDDAETIVEVEDLVKSLHWDVRMIYTNDNQGMLCVHKTYWRP  797

Query  185  KEVQTLAYAI  156
            KE +T+  A+
Sbjct  798  KETETILSAM  807



>ref|XP_003564784.1| PREDICTED: probable methyltransferase PMT26 [Brachypodium distachyon]
 ref|XP_010232657.1| PREDICTED: probable methyltransferase PMT26 [Brachypodium distachyon]
Length=812

 Score =   315 bits (806),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 142/184 (77%), Positives = 163/184 (89%), Gaps = 1/184 (1%)
 Frame = -2

Query  719  GVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALK-DLKV  543
            GVYGKPA EDF ADY HW RVV+KSY+NGMGI+WS VRNVMDM AVYGGFAAAL+   +V
Sbjct  627  GVYGKPANEDFEADYAHWKRVVSKSYVNGMGIDWSKVRNVMDMRAVYGGFAAALRGQRQV  686

Query  542  WVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMG  363
            WVMNIV IDSPDTLPIIYERGLFGMYHDWCESFSTYPR+YDLLHADHLFSK+K++C L+G
Sbjct  687  WVMNIVPIDSPDTLPIIYERGLFGMYHDWCESFSTYPRTYDLLHADHLFSKLKKRCKLLG  746

Query  362  LVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPK  183
            +  EVDRILRPEGKLIVRD  ET+ ELE + KS+H+++ MTY+ G+EGLLCVQKTMWRPK
Sbjct  747  VFAEVDRILRPEGKLIVRDSAETIIELEGMAKSLHWEVTMTYAKGNEGLLCVQKTMWRPK  806

Query  182  EVQT  171
            E++ 
Sbjct  807  EIEA  810



>gb|EPS72708.1| hypothetical protein M569_02045, partial [Genlisea aurea]
Length=585

 Score =   309 bits (791),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 139/189 (74%), Positives = 161/189 (85%), Gaps = 1/189 (1%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            ETGVYGKPAPEDF ADY+HW RVV  SY  G+GI WSTVRNVMDM AVYGG AAAL+DL 
Sbjct  397  ETGVYGKPAPEDFVADYEHWKRVVDNSYKKGLGIEWSTVRNVMDMRAVYGGLAAALRDLN  456

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSK-IKRKCNL  369
            VWVMN+V+I++PDTLP+IYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSK I++KCN 
Sbjct  457  VWVMNVVSINAPDTLPVIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSKIIRQKCNF  516

Query  368  MGLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWR  189
            M LV EVDRILRP+G +IVRD  ET+ +LE++ KSM + IRMTYS   EGL+C QKT WR
Sbjct  517  MALVAEVDRILRPDGTIIVRDTAETINQLESVFKSMQWIIRMTYSKNKEGLICAQKTTWR  576

Query  188  PKEVQTLAY  162
            P+E +T+ Y
Sbjct  577  PEETETVTY  585



>ref|XP_011006302.1| PREDICTED: probable methyltransferase PMT24 isoform X1 [Populus 
euphratica]
Length=826

 Score =   315 bits (806),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 140/190 (74%), Positives = 165/190 (87%), Gaps = 0/190 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGK APEDFAADY HW  VV++SYLNGMGINWS+VRN+MDM AVYGGFAAALKDLK
Sbjct  636  QVGVYGKAAPEDFAADYGHWKNVVSQSYLNGMGINWSSVRNIMDMRAVYGGFAAALKDLK  695

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V IDS DTLPIIYERGLFGMYHDWCESF+TYPR+YDLLHADHLFS + ++CNL+
Sbjct  696  VWVMNVVPIDSADTLPIIYERGLFGMYHDWCESFNTYPRTYDLLHADHLFSSLTKRCNLV  755

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++ EVDRILRPEG LIVRD+ E + E+E++ KS+++DIRM YS  +EGLLCV KTMWRP
Sbjct  756  AVIAEVDRILRPEGNLIVRDNVEIIGEIESLAKSLNWDIRMIYSKDNEGLLCVHKTMWRP  815

Query  185  KEVQTLAYAI  156
             E +T+  AI
Sbjct  816  TEPETITSAI  825



>ref|XP_011006303.1| PREDICTED: probable methyltransferase PMT24 isoform X2 [Populus 
euphratica]
Length=812

 Score =   314 bits (805),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 140/190 (74%), Positives = 165/190 (87%), Gaps = 0/190 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGK APEDFAADY HW  VV++SYLNGMGINWS+VRN+MDM AVYGGFAAALKDLK
Sbjct  622  QVGVYGKAAPEDFAADYGHWKNVVSQSYLNGMGINWSSVRNIMDMRAVYGGFAAALKDLK  681

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V IDS DTLPIIYERGLFGMYHDWCESF+TYPR+YDLLHADHLFS + ++CNL+
Sbjct  682  VWVMNVVPIDSADTLPIIYERGLFGMYHDWCESFNTYPRTYDLLHADHLFSSLTKRCNLV  741

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++ EVDRILRPEG LIVRD+ E + E+E++ KS+++DIRM YS  +EGLLCV KTMWRP
Sbjct  742  AVIAEVDRILRPEGNLIVRDNVEIIGEIESLAKSLNWDIRMIYSKDNEGLLCVHKTMWRP  801

Query  185  KEVQTLAYAI  156
             E +T+  AI
Sbjct  802  TEPETITSAI  811



>ref|NP_001151565.1| ankyrin-like protein [Zea mays]
 gb|ACG43365.1| ankyrin-like protein [Zea mays]
 tpg|DAA36810.1| TPA: ankyrin-like protein [Zea mays]
Length=671

 Score =   310 bits (795),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 136/185 (74%), Positives = 165/185 (89%), Gaps = 0/185 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            E GVYGKPAPEDF ADY+HW RVV+ SY+NG+GI+WSTVRNVMDM AVY GFAAAL+DLK
Sbjct  485  EAGVYGKPAPEDFQADYEHWKRVVSNSYMNGLGIDWSTVRNVMDMKAVYAGFAAALRDLK  544

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V IDSPDTLPIIYERGLFG+YHDWCESFSTYPR+YDL+HA+HLFSK+K++C L+
Sbjct  545  VWVMNVVPIDSPDTLPIIYERGLFGLYHDWCESFSTYPRTYDLVHANHLFSKVKKRCELL  604

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++VEVDR+LRP+G+LIVRD+ ET +E+ENILKS+H+++RM+Y    EGLL VQKT WRP
Sbjct  605  PVIVEVDRVLRPQGRLIVRDNIETTSEVENILKSLHWEVRMSYFQEKEGLLLVQKTTWRP  664

Query  185  KEVQT  171
             E + 
Sbjct  665  NETEA  669



>ref|XP_010112029.1| putative methyltransferase PMT24 [Morus notabilis]
 gb|EXC32448.1| putative methyltransferase PMT24 [Morus notabilis]
Length=739

 Score =   311 bits (798),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 140/191 (73%), Positives = 166/191 (87%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            E GVYGK APEDFAADYK W  VV++SYL GMGI+WS+VRNVMDM AVYGGFAAALKDLK
Sbjct  549  EVGVYGKAAPEDFAADYKRWKNVVSESYLEGMGISWSSVRNVMDMRAVYGGFAAALKDLK  608

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V IDSPDTLPIIYERGLFG+YHDWCESFSTYPRSYDLLHADHLFS +K++C L 
Sbjct  609  VWVMNVVPIDSPDTLPIIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSLLKKRCELR  668

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
            G++ EVDRILRP+G LIVRD  +T+ E+EN+ KS+ +++R+ +SN  E LLCVQKT+WRP
Sbjct  669  GVIAEVDRILRPDGTLIVRDGVKTVNEVENMAKSLKWNVRLVFSNNKEALLCVQKTIWRP  728

Query  185  KEVQTLAYAIA  153
            K+ +T+  AIA
Sbjct  729  KQTETIFSAIA  739



>gb|EMT26912.1| hypothetical protein F775_10259 [Aegilops tauschii]
Length=706

 Score =   311 bits (796),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 135/180 (75%), Positives = 167/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            ETGVYGKPAPEDF ADY+HW RV++ SY+ G+GI+WS+VRNVMDM AVYGGFAAAL+++K
Sbjct  522  ETGVYGKPAPEDFQADYEHWKRVISNSYMEGLGIDWSSVRNVMDMKAVYGGFAAALRNMK  581

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V IDSPDTLPIIYERGLFG+YHDWCESFSTYPRSYDL+HA+HLFSKIK++C L+
Sbjct  582  VWVMNVVPIDSPDTLPIIYERGLFGLYHDWCESFSTYPRSYDLVHANHLFSKIKKRCQLL  641

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
            G++VEVDRI+RPEG+LIVRD  ET+ E+E+I+KS+H+++R++YS  +EGLL VQKTMWRP
Sbjct  642  GVIVEVDRIVRPEGRLIVRDDMETIREVESIVKSLHWEVRLSYSQENEGLLFVQKTMWRP  701



>ref|XP_002300957.2| hypothetical protein POPTR_0002s07640g [Populus trichocarpa]
 gb|ABK94843.1| unknown [Populus trichocarpa]
 gb|EEE80230.2| hypothetical protein POPTR_0002s07640g [Populus trichocarpa]
Length=817

 Score =   313 bits (802),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 140/190 (74%), Positives = 166/190 (87%), Gaps = 0/190 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGK A EDFAADYKHW  VV++SYLNG+GINWS+VRN+MDM AVYGGFAAALKDLK
Sbjct  625  QVGVYGKAAAEDFAADYKHWKNVVSQSYLNGIGINWSSVRNIMDMRAVYGGFAAALKDLK  684

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMNIV IDS DTLP+IYERGLFGMYHDWCESF+TYPR+YDLLHADHLFS +K++CNL+
Sbjct  685  VWVMNIVPIDSADTLPMIYERGLFGMYHDWCESFNTYPRTYDLLHADHLFSSLKKRCNLV  744

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++ EVDRILRPEGKLIVRD+ E + E+E++ KS+ ++IRM YS  +EGLLCVQKT WRP
Sbjct  745  AVIAEVDRILRPEGKLIVRDNVEIIGEIESLAKSLKWEIRMIYSKDNEGLLCVQKTTWRP  804

Query  185  KEVQTLAYAI  156
             E +T+  AI
Sbjct  805  TESETITSAI  814



>dbj|BAD82580.1| ankyrin-like protein [Oryza sativa Japonica Group]
 gb|EAZ14397.1| hypothetical protein OsJ_04316 [Oryza sativa Japonica Group]
Length=798

 Score =   313 bits (801),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 137/183 (75%), Positives = 162/183 (89%), Gaps = 0/183 (0%)
 Frame = -2

Query  719  GVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLKVW  540
            G+YGKP  EDF ADY HW RVV+KSY+NGMGI+WS VRNVMDM AVYGGFAAAL+D KVW
Sbjct  614  GIYGKPGNEDFEADYAHWKRVVSKSYVNGMGIDWSKVRNVMDMRAVYGGFAAALRDQKVW  673

Query  539  VMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGL  360
            VMNIV  DS DTLPIIYERGLFGMYHDWCESFSTYPR+YDLLHADHLFSK+K++C L+ +
Sbjct  674  VMNIVPTDSADTLPIIYERGLFGMYHDWCESFSTYPRTYDLLHADHLFSKLKKRCKLLPV  733

Query  359  VVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKE  180
              EVDRILRPEGKLIVRD+ ET+ EL+ ++KS+ +++RMTY+ G+EGLLCVQK+MWRPKE
Sbjct  734  FAEVDRILRPEGKLIVRDNAETINELQGMVKSLQWEVRMTYTKGNEGLLCVQKSMWRPKE  793

Query  179  VQT  171
            ++ 
Sbjct  794  IEA  796



>ref|NP_001045015.1| Os01g0883900 [Oryza sativa Japonica Group]
 dbj|BAF06929.1| Os01g0883900 [Oryza sativa Japonica Group]
 dbj|BAG94735.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99723.1| unnamed protein product [Oryza sativa Japonica Group]
Length=806

 Score =   313 bits (801),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 137/183 (75%), Positives = 162/183 (89%), Gaps = 0/183 (0%)
 Frame = -2

Query  719  GVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLKVW  540
            G+YGKP  EDF ADY HW RVV+KSY+NGMGI+WS VRNVMDM AVYGGFAAAL+D KVW
Sbjct  622  GIYGKPGNEDFEADYAHWKRVVSKSYVNGMGIDWSKVRNVMDMRAVYGGFAAALRDQKVW  681

Query  539  VMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGL  360
            VMNIV  DS DTLPIIYERGLFGMYHDWCESFSTYPR+YDLLHADHLFSK+K++C L+ +
Sbjct  682  VMNIVPTDSADTLPIIYERGLFGMYHDWCESFSTYPRTYDLLHADHLFSKLKKRCKLLPV  741

Query  359  VVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKE  180
              EVDRILRPEGKLIVRD+ ET+ EL+ ++KS+ +++RMTY+ G+EGLLCVQK+MWRPKE
Sbjct  742  FAEVDRILRPEGKLIVRDNAETINELQGMVKSLQWEVRMTYTKGNEGLLCVQKSMWRPKE  801

Query  179  VQT  171
            ++ 
Sbjct  802  IEA  804



>gb|EAY76734.1| hypothetical protein OsI_04689 [Oryza sativa Indica Group]
Length=798

 Score =   312 bits (800),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 138/183 (75%), Positives = 162/183 (89%), Gaps = 0/183 (0%)
 Frame = -2

Query  719  GVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLKVW  540
            GVYGKP  EDF ADY HW RVV+KSY+NGMGI+WS VRNVMDM AVYGGFAAAL+D KVW
Sbjct  614  GVYGKPGNEDFEADYAHWKRVVSKSYVNGMGIDWSKVRNVMDMRAVYGGFAAALRDQKVW  673

Query  539  VMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGL  360
            VMNIV  DS DTLPIIYERGLFGMYHDWCESFSTYPR+YDLLHADHLFSK+K++C L+ +
Sbjct  674  VMNIVPTDSADTLPIIYERGLFGMYHDWCESFSTYPRTYDLLHADHLFSKLKKRCKLLPV  733

Query  359  VVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKE  180
              EVDRILRPEGKLIVRD+ ET+ EL+ ++KS+ +++RMTY+ G+EGLLCVQK+MWRPKE
Sbjct  734  FAEVDRILRPEGKLIVRDNAETINELQGMVKSLQWEVRMTYTKGNEGLLCVQKSMWRPKE  793

Query  179  VQT  171
            ++ 
Sbjct  794  IEA  796



>ref|XP_004970814.1| PREDICTED: probable methyltransferase PMT26-like [Setaria italica]
Length=797

 Score =   312 bits (800),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 138/185 (75%), Positives = 164/185 (89%), Gaps = 0/185 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGKPA EDF AD  HW RVV+KSY+NGMGI+WS VRNVMDM AVYGGFAAAL+D K
Sbjct  611  QVGVYGKPANEDFEADNAHWKRVVSKSYVNGMGIDWSKVRNVMDMRAVYGGFAAALRDQK  670

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMNIV IDSPDTLPIIYERGLFGMYHDWCESFSTYPR+YDLLHADHLFSK+K++C LM
Sbjct  671  VWVMNIVPIDSPDTLPIIYERGLFGMYHDWCESFSTYPRTYDLLHADHLFSKLKKRCKLM  730

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             +  EVDR+LRP+GKLIVRD  +T+ ELE++ KS+ +++RMTY+ G+EGLLCV+K+MWRP
Sbjct  731  AVFAEVDRVLRPQGKLIVRDTADTINELESMAKSLKWEVRMTYTKGNEGLLCVEKSMWRP  790

Query  185  KEVQT  171
            KE++ 
Sbjct  791  KELEA  795



>ref|XP_002447385.1| hypothetical protein SORBIDRAFT_06g034130 [Sorghum bicolor]
 gb|EES11713.1| hypothetical protein SORBIDRAFT_06g034130 [Sorghum bicolor]
Length=706

 Score =   310 bits (794),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 135/184 (73%), Positives = 166/184 (90%), Gaps = 0/184 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            E GVYGKPAPEDF ADY+HW RVV+ SY+NG+GI+WS+VRNVMDM AVY GFAAAL++LK
Sbjct  520  EAGVYGKPAPEDFQADYEHWKRVVSNSYMNGLGIDWSSVRNVMDMKAVYAGFAAALRNLK  579

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V IDSPDTLPIIYERGLFG+YHDWCESFSTYPR+YDLLHA+HLFSK+K++C L+
Sbjct  580  VWVMNVVPIDSPDTLPIIYERGLFGLYHDWCESFSTYPRTYDLLHANHLFSKVKKRCELL  639

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++VEVDR+LRPEG+LIVRD+ ET++E+ENI+KS+H+++ M+YS   EGLL VQKT WRP
Sbjct  640  PVIVEVDRVLRPEGRLIVRDNIETISEVENIVKSLHWEVHMSYSQDKEGLLFVQKTTWRP  699

Query  185  KEVQ  174
             E +
Sbjct  700  NETE  703



>gb|KDP32896.1| hypothetical protein JCGZ_12188 [Jatropha curcas]
Length=813

 Score =   313 bits (801),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 140/190 (74%), Positives = 164/190 (86%), Gaps = 0/190 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGK APEDF ADY HW  VV++SYLNGMGI+WS+VRNVMDM AVYGGFAAALKDL+
Sbjct  623  QVGVYGKAAPEDFTADYNHWKHVVSQSYLNGMGIDWSSVRNVMDMRAVYGGFAAALKDLQ  682

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V IDS DTLPIIYERGLFGMYHDWCESF+TYPR+YDLLHADHLFS IK++CN++
Sbjct  683  VWVMNVVPIDSADTLPIIYERGLFGMYHDWCESFNTYPRTYDLLHADHLFSSIKKRCNIV  742

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++ EVDRILRPEGKLIVRDH E + E+E + KSM ++IRM YS  +EGLL V+KTMWRP
Sbjct  743  AVMAEVDRILRPEGKLIVRDHVEVIGEIEGMAKSMKWEIRMIYSKDNEGLLFVRKTMWRP  802

Query  185  KEVQTLAYAI  156
             E +T+  AI
Sbjct  803  TETETIQSAI  812



>emb|CBI18946.3| unnamed protein product [Vitis vinifera]
Length=554

 Score =   306 bits (783),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 136/191 (71%), Positives = 164/191 (86%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGK APEDF +DY+HW  VV+ SYL GMGI WS+VRNVMDM AVYGGFAAALKDLK
Sbjct  364  QVGVYGKAAPEDFTSDYEHWKTVVSSSYLKGMGIKWSSVRNVMDMKAVYGGFAAALKDLK  423

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V I+SPDTLPII+ERGLFG+YHDWCESFSTYPRSYDL+HADHLFS +K++C L 
Sbjct  424  VWVMNVVPINSPDTLPIIFERGLFGIYHDWCESFSTYPRSYDLVHADHLFSDLKKRCQLT  483

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++ EVDRILRPEG LIVRD+ ET++E+E++ KS+ +++R+TYS   EGLLCV+KT WRP
Sbjct  484  AVIAEVDRILRPEGMLIVRDNVETVSEVESMAKSLQWEVRLTYSKDKEGLLCVKKTFWRP  543

Query  185  KEVQTLAYAIA  153
             E QT+  AIA
Sbjct  544  TETQTIKSAIA  554



>ref|XP_008371274.1| PREDICTED: probable methyltransferase PMT24 [Malus domestica]
Length=288

 Score =   297 bits (760),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 137/191 (72%), Positives = 163/191 (85%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            +  V GK A EDF +DYKHW +VV+++YLNGMGINWSTVRNVMDM AVYGGFAAALKDLK
Sbjct  98   QLDVDGKSAQEDFISDYKHWKKVVSETYLNGMGINWSTVRNVMDMRAVYGGFAAALKDLK  157

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V +DS DTLPIIYERGL G+YHDWCESFSTYPRSYDLLHADHLFS +K++C+L+
Sbjct  158  VWVMNVVPVDSRDTLPIIYERGLIGIYHDWCESFSTYPRSYDLLHADHLFSVLKKRCSLV  217

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++ EVDRILRPEGKLIV D+ ETL E+E++ KS+ +DIR TYS  +EGLL +QKT WRP
Sbjct  218  AVIAEVDRILRPEGKLIVWDNAETLNEIESMAKSLQWDIRFTYSKXNEGLLYIQKTFWRP  277

Query  185  KEVQTLAYAIA  153
             E +T+  AIA
Sbjct  278  AEKETILSAIA  288



>gb|KHG15143.1| hypothetical protein F383_09666 [Gossypium arboreum]
Length=891

 Score =   313 bits (803),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 141/189 (75%), Positives = 167/189 (88%), Gaps = 1/189 (1%)
 Frame = -2

Query  719  GVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLKVW  540
            GVYGK APEDF ADY+HW RV+ KSYLNG+GINWS++RNVMDM AVYGGFAAALKDL +W
Sbjct  704  GVYGKAAPEDFVADYEHWKRVI-KSYLNGIGINWSSIRNVMDMKAVYGGFAAALKDLNLW  762

Query  539  VMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGL  360
            VMN++ I SPDTLPIIYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSK+K++C L+ +
Sbjct  763  VMNVIPIRSPDTLPIIYERGLFGVYHDWCESFSTYPRSYDLLHADHLFSKVKKRCKLVSV  822

Query  359  VVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKE  180
            V EVDRILRP GKLIVRD+ ET+ ELE+++ SM +++  TYS   EGLLCVQK+MWRPKE
Sbjct  823  VAEVDRILRPGGKLIVRDNVETINELEDMVMSMEWEVLKTYSKNKEGLLCVQKSMWRPKE  882

Query  179  VQTLAYAIA  153
            VQT+ +AI+
Sbjct  883  VQTVTFAIS  891



>dbj|BAJ85194.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=689

 Score =   308 bits (790),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 135/180 (75%), Positives = 164/180 (91%), Gaps = 0/180 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            ETGVYGKPAPEDF ADY+HW RV+  SY+ G+GI+WS VRNVMDM AVYGGFAAAL+++K
Sbjct  505  ETGVYGKPAPEDFQADYEHWKRVIQNSYMEGLGIDWSAVRNVMDMKAVYGGFAAALRNMK  564

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMNIV IDSPDTLPIIYERGLFG+YHDWCESFSTYPRSYDL+HA+HL SKIK++C L+
Sbjct  565  VWVMNIVPIDSPDTLPIIYERGLFGLYHDWCESFSTYPRSYDLVHANHLLSKIKKRCELL  624

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
            G++VEVDRI+RPEG+LIVRD  ET+ E+E+I+KS+H+++R++YS  +EGLL VQKTMWRP
Sbjct  625  GVIVEVDRIVRPEGRLIVRDDMETIREVESIVKSLHWEVRLSYSQDNEGLLFVQKTMWRP  684



>ref|XP_004978303.1| PREDICTED: probable methyltransferase PMT26-like [Setaria italica]
Length=1032

 Score =   315 bits (808),  Expect = 1e-96, Method: Composition-based stats.
 Identities = 137/187 (73%), Positives = 162/187 (87%), Gaps = 0/187 (0%)
 Frame = -2

Query  725   ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
             + GVYGKPAP DF+AD +HW +VV  SYL+GMGI+W  VRNVMDM AVYGGFAAAL+D+K
Sbjct  846   QVGVYGKPAPADFSADQEHWRKVVQGSYLDGMGIDWKNVRNVMDMRAVYGGFAAALRDMK  905

Query  545   VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
             VWVMN+V IDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDL+HADHLFSK+K +C L+
Sbjct  906   VWVMNVVTIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLVHADHLFSKLKSRCELL  965

Query  365   GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
              ++VEVDRILRPEGKLIVRD   T+ E+E+I +S+H+++RMT S   EGLLCV KTMWRP
Sbjct  966   PVIVEVDRILRPEGKLIVRDDRATVEEVESIARSLHWEVRMTVSEQGEGLLCVGKTMWRP  1025

Query  185   KEVQTLA  165
              EV+ L+
Sbjct  1026  TEVEALS  1032



>ref|XP_009414876.1| PREDICTED: probable methyltransferase PMT26 [Musa acuminata subsp. 
malaccensis]
Length=637

 Score =   306 bits (784),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 134/191 (70%), Positives = 165/191 (86%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGKPAPEDF AD++HW RVV+ SYL G+GI+WS VRNVMDM AVYGGFAAAL+++ 
Sbjct  447  QIGVYGKPAPEDFKADFQHWKRVVSNSYLKGLGIDWSGVRNVMDMRAVYGGFAAALQEVN  506

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
             WVMNIV IDSPDTLP+IYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSK K++C L+
Sbjct  507  AWVMNIVTIDSPDTLPVIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKTKKRCKLL  566

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++ EVDRILRP+GKLIVRD+ ETL E+E++ KS+++++RM YS    GLLCVQKT+WRP
Sbjct  567  PVIAEVDRILRPQGKLIVRDNAETLEEVESMAKSLNWEVRMGYSKEKGGLLCVQKTLWRP  626

Query  185  KEVQTLAYAIA  153
            +EV+    +++
Sbjct  627  EEVEATVSSLS  637



>ref|XP_011027424.1| PREDICTED: probable methyltransferase PMT24 [Populus euphratica]
Length=690

 Score =   307 bits (787),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 138/190 (73%), Positives = 164/190 (86%), Gaps = 0/190 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGK A EDFAADY+HW  VV++SYLNG+GI WS+VRN+MDM AVYGGFAAALKDLK
Sbjct  498  QVGVYGKAAAEDFAADYRHWKNVVSQSYLNGIGIKWSSVRNIMDMRAVYGGFAAALKDLK  557

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMNIV  DS DTLPIIYERGLFGMYHDWCESF+TYPR+YDLLHADHLFS +K++C+L+
Sbjct  558  VWVMNIVPTDSADTLPIIYERGLFGMYHDWCESFNTYPRTYDLLHADHLFSGLKKRCDLV  617

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++ EVDRILRPEGKLIVRD+ E + E+E + KS+ ++IRM YS  +EGLLCVQKTMWRP
Sbjct  618  AVIAEVDRILRPEGKLIVRDNVEIIGEIERLAKSLKWEIRMIYSKDNEGLLCVQKTMWRP  677

Query  185  KEVQTLAYAI  156
             E +T+  AI
Sbjct  678  TESETITSAI  687



>ref|XP_006303155.1| hypothetical protein CARUB_v10008372mg [Capsella rubella]
 ref|XP_006303156.1| hypothetical protein CARUB_v10008372mg [Capsella rubella]
 gb|EOA36053.1| hypothetical protein CARUB_v10008372mg [Capsella rubella]
 gb|EOA36054.1| hypothetical protein CARUB_v10008372mg [Capsella rubella]
Length=767

 Score =   308 bits (790),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 138/191 (72%), Positives = 166/191 (87%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGKPA EDF AD++ W  +V+KSYLNGMGI+WS VRNVMDM AVYGGFAAALKDLK
Sbjct  577  QEGVYGKPAQEDFTADHERWKTIVSKSYLNGMGIDWSYVRNVMDMRAVYGGFAAALKDLK  636

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            +WVMN+V IDSPDTLPIIYERGLFG+YHDWCESFSTYPR+YDLLHADHLFS +K++CNL+
Sbjct  637  LWVMNVVPIDSPDTLPIIYERGLFGIYHDWCESFSTYPRTYDLLHADHLFSSLKKRCNLV  696

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
            G++ EVDRILRPEG  IVRD  ET+ E+E ++KSM +++RMT+S   EGLL VQK+ WRP
Sbjct  697  GVMAEVDRILRPEGTFIVRDDMETIGEIEKMVKSMKWNVRMTHSKDGEGLLSVQKSWWRP  756

Query  185  KEVQTLAYAIA  153
            +EV+T+  AIA
Sbjct  757  EEVETIQSAIA  767



>ref|XP_002285889.2| PREDICTED: probable methyltransferase PMT24 [Vitis vinifera]
 ref|XP_010664148.1| PREDICTED: probable methyltransferase PMT24 [Vitis vinifera]
Length=844

 Score =   310 bits (793),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 136/191 (71%), Positives = 164/191 (86%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGK APEDF +DY+HW  VV+ SYL GMGI WS+VRNVMDM AVYGGFAAALKDLK
Sbjct  654  QVGVYGKAAPEDFTSDYEHWKTVVSSSYLKGMGIKWSSVRNVMDMKAVYGGFAAALKDLK  713

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V I+SPDTLPII+ERGLFG+YHDWCESFSTYPRSYDL+HADHLFS +K++C L 
Sbjct  714  VWVMNVVPINSPDTLPIIFERGLFGIYHDWCESFSTYPRSYDLVHADHLFSDLKKRCQLT  773

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++ EVDRILRPEG LIVRD+ ET++E+E++ KS+ +++R+TYS   EGLLCV+KT WRP
Sbjct  774  AVIAEVDRILRPEGMLIVRDNVETVSEVESMAKSLQWEVRLTYSKDKEGLLCVKKTFWRP  833

Query  185  KEVQTLAYAIA  153
             E QT+  AIA
Sbjct  834  TETQTIKSAIA  844



>ref|XP_008338454.1| PREDICTED: probable methyltransferase PMT24 [Malus domestica]
Length=432

 Score =   298 bits (764),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 136/188 (72%), Positives = 161/188 (86%), Gaps = 0/188 (0%)
 Frame = -2

Query  716  VYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLKVWV  537
            V GK APE F +DYKHW +VV+++YLNGMGINWSTVRNVMDM AVYGGFAAALKDLKVWV
Sbjct  245  VNGKSAPEXFVSDYKHWKKVVSETYLNGMGINWSTVRNVMDMRAVYGGFAAALKDLKVWV  304

Query  536  MNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLV  357
            MN+V +DS DTLPIIYERGL G+YHDWCESFSTYPRSYDLLHADHLFS +K++C+L+  +
Sbjct  305  MNVVPVDSRDTLPIIYERGLIGIYHDWCESFSTYPRSYDLLHADHLFSVLKKRCSLVAAI  364

Query  356  VEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEV  177
             EVDRILRPEGKLIV D+ ETL E+E++ KS+ ++IR TYS  +EGLLC+QKT WRP E 
Sbjct  365  AEVDRILRPEGKLIVWDNAETLNEIESLAKSLQWNIRFTYSKDNEGLLCIQKTFWRPAEK  424

Query  176  QTLAYAIA  153
            + +  AIA
Sbjct  425  EKILSAIA  432



>ref|XP_009779710.1| PREDICTED: probable methyltransferase PMT26 [Nicotiana sylvestris]
Length=766

 Score =   307 bits (787),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 138/191 (72%), Positives = 162/191 (85%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGK AP DFAADY HW  VV+KSYLNG+GINWS+VRNVMDM AVYGGFAAALKDLK
Sbjct  576  QVGVYGKAAPADFAADYDHWKHVVSKSYLNGLGINWSSVRNVMDMKAVYGGFAAALKDLK  635

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V +DSPDTLPIIYERG FG+YHDWCESFSTYPRSYDLLHADHLFS IK++C ++
Sbjct  636  VWVMNVVPVDSPDTLPIIYERGFFGIYHDWCESFSTYPRSYDLLHADHLFSDIKKRCKIV  695

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             +  EVDRILRPEGKLIVRD+ ET+ E+EN+ +S  + ++M+YS   EGLL VQK+ WRP
Sbjct  696  PVFAEVDRILRPEGKLIVRDNAETILEIENMARSAKWKVKMSYSKDGEGLLFVQKSFWRP  755

Query  185  KEVQTLAYAIA  153
            K+ Q +  AIA
Sbjct  756  KQEQIIKSAIA  766



>gb|KJB71369.1| hypothetical protein B456_011G118900 [Gossypium raimondii]
Length=1015

 Score =   312 bits (799),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 140/189 (74%), Positives = 165/189 (87%), Gaps = 1/189 (1%)
 Frame = -2

Query  719   GVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLKVW  540
             GVYGK APEDF ADY+HW R + KSYLNGMGINWS++RNVMDM AVYGGFAAALK L +W
Sbjct  828   GVYGKAAPEDFVADYEHWKRGI-KSYLNGMGINWSSIRNVMDMKAVYGGFAAALKGLNLW  886

Query  539   VMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGL  360
             VMN++ I SPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSK+K++C L+ +
Sbjct  887   VMNVIPIRSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKVKKRCKLVSV  946

Query  359   VVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKE  180
             V EVDRILRP GKLIVRD+ +T+ ELE+++ SM +++  TYS   EGLLCVQK+MWRPKE
Sbjct  947   VAEVDRILRPGGKLIVRDNVDTINELEDMVMSMEWEVLKTYSKNKEGLLCVQKSMWRPKE  1006

Query  179   VQTLAYAIA  153
             VQT+ +AI+
Sbjct  1007  VQTVTFAIS  1015



>gb|AAX96340.1| Putative methyltransferase [Oryza sativa Japonica Group]
 gb|AAY23281.1| Putative methyltransferase [Oryza sativa Japonica Group]
Length=197

 Score =   290 bits (741),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 126/185 (68%), Positives = 155/185 (84%), Gaps = 0/185 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGKPAPEDF AD +HW +VV  SYL GMGI+W TVRNVMDM AVYGGFAAAL+D+ 
Sbjct  12   QVGVYGKPAPEDFVADQEHWRKVVRNSYLTGMGIDWKTVRNVMDMRAVYGGFAAALRDMS  71

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V I+SPDTLP+IYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSK+K +C ++
Sbjct  72   VWVMNVVTINSPDTLPVIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSKLKSRCEVL  131

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++VEVDRILRP GKLIVRD  ET+ E++ +++S+ +++RMT S   E +LC +KT WRP
Sbjct  132  PVIVEVDRILRPNGKLIVRDDKETVDEIKGVVRSLQWEVRMTVSKNREAMLCARKTTWRP  191

Query  185  KEVQT  171
             E + 
Sbjct  192  TEAEA  196



>gb|ACN28572.1| unknown [Zea mays]
 gb|AFW84363.1| hypothetical protein ZEAMMB73_169809 [Zea mays]
Length=792

 Score =   307 bits (787),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 136/181 (75%), Positives = 160/181 (88%), Gaps = 0/181 (0%)
 Frame = -2

Query  719  GVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLKVW  540
            GVYGKPA EDF AD  HW RVV+KSY+NGMGI+WS VRNVMDM AVYGGFAAAL+D KVW
Sbjct  608  GVYGKPANEDFEADNAHWKRVVSKSYVNGMGIDWSKVRNVMDMRAVYGGFAAALRDQKVW  667

Query  539  VMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGL  360
            VMNIV IDSPDTLPIIYERGLFGMYHDWCESFSTYPR+YDLLHADHLFSK++++C L  +
Sbjct  668  VMNIVPIDSPDTLPIIYERGLFGMYHDWCESFSTYPRTYDLLHADHLFSKLRKRCKLAAV  727

Query  359  VVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKE  180
              EVDR+LRP+GKLIVRD  +T+ ELE++ KS+ +++RMTY+ G EGLLCV+K+MWRPKE
Sbjct  728  FAEVDRVLRPQGKLIVRDTADTINELESMAKSVQWEVRMTYTKGSEGLLCVEKSMWRPKE  787

Query  179  V  177
            +
Sbjct  788  L  788



>ref|XP_010478312.1| PREDICTED: probable methyltransferase PMT24 isoform X1 [Camelina 
sativa]
 ref|XP_010478313.1| PREDICTED: probable methyltransferase PMT24 isoform X2 [Camelina 
sativa]
 ref|XP_010478314.1| PREDICTED: probable methyltransferase PMT24 isoform X3 [Camelina 
sativa]
Length=769

 Score =   306 bits (785),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 137/191 (72%), Positives = 164/191 (86%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGKPA EDF AD++ W  +V+KSYLNGMGI+WS VRNVMDM AVYGGFAAALKDLK
Sbjct  579  QKGVYGKPAQEDFTADHERWKTIVSKSYLNGMGIDWSYVRNVMDMRAVYGGFAAALKDLK  638

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            +WVMN+V IDSPDTLPIIYERGLFG+YHDWCESFSTYPR+YDLLHADHLFS +K++CNL+
Sbjct  639  LWVMNVVPIDSPDTLPIIYERGLFGIYHDWCESFSTYPRTYDLLHADHLFSSLKKRCNLV  698

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
            G++ EVDRILRPEG  IVRD  ET+ E+E ++KSM +++RMT+S   EGLL VQK+ WRP
Sbjct  699  GVMAEVDRILRPEGTFIVRDDMETIGEIEKMVKSMKWNVRMTHSKDGEGLLSVQKSWWRP  758

Query  185  KEVQTLAYAIA  153
             E +T+  AIA
Sbjct  759  TEAETIQAAIA  769



>ref|XP_010460728.1| PREDICTED: probable methyltransferase PMT24 [Camelina sativa]
 ref|XP_010460729.1| PREDICTED: probable methyltransferase PMT24 [Camelina sativa]
Length=764

 Score =   306 bits (784),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 137/191 (72%), Positives = 164/191 (86%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGKPA EDF AD++ W  +V+KSYLNGMGI+WS VRNVMDM AVYGGFAAALKDLK
Sbjct  574  QKGVYGKPAQEDFTADHERWKTIVSKSYLNGMGIDWSYVRNVMDMRAVYGGFAAALKDLK  633

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            +WVMN+V IDSPDTLPIIYERGLFG+YHDWCESFSTYPR+YDLLHADHLFS +K++CNL+
Sbjct  634  LWVMNVVPIDSPDTLPIIYERGLFGIYHDWCESFSTYPRTYDLLHADHLFSSLKKRCNLV  693

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
            G++ EVDRILRPEG  IVRD  ET+ E+E ++KSM +++RMT+S   EGLL VQK+ WRP
Sbjct  694  GVMAEVDRILRPEGTFIVRDDMETIGEIEKMVKSMKWNVRMTHSKDGEGLLSVQKSWWRP  753

Query  185  KEVQTLAYAIA  153
             E +T+  AIA
Sbjct  754  TEAETIQAAIA  764



>ref|XP_002458871.1| hypothetical protein SORBIDRAFT_03g041910 [Sorghum bicolor]
 gb|EES03991.1| hypothetical protein SORBIDRAFT_03g041910 [Sorghum bicolor]
Length=791

 Score =   307 bits (786),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 136/181 (75%), Positives = 160/181 (88%), Gaps = 0/181 (0%)
 Frame = -2

Query  719  GVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLKVW  540
            GVYGKPA EDF AD  HW RVV+KSY+NGMGI+WS VRNVMDM AVYGGFAAAL+D KVW
Sbjct  607  GVYGKPANEDFEADNAHWKRVVSKSYVNGMGIDWSKVRNVMDMRAVYGGFAAALRDQKVW  666

Query  539  VMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGL  360
            VMNIV IDSPDTLPIIYERGLFGMYHDWCES STYPR+YDLLHADHLFSK+ ++C LM +
Sbjct  667  VMNIVPIDSPDTLPIIYERGLFGMYHDWCESLSTYPRTYDLLHADHLFSKLTKRCKLMAV  726

Query  359  VVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKE  180
              EVDR+LRP+GKLIVRD  +T+ ELE++ KS+ +++RMTY+ G+EGLLCV+K+MWRPKE
Sbjct  727  FAEVDRVLRPQGKLIVRDTADTINELESMAKSLQWEVRMTYTKGNEGLLCVEKSMWRPKE  786

Query  179  V  177
            +
Sbjct  787  L  787



>ref|XP_010527657.1| PREDICTED: probable methyltransferase PMT24 [Tarenaya hassleriana]
Length=790

 Score =   306 bits (785),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 137/191 (72%), Positives = 163/191 (85%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGKPA EDF  DY+ W  +V+KSYLNGMGI+WS+VRNVMDM AVYGGFAAALKDLK
Sbjct  600  QEGVYGKPAEEDFNTDYERWKTIVSKSYLNGMGIDWSSVRNVMDMRAVYGGFAAALKDLK  659

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            +WVMN+V IDS DTLPIIYERGLFGMYHDWCESF+TYPR+YDLLHADHLFS +K++CNL+
Sbjct  660  LWVMNVVPIDSADTLPIIYERGLFGMYHDWCESFNTYPRTYDLLHADHLFSALKKRCNLI  719

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++ EVDRILRP+G  IVRD  ET+ E+E + KSM +++RMTYS  +EGLL VQKT WRP
Sbjct  720  SVMAEVDRILRPQGTFIVRDDVETVGEVERMAKSMKWEVRMTYSKDNEGLLSVQKTFWRP  779

Query  185  KEVQTLAYAIA  153
            KE +T+  AIA
Sbjct  780  KEAETIKSAIA  790



>ref|XP_010906388.1| PREDICTED: probable methyltransferase PMT24 [Elaeis guineensis]
Length=955

 Score =   309 bits (792),  Expect = 8e-95, Method: Composition-based stats.
 Identities = 131/183 (72%), Positives = 160/183 (87%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGKPAP DF +DY+HW RVV KSY+NG GI+WS VRNVMDM AVYGGFAAALKDL 
Sbjct  769  QMGVYGKPAPNDFTSDYEHWKRVVKKSYINGFGIDWSQVRNVMDMRAVYGGFAAALKDLN  828

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V IDSPDTLPIIYERGLFG+YHDWCESFSTYPRSYDLLHADHLFS+IK++C +M
Sbjct  829  VWVMNVVNIDSPDTLPIIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSRIKKRCKIM  888

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++ EVDRILRP GKLIVRD +  ++E+EN+LKS+H+++R+T+S   EG+LC +K+ WRP
Sbjct  889  TVIAEVDRILRPGGKLIVRDESSVVSEVENLLKSLHWEVRLTFSKNKEGILCSEKSDWRP  948

Query  185  KEV  177
            + +
Sbjct  949  ENL  951



>ref|XP_004237701.1| PREDICTED: probable methyltransferase PMT24 [Solanum lycopersicum]
Length=768

 Score =   305 bits (782),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 137/191 (72%), Positives = 162/191 (85%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGK APEDFAADY HW  VV+KSYLN +GINWS+VRNVMDM A+YGGFAAALKDLK
Sbjct  578  QVGVYGKAAPEDFAADYDHWKNVVSKSYLNDLGINWSSVRNVMDMKAIYGGFAAALKDLK  637

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V IDSPDTLPIIY+RGLFG+YHDWCESFSTYPRSYDLLHADHLFS IK++C + 
Sbjct  638  VWVMNVVPIDSPDTLPIIYDRGLFGIYHDWCESFSTYPRSYDLLHADHLFSDIKKRCTIE  697

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             +  EVDRILRPEGKLIVRD+ ET+ E+EN+ +S+ + ++M+YS   EGLL VQK+ WRP
Sbjct  698  SVFAEVDRILRPEGKLIVRDNAETILEIENMARSVKWKVKMSYSKNGEGLLFVQKSFWRP  757

Query  185  KEVQTLAYAIA  153
             + Q +  AIA
Sbjct  758  NQEQIVKSAIA  768



>ref|XP_009602526.1| PREDICTED: probable methyltransferase PMT24 [Nicotiana tomentosiformis]
 ref|XP_009602527.1| PREDICTED: probable methyltransferase PMT24 [Nicotiana tomentosiformis]
Length=767

 Score =   305 bits (782),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 138/191 (72%), Positives = 161/191 (84%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGK AP DFAAD  HW  VV+KSYLNG+GINWS+VRNVMDM AVYGGFAAALKDLK
Sbjct  577  QVGVYGKAAPADFAADNDHWKHVVSKSYLNGLGINWSSVRNVMDMKAVYGGFAAALKDLK  636

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V IDSPDTLPIIYERG FG+YHDWCESFSTYPRSYDLLHADHLFS IK++C ++
Sbjct  637  VWVMNVVPIDSPDTLPIIYERGFFGIYHDWCESFSTYPRSYDLLHADHLFSDIKKRCKIV  696

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             +  EVDRILRPEGKLIVRD+ ET+ E+EN+ +S  + ++M+YS   EGLL VQK+ WRP
Sbjct  697  PVFAEVDRILRPEGKLIVRDNAETILEIENMARSAKWKVKMSYSKDGEGLLFVQKSFWRP  756

Query  185  KEVQTLAYAIA  153
            K+ Q +  AIA
Sbjct  757  KQEQIIKSAIA  767



>ref|XP_007019267.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
 gb|EOY16492.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
Length=837

 Score =   306 bits (785),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 164/190 (86%), Gaps = 0/190 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGK A EDF ADY HW  VV++SYLNGMGINWS+VRNVMDM AVYGGFAAALKDLK
Sbjct  647  QVGVYGKAAQEDFTADYNHWKTVVSQSYLNGMGINWSSVRNVMDMKAVYGGFAAALKDLK  706

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V IDS DTLPIIYERGLFG+YHDWCESF+TYPR+YD+LHADHLFS  K++C L+
Sbjct  707  VWVMNVVPIDSSDTLPIIYERGLFGIYHDWCESFNTYPRTYDVLHADHLFSTTKKRCKLV  766

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++ EVDRILRPEGKLIVRD+ ET++E+E++ KS+ ++IRM YS  +EGLLCV+KT WRP
Sbjct  767  TVIAEVDRILRPEGKLIVRDNGETISEVESLAKSLQWEIRMIYSKDNEGLLCVRKTFWRP  826

Query  185  KEVQTLAYAI  156
             E +T+  +I
Sbjct  827  TEEETIKSSI  836



>gb|AAG51752.1|AC068667_31 unknown protein; 55790-52851 [Arabidopsis thaliana]
Length=768

 Score =   305 bits (781),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 136/191 (71%), Positives = 164/191 (86%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGKPA EDF AD++ W  +V+KSYLNGMGI+WS VRNVMDM AVYGGFAAALKDLK
Sbjct  578  QEGVYGKPAQEDFTADHERWKTIVSKSYLNGMGIDWSYVRNVMDMRAVYGGFAAALKDLK  637

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            +WVMN+V IDSPDTLPIIYERGLFG+YHDWCESFSTYPR+YDLLHADHLFS +K++CNL+
Sbjct  638  LWVMNVVPIDSPDTLPIIYERGLFGIYHDWCESFSTYPRTYDLLHADHLFSSLKKRCNLV  697

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
            G++ EVDRILRP+G  IVRD  ET+ E+E ++KSM +++RMT+S   EGLL VQK+ WRP
Sbjct  698  GVMAEVDRILRPQGTFIVRDDMETIGEIEKMVKSMKWNVRMTHSKDGEGLLSVQKSWWRP  757

Query  185  KEVQTLAYAIA  153
             E +T+  AIA
Sbjct  758  TEAETIQSAIA  768



>ref|XP_002893569.1| hypothetical protein ARALYDRAFT_473159 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69828.1| hypothetical protein ARALYDRAFT_473159 [Arabidopsis lyrata subsp. 
lyrata]
Length=771

 Score =   305 bits (781),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 136/191 (71%), Positives = 164/191 (86%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGKPA EDF AD++ W  +V+KSYLNGMGI+WS VRNVMDM AVYGGFAAALKDLK
Sbjct  581  QEGVYGKPAQEDFTADHERWKTIVSKSYLNGMGIDWSYVRNVMDMRAVYGGFAAALKDLK  640

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            +WVMN+V IDSPDTLPIIYERGLFG+YHDWCESFSTYPR+YDLLHADHLFS +K++CNL+
Sbjct  641  LWVMNVVPIDSPDTLPIIYERGLFGIYHDWCESFSTYPRTYDLLHADHLFSSLKKRCNLV  700

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
            G++ EVDRILRP+G  IVRD  ET+ E+E ++KSM +++RMT+S   EGLL VQK+ WRP
Sbjct  701  GVMAEVDRILRPQGTFIVRDDMETIGEIEKMVKSMKWNVRMTHSKDGEGLLSVQKSWWRP  760

Query  185  KEVQTLAYAIA  153
             E +T+  AIA
Sbjct  761  TEAETIQSAIA  771



>dbj|BAE99079.1| hypothetical protein [Arabidopsis thaliana]
Length=770

 Score =   305 bits (781),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 136/191 (71%), Positives = 164/191 (86%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGKPA EDF AD++ W  +V+KSYLNGMGI+WS VRNVMDM AVYGGFAAALKDLK
Sbjct  580  QEGVYGKPAQEDFTADHERWKTIVSKSYLNGMGIDWSYVRNVMDMRAVYGGFAAALKDLK  639

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            +WVMN+V IDSPDTLPIIYERGLFG+YHDWCESFSTYPR+YDLLHADHLFS +K++CNL+
Sbjct  640  LWVMNVVPIDSPDTLPIIYERGLFGIYHDWCESFSTYPRTYDLLHADHLFSSLKKRCNLV  699

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
            G++ EVDRILRP+G  IVRD  ET+ E+E ++KSM +++RMT+S   EGLL VQK+ WRP
Sbjct  700  GVMAEVDRILRPQGTFIVRDDMETIGEIEKMVKSMKWNVRMTHSKDGEGLLSVQKSWWRP  759

Query  185  KEVQTLAYAIA  153
             E +T+  AIA
Sbjct  760  TEAETIQSAIA  770



>ref|NP_174240.2| putative methyltransferase PMT24 [Arabidopsis thaliana]
 ref|NP_001031109.1| putative methyltransferase PMT24 [Arabidopsis thaliana]
 sp|Q6NPR7.1|PMTO_ARATH RecName: Full=Probable methyltransferase PMT24 [Arabidopsis thaliana]
 gb|AAR23721.1| At1g29470 [Arabidopsis thaliana]
 gb|AEE31093.1| putative methyltransferase PMT24 [Arabidopsis thaliana]
 gb|AEE31094.1| putative methyltransferase PMT24 [Arabidopsis thaliana]
Length=770

 Score =   305 bits (781),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 136/191 (71%), Positives = 164/191 (86%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGKPA EDF AD++ W  +V+KSYLNGMGI+WS VRNVMDM AVYGGFAAALKDLK
Sbjct  580  QEGVYGKPAQEDFTADHERWKTIVSKSYLNGMGIDWSYVRNVMDMRAVYGGFAAALKDLK  639

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            +WVMN+V IDSPDTLPIIYERGLFG+YHDWCESFSTYPR+YDLLHADHLFS +K++CNL+
Sbjct  640  LWVMNVVPIDSPDTLPIIYERGLFGIYHDWCESFSTYPRTYDLLHADHLFSSLKKRCNLV  699

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
            G++ EVDRILRP+G  IVRD  ET+ E+E ++KSM +++RMT+S   EGLL VQK+ WRP
Sbjct  700  GVMAEVDRILRPQGTFIVRDDMETIGEIEKMVKSMKWNVRMTHSKDGEGLLSVQKSWWRP  759

Query  185  KEVQTLAYAIA  153
             E +T+  AIA
Sbjct  760  TEAETIQSAIA  770



>ref|XP_006365916.1| PREDICTED: probable methyltransferase PMT24-like [Solanum tuberosum]
Length=768

 Score =   305 bits (780),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 137/191 (72%), Positives = 162/191 (85%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGK APEDFAADY HW  VV+KSYLN +GINWS+VRNVMDM A+YGGFAAALKDLK
Sbjct  578  QVGVYGKAAPEDFAADYDHWKHVVSKSYLNDLGINWSSVRNVMDMKAIYGGFAAALKDLK  637

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V IDSPDTLPIIY+RGLFG+YHDWCESFSTYPRSYDLLHADHLFS IK++C + 
Sbjct  638  VWVMNVVPIDSPDTLPIIYDRGLFGIYHDWCESFSTYPRSYDLLHADHLFSDIKKRCTIE  697

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             +  EVDRILRPEGKLIVRD+ ET+ E+EN+ +S+ + ++M+YS   EGLL VQK+ WRP
Sbjct  698  SVFAEVDRILRPEGKLIVRDNAETILEIENMARSVKWKVKMSYSKDGEGLLFVQKSFWRP  757

Query  185  KEVQTLAYAIA  153
             + Q +  AIA
Sbjct  758  NQEQIVKSAIA  768



>emb|CDY48339.1| BnaA09g26820D [Brassica napus]
Length=756

 Score =   304 bits (779),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 135/189 (71%), Positives = 163/189 (86%), Gaps = 0/189 (0%)
 Frame = -2

Query  719  GVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLKVW  540
            GVYGKPA EDF AD++ W  +V+KSYLNGMGI+WS VRNVMDM AVYGGFAAALKDLK+W
Sbjct  563  GVYGKPAQEDFTADHERWKSIVSKSYLNGMGIDWSNVRNVMDMRAVYGGFAAALKDLKLW  622

Query  539  VMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGL  360
            VMN+V IDSPDTLPIIYERGLFG+YHDWCESFSTYPR+YDLLHADHLFS +K++CNL+ +
Sbjct  623  VMNVVPIDSPDTLPIIYERGLFGIYHDWCESFSTYPRTYDLLHADHLFSSLKKRCNLVSV  682

Query  359  VVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKE  180
            + EVDRILRP+G  IVRD +ET+ E+E ++KS+ +D+RMT S   EG+L VQK+ WRP E
Sbjct  683  MAEVDRILRPQGTFIVRDDSETIGEIEKMVKSLKWDVRMTQSKDGEGVLAVQKSWWRPTE  742

Query  179  VQTLAYAIA  153
            V+T+  AIA
Sbjct  743  VETITSAIA  751



>emb|CDX99828.1| BnaC05g22500D [Brassica napus]
Length=750

 Score =   304 bits (778),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 135/189 (71%), Positives = 162/189 (86%), Gaps = 0/189 (0%)
 Frame = -2

Query  719  GVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLKVW  540
            GVYGKPA EDF AD++ W  +V+KSYLNGMGI+WS VRNVMDM AVYGGFAAALKDLK+W
Sbjct  557  GVYGKPAQEDFTADHERWKTIVSKSYLNGMGIDWSNVRNVMDMRAVYGGFAAALKDLKLW  616

Query  539  VMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGL  360
            VMN+V IDSPDTLPIIYERGLFG+YHDWCESFSTYPR+YDLLHADHLFS +K++CNL  +
Sbjct  617  VMNVVPIDSPDTLPIIYERGLFGIYHDWCESFSTYPRTYDLLHADHLFSSLKKRCNLASV  676

Query  359  VVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKE  180
            + EVDRILRP+G  IVRD +ET+ E+E ++KS+ +D+RMT S   EG+L VQK+ WRP E
Sbjct  677  MAEVDRILRPQGTFIVRDDSETIGEIEKMVKSLKWDVRMTQSKDGEGVLAVQKSWWRPTE  736

Query  179  VQTLAYAIA  153
            V+T+  AIA
Sbjct  737  VETITSAIA  745



>gb|EMS56319.1| putative methyltransferase PMT26 [Triticum urartu]
Length=953

 Score =   308 bits (789),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 133/180 (74%), Positives = 166/180 (92%), Gaps = 0/180 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            ETGVYGKPAPEDF ADY+HW RV++ SY+ G+GI+WS VRN+MDM AVYGGFAAAL+++K
Sbjct  769  ETGVYGKPAPEDFQADYEHWKRVISNSYMEGLGIDWSAVRNIMDMKAVYGGFAAALRNMK  828

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V IDSPDTLPIIYERGLFG+YHDWCESFSTYPRSYDL+HA+HLFSKIK++C ++
Sbjct  829  VWVMNVVPIDSPDTLPIIYERGLFGLYHDWCESFSTYPRSYDLVHANHLFSKIKKRCEVL  888

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
            G++VEVDRI+RPEG+LIVRD  ET+ E+E+I+KS+H+++R++YS  +EGLL VQKTMWRP
Sbjct  889  GVIVEVDRIVRPEGRLIVRDDMETIREVESIVKSLHWEVRLSYSQDNEGLLFVQKTMWRP  948



>ref|XP_007199628.1| hypothetical protein PRUPE_ppa001750mg [Prunus persica]
 gb|EMJ00827.1| hypothetical protein PRUPE_ppa001750mg [Prunus persica]
Length=771

 Score =   304 bits (779),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 136/188 (72%), Positives = 164/188 (87%), Gaps = 0/188 (0%)
 Frame = -2

Query  716  VYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLKVWV  537
            V GK APEDF +DYKHW +VV+++YLNGMGINWS+VRNVMDM AVYGGFAAALKDLKVWV
Sbjct  584  VDGKSAPEDFISDYKHWKKVVSETYLNGMGINWSSVRNVMDMRAVYGGFAAALKDLKVWV  643

Query  536  MNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLV  357
            MN+V +DS DTLPII+ERGL G+YHDWCESFSTYPR+YDLLHADHLFS +K++CNL+ ++
Sbjct  644  MNVVPVDSRDTLPIIFERGLTGIYHDWCESFSTYPRTYDLLHADHLFSVLKKRCNLVAVI  703

Query  356  VEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEV  177
             EVDRILRPEGKLI+ D+ ETL E+E++ KS+ +DIR TYS  +EGLLC+QKT WRP E 
Sbjct  704  AEVDRILRPEGKLIIWDNAETLNEVESMAKSLQWDIRFTYSKDNEGLLCIQKTFWRPAEK  763

Query  176  QTLAYAIA  153
            +T+  AIA
Sbjct  764  ETILSAIA  771



>ref|XP_006847154.1| hypothetical protein AMTR_s00017p00240980 [Amborella trichopoda]
 gb|ERN08735.1| hypothetical protein AMTR_s00017p00240980 [Amborella trichopoda]
Length=850

 Score =   305 bits (781),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 136/182 (75%), Positives = 160/182 (88%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGK A EDF  DYKHW RVV+ SYLNG+GI+WS VRNVMDM AVYGGFAAAL+D++
Sbjct  651  QVGVYGKAAAEDFTVDYKHWKRVVSNSYLNGLGISWSKVRNVMDMRAVYGGFAAALRDIQ  710

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V IDSPDTLPIIYERGLFG+YHDWCESFSTYPR+YDLLHADHLFSK+K +CNL 
Sbjct  711  VWVMNVVPIDSPDTLPIIYERGLFGIYHDWCESFSTYPRTYDLLHADHLFSKLKTRCNLE  770

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
            G++VE DRILRPEGK+IVRD  +T+ E+E ILKSMH+D+R+TY+   E LL V+K+MWRP
Sbjct  771  GVLVEADRILRPEGKMIVRDAGDTVAEVEKILKSMHWDVRLTYTKDKEALLVVKKSMWRP  830

Query  185  KE  180
            KE
Sbjct  831  KE  832



>ref|XP_009383568.1| PREDICTED: probable methyltransferase PMT26 [Musa acuminata subsp. 
malaccensis]
Length=883

 Score =   306 bits (783),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 134/185 (72%), Positives = 162/185 (88%), Gaps = 0/185 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYG+PAPEDF AD + W  +V+KSY+ G+GINWS VRNVMDM AVYGGFAAAL++  
Sbjct  693  QVGVYGRPAPEDFKADTELWKHIVSKSYMKGLGINWSAVRNVMDMRAVYGGFAAALQEAN  752

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
             W+MNIV+IDSPDTLP+IYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIK++C L 
Sbjct  753  AWIMNIVSIDSPDTLPLIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKKRCKLR  812

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++ EVDRILRPEGKLIVRD++ET+ E+E++ KS+ +++RMTYS  +EGLL VQKTMWRP
Sbjct  813  AVIAEVDRILRPEGKLIVRDNSETIEEVESMAKSLKWEVRMTYSKENEGLLFVQKTMWRP  872

Query  185  KEVQT  171
            KEV+ 
Sbjct  873  KEVEA  877



>ref|XP_006828886.1| hypothetical protein AMTR_s00001p00185010 [Amborella trichopoda]
 gb|ERM96302.1| hypothetical protein AMTR_s00001p00185010 [Amborella trichopoda]
Length=918

 Score =   306 bits (783),  Expect = 9e-94, Method: Composition-based stats.
 Identities = 126/181 (70%), Positives = 162/181 (90%), Gaps = 0/181 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGKP P+DF ADYKHW RVV+KSY++G+GI+WS+VRNVMDM AVYGGFAAAL ++K
Sbjct  732  QIGVYGKPVPDDFVADYKHWKRVVSKSYISGLGISWSSVRNVMDMRAVYGGFAAALSEMK  791

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V +DSPDTLPIIYERGLFG+YHDWCESFSTYPR+YDLLHADHLFS++ ++CNL+
Sbjct  792  VWVMNVVNVDSPDTLPIIYERGLFGIYHDWCESFSTYPRTYDLLHADHLFSRLDKRCNLV  851

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
            G++ EVDRILRP G +IVRD + T++E+EN+ KS+H+++ +T+S   EG+LC +KTMWRP
Sbjct  852  GVMTEVDRILRPGGTIIVRDESATVSEVENLAKSLHWEVSLTFSKDKEGMLCAKKTMWRP  911

Query  185  K  183
            +
Sbjct  912  E  912



>ref|XP_010547883.1| PREDICTED: probable methyltransferase PMT26 [Tarenaya hassleriana]
Length=706

 Score =   301 bits (772),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 131/189 (69%), Positives = 162/189 (86%), Gaps = 0/189 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GV+ KP PEDF ADY+HW RVVT+SYLNG+GI+WS++RNVMDM A YGGFAAAL+DL 
Sbjct  516  QVGVFSKPGPEDFTADYEHWKRVVTESYLNGLGIDWSSIRNVMDMQAFYGGFAAALRDLD  575

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V IDS DTLPIIYERGLFG+YHDWCESFSTYPR+YDL+HADH+FS IK +CN +
Sbjct  576  VWVMNVVPIDSADTLPIIYERGLFGIYHDWCESFSTYPRTYDLVHADHIFSAIKNRCNFV  635

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++ EVDR+LRP+G LIVRD+ ET+ ELE +++SM++++RMTYS  +EGLLCVQKT WRP
Sbjct  636  AVLAEVDRMLRPDGNLIVRDNVETINELEALVRSMNWEVRMTYSMDEEGLLCVQKTFWRP  695

Query  185  KEVQTLAYA  159
             +   L YA
Sbjct  696  TDSVQLPYA  704



>ref|XP_008244575.1| PREDICTED: probable methyltransferase PMT24 [Prunus mume]
Length=815

 Score =   304 bits (778),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 135/188 (72%), Positives = 164/188 (87%), Gaps = 0/188 (0%)
 Frame = -2

Query  716  VYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLKVWV  537
            V G+ APEDF +DYKHW +VV+++YLNGMGINWS+VRNVMDM AVYGGFAAALKDLKVWV
Sbjct  628  VDGRSAPEDFISDYKHWKKVVSETYLNGMGINWSSVRNVMDMRAVYGGFAAALKDLKVWV  687

Query  536  MNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLV  357
            MN+V +DS DTLPII+ERGL G+YHDWCESFSTYPR+YDLLHADHLFS +K++CNL+ ++
Sbjct  688  MNVVPVDSRDTLPIIFERGLTGIYHDWCESFSTYPRTYDLLHADHLFSVLKKRCNLVAVI  747

Query  356  VEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEV  177
             EVDRILRPEGKLI+ D+ ETL E+E++ KS+ +DIR TYS  +EGLLC+QKT WRP E 
Sbjct  748  AEVDRILRPEGKLIIWDNAETLNEVESMAKSLQWDIRFTYSKDNEGLLCIQKTFWRPAER  807

Query  176  QTLAYAIA  153
            +T+  AIA
Sbjct  808  ETILSAIA  815



>emb|CDX90190.1| BnaA08g17940D [Brassica napus]
Length=687

 Score =   301 bits (770),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 135/191 (71%), Positives = 164/191 (86%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGKPA EDF AD++ W  +V+KSYLNGMGI+WS VRNVMDM AVYGGFAAALKDLK
Sbjct  497  QEGVYGKPAQEDFTADHERWKNIVSKSYLNGMGIDWSYVRNVMDMRAVYGGFAAALKDLK  556

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            +WVMN+V IDS DTLPIIYERGLFG+YHDWCESFSTYPR+YDLLHADHLFS +K++CNL+
Sbjct  557  LWVMNVVPIDSADTLPIIYERGLFGIYHDWCESFSTYPRTYDLLHADHLFSALKKRCNLV  616

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++ EVDRILRP+G  IVRD +ET+ E+E ++KSM +++ MT+S G EGLL VQK+ WRP
Sbjct  617  SVMAEVDRILRPQGTFIVRDDSETVGEIEKMVKSMKWNVTMTHSKGGEGLLSVQKSWWRP  676

Query  185  KEVQTLAYAIA  153
             EV+T+  AIA
Sbjct  677  TEVETITSAIA  687



>tpg|DAA55524.1| TPA: hypothetical protein ZEAMMB73_749730 [Zea mays]
Length=1062

 Score =   308 bits (789),  Expect = 1e-93, Method: Composition-based stats.
 Identities = 130/187 (70%), Positives = 161/187 (86%), Gaps = 0/187 (0%)
 Frame = -2

Query  725   ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
             +TGVYGKPAP DFAAD +HW +VV  SY +GMGI+W  VRNVMDM AVYGGFAAAL D+K
Sbjct  876   QTGVYGKPAPADFAADQEHWRKVVDNSYRDGMGIDWKNVRNVMDMRAVYGGFAAALSDMK  935

Query  545   VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
             VWVMN+V +DSPDTLP+IYERGLFGMYHDWCESFSTYPRSYDL+HA+HLFSK+K +C L+
Sbjct  936   VWVMNVVTVDSPDTLPVIYERGLFGMYHDWCESFSTYPRSYDLVHANHLFSKLKSRCKLL  995

Query  365   GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
              ++ EVDR+LRPEGKLIVRD   T+ E+++I +S+H+++RMT S   +GLLCV+KTMWRP
Sbjct  996   PVIAEVDRVLRPEGKLIVRDDMATVKEVQSIARSLHWEVRMTVSKQGQGLLCVRKTMWRP  1055

Query  185   KEVQTLA  165
              +V+ L+
Sbjct  1056  TQVEALS  1062



>ref|XP_008674424.1| PREDICTED: probable methyltransferase PMT26 [Zea mays]
 ref|XP_008674425.1| PREDICTED: probable methyltransferase PMT26 [Zea mays]
 ref|XP_008674426.1| PREDICTED: probable methyltransferase PMT26 [Zea mays]
Length=1040

 Score =   308 bits (788),  Expect = 1e-93, Method: Composition-based stats.
 Identities = 130/187 (70%), Positives = 161/187 (86%), Gaps = 0/187 (0%)
 Frame = -2

Query  725   ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
             +TGVYGKPAP DFAAD +HW +VV  SY +GMGI+W  VRNVMDM AVYGGFAAAL D+K
Sbjct  854   QTGVYGKPAPADFAADQEHWRKVVDNSYRDGMGIDWKNVRNVMDMRAVYGGFAAALSDMK  913

Query  545   VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
             VWVMN+V +DSPDTLP+IYERGLFGMYHDWCESFSTYPRSYDL+HA+HLFSK+K +C L+
Sbjct  914   VWVMNVVTVDSPDTLPVIYERGLFGMYHDWCESFSTYPRSYDLVHANHLFSKLKSRCKLL  973

Query  365   GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
              ++ EVDR+LRPEGKLIVRD   T+ E+++I +S+H+++RMT S   +GLLCV+KTMWRP
Sbjct  974   PVIAEVDRVLRPEGKLIVRDDMATVKEVQSIARSLHWEVRMTVSKQGQGLLCVRKTMWRP  1033

Query  185   KEVQTLA  165
              +V+ L+
Sbjct  1034  TQVEALS  1040



>ref|XP_009115236.1| PREDICTED: probable methyltransferase PMT24 isoform X1 [Brassica 
rapa]
Length=753

 Score =   302 bits (774),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 134/189 (71%), Positives = 163/189 (86%), Gaps = 0/189 (0%)
 Frame = -2

Query  719  GVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLKVW  540
            GVYGKPA EDF AD++ W  +V+KSYLNGMGI+WS VRNVMDM AVYGGFAAALKDLK+W
Sbjct  563  GVYGKPAEEDFTADHERWKSIVSKSYLNGMGIDWSYVRNVMDMRAVYGGFAAALKDLKLW  622

Query  539  VMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGL  360
            VMN+V IDSPDTLP+IYERGLFG+YHDWCESFSTYPR+YDLLHADHLFS +K++CNL+ +
Sbjct  623  VMNVVPIDSPDTLPVIYERGLFGIYHDWCESFSTYPRTYDLLHADHLFSSLKKRCNLVSV  682

Query  359  VVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKE  180
            + EVDRILRP+G  IVRD +ET+ E+E ++KS+ +D+RMT S   EG+L VQK+ WRP E
Sbjct  683  MAEVDRILRPQGTFIVRDDSETIGEIEKMVKSLKWDVRMTQSKDGEGVLAVQKSWWRPTE  742

Query  179  VQTLAYAIA  153
            V+T+  AIA
Sbjct  743  VETITSAIA  751



>ref|XP_009115237.1| PREDICTED: probable methyltransferase PMT24 isoform X2 [Brassica 
rapa]
Length=725

 Score =   301 bits (772),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 134/189 (71%), Positives = 163/189 (86%), Gaps = 0/189 (0%)
 Frame = -2

Query  719  GVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLKVW  540
            GVYGKPA EDF AD++ W  +V+KSYLNGMGI+WS VRNVMDM AVYGGFAAALKDLK+W
Sbjct  535  GVYGKPAEEDFTADHERWKSIVSKSYLNGMGIDWSYVRNVMDMRAVYGGFAAALKDLKLW  594

Query  539  VMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGL  360
            VMN+V IDSPDTLP+IYERGLFG+YHDWCESFSTYPR+YDLLHADHLFS +K++CNL+ +
Sbjct  595  VMNVVPIDSPDTLPVIYERGLFGIYHDWCESFSTYPRTYDLLHADHLFSSLKKRCNLVSV  654

Query  359  VVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKE  180
            + EVDRILRP+G  IVRD +ET+ E+E ++KS+ +D+RMT S   EG+L VQK+ WRP E
Sbjct  655  MAEVDRILRPQGTFIVRDDSETIGEIEKMVKSLKWDVRMTQSKDGEGVLAVQKSWWRPTE  714

Query  179  VQTLAYAIA  153
            V+T+  AIA
Sbjct  715  VETITSAIA  723



>gb|AAP72961.1| putative ankyrin-like protein [Lactuca sativa]
Length=721

 Score =   301 bits (771),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 128/177 (72%), Positives = 161/177 (91%), Gaps = 0/177 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            E+GVYGKPAPEDF ADY+HW RVV+KSYLNG+GI+WS++RN+MDM ++YGGFAAALKDL 
Sbjct  541  ESGVYGKPAPEDFTADYEHWKRVVSKSYLNGLGIDWSSIRNIMDMRSIYGGFAAALKDLN  600

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V +DSPDTLPIIYERGLFG+YH+WCESFSTYPRSYDLLHADHLFS +K++C L 
Sbjct  601  VWVMNVVPLDSPDTLPIIYERGLFGIYHNWCESFSTYPRSYDLLHADHLFSDLKKRCKLA  660

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTM  195
             ++ EVDRILRPEGKLIVRD+ ET+ E+EN+ KS+H+++R++Y+  +EGLLCV+K +
Sbjct  661  SVIAEVDRILRPEGKLIVRDNVETIAEVENMAKSLHWNVRLSYNKDNEGLLCVEKNI  717



>ref|XP_002442915.1| hypothetical protein SORBIDRAFT_08g004870 [Sorghum bicolor]
 gb|EES16753.1| hypothetical protein SORBIDRAFT_08g004870 [Sorghum bicolor]
Length=1067

 Score =   307 bits (787),  Expect = 2e-93, Method: Composition-based stats.
 Identities = 130/184 (71%), Positives = 161/184 (88%), Gaps = 0/184 (0%)
 Frame = -2

Query  725   ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
             + GVYGKPAP DFAAD +HW +VV  SYL+GMGI+W  VRNVMDM AVYGGFAAAL+D+K
Sbjct  883   QVGVYGKPAPADFAADQQHWRKVVDNSYLHGMGIDWKNVRNVMDMRAVYGGFAAALRDMK  942

Query  545   VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
             VWVMN+V +DSPDTLPIIYERGLFGMYHDWCESFSTYPR+YDL+HADHLFSK+K +C L+
Sbjct  943   VWVMNVVTVDSPDTLPIIYERGLFGMYHDWCESFSTYPRTYDLVHADHLFSKLKSRCKLL  1002

Query  365   GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
              ++ EVDR+LRPEGKLIVRD   T+ E++++++S+H+++RMT S   +GLLCV+KTMWRP
Sbjct  1003  PVIAEVDRMLRPEGKLIVRDDKATVEEVQSMVRSLHWEVRMTVSKQGQGLLCVRKTMWRP  1062

Query  185   KEVQ  174
              EV+
Sbjct  1063  TEVE  1066



>ref|XP_010271514.1| PREDICTED: probable methyltransferase PMT27 [Nelumbo nucifera]
Length=983

 Score =   306 bits (783),  Expect = 2e-93, Method: Composition-based stats.
 Identities = 129/180 (72%), Positives = 159/180 (88%), Gaps = 0/180 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGKPAP+DF+ADY+HW RVVTKSYL G+GI+WS VRNVMDM AVYGGFAAAL+DL+
Sbjct  797  QMGVYGKPAPDDFSADYEHWKRVVTKSYLTGLGISWSNVRNVMDMRAVYGGFAAALRDLQ  856

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWV+N+V IDSPDTLPIIYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSK+K++C L 
Sbjct  857  VWVLNVVNIDSPDTLPIIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSKLKKRCKLA  916

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++ E+DRI++P GKLI+RD + T+ E+ENILKS+H++I +T+S   EG+L  QK+ WRP
Sbjct  917  PVIAEIDRIVKPGGKLIIRDDSTTMREIENILKSLHWEIHLTFSKNKEGILSAQKSDWRP  976



>ref|XP_010679252.1| PREDICTED: probable methyltransferase PMT26 [Beta vulgaris subsp. 
vulgaris]
Length=788

 Score =   302 bits (773),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 130/191 (68%), Positives = 165/191 (86%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            ETGVYGK AP+DF +DYKHW RVV+ SY++G+GI+WS+VRNVMDM A+YGGFAAALKDLK
Sbjct  598  ETGVYGKSAPKDFISDYKHWKRVVSDSYMDGIGIDWSSVRNVMDMRAIYGGFAAALKDLK  657

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V + S DTLPIIYERGLFG+YH+WCESF+TYPR+YDLLHADHLFS +K++CN +
Sbjct  658  VWVMNVVPVTSSDTLPIIYERGLFGIYHNWCESFNTYPRTYDLLHADHLFSDLKKRCNFV  717

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++ E DRILRP+G LIVRD+ ET+ E+E++ KS+ + IR ++S  +EGLLCVQKT WRP
Sbjct  718  AVMAEADRILRPQGSLIVRDNAETVAEVESMAKSLQWKIRFSFSKDNEGLLCVQKTRWRP  777

Query  185  KEVQTLAYAIA  153
             +V+T+  AIA
Sbjct  778  SDVETITSAIA  788



>ref|XP_003580900.1| PREDICTED: probable methyltransferase PMT26 [Brachypodium distachyon]
Length=716

 Score =   300 bits (767),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 130/180 (72%), Positives = 160/180 (89%), Gaps = 0/180 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            E GVYGKPAPEDF ADY HW RV++ SY++G+GI+WS VRNVMDMNAVYGGFAAAL+D+K
Sbjct  533  EPGVYGKPAPEDFEADYDHWKRVISNSYMDGLGIDWSAVRNVMDMNAVYGGFAAALRDVK  592

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V IDSPDTL IIYERGLFG+YHDWCESFSTYPRSYDL+HADH+FSK+K++C L+
Sbjct  593  VWVMNVVPIDSPDTLAIIYERGLFGLYHDWCESFSTYPRSYDLVHADHIFSKVKKRCGLL  652

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++VEVDR+ RPEG+LIVRD  ET+ E+ +I +S+H+++R++YS   EGLL VQKTMWRP
Sbjct  653  SVIVEVDRMARPEGRLIVRDDMETINEVRSIAESLHWEVRLSYSQEKEGLLFVQKTMWRP  712



>gb|EAY82457.1| hypothetical protein OsI_37674 [Oryza sativa Indica Group]
Length=932

 Score =   304 bits (778),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 136/187 (73%), Positives = 162/187 (87%), Gaps = 0/187 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGKPAP+DFAAD +HW+ VV  SYL G+GI+WS VRNVMDM AVYGGFAAALKD+ 
Sbjct  742  QVGVYGKPAPDDFAADEEHWNHVVNSSYLAGVGIDWSNVRNVMDMRAVYGGFAAALKDMN  801

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V +DS DTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSK+K++C L+
Sbjct  802  VWVMNVVPVDSADTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKLKKRCKLL  861

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++VEVDRILRPEGKLIVRD  +T  E+E+IL+S+H+++RMT S   E +LC +KTMWRP
Sbjct  862  PVMVEVDRILRPEGKLIVRDGRDTAAEVESILRSLHWEVRMTVSKQGEVMLCAEKTMWRP  921

Query  185  KEVQTLA  165
            KEV+  A
Sbjct  922  KEVEKAA  928



>gb|ABA96619.1| dehydration-responsive protein, putative [Oryza sativa Japonica 
Group]
Length=990

 Score =   305 bits (781),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 136/187 (73%), Positives = 162/187 (87%), Gaps = 0/187 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGKPAP+DFAAD +HW+ VV  SYL G+GI+WS VRNVMDM AVYGGFAAALKD+ 
Sbjct  800  QVGVYGKPAPDDFAADEEHWNHVVNSSYLAGVGIDWSNVRNVMDMRAVYGGFAAALKDMN  859

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V +DS DTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSK+K++C L+
Sbjct  860  VWVMNVVPVDSADTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKLKKRCKLL  919

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++VEVDRILRPEGKLIVRD  +T  E+E+IL+S+H+++RMT S   E +LC +KTMWRP
Sbjct  920  PVMVEVDRILRPEGKLIVRDGRDTAAEVESILRSLHWEVRMTVSKQGEVMLCAEKTMWRP  979

Query  185  KEVQTLA  165
            KEV+  A
Sbjct  980  KEVEKAA  986



>gb|EAZ19833.1| hypothetical protein OsJ_35417 [Oryza sativa Japonica Group]
Length=990

 Score =   305 bits (781),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 136/187 (73%), Positives = 162/187 (87%), Gaps = 0/187 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGKPAP+DFAAD +HW+ VV  SYL G+GI+WS VRNVMDM AVYGGFAAALKD+ 
Sbjct  800  QVGVYGKPAPDDFAADEEHWNHVVNSSYLAGVGIDWSNVRNVMDMRAVYGGFAAALKDMN  859

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V +DS DTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSK+K++C L+
Sbjct  860  VWVMNVVPVDSADTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKLKKRCKLL  919

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++VEVDRILRPEGKLIVRD  +T  E+E+IL+S+H+++RMT S   E +LC +KTMWRP
Sbjct  920  PVMVEVDRILRPEGKLIVRDGRDTAAEVESILRSLHWEVRMTVSKQGEVMLCAEKTMWRP  979

Query  185  KEVQTLA  165
            KEV+  A
Sbjct  980  KEVEKAA  986



>ref|XP_006415572.1| hypothetical protein EUTSA_v10006884mg [Eutrema salsugineum]
 gb|ESQ33925.1| hypothetical protein EUTSA_v10006884mg [Eutrema salsugineum]
Length=761

 Score =   301 bits (770),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 134/191 (70%), Positives = 163/191 (85%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGKPA EDF AD+K W  +V+KSYLNGMGI+WS VRNVMDM AVYGGFAAALKD+K
Sbjct  571  QEGVYGKPAQEDFTADHKRWKSIVSKSYLNGMGIDWSYVRNVMDMRAVYGGFAAALKDMK  630

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            +WVMN+V IDSPDTLPIIYERGLFG+YHDWCESFSTYPR+YDLLHADHLFS +K++C+L+
Sbjct  631  LWVMNVVPIDSPDTLPIIYERGLFGIYHDWCESFSTYPRTYDLLHADHLFSALKKRCSLV  690

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++ EVDRILRP+G  IVRD  ET+ E+E ++KSM +++RMT+S   EGLL VQK+ WRP
Sbjct  691  SVMAEVDRILRPQGTFIVRDDMETIGEIEKMVKSMKWNVRMTHSKDGEGLLSVQKSWWRP  750

Query  185  KEVQTLAYAIA  153
             E +T+  AIA
Sbjct  751  TEAETIKSAIA  761



>ref|XP_009109665.1| PREDICTED: probable methyltransferase PMT24 [Brassica rapa]
 ref|XP_009109666.1| PREDICTED: probable methyltransferase PMT24 [Brassica rapa]
Length=682

 Score =   298 bits (763),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 134/191 (70%), Positives = 162/191 (85%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGKPA EDF  D++ W   V+KSYLNGMGI+WS VRNVMDM AVYGGFAAALKDLK
Sbjct  492  QEGVYGKPAQEDFTTDHERWKNTVSKSYLNGMGIDWSYVRNVMDMRAVYGGFAAALKDLK  551

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            +WVMN+V IDS DTLPIIYERGLFG+YHDWCESFSTYPR+YDLLHADHLFS +K++CNL+
Sbjct  552  LWVMNVVPIDSADTLPIIYERGLFGIYHDWCESFSTYPRTYDLLHADHLFSALKKRCNLV  611

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++ EVDRILRP+G  IVRD +ET+ E+E ++KSM +++ MT+S G EGLL VQK+ WRP
Sbjct  612  SVMAEVDRILRPQGTFIVRDDSETVGEIEKMVKSMKWNVTMTHSKGGEGLLSVQKSWWRP  671

Query  185  KEVQTLAYAIA  153
             EV+T+  AIA
Sbjct  672  TEVETITSAIA  682



>ref|XP_004171289.1| PREDICTED: probable methyltransferase PMT27-like, partial [Cucumis 
sativus]
Length=296

 Score =   286 bits (732),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 125/180 (69%), Positives = 155/180 (86%), Gaps = 0/180 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGKPAP+DF+ DY+HW RVV K+Y+NG+GIN S +RNVMDM +VYGGFAAAL+DLK
Sbjct  110  QMGVYGKPAPQDFSTDYEHWKRVVNKTYMNGLGINLSNIRNVMDMRSVYGGFAAALRDLK  169

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V IDSPDTLP+IYERGLFG+YHDWCESFSTYPR+YDLLHADHLFSK+K++C L 
Sbjct  170  VWVMNVVNIDSPDTLPVIYERGLFGIYHDWCESFSTYPRTYDLLHADHLFSKLKKRCKLQ  229

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++ EVDRI+RP GKLIVRD + T+ E+EN+LKS+ +++ +T+S   EGLL  QK  WRP
Sbjct  230  PVLAEVDRIVRPGGKLIVRDESSTIGEVENLLKSLRWEVHLTFSKNQEGLLSAQKGDWRP  289



>ref|XP_010533385.1| PREDICTED: probable methyltransferase PMT24 [Tarenaya hassleriana]
Length=783

 Score =   300 bits (768),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 132/190 (69%), Positives = 161/190 (85%), Gaps = 0/190 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGKPA EDF  DY+ W  +++KSYLNGMGI+WS+VRNVMDM AVYGGFAAALKDLK
Sbjct  593  QEGVYGKPAEEDFNTDYERWKTIISKSYLNGMGIDWSSVRNVMDMRAVYGGFAAALKDLK  652

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            +WVMN+V IDS DTLPIIYERGLFG+YHDWCESF+TYPR+YDLLHAD LFS +K++CNL+
Sbjct  653  LWVMNVVPIDSADTLPIIYERGLFGIYHDWCESFNTYPRTYDLLHADRLFSALKKRCNLI  712

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++ EVDRILRP+G  IVRD  ET+ E+E I+KSM +++RM YS  DEGL+ VQK+ WRP
Sbjct  713  PVMAEVDRILRPQGTFIVRDDVETINEIERIVKSMKWEVRMMYSKDDEGLISVQKSFWRP  772

Query  185  KEVQTLAYAI  156
            KE +T+  AI
Sbjct  773  KEAETIDSAI  782



>ref|XP_009366818.1| PREDICTED: probable methyltransferase PMT24 [Pyrus x bretschneideri]
 ref|XP_009366819.1| PREDICTED: probable methyltransferase PMT24 [Pyrus x bretschneideri]
Length=805

 Score =   300 bits (768),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 134/188 (71%), Positives = 160/188 (85%), Gaps = 0/188 (0%)
 Frame = -2

Query  716  VYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLKVWV  537
            V GK APEDF +DY HW +VV+++YLNGMGINWSTVRNVMDM AVYGGFAAALKDLKVWV
Sbjct  618  VNGKSAPEDFVSDYNHWKKVVSETYLNGMGINWSTVRNVMDMRAVYGGFAAALKDLKVWV  677

Query  536  MNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLV  357
            MN+V +DS DTLPIIYERG  G+YHDWCESFSTYPRSYDLLHADHLFS +K++C+L+  +
Sbjct  678  MNVVPVDSRDTLPIIYERGFIGIYHDWCESFSTYPRSYDLLHADHLFSVLKKRCSLVAAI  737

Query  356  VEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEV  177
             EVDRILRPEGKLIV D+ ETL E+E++ KS+ ++IR TYS  +EGLLC+QKT WRP + 
Sbjct  738  AEVDRILRPEGKLIVWDNAETLNEIESLAKSLQWNIRFTYSKDNEGLLCIQKTFWRPADK  797

Query  176  QTLAYAIA  153
            + +  AIA
Sbjct  798  EKILSAIA  805



>gb|KHN44285.1| Putative methyltransferase PMT25 [Glycine soja]
Length=797

 Score =   300 bits (767),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 133/193 (69%), Positives = 163/193 (84%), Gaps = 2/193 (1%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYG+ A  +F ADYKHW  V++ SYLNGMGINWS+VRNVMDM AVYGGFAAAL+ LK
Sbjct  605  QAGVYGRAASVEFTADYKHWKNVISHSYLNGMGINWSSVRNVMDMKAVYGGFAAALRALK  664

Query  545  V--WVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCN  372
            V  WVMN+V IDSPDTLPIIYERGLFG+YHDWCES +TYPRSYDLLHAD +FS +K KCN
Sbjct  665  VNVWVMNVVPIDSPDTLPIIYERGLFGIYHDWCESLNTYPRSYDLLHADSIFSTLKEKCN  724

Query  371  LMGLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMW  192
            ++ ++ EVDRILRPEG L++RD+ ET+ E+E++ KS+H+DIR+TYS   EG LC+QKT W
Sbjct  725  ILAVIAEVDRILRPEGYLVIRDNVETIGEIESMAKSLHWDIRLTYSKNGEGFLCIQKTFW  784

Query  191  RPKEVQTLAYAIA  153
            RP +V+T+A AIA
Sbjct  785  RPTKVETVASAIA  797



>ref|XP_009102852.1| PREDICTED: probable methyltransferase PMT24 [Brassica rapa]
Length=750

 Score =   298 bits (763),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 133/191 (70%), Positives = 163/191 (85%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGKPA EDF AD + W  +V+KSYLNGMGI+WS VRNVMDM AVYGGFAAALKDLK
Sbjct  560  QEGVYGKPAQEDFTADQERWKTIVSKSYLNGMGIDWSYVRNVMDMRAVYGGFAAALKDLK  619

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            +WVMN+V IDS DTLPIIYERGLFG+YHDWCESFSTYPR+YDLLHADHLFS +K++C+L+
Sbjct  620  LWVMNVVPIDSADTLPIIYERGLFGIYHDWCESFSTYPRTYDLLHADHLFSALKKRCSLV  679

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
              + EVDRILRP+G  IVRD  ET+ E+E ++KSM +++RMT+S   EG+L VQK++WRP
Sbjct  680  SAMAEVDRILRPQGTFIVRDDMETIGEIEKMVKSMKWNVRMTHSKDGEGVLSVQKSLWRP  739

Query  185  KEVQTLAYAIA  153
             EV+T+ +AIA
Sbjct  740  SEVETVTWAIA  750



>ref|XP_006578951.1| PREDICTED: probable methyltransferase PMT26-like isoform X3 [Glycine 
max]
Length=689

 Score =   296 bits (759),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 132/193 (68%), Positives = 163/193 (84%), Gaps = 2/193 (1%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYG+ A  +F ADYKHW  V++ SYLNGMGINWS+VRNVMDM AVYGGFAAAL+ LK
Sbjct  497  QAGVYGRAASVEFTADYKHWKNVISHSYLNGMGINWSSVRNVMDMKAVYGGFAAALRALK  556

Query  545  V--WVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCN  372
            V  WVMN+V IDSPDTLPIIYERGLFG+YHDWCES +TYPRSYDLLHAD +FS +K KCN
Sbjct  557  VNVWVMNVVPIDSPDTLPIIYERGLFGIYHDWCESLNTYPRSYDLLHADSIFSTLKEKCN  616

Query  371  LMGLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMW  192
            ++ ++ EVDRILRPEG L++RD+ ET+ E+E++ KS+H+DI++TYS   EG LC+QKT W
Sbjct  617  ILAVIAEVDRILRPEGYLVIRDNVETIGEIESMAKSLHWDIQLTYSKNGEGFLCIQKTFW  676

Query  191  RPKEVQTLAYAIA  153
            RP +V+T+A AIA
Sbjct  677  RPTKVETVASAIA  689



>ref|XP_002267515.2| PREDICTED: probable methyltransferase PMT27 [Vitis vinifera]
Length=938

 Score =   301 bits (772),  Expect = 5e-92, Method: Composition-based stats.
 Identities = 126/180 (70%), Positives = 157/180 (87%), Gaps = 0/180 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + G+YG+PAP+DFA+DY+HW RVV KSYLNG+GI+WS VRNVMDM AVYGGFAAALKDLK
Sbjct  752  QMGIYGRPAPDDFASDYEHWKRVVNKSYLNGLGISWSNVRNVMDMRAVYGGFAAALKDLK  811

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWV+N+V IDSPDTLPIIYERGLFG+YHDWCESFSTYPR+YDLLHADHLFSK+K++C + 
Sbjct  812  VWVLNVVNIDSPDTLPIIYERGLFGIYHDWCESFSTYPRTYDLLHADHLFSKLKKRCKIA  871

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             L+ E+DRI+RP GKLIVRD +  + E+EN+LKS+H+++ + +S   EG+L  QK+ WRP
Sbjct  872  PLMAEIDRIVRPGGKLIVRDESSAIGEVENLLKSLHWEVHLAFSKDQEGILSAQKSYWRP  931



>ref|XP_010263954.1| PREDICTED: probable methyltransferase PMT27 [Nelumbo nucifera]
Length=934

 Score =   301 bits (772),  Expect = 5e-92, Method: Composition-based stats.
 Identities = 127/181 (70%), Positives = 160/181 (88%), Gaps = 0/181 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + G+YGKPAP+DFAADY+HW RVV KSYL+G+GI+WS VRNVMDM AVYGGFAAALKDLK
Sbjct  748  QMGIYGKPAPDDFAADYEHWKRVVRKSYLSGLGISWSNVRNVMDMRAVYGGFAAALKDLK  807

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            +WVMN+V IDSPDTLPIIYERGLFG+YHDWCESFSTYPRSYDLLHADHLFS++K++C ++
Sbjct  808  LWVMNVVTIDSPDTLPIIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSRLKKRCKVV  867

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++ E+DRI++P GKLIVRD +  + E+ENILKS+H+++R+ +S   EG+L  QK+ WRP
Sbjct  868  PVMAEIDRIVKPGGKLIVRDKSSIVGEVENILKSLHWEVRLIFSKDQEGILSAQKSDWRP  927

Query  185  K  183
            +
Sbjct  928  R  928



>ref|XP_010063906.1| PREDICTED: probable methyltransferase PMT25 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010063907.1| PREDICTED: probable methyltransferase PMT25 isoform X2 [Eucalyptus 
grandis]
 gb|KCW71194.1| hypothetical protein EUGRSUZ_F04285 [Eucalyptus grandis]
Length=825

 Score =   299 bits (766),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 131/191 (69%), Positives = 164/191 (86%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            E GVYGKP  EDF ADY+HW  +V+++Y+NG+G++WS++RN+MDM AVYGGFAAALKDLK
Sbjct  635  ELGVYGKPGQEDFTADYEHWKDIVSQTYMNGIGVSWSSIRNIMDMRAVYGGFAAALKDLK  694

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN++ I+SPDTLPIIYERGLFGM+HDWCESF+TYPRSYDLLHAD+LFS +K++CNLM
Sbjct  695  VWVMNVIPIESPDTLPIIYERGLFGMHHDWCESFNTYPRSYDLLHADNLFSSLKKRCNLM  754

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             +  EVDRILRPEG LIVRD+  T+ E+E+I KS+ +D+R T S  +EGLL VQKT WRP
Sbjct  755  PVFAEVDRILRPEGILIVRDNAATIAEIESIAKSLQWDVRFTDSKDNEGLLSVQKTFWRP  814

Query  185  KEVQTLAYAIA  153
             +V+T+  AIA
Sbjct  815  LDVETITSAIA  825



>emb|CDY44314.1| BnaA07g07980D [Brassica napus]
Length=744

 Score =   298 bits (762),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 133/191 (70%), Positives = 163/191 (85%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGKPA EDF AD + W  +V+KSYLNGMGI+WS VRNVMDM AVYGGFAAALKDLK
Sbjct  554  QEGVYGKPAQEDFTADQERWKTIVSKSYLNGMGIDWSYVRNVMDMRAVYGGFAAALKDLK  613

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            +WVMN+V IDS DTLPIIYERGLFG+YHDWCESFSTYPR+YDLLHADHLFS +K++C+L+
Sbjct  614  LWVMNVVPIDSADTLPIIYERGLFGIYHDWCESFSTYPRTYDLLHADHLFSALKKRCSLV  673

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
              + EVDRILRP+G  IVRD  ET+ E+E ++KSM +++RMT+S   EG+L VQK++WRP
Sbjct  674  SAMAEVDRILRPQGTFIVRDDMETIGEIEKMVKSMKWNVRMTHSKDGEGVLSVQKSLWRP  733

Query  185  KEVQTLAYAIA  153
             EV+T+ +AIA
Sbjct  734  SEVETVTWAIA  744



>gb|KHG22120.1| hypothetical protein F383_28461 [Gossypium arboreum]
Length=834

 Score =   300 bits (767),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 133/190 (70%), Positives = 163/190 (86%), Gaps = 0/190 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGK A  D  ADY HW +VV++SYL+GMGI+WS+VRNVMDM AVYGGFAAALK LK
Sbjct  644  QVGVYGKAAQSDLTADYSHWKKVVSQSYLSGMGIDWSSVRNVMDMKAVYGGFAAALKYLK  703

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V IDSPDTLPIIYERGLFGMYHDWCESF+TYPR+YD++HADHLFS IK++C L+
Sbjct  704  VWVMNVVPIDSPDTLPIIYERGLFGMYHDWCESFNTYPRTYDVVHADHLFSSIKKRCKLV  763

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++VEVDRILRPEGKLIVRD+ ET++E+E++ KS+ ++IRM YS  +EGLLCV+KT WRP
Sbjct  764  AVIVEVDRILRPEGKLIVRDNLETISEVESMAKSLQWEIRMIYSKDNEGLLCVRKTFWRP  823

Query  185  KEVQTLAYAI  156
             E + +   I
Sbjct  824  TEEEPIKSGI  833



>emb|CDX94669.1| BnaC07g09890D [Brassica napus]
Length=749

 Score =   297 bits (761),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 133/191 (70%), Positives = 163/191 (85%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGKPA EDF AD + W  +V+KSYLNGMGI+WS VRNVMDM AVYGGFAAALKDLK
Sbjct  559  QEGVYGKPAQEDFTADQERWKTIVSKSYLNGMGIDWSYVRNVMDMRAVYGGFAAALKDLK  618

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            +WVMN+V IDS DTLPIIYERGLFG+YHDWCESFSTYPR+YDLLHADHLFS +K++C+L+
Sbjct  619  LWVMNVVPIDSADTLPIIYERGLFGIYHDWCESFSTYPRTYDLLHADHLFSALKKRCSLV  678

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
              + EVDRILRP+G  IVRD  ET+ E+E ++KSM +++RMT+S   EG+L VQK++WRP
Sbjct  679  SAMTEVDRILRPQGTFIVRDDMETIGEIEKMVKSMKWNVRMTHSKDGEGVLSVQKSLWRP  738

Query  185  KEVQTLAYAIA  153
             EV+T+ +AIA
Sbjct  739  TEVETVTWAIA  749



>ref|XP_006653085.1| PREDICTED: probable methyltransferase PMT26-like [Oryza brachyantha]
Length=666

 Score =   295 bits (754),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 132/187 (71%), Positives = 164/187 (88%), Gaps = 2/187 (1%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            E GVYGKPA +DF ADY+HW RV++ SY+N +GI+WS VRNVMDM AVYGGFAAAL+DLK
Sbjct  478  EAGVYGKPATDDFRADYEHWKRVISNSYMNVLGIDWSAVRNVMDMKAVYGGFAAALRDLK  537

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKR--KCN  372
            VWVMN++ IDSPDTLPIIYERGLFG+YHDWCESFSTYPR+YD LHA+HLFSKIK+  +C 
Sbjct  538  VWVMNVIPIDSPDTLPIIYERGLFGVYHDWCESFSTYPRTYDFLHANHLFSKIKKSDRCK  597

Query  371  LMGLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMW  192
            L+ ++VEVDRI+RPEG LIVRD  ET+ E+E+++KS+H+++R++YS  +EGLL VQKTMW
Sbjct  598  LVAVMVEVDRIVRPEGMLIVRDSLETIREVESMVKSLHWEVRVSYSQDNEGLLLVQKTMW  657

Query  191  RPKEVQT  171
            RP EV+ 
Sbjct  658  RPNEVEA  664



>gb|KHN46967.1| Putative methyltransferase PMT25 [Glycine soja]
Length=689

 Score =   295 bits (755),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 133/193 (69%), Positives = 162/193 (84%), Gaps = 2/193 (1%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYG+ A  +F ADYKHW  V++  YLNGMGINWS+VRNVMDM AVYGGFAAAL+ LK
Sbjct  497  QAGVYGRAASVEFTADYKHWKNVISHLYLNGMGINWSSVRNVMDMKAVYGGFAAALRALK  556

Query  545  --VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCN  372
              VWVMN+V IDSPDTLPIIYERGLFG+YHDWCESF+TYPRSYDLLHAD +FS +K KCN
Sbjct  557  LNVWVMNVVPIDSPDTLPIIYERGLFGIYHDWCESFNTYPRSYDLLHADSIFSTLKEKCN  616

Query  371  LMGLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMW  192
             + ++ EVDRILRPEG L++RD+ ET+ E+E++ KS+ +DIR+TYS   EGLLC+QKT W
Sbjct  617  KVAVIAEVDRILRPEGYLVIRDNVETIGEIESLAKSLQWDIRLTYSKNGEGLLCIQKTFW  676

Query  191  RPKEVQTLAYAIA  153
            RP +V+T+A AIA
Sbjct  677  RPTKVETVASAIA  689



>ref|XP_009360657.1| PREDICTED: probable methyltransferase PMT24 [Pyrus x bretschneideri]
Length=805

 Score =   298 bits (762),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 137/188 (73%), Positives = 162/188 (86%), Gaps = 0/188 (0%)
 Frame = -2

Query  716  VYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLKVWV  537
            V GK A EDF +DYKHW +VV+++YLNGMGINWSTVRNVMDM AVYGGFAAALKDLKVWV
Sbjct  618  VDGKSAQEDFISDYKHWKKVVSETYLNGMGINWSTVRNVMDMRAVYGGFAAALKDLKVWV  677

Query  536  MNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLV  357
            MN+V +DS DTLPIIYERGL G+YHDWCESFSTYPRSYDLL+ADHLFS +K++C+L+ ++
Sbjct  678  MNVVPVDSRDTLPIIYERGLIGIYHDWCESFSTYPRSYDLLNADHLFSVLKKRCSLVAVI  737

Query  356  VEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEV  177
             EVDRILRPEGKLIV D+ ETL E+E++ KS+ +DIR TYS  +EGLL VQKT WRP E 
Sbjct  738  AEVDRILRPEGKLIVWDNAETLNEIESMAKSLQWDIRFTYSKDNEGLLYVQKTFWRPAEK  797

Query  176  QTLAYAIA  153
            +T+  AIA
Sbjct  798  ETILSAIA  805



>ref|XP_006578949.1| PREDICTED: probable methyltransferase PMT26-like isoform X1 [Glycine 
max]
 ref|XP_006578950.1| PREDICTED: probable methyltransferase PMT26-like isoform X2 [Glycine 
max]
Length=834

 Score =   298 bits (763),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 132/193 (68%), Positives = 163/193 (84%), Gaps = 2/193 (1%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYG+ A  +F ADYKHW  V++ SYLNGMGINWS+VRNVMDM AVYGGFAAAL+ LK
Sbjct  642  QAGVYGRAASVEFTADYKHWKNVISHSYLNGMGINWSSVRNVMDMKAVYGGFAAALRALK  701

Query  545  V--WVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCN  372
            V  WVMN+V IDSPDTLPIIYERGLFG+YHDWCES +TYPRSYDLLHAD +FS +K KCN
Sbjct  702  VNVWVMNVVPIDSPDTLPIIYERGLFGIYHDWCESLNTYPRSYDLLHADSIFSTLKEKCN  761

Query  371  LMGLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMW  192
            ++ ++ EVDRILRPEG L++RD+ ET+ E+E++ KS+H+DI++TYS   EG LC+QKT W
Sbjct  762  ILAVIAEVDRILRPEGYLVIRDNVETIGEIESMAKSLHWDIQLTYSKNGEGFLCIQKTFW  821

Query  191  RPKEVQTLAYAIA  153
            RP +V+T+A AIA
Sbjct  822  RPTKVETVASAIA  834



>gb|KJB59346.1| hypothetical protein B456_009G250600 [Gossypium raimondii]
 gb|KJB59347.1| hypothetical protein B456_009G250600 [Gossypium raimondii]
Length=833

 Score =   298 bits (762),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 132/190 (69%), Positives = 164/190 (86%), Gaps = 1/190 (1%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGK A  D  ADY HW +VV++SYL+GMGI+WS+VRNV+DM AVYGGFAAALKDLK
Sbjct  644  QVGVYGKAAQSDLTADYSHWKKVVSQSYLSGMGIDWSSVRNVIDMKAVYGGFAAALKDLK  703

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V IDSPDTLPIIYERGLFGMYHDWCESF+TYPR+YD++HADHLFS IK++C L+
Sbjct  704  VWVMNVVPIDSPDTLPIIYERGLFGMYHDWCESFNTYPRTYDVVHADHLFSSIKKRCKLV  763

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++ EVDRILRPEGKLI+RD+ ET++E+E++ KS+ ++IRM YS  +EGLLCV KT WRP
Sbjct  764  AVIAEVDRILRPEGKLILRDNLETISEVESMAKSLQWEIRMIYSKDNEGLLCVHKTFWRP  823

Query  185  KEVQTLAYAI  156
             E + + +AI
Sbjct  824  TE-EPIKFAI  832



>ref|XP_008669787.1| PREDICTED: probable methyltransferase PMT26 [Zea mays]
 ref|XP_008669788.1| PREDICTED: probable methyltransferase PMT26 [Zea mays]
Length=906

 Score =   299 bits (765),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 127/185 (69%), Positives = 159/185 (86%), Gaps = 0/185 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGKPAP+DFAAD +HW +VV  SYL GMGI+W T+RNVMDM AVYGGFAAAL+D+K
Sbjct  721  QVGVYGKPAPDDFAADLQHWKKVVRSSYLAGMGIDWKTIRNVMDMRAVYGGFAAALRDMK  780

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V IDSPDTLP+IYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSK+K +C ++
Sbjct  781  VWVMNVVTIDSPDTLPVIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSKLKPRCKVL  840

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++VEVDRILRP GKLIVRD  ET+ E++ +++S+ +++RMT S   + +LC +KT WRP
Sbjct  841  PVIVEVDRILRPNGKLIVRDDKETVDEIQGVVRSLQWEVRMTVSKNKQAMLCARKTTWRP  900

Query  185  KEVQT  171
             E++T
Sbjct  901  TEIET  905



>tpg|DAA38926.1| TPA: hypothetical protein ZEAMMB73_582749 [Zea mays]
Length=939

 Score =   299 bits (766),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 127/185 (69%), Positives = 159/185 (86%), Gaps = 0/185 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGKPAP+DFAAD +HW +VV  SYL GMGI+W T+RNVMDM AVYGGFAAAL+D+K
Sbjct  754  QVGVYGKPAPDDFAADLQHWKKVVRSSYLAGMGIDWKTIRNVMDMRAVYGGFAAALRDMK  813

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V IDSPDTLP+IYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSK+K +C ++
Sbjct  814  VWVMNVVTIDSPDTLPVIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSKLKPRCKVL  873

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++VEVDRILRP GKLIVRD  ET+ E++ +++S+ +++RMT S   + +LC +KT WRP
Sbjct  874  PVIVEVDRILRPNGKLIVRDDKETVDEIQGVVRSLQWEVRMTVSKNKQAMLCARKTTWRP  933

Query  185  KEVQT  171
             E++T
Sbjct  934  TEIET  938



>gb|EPS59022.1| hypothetical protein M569_15788, partial [Genlisea aurea]
Length=289

 Score =   282 bits (721),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 122/180 (68%), Positives = 157/180 (87%), Gaps = 0/180 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + G+YGKP+P+DFA+DYKHW  VV KSY+NG+GI+WS VRNVMDM +VYGGFAAA++DLK
Sbjct  103  QMGIYGKPSPDDFASDYKHWKNVVPKSYINGLGIDWSNVRNVMDMRSVYGGFAAAMRDLK  162

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V +DSPDTLPIIY RGLFG+YHDWCESFSTYPRSYDLLHADHLFS++K++C++ 
Sbjct  163  VWVMNVVNVDSPDTLPIIYGRGLFGIYHDWCESFSTYPRSYDLLHADHLFSRVKKRCDVE  222

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++ EVDRI+RP GKLIVRD ++T+ ELE ILKS+H+++ + ++   EG+L  QK+ WRP
Sbjct  223  VVMAEVDRIVRPGGKLIVRDESKTIGELEAILKSLHWEVFLNFAKNKEGILSAQKSDWRP  282



>ref|XP_008811930.1| PREDICTED: probable methyltransferase PMT24 [Phoenix dactylifera]
Length=955

 Score =   299 bits (765),  Expect = 7e-91, Method: Composition-based stats.
 Identities = 128/180 (71%), Positives = 155/180 (86%), Gaps = 0/180 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            +TGVYGKPA  DF +DY+HW RVV KSY+NG GI+WS VRNVMDM AVYGGFAAALKDL 
Sbjct  776  QTGVYGKPAHNDFTSDYEHWKRVVEKSYINGFGIDWSQVRNVMDMRAVYGGFAAALKDLN  835

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V IDSPDTLPIIYERGLFG+YHDWCESFSTYPRSYDLLHADHLFS+I ++C +M
Sbjct  836  VWVMNVVNIDSPDTLPIIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSQINKRCEIM  895

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++ EVDRILRP GKLIVRD +  ++++EN+LKS+H+++R+T+S   EG+L  +K  WRP
Sbjct  896  PVIAEVDRILRPGGKLIVRDESAVVSKVENLLKSLHWEVRLTFSKNKEGILWAEKLDWRP  955



>ref|XP_003527960.1| PREDICTED: probable methyltransferase PMT26-like [Glycine max]
Length=835

 Score =   296 bits (759),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 133/193 (69%), Positives = 162/193 (84%), Gaps = 2/193 (1%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYG+ A  +F ADYKHW  V++  YLNGMGINWS+VRNVMDM AVYGGFAAAL+ LK
Sbjct  643  QAGVYGRAASVEFTADYKHWKNVISHLYLNGMGINWSSVRNVMDMKAVYGGFAAALRALK  702

Query  545  --VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCN  372
              VWVMN+V IDSPDTLPIIYERGLFG+YHDWCESF+TYPRSYDLLHAD +FS +K KCN
Sbjct  703  LNVWVMNVVPIDSPDTLPIIYERGLFGIYHDWCESFNTYPRSYDLLHADSIFSTLKEKCN  762

Query  371  LMGLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMW  192
             + ++ EVDRILRPEG L++RD+ ET+ E+E++ KS+ +DIR+TYS   EGLLC+QKT W
Sbjct  763  KVAVIAEVDRILRPEGYLVIRDNVETIGEIESLAKSLQWDIRLTYSKNGEGLLCIQKTFW  822

Query  191  RPKEVQTLAYAIA  153
            RP +V+T+A AIA
Sbjct  823  RPTKVETVASAIA  835



>ref|XP_006410572.1| hypothetical protein EUTSA_v10016285mg [Eutrema salsugineum]
 ref|XP_006410573.1| hypothetical protein EUTSA_v10016285mg [Eutrema salsugineum]
 gb|ESQ52025.1| hypothetical protein EUTSA_v10016285mg [Eutrema salsugineum]
 gb|ESQ52026.1| hypothetical protein EUTSA_v10016285mg [Eutrema salsugineum]
Length=771

 Score =   295 bits (754),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 127/191 (66%), Positives = 161/191 (84%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGKPAPEDFAAD + W  +V++SYLNGMGI+WS VRNVMDM AVYGGFAAALKDLK
Sbjct  581  QEGVYGKPAPEDFAADQEKWKTIVSESYLNGMGIDWSNVRNVMDMKAVYGGFAAALKDLK  640

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            +WVMN+V +D+PDTLPIIYERGLFG+YHDWCESF+TYPR+YDLLHADHLFS ++++CNL 
Sbjct  641  LWVMNVVPVDAPDTLPIIYERGLFGIYHDWCESFNTYPRTYDLLHADHLFSTLRKRCNLE  700

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++ E+DRILRPEG  I+RD  E++ E+E ++KSM + ++ T S  +EGLL +QK+ WRP
Sbjct  701  SVMAEIDRILRPEGTFIIRDDMESIGEVEKMVKSMKWKVKFTLSKDNEGLLSIQKSWWRP  760

Query  185  KEVQTLAYAIA  153
             E +T+  AIA
Sbjct  761  TETETIKSAIA  771



>ref|XP_009398710.1| PREDICTED: probable methyltransferase PMT27 [Musa acuminata subsp. 
malaccensis]
Length=1006

 Score =   298 bits (764),  Expect = 2e-90, Method: Composition-based stats.
 Identities = 127/183 (69%), Positives = 157/183 (86%), Gaps = 0/183 (0%)
 Frame = -2

Query  725   ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
             + G+YGKPAP DF +DY+HW RVV KSYL G GI WS VRNVMDM AVYGGFAAALKDLK
Sbjct  820   QMGIYGKPAPVDFTSDYEHWKRVVAKSYLTGFGIRWSNVRNVMDMRAVYGGFAAALKDLK  879

Query  545   VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
             VWVMN+V ID PDTLPIIYERGLFG+YHDWCESFSTYPRSYDLLHAD LFS+IK++C ++
Sbjct  880   VWVMNVVNIDDPDTLPIIYERGLFGIYHDWCESFSTYPRSYDLLHADRLFSQIKQRCKIL  939

Query  365   GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
              L+ EVDRI+RP GK+IVRD + T +E+E++LKS+H+ +R+T+S   EG+LC +K+ WRP
Sbjct  940   PLIAEVDRIVRPGGKIIVRDDSVTTSEVESLLKSLHWVVRLTFSKDQEGILCAEKSEWRP  999

Query  185   KEV  177
             +++
Sbjct  1000  EKL  1002



>ref|NP_180977.1| putative methyltransferase PMT25 [Arabidopsis thaliana]
 ref|NP_001031477.1| putative methyltransferase PMT25 [Arabidopsis thaliana]
 sp|Q0WT31.2|PMTP_ARATH RecName: Full=Probable methyltransferase PMT25 [Arabidopsis thaliana]
 gb|AAC27406.1| unknown protein [Arabidopsis thaliana]
 gb|AEC08950.1| putative methyltransferase PMT25 [Arabidopsis thaliana]
 gb|AEC08951.1| putative methyltransferase PMT25 [Arabidopsis thaliana]
Length=770

 Score =   294 bits (753),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 126/191 (66%), Positives = 162/191 (85%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGKPAPEDF AD + W  +V+K+YLN MGI+WS VRNVMDM AVYGGFAAALKDLK
Sbjct  580  QEGVYGKPAPEDFTADQEKWKTIVSKAYLNDMGIDWSNVRNVMDMRAVYGGFAAALKDLK  639

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            +WVMN+V +D+PDTLPIIYERGLFG+YHDWCESF+TYPR+YDLLHADHLFS ++++CNL+
Sbjct  640  LWVMNVVPVDAPDTLPIIYERGLFGIYHDWCESFNTYPRTYDLLHADHLFSTLRKRCNLV  699

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++ E+DRILRP+G  I+RD  ETL E+E ++KSM + ++MT S  +EGLL ++K+ WRP
Sbjct  700  SVMAEIDRILRPQGTFIIRDDMETLGEVEKMVKSMKWKVKMTQSKDNEGLLSIEKSWWRP  759

Query  185  KEVQTLAYAIA  153
            +E +T+  AIA
Sbjct  760  EETETIKSAIA  770



>dbj|BAE99717.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAH20160.1| AT2G34300 [Arabidopsis thaliana]
Length=770

 Score =   294 bits (752),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 126/191 (66%), Positives = 162/191 (85%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGKPAPEDF AD + W  +V+K+YLN MGI+WS VRNVMDM AVYGGFAAALKDLK
Sbjct  580  QEGVYGKPAPEDFTADQEKWKTIVSKAYLNDMGIDWSNVRNVMDMRAVYGGFAAALKDLK  639

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            +WVMN+V +D+PDTLPIIYERGLFG+YHDWCESF+TYPR+YDLLHADHLFS ++++CNL+
Sbjct  640  LWVMNVVPVDAPDTLPIIYERGLFGIYHDWCESFNTYPRTYDLLHADHLFSTLRKRCNLV  699

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++ E+DRILRP+G  I+RD  ETL E+E ++KSM + ++MT S  +EGLL ++K+ WRP
Sbjct  700  SVMAEIDRILRPQGTFIIRDDMETLGEVEKMVKSMKWKVKMTQSKDNEGLLSIEKSWWRP  759

Query  185  KEVQTLAYAIA  153
            +E +T+  AIA
Sbjct  760  EETETIKSAIA  770



>emb|CBI17424.3| unnamed protein product [Vitis vinifera]
Length=860

 Score =   295 bits (756),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 126/180 (70%), Positives = 157/180 (87%), Gaps = 0/180 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + G+YG+PAP+DFA+DY+HW RVV KSYLNG+GI+WS VRNVMDM AVYGGFAAALKDLK
Sbjct  674  QMGIYGRPAPDDFASDYEHWKRVVNKSYLNGLGISWSNVRNVMDMRAVYGGFAAALKDLK  733

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWV+N+V IDSPDTLPIIYERGLFG+YHDWCESFSTYPR+YDLLHADHLFSK+K++C + 
Sbjct  734  VWVLNVVNIDSPDTLPIIYERGLFGIYHDWCESFSTYPRTYDLLHADHLFSKLKKRCKIA  793

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             L+ E+DRI+RP GKLIVRD +  + E+EN+LKS+H+++ + +S   EG+L  QK+ WRP
Sbjct  794  PLMAEIDRIVRPGGKLIVRDESSAIGEVENLLKSLHWEVHLAFSKDQEGILSAQKSYWRP  853



>ref|XP_002449126.1| hypothetical protein SORBIDRAFT_05g005510 [Sorghum bicolor]
 gb|EES08114.1| hypothetical protein SORBIDRAFT_05g005510 [Sorghum bicolor]
Length=894

 Score =   296 bits (757),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 126/185 (68%), Positives = 159/185 (86%), Gaps = 0/185 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGKPAP+DFAAD +HW +VV  SYL GMGI+W T+RNVMDM AVYGGFAAAL+++K
Sbjct  709  QVGVYGKPAPDDFAADLQHWRKVVRSSYLAGMGIDWKTIRNVMDMRAVYGGFAAALREMK  768

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V IDSPDTLP+IYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSK+K +C ++
Sbjct  769  VWVMNVVTIDSPDTLPVIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSKLKPRCKVL  828

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++VEVDRILRP GKLIVRD  ET+ E++ +++S+ +++RMT S   E +LC +KT WRP
Sbjct  829  PVIVEVDRILRPNGKLIVRDDKETVDEIQGVVRSLQWEVRMTVSKNKEAMLCARKTTWRP  888

Query  185  KEVQT  171
             E+++
Sbjct  889  TEIES  893



>ref|XP_010515490.1| PREDICTED: probable methyltransferase PMT27 [Camelina sativa]
Length=912

 Score =   296 bits (758),  Expect = 4e-90, Method: Composition-based stats.
 Identities = 127/184 (69%), Positives = 154/184 (84%), Gaps = 0/184 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + G+YGKPAP DF  DY+HW  VV+K Y+N +GI+WS VRNVMDM AVYGGFAAALKDL+
Sbjct  729  QMGIYGKPAPRDFTTDYEHWKHVVSKVYMNEIGISWSNVRNVMDMRAVYGGFAAALKDLQ  788

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V I+SPDTLPIIYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSK+K +CNL+
Sbjct  789  VWVMNVVNINSPDTLPIIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSKLKARCNLV  848

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++ EVDRI+RP GKLIVRD +  + E+EN+LKS+H+D+ +T+S   EG+L  QK  WRP
Sbjct  849  PVMAEVDRIVRPGGKLIVRDESNVIREVENMLKSLHWDVHLTFSKHQEGILSAQKGFWRP  908

Query  185  KEVQ  174
               Q
Sbjct  909  NTSQ  912



>ref|XP_010503787.1| PREDICTED: probable methyltransferase PMT27 [Camelina sativa]
Length=913

 Score =   296 bits (758),  Expect = 5e-90, Method: Composition-based stats.
 Identities = 127/184 (69%), Positives = 154/184 (84%), Gaps = 0/184 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + G+YGKPAP DF  DY+HW  VV+K Y+N +GI+WS VRNVMDM AVYGGFAAALKDL+
Sbjct  730  QMGIYGKPAPRDFTTDYEHWKHVVSKVYMNEIGISWSNVRNVMDMRAVYGGFAAALKDLQ  789

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V I+SPDTLPIIYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSK+K +CNL+
Sbjct  790  VWVMNVVNINSPDTLPIIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSKLKARCNLV  849

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++ EVDRI+RP GKLIVRD +  + E+EN+LKS+H+D+ +T+S   EG+L  QK  WRP
Sbjct  850  PVMAEVDRIVRPGGKLIVRDESNVIREVENMLKSLHWDVHLTFSKHQEGILSAQKGFWRP  909

Query  185  KEVQ  174
               Q
Sbjct  910  NTSQ  913



>ref|XP_010426649.1| PREDICTED: probable methyltransferase PMT27 [Camelina sativa]
Length=914

 Score =   296 bits (758),  Expect = 5e-90, Method: Composition-based stats.
 Identities = 127/184 (69%), Positives = 154/184 (84%), Gaps = 0/184 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + G+YGKPAP DF  DY+HW  VV+K Y+N +GI+WS VRNVMDM AVYGGFAAALKDL+
Sbjct  731  QMGIYGKPAPRDFTTDYEHWKHVVSKVYMNEIGISWSNVRNVMDMRAVYGGFAAALKDLQ  790

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V I+SPDTLPIIYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSK+K +CNL+
Sbjct  791  VWVMNVVNINSPDTLPIIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSKLKARCNLV  850

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++ EVDRI+RP GKLIVRD +  + E+EN+LKS+H+D+ +T+S   EG+L  QK  WRP
Sbjct  851  PVMAEVDRIVRPGGKLIVRDESNVIREVENMLKSLHWDVHLTFSKHQEGILSAQKGFWRP  910

Query  185  KEVQ  174
               Q
Sbjct  911  NTSQ  914



>gb|EEC78319.1| hypothetical protein OsI_18053 [Oryza sativa Indica Group]
Length=672

 Score =   291 bits (744),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 130/187 (70%), Positives = 162/187 (87%), Gaps = 2/187 (1%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            E GVYGKPA EDF ADY+HW +V++ SY+N +GI+WS VRNVMDM A YGGFAAAL+DLK
Sbjct  484  EAGVYGKPATEDFQADYEHWKQVISNSYMNDLGIDWSAVRNVMDMKAAYGGFAAALRDLK  543

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKR--KCN  372
            +WVMN++ IDSPDTLPIIYERGLFG+YHDWCESFSTYPR+YDLLHA+HLFSKIK+  +C 
Sbjct  544  LWVMNVIPIDSPDTLPIIYERGLFGIYHDWCESFSTYPRTYDLLHANHLFSKIKKSDRCK  603

Query  371  LMGLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMW  192
            L+ ++VEVDRILRP G+LIVRD  ET+ E+E++ KS+H+++R +YS  +EGLL V+KTMW
Sbjct  604  LVAVMVEVDRILRPGGRLIVRDSMETMHEVESMAKSLHWEVRKSYSQDNEGLLFVEKTMW  663

Query  191  RPKEVQT  171
            RP EV+ 
Sbjct  664  RPNEVEA  670



>gb|EEE61974.1| hypothetical protein OsJ_16751 [Oryza sativa Japonica Group]
Length=677

 Score =   291 bits (744),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 130/187 (70%), Positives = 162/187 (87%), Gaps = 2/187 (1%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            E GVYGKPA EDF ADY+HW +V++ SY+N +GI+WS VRNVMDM A YGGFAAAL+DLK
Sbjct  489  EAGVYGKPATEDFQADYEHWKQVISNSYMNDLGIDWSAVRNVMDMKAAYGGFAAALRDLK  548

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKR--KCN  372
            +WVMN++ IDSPDTLPIIYERGLFG+YHDWCESFSTYPR+YDLLHA+HLFSKIK+  +C 
Sbjct  549  LWVMNVIPIDSPDTLPIIYERGLFGIYHDWCESFSTYPRTYDLLHANHLFSKIKKSDRCK  608

Query  371  LMGLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMW  192
            L+ ++VEVDRILRP G+LIVRD  ET+ E+E++ KS+H+++R +YS  +EGLL V+KTMW
Sbjct  609  LVAVMVEVDRILRPGGRLIVRDSMETMHEVESMAKSLHWEVRKSYSQDNEGLLFVEKTMW  668

Query  191  RPKEVQT  171
            RP EV+ 
Sbjct  669  RPNEVEA  675



>gb|KGN48886.1| hypothetical protein Csa_6G504660 [Cucumis sativus]
Length=928

 Score =   296 bits (757),  Expect = 7e-90, Method: Composition-based stats.
 Identities = 125/180 (69%), Positives = 155/180 (86%), Gaps = 0/180 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGKPAP+DF+ DY+HW RVV K+Y+NG+GIN S +RNVMDM +VYGGFAAAL+DLK
Sbjct  742  QMGVYGKPAPQDFSTDYEHWKRVVNKTYMNGLGINLSNIRNVMDMRSVYGGFAAALRDLK  801

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V IDSPDTLP+IYERGLFG+YHDWCESFSTYPR+YDLLHADHLFSK+K++C L 
Sbjct  802  VWVMNVVNIDSPDTLPVIYERGLFGIYHDWCESFSTYPRTYDLLHADHLFSKLKKRCKLQ  861

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++ EVDRI+RP GKLIVRD + T+ E+EN+LKS+ +++ +T+S   EGLL  QK  WRP
Sbjct  862  PVLAEVDRIVRPGGKLIVRDESSTIGEVENLLKSLRWEVHLTFSKNQEGLLSAQKGDWRP  921



>ref|XP_003576215.1| PREDICTED: probable methyltransferase PMT24 [Brachypodium distachyon]
Length=870

 Score =   295 bits (754),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 128/185 (69%), Positives = 156/185 (84%), Gaps = 0/185 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYG+PA EDFAADY+HW +VV  SYL GMGI+W+ VRNVMDM AVYGG AAAL+D+ 
Sbjct  684  QVGVYGRPAREDFAADYEHWRKVVQNSYLTGMGIDWAAVRNVMDMRAVYGGLAAALRDMS  743

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN V IDSPDTLP+I+ERGLFG+YHDWCESFSTYPRSYDLLHADHLFSK+K +C ++
Sbjct  744  VWVMNTVTIDSPDTLPVIFERGLFGIYHDWCESFSTYPRSYDLLHADHLFSKLKTRCKVL  803

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++VE DRILRP GKLIVRD  ET+ E+  +++SMH+++RMT SN  E +LC +KTMWRP
Sbjct  804  PVIVEADRILRPNGKLIVRDDKETVNEIVELVRSMHWEVRMTVSNRKEAMLCARKTMWRP  863

Query  185  KEVQT  171
             EV+ 
Sbjct  864  TEVEA  868



>ref|XP_006403957.1| hypothetical protein EUTSA_v10010109mg [Eutrema salsugineum]
 gb|ESQ45410.1| hypothetical protein EUTSA_v10010109mg [Eutrema salsugineum]
Length=914

 Score =   295 bits (756),  Expect = 9e-90, Method: Composition-based stats.
 Identities = 127/184 (69%), Positives = 153/184 (83%), Gaps = 0/184 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + G+YGKPAP DF  DY+HW  VV+K Y+N +GI+WS VRNVMDM AVYGGFAAALKDL+
Sbjct  731  QMGIYGKPAPRDFTTDYEHWKHVVSKVYMNEIGISWSNVRNVMDMRAVYGGFAAALKDLQ  790

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V I+SPDTLPIIYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSK+K +CNL 
Sbjct  791  VWVMNVVNINSPDTLPIIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSKLKARCNLA  850

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++ EVDRI+RP GKLIVRD +  + E+EN+LKS+H+D+ +T+S   EG+L  QK  WRP
Sbjct  851  PVMAEVDRIVRPGGKLIVRDESNVIREVENMLKSLHWDVHLTFSKHQEGILSAQKGFWRP  910

Query  185  KEVQ  174
               Q
Sbjct  911  DTSQ  914



>ref|XP_007203224.1| hypothetical protein PRUPE_ppa000863mg [Prunus persica]
 gb|EMJ04423.1| hypothetical protein PRUPE_ppa000863mg [Prunus persica]
Length=977

 Score =   296 bits (758),  Expect = 1e-89, Method: Composition-based stats.
 Identities = 124/180 (69%), Positives = 153/180 (85%), Gaps = 0/180 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + G+YGKPAP+DFA DY+HW RV+  +Y+  +GINWS VRNVMDM AVYGGFAAALKDLK
Sbjct  789  QMGIYGKPAPQDFARDYEHWKRVINNTYIKSLGINWSNVRNVMDMRAVYGGFAAALKDLK  848

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V IDSPDTLPIIYERGLFG+YHDWCESFSTYPR+YDLLHADHLFS++K++C L 
Sbjct  849  VWVMNVVNIDSPDTLPIIYERGLFGIYHDWCESFSTYPRTYDLLHADHLFSRLKKRCKLP  908

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++ E+DRI+RP GKLIVRD + T+ E+EN+LKS+H+++ +T S   EG+L  QK  WRP
Sbjct  909  PVLAEIDRIVRPGGKLIVRDESSTIGEVENLLKSLHWEVSLTVSKNQEGMLSAQKGKWRP  968



>ref|XP_008440784.1| PREDICTED: probable methyltransferase PMT27 [Cucumis melo]
Length=933

 Score =   295 bits (756),  Expect = 1e-89, Method: Composition-based stats.
 Identities = 125/180 (69%), Positives = 155/180 (86%), Gaps = 0/180 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGKPAP+DF+ DY+HW RVV K+Y+NG+GIN S +RNVMDM +VYGGFAAAL+DLK
Sbjct  747  QMGVYGKPAPQDFSTDYEHWKRVVNKTYMNGLGINLSNIRNVMDMRSVYGGFAAALRDLK  806

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V IDSPDTLP+IYERGLFG+YHDWCESFSTYPR+YDLLHADHLFSK+K++C L 
Sbjct  807  VWVMNVVNIDSPDTLPVIYERGLFGIYHDWCESFSTYPRTYDLLHADHLFSKLKKRCKLQ  866

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++ EVDRI+RP GKLIVRD + T+ E+EN+LKS+ +++ +T+S   EGLL  QK  WRP
Sbjct  867  PVLAEVDRIVRPGGKLIVRDESSTIGEVENLLKSLRWEVHLTFSKNQEGLLSAQKGDWRP  926



>ref|XP_002881329.1| hypothetical protein ARALYDRAFT_482372 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57588.1| hypothetical protein ARALYDRAFT_482372 [Arabidopsis lyrata subsp. 
lyrata]
Length=773

 Score =   292 bits (748),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 127/191 (66%), Positives = 161/191 (84%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGKPAPEDF AD + W  +V+KSYLN MGI+WS VRNVMDM AVYGGFAAALKDLK
Sbjct  583  QEGVYGKPAPEDFTADQEKWKTIVSKSYLNDMGIDWSNVRNVMDMRAVYGGFAAALKDLK  642

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            +WVMN+V +D+PDTLPIIYERGLFG+YHDWCESF+TY R+YDLLHADHLFS ++++CNL+
Sbjct  643  LWVMNVVPVDAPDTLPIIYERGLFGIYHDWCESFNTYLRTYDLLHADHLFSTLRKRCNLV  702

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++ E+DRILRP+G  I+RD  ETL E+E ++KSM ++++MT S  +EGLL +QK+ WRP
Sbjct  703  SVMAEIDRILRPQGTFIIRDDMETLGEVEKMVKSMKWNVKMTQSKDNEGLLSIQKSWWRP  762

Query  185  KEVQTLAYAIA  153
             E +T+  AIA
Sbjct  763  AETETIKSAIA  773



>ref|XP_006295874.1| hypothetical protein CARUB_v10025004mg [Capsella rubella]
 gb|EOA28772.1| hypothetical protein CARUB_v10025004mg [Capsella rubella]
Length=777

 Score =   292 bits (748),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 126/189 (67%), Positives = 160/189 (85%), Gaps = 0/189 (0%)
 Frame = -2

Query  719  GVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLKVW  540
            GVYGKPA EDF AD + W  +V+KSYLNGM I+WS VRNVMDM AVYGGFAAALKDLK+W
Sbjct  589  GVYGKPAQEDFTADQEKWKTIVSKSYLNGMEIDWSNVRNVMDMRAVYGGFAAALKDLKLW  648

Query  539  VMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGL  360
            VMN+V +D+PDTLPIIYERGLFG+YHDWCESF+TYPR+YDLLHADHLFS ++++CNL+ +
Sbjct  649  VMNVVPVDAPDTLPIIYERGLFGIYHDWCESFNTYPRTYDLLHADHLFSTLRKRCNLVSV  708

Query  359  VVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKE  180
            + E+DRILRP+G  I+RD  ET+ E+E ++KSM ++++MT S  +EGLL +QK+ WRP E
Sbjct  709  MAEIDRILRPQGTFIIRDDMETIGEVEKMVKSMKWNVKMTQSKDNEGLLSIQKSWWRPAE  768

Query  179  VQTLAYAIA  153
             +T+  AIA
Sbjct  769  TETIKSAIA  777



>ref|XP_007046783.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
 gb|EOX90940.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
Length=920

 Score =   295 bits (754),  Expect = 1e-89, Method: Composition-based stats.
 Identities = 125/184 (68%), Positives = 158/184 (86%), Gaps = 0/184 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + G+YGKPAP+DFA DY+HW+RVV+K Y++G+GI+WS VRNVMDM AVYGGFAAALKD++
Sbjct  734  QMGIYGKPAPQDFARDYEHWTRVVSKLYMSGLGISWSNVRNVMDMRAVYGGFAAALKDIQ  793

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWV+N+V  DSPDTLPIIYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSK+ ++C L 
Sbjct  794  VWVLNVVNFDSPDTLPIIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSKLTKRCKLE  853

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++ EVDRI+RP GKLIVRD ++ + E+EN+LKS+H+++ +T+S  DEG+L  QK  WRP
Sbjct  854  PVMAEVDRIVRPGGKLIVRDESKAIGEVENLLKSLHWEVHLTFSKDDEGILSAQKGDWRP  913

Query  185  KEVQ  174
               Q
Sbjct  914  TTYQ  917



>ref|XP_004978888.1| PREDICTED: probable methyltransferase PMT26-like [Setaria italica]
Length=839

 Score =   293 bits (750),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 127/185 (69%), Positives = 158/185 (85%), Gaps = 0/185 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            +TGVYGKPAPEDFAAD +HW +VV  SYL GMGI+W T+RNVMDM AVYGG AAAL++++
Sbjct  654  QTGVYGKPAPEDFAADLEHWRKVVRSSYLAGMGIDWKTIRNVMDMRAVYGGLAAALREME  713

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V IDSPDTLP+IYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSK+K +C ++
Sbjct  714  VWVMNVVTIDSPDTLPVIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSKLKPRCKVL  773

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             +VVEVDRILRP GK IVRD  ET+ E+++ ++S+ +++RMT S   E +LC +KT WRP
Sbjct  774  PVVVEVDRILRPNGKFIVRDDKETVDEIQSAVRSLQWEVRMTVSKNKEAMLCARKTTWRP  833

Query  185  KEVQT  171
             EV++
Sbjct  834  TEVES  838



>ref|XP_008337883.1| PREDICTED: probable methyltransferase PMT27 [Malus domestica]
Length=968

 Score =   295 bits (756),  Expect = 2e-89, Method: Composition-based stats.
 Identities = 124/180 (69%), Positives = 152/180 (84%), Gaps = 0/180 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + G+YGKPAP+DF+ DY+HW RV++ +Y+  +GINWS VRN MDM AVYGGFAAALKDLK
Sbjct  780  QMGIYGKPAPQDFSTDYEHWKRVISNTYMKSLGINWSNVRNCMDMRAVYGGFAAALKDLK  839

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V IDSPDTLPIIYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSK+K++C L 
Sbjct  840  VWVMNVVNIDSPDTLPIIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSKLKKRCKLA  899

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++ EVDRI+RP GK IVRD + T+ E+EN+LKS+H+++ +T S   EG+L  QK  WRP
Sbjct  900  PVLAEVDRIVRPGGKFIVRDESSTIGEVENLLKSLHWEVSLTVSKNQEGMLSAQKGNWRP  959



>ref|XP_009143789.1| PREDICTED: probable methyltransferase PMT25 [Brassica rapa]
Length=762

 Score =   291 bits (746),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 125/191 (65%), Positives = 161/191 (84%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGKPAPEDFAAD + W  VV+KSY++GMGI+WS VRNVMDM AVYGGFAAALKDLK
Sbjct  572  QEGVYGKPAPEDFAADQEKWKTVVSKSYIDGMGIDWSNVRNVMDMRAVYGGFAAALKDLK  631

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            +WVMN+V +D+PDTLP+IYERGLFG+YHDWCESF+TYPR+YDLLHADHLFS ++++C L 
Sbjct  632  LWVMNVVPVDAPDTLPVIYERGLFGIYHDWCESFNTYPRTYDLLHADHLFSTLRKRCKLE  691

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++ EVDRILRPEG  I+RD  ET+ E+E ++KSM ++++ T S  +EGLL ++K+ WRP
Sbjct  692  SVMAEVDRILRPEGTFIIRDDMETIGEVEKMVKSMKWEVKTTQSKDNEGLLSIKKSWWRP  751

Query  185  KEVQTLAYAIA  153
             + +T+  AIA
Sbjct  752  TQTETIESAIA  762



>emb|CDY17234.1| BnaA05g09540D [Brassica napus]
Length=762

 Score =   291 bits (746),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 125/191 (65%), Positives = 161/191 (84%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGKPAPEDFAAD + W  VV+KSY++GMGI+WS VRNVMDM AVYGGFAAALKDLK
Sbjct  572  QEGVYGKPAPEDFAADQEKWKTVVSKSYIDGMGIDWSNVRNVMDMRAVYGGFAAALKDLK  631

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            +WVMN+V +D+PDTLP+IYERGLFG+YHDWCESF+TYPR+YDLLHADHLFS ++++C L 
Sbjct  632  LWVMNVVPVDAPDTLPVIYERGLFGIYHDWCESFNTYPRTYDLLHADHLFSTLRKRCKLE  691

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++ EVDRILRPEG  I+RD  ET+ E+E ++KSM ++++ T S  +EGLL ++K+ WRP
Sbjct  692  SVMAEVDRILRPEGTFIIRDDMETIGEVEKMVKSMKWEVKTTQSKDNEGLLSIKKSWWRP  751

Query  185  KEVQTLAYAIA  153
             + +T+  AIA
Sbjct  752  TQTETIESAIA  762



>ref|XP_010679237.1| PREDICTED: probable methyltransferase PMT26 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=791

 Score =   291 bits (746),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 127/191 (66%), Positives = 161/191 (84%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            E GVYGK AP+DF  DYKHW RVV +SY + +GI+WS+VRNVMDM AVYGGFAAALKDLK
Sbjct  601  EAGVYGKVAPKDFVDDYKHWKRVVAESYSDEIGIDWSSVRNVMDMKAVYGGFAAALKDLK  660

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            +WVMN+V + S DTLP+IYERGLFG+YHDWCESFSTYPRSYDLLHADHLFS +K++CN +
Sbjct  661  LWVMNVVPVISSDTLPVIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSDLKKRCNFV  720

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++ EVDRILRPEG LIVRD  ET+ ++E++  S+ + I+ ++S  +EGLLCVQK+ WRP
Sbjct  721  AVMAEVDRILRPEGSLIVRDDAETIAKVESMTNSLQWKIKFSFSKNNEGLLCVQKSRWRP  780

Query  185  KEVQTLAYAIA  153
             +++T++ AIA
Sbjct  781  SDIETISSAIA  791



>ref|XP_009346291.1| PREDICTED: probable methyltransferase PMT27 [Pyrus x bretschneideri]
Length=962

 Score =   295 bits (754),  Expect = 3e-89, Method: Composition-based stats.
 Identities = 124/180 (69%), Positives = 152/180 (84%), Gaps = 0/180 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + G+YGKPAP+DF+ DY+HW RV++ +Y+  +GINWS VRN MDM AVYGGFAAALKDLK
Sbjct  774  QMGIYGKPAPQDFSTDYEHWKRVISNTYMKSLGINWSNVRNCMDMRAVYGGFAAALKDLK  833

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V IDSPDTLPIIYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSK+K++C L 
Sbjct  834  VWVMNVVNIDSPDTLPIIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSKLKKRCKLA  893

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++ EVDRI+RP GK IVRD + T+ E+EN+LKS+H+++ +T S   EG+L  QK  WRP
Sbjct  894  PVLGEVDRIVRPGGKFIVRDESSTIGEVENLLKSLHWEVSLTVSKNQEGMLSAQKGNWRP  953



>emb|CDX84330.1| BnaC04g10920D [Brassica napus]
Length=713

 Score =   290 bits (741),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 126/191 (66%), Positives = 160/191 (84%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGKPAPEDFAAD + W  VV KSY++GMGI+WS VRNVMDM AVYGGFAAALKDLK
Sbjct  523  QEGVYGKPAPEDFAADQEKWKTVVAKSYIDGMGIDWSNVRNVMDMRAVYGGFAAALKDLK  582

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            +WVMN+V +D+PDTLPIIYERGLFG+YHDWCESF+TYPR+YDLLHADHLFS ++++C L 
Sbjct  583  LWVMNVVPVDAPDTLPIIYERGLFGIYHDWCESFNTYPRTYDLLHADHLFSTLRKRCKLE  642

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++ EVDRILRPEG  I+RD  ET+ E+E ++KSM ++++ T S  +EGLL ++K+ WRP
Sbjct  643  SVMAEVDRILRPEGTFIIRDDMETIGEVEKMVKSMKWEVKTTQSKDNEGLLSIKKSWWRP  702

Query  185  KEVQTLAYAIA  153
             + +T+  AIA
Sbjct  703  TQTETIKSAIA  713



>ref|XP_004502550.1| PREDICTED: probable methyltransferase PMT26-like [Cicer arietinum]
Length=782

 Score =   291 bits (745),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 130/192 (68%), Positives = 162/192 (84%), Gaps = 2/192 (1%)
 Frame = -2

Query  722  TGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK-  546
            TGVYG+ A  +F ADY+HW  V++ SYLNGMGINWS+VRNVMDM AVYGGF+AAL+ LK 
Sbjct  591  TGVYGRAATVEFTADYRHWKNVISHSYLNGMGINWSSVRNVMDMKAVYGGFSAALRALKL  650

Query  545  -VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNL  369
             VWVMN+V IDSPDTL +IYERGLFG+YHDWCESFSTYPRSYDLLHAD LFS +K +CN+
Sbjct  651  NVWVMNVVPIDSPDTLAVIYERGLFGIYHDWCESFSTYPRSYDLLHADSLFSTLKERCNI  710

Query  368  MGLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWR  189
            + ++ EVDR+LRPEG LI+RD+ ET+ E+EN+ KS+H+D+R  Y+   EGLLC+QKT+WR
Sbjct  711  VAVIAEVDRMLRPEGYLIIRDNVETIDEIENMAKSLHWDVRFRYAKLGEGLLCLQKTLWR  770

Query  188  PKEVQTLAYAIA  153
            P +V+T+  AIA
Sbjct  771  PTKVETVVSAIA  782



>ref|XP_003563554.1| PREDICTED: probable methyltransferase PMT25 [Brachypodium distachyon]
Length=928

 Score =   293 bits (751),  Expect = 4e-89, Method: Composition-based stats.
 Identities = 121/181 (67%), Positives = 157/181 (87%), Gaps = 0/181 (0%)
 Frame = -2

Query  719  GVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLKVW  540
            GVYGKPAPEDFA DY+HW RV+ KSYLNG+G++WS VRNVMDM A YGGFAAAL+D K+W
Sbjct  744  GVYGKPAPEDFAVDYQHWRRVIDKSYLNGLGVDWSRVRNVMDMRAAYGGFAAALRDQKIW  803

Query  539  VMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGL  360
            VMN+V +D+PDTLPI+Y+RGLFG+YHDWCESFSTYPR+YDLLHADHLFSKIK +C ++ +
Sbjct  804  VMNVVNVDAPDTLPIVYDRGLFGIYHDWCESFSTYPRTYDLLHADHLFSKIKERCPVLPV  863

Query  359  VVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKE  180
            +VEVDRI+RP G +IVRD +  + E+E +L+S+H+D+R+T+S  +EG+L  +K+ WRP+ 
Sbjct  864  IVEVDRIVRPGGSIIVRDESGAVGEVEKLLRSLHWDVRLTFSKNNEGVLFAEKSDWRPEM  923

Query  179  V  177
            V
Sbjct  924  V  924



>ref|XP_010679222.1| PREDICTED: probable methyltransferase PMT25 isoform X1 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010679229.1| PREDICTED: probable methyltransferase PMT25 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=802

 Score =   291 bits (745),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 127/191 (66%), Positives = 161/191 (84%), Gaps = 0/191 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            E GVYGK AP+DF  DYKHW RVV +SY + +GI+WS+VRNVMDM AVYGGFAAALKDLK
Sbjct  612  EAGVYGKVAPKDFVDDYKHWKRVVAESYSDEIGIDWSSVRNVMDMKAVYGGFAAALKDLK  671

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            +WVMN+V + S DTLP+IYERGLFG+YHDWCESFSTYPRSYDLLHADHLFS +K++CN +
Sbjct  672  LWVMNVVPVISSDTLPVIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSDLKKRCNFV  731

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++ EVDRILRPEG LIVRD  ET+ ++E++  S+ + I+ ++S  +EGLLCVQK+ WRP
Sbjct  732  AVMAEVDRILRPEGSLIVRDDAETIAKVESMTNSLQWKIKFSFSKNNEGLLCVQKSRWRP  791

Query  185  KEVQTLAYAIA  153
             +++T++ AIA
Sbjct  792  SDIETISSAIA  802



>ref|XP_008241902.1| PREDICTED: probable methyltransferase PMT27 [Prunus mume]
Length=983

 Score =   294 bits (753),  Expect = 5e-89, Method: Composition-based stats.
 Identities = 123/180 (68%), Positives = 152/180 (84%), Gaps = 0/180 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + G+YGKPAP+DFA DY+HW RV+  +Y+  +GINWS VRNVMDM AVYGGFAAALKDLK
Sbjct  795  QMGIYGKPAPQDFARDYEHWKRVINNTYIKSLGINWSNVRNVMDMRAVYGGFAAALKDLK  854

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V IDSPDTLPIIYERGLFG+YHDWCESFSTYPR+YDLLHADHLFS++K++C L 
Sbjct  855  VWVMNVVNIDSPDTLPIIYERGLFGIYHDWCESFSTYPRTYDLLHADHLFSRLKKRCKLP  914

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++ E+DRI+RP GK IVRD + T+ E+EN+LKS+H+++ +T S   EG+L  QK  WRP
Sbjct  915  PVLAEIDRIVRPGGKFIVRDESSTIGEVENLLKSLHWEVSLTVSKNQEGMLSAQKGKWRP  974



>ref|XP_010509773.1| PREDICTED: probable methyltransferase PMT25 [Camelina sativa]
Length=771

 Score =   290 bits (743),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 126/189 (67%), Positives = 160/189 (85%), Gaps = 0/189 (0%)
 Frame = -2

Query  719  GVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLKVW  540
            GVYGKPA EDF AD + W  +V+KSYLNGM I+WS VRNVMDM AVYGGFAAALKDLK+W
Sbjct  583  GVYGKPAQEDFTADQEKWKTIVSKSYLNGMEIDWSNVRNVMDMRAVYGGFAAALKDLKLW  642

Query  539  VMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGL  360
            VMN+V +D+PDTLPIIYERGLFG+YHDWCESF+TYPR+YDLLHADHLFS ++++CNL+ +
Sbjct  643  VMNVVPVDAPDTLPIIYERGLFGIYHDWCESFNTYPRTYDLLHADHLFSTLRKRCNLVSV  702

Query  359  VVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKE  180
            + EVDRILRP+G  I+RD  ET+ E+E ++KSM +++++T S  +EGLL +QK+ WRP E
Sbjct  703  MAEVDRILRPQGTFIIRDDMETIGEVEKMVKSMKWNVKVTQSKDNEGLLSIQKSWWRPAE  762

Query  179  VQTLAYAIA  153
             +T+  AIA
Sbjct  763  TETIKSAIA  771



>gb|KEH35375.1| methyltransferase PMT26-like protein, putative [Medicago truncatula]
Length=755

 Score =   290 bits (742),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 129/193 (67%), Positives = 162/193 (84%), Gaps = 2/193 (1%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            +TGVYG+ AP +F AD +HW  V++ SYLNGMGINWS+VRNVMDM +VYGGFAAAL+ LK
Sbjct  563  QTGVYGRDAPVEFTADTRHWKVVISHSYLNGMGINWSSVRNVMDMKSVYGGFAAALRLLK  622

Query  545  --VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCN  372
              VWVMN+V +DSPDTLP+IYERGLFG+YHDWCESFSTYPRSYDLLHAD LFS +K +CN
Sbjct  623  LNVWVMNVVPVDSPDTLPLIYERGLFGIYHDWCESFSTYPRSYDLLHADFLFSALKERCN  682

Query  371  LMGLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMW  192
            ++ ++ EVDR+LRPEG LI+RD+ E + E+EN+ KS+H+DIR +Y+   EGLLC+QKT W
Sbjct  683  IVAVIAEVDRMLRPEGYLIIRDNEEIIGEIENMAKSLHWDIRSSYAKNGEGLLCLQKTFW  742

Query  191  RPKEVQTLAYAIA  153
            RP +V+T+  A A
Sbjct  743  RPTKVETVVSAFA  755



>dbj|BAK08087.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=892

 Score =   292 bits (748),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 130/184 (71%), Positives = 154/184 (84%), Gaps = 0/184 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGK APEDFAADY HW +VV  SYL+GMGI W +VRNVMDM AVYGG AAAL+D+ 
Sbjct  703  QVGVYGKAAPEDFAADYAHWKKVVQHSYLDGMGIEWKSVRNVMDMRAVYGGLAAALRDMN  762

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN V IDSPDTLP+IYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSK+K +C ++
Sbjct  763  VWVMNTVNIDSPDTLPVIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSKLKARCKVL  822

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++VEVDRILRP GKLIVRD  ET+ E+   +KSMH+++RMT S   E +LC +KTMWRP
Sbjct  823  PVLVEVDRILRPNGKLIVRDDKETVDEIVEGVKSMHWEVRMTVSKRKEAMLCARKTMWRP  882

Query  185  KEVQ  174
             E++
Sbjct  883  TEME  886



>ref|NP_001065922.2| Os11g0186300 [Oryza sativa Japonica Group]
 gb|ABG22395.1| dehydration-responsive protein, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF27767.2| Os11g0186300 [Oryza sativa Japonica Group]
Length=867

 Score =   292 bits (747),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 126/185 (68%), Positives = 155/185 (84%), Gaps = 0/185 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGKPAPEDF AD +HW +VV  SYL GMGI+W TVRNVMDM AVYGGFAAAL+D+ 
Sbjct  682  QVGVYGKPAPEDFVADQEHWRKVVRNSYLTGMGIDWKTVRNVMDMRAVYGGFAAALRDMS  741

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V I+SPDTLP+IYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSK+K +C ++
Sbjct  742  VWVMNVVTINSPDTLPVIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSKLKSRCEVL  801

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++VEVDRILRP GKLIVRD  ET+ E++ +++S+ +++RMT S   E +LC +KT WRP
Sbjct  802  PVIVEVDRILRPNGKLIVRDDKETVDEIKGVVRSLQWEVRMTVSKNREAMLCARKTTWRP  861

Query  185  KEVQT  171
             E + 
Sbjct  862  TEAEA  866



>ref|XP_006662791.1| PREDICTED: probable methyltransferase PMT26-like [Oryza brachyantha]
Length=871

 Score =   291 bits (746),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 125/184 (68%), Positives = 157/184 (85%), Gaps = 0/184 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGKPAP+DF AD++HW +VV  SYL GMGI+W TVRNVMDM AVYGGFAAAL+D+ 
Sbjct  686  QVGVYGKPAPDDFVADHEHWKKVVRNSYLTGMGIDWKTVRNVMDMRAVYGGFAAALRDMS  745

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V I+SPDTLP+IYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSK+K +C ++
Sbjct  746  VWVMNVVTINSPDTLPVIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSKLKSRCKVL  805

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++VEVDRILRP GKLIVRD  ET+ E++ +++S+ +++RMT S   E +LC +KT WRP
Sbjct  806  PVIVEVDRILRPNGKLIVRDDKETVDEVQGVVRSLQWEVRMTVSKNREAMLCARKTTWRP  865

Query  185  KEVQ  174
             +V+
Sbjct  866  TDVE  869



>ref|XP_009149307.1| PREDICTED: probable methyltransferase PMT27 [Brassica rapa]
Length=902

 Score =   292 bits (748),  Expect = 1e-88, Method: Composition-based stats.
 Identities = 124/180 (69%), Positives = 152/180 (84%), Gaps = 0/180 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + G+YGKPAP DF  DY+HW  VV+K Y+N +G++WS VRNVMDM AVYGGFAAALKDL+
Sbjct  719  QMGIYGKPAPRDFTTDYEHWKHVVSKVYMNEIGLSWSNVRNVMDMRAVYGGFAAALKDLQ  778

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V I+SPDTLPIIYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSK++ +CNL+
Sbjct  779  VWVMNVVNINSPDTLPIIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSKLRPRCNLV  838

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++ EVDRI+RP GKLIVRD    + E+EN+LKS+H+D+ +T+S   EG+L  QK  WRP
Sbjct  839  PVMAEVDRIVRPGGKLIVRDEANVIREIENMLKSLHWDVHLTFSKHQEGILSAQKGFWRP  898



>ref|NP_001054368.1| Os04g0692400 [Oryza sativa Japonica Group]
 dbj|BAF16282.1| Os04g0692400 [Oryza sativa Japonica Group]
Length=677

 Score =   287 bits (735),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 129/187 (69%), Positives = 161/187 (86%), Gaps = 2/187 (1%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            E GVYGKPA EDF ADY+HW +V++ SY+N +GI+WS VRNVMDM A YGGFAAAL+DLK
Sbjct  489  EAGVYGKPATEDFQADYEHWKQVISNSYMNDLGIDWSAVRNVMDMKAAYGGFAAALRDLK  548

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKR--KCN  372
            +WVMN++ IDSPDTLPIIYERGLFG+YHDWCESFSTYPR+YDLLHA+HLFSKIK+  +C 
Sbjct  549  LWVMNVIPIDSPDTLPIIYERGLFGIYHDWCESFSTYPRTYDLLHANHLFSKIKKSDRCK  608

Query  371  LMGLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMW  192
            L+ ++VEVDRILR  G+LIVRD  ET+ E+E++ KS+H+++R +YS  +EGLL V+KTMW
Sbjct  609  LVAVMVEVDRILRKGGRLIVRDSMETMHEVESMAKSLHWEVRKSYSQDNEGLLFVEKTMW  668

Query  191  RPKEVQT  171
            RP EV+ 
Sbjct  669  RPNEVEA  675



>gb|KHG04009.1| hypothetical protein F383_29196 [Gossypium arboreum]
Length=770

 Score =   290 bits (741),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 126/169 (75%), Positives = 152/169 (90%), Gaps = 0/169 (0%)
 Frame = -2

Query  659  VVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLKVWVMNIVAIDSPDTLPIIYERG  480
            VVTKSY+ GMGINWS+VRNVMDM AVYGGFAAALKD+ +WVMN++ +D PDTLPIIYERG
Sbjct  602  VVTKSYMQGMGINWSSVRNVMDMKAVYGGFAAALKDMNLWVMNVIPVDFPDTLPIIYERG  661

Query  479  LFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPEGKLIVRDHT  300
            LFG+YHDWCESFSTYPRSYDLLHADH+FS++K++CN + +V EVDRILRP GKLI RD  
Sbjct  662  LFGIYHDWCESFSTYPRSYDLLHADHIFSRVKKRCNFVAVVAEVDRILRPGGKLIARDDV  721

Query  299  ETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  153
            ET+TELEN+++SMH+++R++YS   EGLLCVQK+MWRP EV+TL YAIA
Sbjct  722  ETITELENMVRSMHWEVRLSYSKDKEGLLCVQKSMWRPTEVETLTYAIA  770



>ref|XP_004289881.1| PREDICTED: probable methyltransferase PMT24 [Fragaria vesca subsp. 
vesca]
Length=797

 Score =   290 bits (741),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 133/189 (70%), Positives = 159/189 (84%), Gaps = 1/189 (1%)
 Frame = -2

Query  716  VYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLKVWV  537
            V GK APEDF +DYKHW  VV+K+YL GMGI+WS+VRNV+DM AVYGGFAAALKDL VWV
Sbjct  609  VNGKSAPEDFISDYKHWKNVVSKTYLTGMGIDWSSVRNVLDMRAVYGGFAAALKDLNVWV  668

Query  536  MNIVA-IDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGL  360
            MN+V  IDS DTL II+ERGL GMYHDWCESFSTYPR+YD++HADHLFS +K++CNL+ +
Sbjct  669  MNVVPHIDSRDTLAIIFERGLIGMYHDWCESFSTYPRTYDVVHADHLFSVLKKRCNLVVV  728

Query  359  VVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKE  180
            + EVDRILRPEGKLIV D  ETL E+E++ KS+H+DIR TYS  + GLLC+QKT WRP E
Sbjct  729  IAEVDRILRPEGKLIVWDDAETLNEIESMAKSLHWDIRFTYSKDNMGLLCIQKTFWRPTE  788

Query  179  VQTLAYAIA  153
             +T+  AIA
Sbjct  789  QETILSAIA  797



>ref|XP_008338020.1| PREDICTED: probable methyltransferase PMT27 [Malus domestica]
Length=965

 Score =   292 bits (748),  Expect = 2e-88, Method: Composition-based stats.
 Identities = 122/180 (68%), Positives = 152/180 (84%), Gaps = 0/180 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + G+YGKPAP+DF+ DY+HW RV++ +Y+  +GINWS VRN MDM AVYGGFAAALKDLK
Sbjct  777  QMGIYGKPAPQDFSTDYEHWKRVISNTYMKSLGINWSNVRNCMDMRAVYGGFAAALKDLK  836

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V +DSPDTLPIIYERGLFG+YHDWCESFSTYPR+YDLLHADHLFSK+K++C L 
Sbjct  837  VWVMNVVNVDSPDTLPIIYERGLFGIYHDWCESFSTYPRTYDLLHADHLFSKLKKRCKLA  896

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++ EVDRI+RP GK IVRD + T+ E+EN+LKS+H+++ +T S   EG+L  QK  WRP
Sbjct  897  PVLAEVDRIVRPGGKFIVRDESSTIGEVENLLKSLHWEVSLTVSKNQEGMLSAQKGNWRP  956



>ref|XP_006383147.1| dehydration-responsive family protein [Populus trichocarpa]
 gb|ERP60944.1| dehydration-responsive family protein [Populus trichocarpa]
Length=949

 Score =   291 bits (746),  Expect = 3e-88, Method: Composition-based stats.
 Identities = 124/187 (66%), Positives = 154/187 (82%), Gaps = 0/187 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + G+YGKPAP+DFA DY+HW  VV+ SY+  +GI+WS VRNVMDM AVYGGFAAALKDLK
Sbjct  763  QMGIYGKPAPQDFATDYEHWKHVVSNSYMKALGISWSNVRNVMDMRAVYGGFAAALKDLK  822

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            +WV N+V  DSPDTLPIIYERGLFG+YHDWCESFS+YPR+YDLLHADHLFSK+K++C L 
Sbjct  823  IWVFNVVNTDSPDTLPIIYERGLFGIYHDWCESFSSYPRTYDLLHADHLFSKLKKRCQLA  882

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             L+ EVDRI+RP GKLIVRD +  + E+EN+LKS+H+++ +T+S   EGLL  QK  WRP
Sbjct  883  PLLAEVDRIVRPGGKLIVRDESSAIGEVENLLKSLHWEVHLTFSKDQEGLLSAQKGDWRP  942

Query  185  KEVQTLA  165
            +    L+
Sbjct  943  QTYAALS  949



>ref|XP_007137499.1| hypothetical protein PHAVU_009G132000g [Phaseolus vulgaris]
 gb|ESW09493.1| hypothetical protein PHAVU_009G132000g [Phaseolus vulgaris]
Length=833

 Score =   290 bits (741),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 128/193 (66%), Positives = 162/193 (84%), Gaps = 2/193 (1%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYG+ A  +F ADYKHW  V++ +YLNGM I+WS+VRNVMDM A YGGFAAAL+ LK
Sbjct  641  QAGVYGRAASVEFTADYKHWKNVLSHTYLNGMSIDWSSVRNVMDMRAAYGGFAAALRTLK  700

Query  545  --VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCN  372
              VWVMN+V IDSPDTLPIIYERGLFG+YHDWCESF+TYPRSYDLLHAD + S +++KCN
Sbjct  701  FNVWVMNVVPIDSPDTLPIIYERGLFGIYHDWCESFNTYPRSYDLLHADSILSTLRKKCN  760

Query  371  LMGLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMW  192
            +M ++ EVDRILRPEG L+VRD+ ET+ E+E++ KS+H++IR+TY    EGL+C+QKT W
Sbjct  761  IMAVIAEVDRILRPEGYLVVRDNAETVGEIESMAKSLHWEIRLTYIKSGEGLICIQKTFW  820

Query  191  RPKEVQTLAYAIA  153
            RP +V+T+A AIA
Sbjct  821  RPTKVETVASAIA  833



>ref|XP_002310282.2| hypothetical protein POPTR_0007s13620g [Populus trichocarpa]
 gb|EEE90732.2| hypothetical protein POPTR_0007s13620g [Populus trichocarpa]
Length=847

 Score =   290 bits (742),  Expect = 3e-88, Method: Composition-based stats.
 Identities = 123/181 (68%), Positives = 151/181 (83%), Gaps = 0/181 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + G+YGKPAP+DF ADY+HW  VV+ SY+ G+GI+WS VRN+MDM AVYGGFAAALKDLK
Sbjct  661  QMGIYGKPAPQDFEADYEHWKHVVSNSYMKGLGISWSNVRNIMDMRAVYGGFAAALKDLK  720

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWV N+V  DSPDTLPIIYERGLFG+YHDWCESFSTYPR+YDLLHADHLFSK+K++C L 
Sbjct  721  VWVFNVVNTDSPDTLPIIYERGLFGIYHDWCESFSTYPRTYDLLHADHLFSKLKKRCQLA  780

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++ EVDRI RP GKLIVRD +  + E+EN+LKS+H+++ + +S   EGLL  QK  WRP
Sbjct  781  PVLAEVDRIARPGGKLIVRDESSAIEEVENLLKSLHWEVHLIFSKDQEGLLSAQKGEWRP  840

Query  185  K  183
            +
Sbjct  841  Q  841



>gb|KJB40187.1| hypothetical protein B456_007G049800 [Gossypium raimondii]
Length=942

 Score =   291 bits (746),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 125/185 (68%), Positives = 158/185 (85%), Gaps = 0/185 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + G+YGKPAP+DF  D++HW+RVV+K Y++G+GI+WS VRNVMDM AVYGGFAAALKD+K
Sbjct  756  QMGIYGKPAPQDFVKDHEHWTRVVSKLYMSGLGISWSNVRNVMDMRAVYGGFAAALKDIK  815

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V +DSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSK++++C L 
Sbjct  816  VWVMNVVNLDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKLEKRCKLQ  875

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++ EVDRI+RP GKLIVRD ++ + E+EN+LKS+H+++ +T+S   EG+L  QK  WRP
Sbjct  876  PVLAEVDRIVRPGGKLIVRDESDAIGEVENLLKSLHWEVHLTFSKDQEGILSAQKGDWRP  935

Query  185  KEVQT  171
               Q 
Sbjct  936  TAYQA  940



>ref|XP_004149997.1| PREDICTED: probable methyltransferase PMT27-like [Cucumis sativus]
Length=882

 Score =   290 bits (743),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 125/180 (69%), Positives = 155/180 (86%), Gaps = 0/180 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGKPAP+DF+ DY+HW RVV K+Y+NG+GIN S +RNVMDM +VYGGFAAAL+DLK
Sbjct  696  QMGVYGKPAPQDFSTDYEHWKRVVNKTYMNGLGINLSNIRNVMDMRSVYGGFAAALRDLK  755

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V IDSPDTLP+IYERGLFG+YHDWCESFSTYPR+YDLLHADHLFSK+K++C L 
Sbjct  756  VWVMNVVNIDSPDTLPVIYERGLFGIYHDWCESFSTYPRTYDLLHADHLFSKLKKRCKLQ  815

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++ EVDRI+RP GKLIVRD + T+ E+EN+LKS+ +++ +T+S   EGLL  QK  WRP
Sbjct  816  PVLAEVDRIVRPGGKLIVRDESSTIGEVENLLKSLRWEVHLTFSKNQEGLLSAQKGDWRP  875



>gb|KHG06183.1| hypothetical protein F383_31802 [Gossypium arboreum]
Length=1220

 Score =   294 bits (752),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 126/185 (68%), Positives = 159/185 (86%), Gaps = 0/185 (0%)
 Frame = -2

Query  725   ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
             + G+YGKPAP+DF  DY+HW+RVV+K Y++G+GI+WS VRNVMDM AVYGGFAAALKD+K
Sbjct  1034  QMGIYGKPAPQDFVKDYEHWTRVVSKLYMSGLGISWSNVRNVMDMRAVYGGFAAALKDIK  1093

Query  545   VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
             VWVMN+V +DSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSK++++C L 
Sbjct  1094  VWVMNVVNLDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKLEKRCKLQ  1153

Query  365   GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
              ++ EVDRI+RP GKLIVRD ++ + E+EN+LKS+H+++++T+S   EG+L  QK  WRP
Sbjct  1154  PVLAEVDRIVRPGGKLIVRDESDAIGEVENLLKSLHWEVQLTFSKDQEGILSAQKGDWRP  1213

Query  185   KEVQT  171
                Q 
Sbjct  1214  TAYQA  1218



>ref|NP_190676.1| putative methyltransferase PMT27 [Arabidopsis thaliana]
 sp|Q9SD39.1|PMTR_ARATH RecName: Full=Probable methyltransferase PMT27 [Arabidopsis thaliana]
 emb|CAB62629.1| putative protein [Arabidopsis thaliana]
 gb|AEE78746.1| putative methyltransferase PMT27 [Arabidopsis thaliana]
Length=895

 Score =   290 bits (743),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 126/182 (69%), Positives = 154/182 (85%), Gaps = 0/182 (0%)
 Frame = -2

Query  719  GVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLKVW  540
            G+YGKPAP DF  DY+HW  VV+K Y+N +GI+WS VRNVMDM AVYGGFAAALKDL+VW
Sbjct  714  GIYGKPAPRDFTTDYEHWKHVVSKVYMNEIGISWSNVRNVMDMRAVYGGFAAALKDLQVW  773

Query  539  VMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGL  360
            VMN+V I+SPDTLPIIYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSK++ +CNL+ +
Sbjct  774  VMNVVNINSPDTLPIIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSKLRTRCNLVPV  833

Query  359  VVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKE  180
            + EVDRI+RP GKLIVRD +  + E+EN+LKS+H+D+ +T+S   EG+L  QK  WRP+ 
Sbjct  834  MAEVDRIVRPGGKLIVRDESNVIREVENMLKSLHWDVHLTFSKHQEGILSAQKGFWRPET  893

Query  179  VQ  174
             Q
Sbjct  894  SQ  895



>ref|XP_009115787.1| PREDICTED: probable methyltransferase PMT27 [Brassica rapa]
Length=898

 Score =   290 bits (743),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 128/185 (69%), Positives = 153/185 (83%), Gaps = 0/185 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + G+YGKPAP DF  DY+HW  VV+K Y+  MGI+WS VRNVMDM AVYGGFAAALKDL+
Sbjct  712  QMGIYGKPAPLDFTTDYEHWKHVVSKVYMKEMGISWSNVRNVMDMRAVYGGFAAALKDLQ  771

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V I+SPDTLPIIYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSK+K +CNL+
Sbjct  772  VWVMNVVNINSPDTLPIIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSKLKARCNLV  831

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++ EVDRI+RP GKLIVRD    + E+EN+LKS+H+D+ +T+S   EG+L  QK  WRP
Sbjct  832  PVMAEVDRIVRPGGKLIVRDEANVIREIENMLKSLHWDVHLTFSKHQEGILSAQKGFWRP  891

Query  185  KEVQT  171
               QT
Sbjct  892  DTSQT  896



>ref|XP_010469377.1| PREDICTED: probable methyltransferase PMT25 [Camelina sativa]
Length=779

 Score =   288 bits (737),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 125/189 (66%), Positives = 159/189 (84%), Gaps = 0/189 (0%)
 Frame = -2

Query  719  GVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLKVW  540
            GVYGKPA EDF AD + W  +V+KSYL+GM I+WS VRNVMDM AVYGGFAAALKDLK+W
Sbjct  591  GVYGKPAQEDFTADQEKWKTIVSKSYLSGMEIDWSNVRNVMDMRAVYGGFAAALKDLKLW  650

Query  539  VMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGL  360
            VMN+V +D+PDTLPIIYERGLFG+YHDWCESF+TYPR+YDLLHADHLFS ++++C+L+ +
Sbjct  651  VMNVVPVDAPDTLPIIYERGLFGIYHDWCESFNTYPRTYDLLHADHLFSTLRKRCSLVSV  710

Query  359  VVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKE  180
            + E+DRILRP+G  I+RD  ETL E+E ++KSM + ++MT S  +EGLL +QK+ WRP E
Sbjct  711  MAEIDRILRPQGTFIIRDDMETLGEVEKMVKSMKWKVKMTQSKDNEGLLSIQKSWWRPAE  770

Query  179  VQTLAYAIA  153
             +T+  AIA
Sbjct  771  TETIKSAIA  779



>ref|XP_006290554.1| hypothetical protein CARUB_v10016641mg [Capsella rubella]
 gb|EOA23452.1| hypothetical protein CARUB_v10016641mg [Capsella rubella]
Length=967

 Score =   291 bits (745),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 126/184 (68%), Positives = 155/184 (84%), Gaps = 0/184 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + G+YGKPAP DF  DY+HW  VV+K Y+N +GI+WS VRNVMDM AVYGGFAAALKDL+
Sbjct  784  QMGIYGKPAPRDFTTDYEHWKHVVSKVYMNEIGISWSNVRNVMDMRAVYGGFAAALKDLQ  843

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V I+SPDTLPIIYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSK++++CNL+
Sbjct  844  VWVMNVVNINSPDTLPIIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSKLRKRCNLV  903

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++ EVDRI+RP GKLIVRD +  + E+EN+LKS+H+D+ +T+S   EG+L  QK  WRP
Sbjct  904  PVMAEVDRIVRPGGKLIVRDESNVIREVENMLKSLHWDVHLTFSKHQEGILSAQKGFWRP  963

Query  185  KEVQ  174
               Q
Sbjct  964  DTSQ  967



>gb|KDP32665.1| hypothetical protein JCGZ_13663 [Jatropha curcas]
Length=855

 Score =   289 bits (740),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 126/181 (70%), Positives = 153/181 (85%), Gaps = 0/181 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + G+YGKPAP+DFA DY+HW  VV KSY+ G+GI+WS VRN+MDM AVYGGFAAAL DLK
Sbjct  668  QMGIYGKPAPQDFATDYEHWKHVVRKSYMKGLGISWSNVRNIMDMRAVYGGFAAALMDLK  727

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWV+N+V IDSPDTLPIIYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSK+K++C L 
Sbjct  728  VWVLNVVNIDSPDTLPIIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSKLKKRCKLA  787

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++ EVDRI+RP GKLIVRD +  + E+EN+LKS+ +++ +TYS   EGLL  QK  WRP
Sbjct  788  SVMAEVDRIVRPGGKLIVRDESSAIGEVENLLKSLKWEVYLTYSKDQEGLLSAQKGEWRP  847

Query  185  K  183
            +
Sbjct  848  Q  848



>ref|XP_011028617.1| PREDICTED: probable methyltransferase PMT27 [Populus euphratica]
Length=948

 Score =   291 bits (744),  Expect = 7e-88, Method: Composition-based stats.
 Identities = 123/187 (66%), Positives = 154/187 (82%), Gaps = 0/187 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + G+YGKPAP+DFA DY+HW  VV+ SY+  +GI+WS VRNVMDM AVYGGFAAALKD+K
Sbjct  762  QMGIYGKPAPQDFATDYEHWKHVVSNSYMKALGISWSNVRNVMDMRAVYGGFAAALKDMK  821

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            +WV N+V  DSPDTLPIIYERGLFG+YHDWCESFS+YPR+YDLLHADHLFSK+K++C L 
Sbjct  822  IWVFNVVNTDSPDTLPIIYERGLFGIYHDWCESFSSYPRTYDLLHADHLFSKLKKRCQLA  881

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             L+ EVDRI+RP GKLIVRD +  + E+EN+LKS+H+++ +T+S   EGLL  QK  WRP
Sbjct  882  PLLAEVDRIVRPGGKLIVRDESSAIGEVENLLKSLHWEVHLTFSKDQEGLLSAQKGDWRP  941

Query  185  KEVQTLA  165
            +    L+
Sbjct  942  QTYAALS  948



>ref|XP_011025891.1| PREDICTED: LOW QUALITY PROTEIN: probable methyltransferase PMT27 
[Populus euphratica]
Length=1039

 Score =   292 bits (747),  Expect = 7e-88, Method: Composition-based stats.
 Identities = 123/181 (68%), Positives = 151/181 (83%), Gaps = 0/181 (0%)
 Frame = -2

Query  725   ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
             + G+YGKPAP+DF ADY+HW  VV+ SY+ G+GI+WS VRN+MDM AVYGGFAAALKDLK
Sbjct  853   QMGIYGKPAPQDFEADYEHWKHVVSNSYMKGLGISWSNVRNIMDMRAVYGGFAAALKDLK  912

Query  545   VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
             VWV N+V  DSPDTLPIIYERGLFG+YHDWCESFSTYPR+YDLLHADHLFSK+K++C L 
Sbjct  913   VWVFNVVNTDSPDTLPIIYERGLFGIYHDWCESFSTYPRTYDLLHADHLFSKLKKRCQLA  972

Query  365   GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
              ++ EVDRI RP GKLIVRD +  + E+EN+LKS+H+++ + +S   EGLL  QK  WRP
Sbjct  973   PVLAEVDRIARPGGKLIVRDESRAIEEVENLLKSLHWEVHLIFSKDQEGLLIAQKGEWRP  1032

Query  185   K  183
             +
Sbjct  1033  Q  1033



>dbj|BAK05773.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=916

 Score =   290 bits (741),  Expect = 1e-87, Method: Composition-based stats.
 Identities = 122/183 (67%), Positives = 157/183 (86%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGK APEDF ADY+HW RV+ KSYLNG+G++WS VRNVMDM A YGGFAAAL+D K
Sbjct  730  QVGVYGKAAPEDFVADYQHWRRVMDKSYLNGLGVDWSRVRNVMDMRAAYGGFAAALRDHK  789

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V +D+PDTLPII++RGLFGMYHDWCESFSTYPR+YDLLHADHLFSKIK +C ++
Sbjct  790  VWVMNVVNVDAPDTLPIIFDRGLFGMYHDWCESFSTYPRTYDLLHADHLFSKIKDRCAVL  849

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++VEVDRI+RP G +IVRD +  + E+E +L+S+H+D+R+T+S  +EG+L  +K+ WRP
Sbjct  850  PVIVEVDRIVRPGGSIIVRDDSGAVGEVEKLLRSLHWDVRLTFSKNNEGVLFAEKSDWRP  909

Query  185  KEV  177
            + V
Sbjct  910  ELV  912



>gb|KJB29128.1| hypothetical protein B456_005G086100 [Gossypium raimondii]
 gb|KJB29132.1| hypothetical protein B456_005G086100 [Gossypium raimondii]
Length=821

 Score =   288 bits (736),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 127/190 (67%), Positives = 157/190 (83%), Gaps = 0/190 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGK A EDF ADY HW  V+++SYL GMGI+WS+VRNVMDM AVYGGFAAALKDLK
Sbjct  631  QIGVYGKAAQEDFTADYNHWKTVISESYLKGMGIDWSSVRNVMDMKAVYGGFAAALKDLK  690

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V ID+ DTLP+IYERGLFG++HDWCESF+TYPR+YD+LHADHLFS I+ +C L+
Sbjct  691  VWVMNVVPIDAADTLPVIYERGLFGIHHDWCESFNTYPRTYDVLHADHLFSSIQNRCKLV  750

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++ EVDRILRPEGKLIVRD  ET++ +E++ KS+ ++IRM YS   EGLLCV+K  WRP
Sbjct  751  AVIAEVDRILRPEGKLIVRDKAETISAVESMAKSLQWEIRMIYSKDGEGLLCVRKKFWRP  810

Query  185  KEVQTLAYAI  156
               + +  AI
Sbjct  811  TVEEPIKSAI  820



>ref|XP_011470976.1| PREDICTED: probable methyltransferase PMT27 [Fragaria vesca subsp. 
vesca]
Length=931

 Score =   290 bits (741),  Expect = 1e-87, Method: Composition-based stats.
 Identities = 120/180 (67%), Positives = 151/180 (84%), Gaps = 0/180 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + G+YGKPAP+DFA DY+HW RV+  SY+  +GINWS VRNVMDM AVYGGFAAAL+DLK
Sbjct  745  QMGIYGKPAPQDFARDYEHWKRVINNSYMKSLGINWSGVRNVMDMRAVYGGFAAALRDLK  804

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            +WVMN+V +DS DTLPIIYERGLFG+YHDWCESFSTYPR+YDL+HADHLFS +K++C L 
Sbjct  805  IWVMNVVNVDSADTLPIIYERGLFGIYHDWCESFSTYPRTYDLVHADHLFSSLKKRCRLA  864

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++ EVDRI+RP GKLIVRD +  + E+EN+LKS+H+++ +T+S   EG+L  QK  WRP
Sbjct  865  PVMAEVDRIVRPGGKLIVRDESSAIGEVENLLKSLHWEVHLTFSKNQEGMLSAQKGNWRP  924



>ref|XP_002533655.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF28726.1| ATP binding protein, putative [Ricinus communis]
Length=961

 Score =   290 bits (742),  Expect = 2e-87, Method: Composition-based stats.
 Identities = 124/181 (69%), Positives = 151/181 (83%), Gaps = 0/181 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + G+YGKPAP+DFA DY HW  VV  SYL G+GI+WS VRNVMDM AVYGGFAAALKDLK
Sbjct  775  QMGIYGKPAPQDFATDYAHWKHVVRSSYLKGLGISWSNVRNVMDMRAVYGGFAAALKDLK  834

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWV N+V  DSPDTLPII+ERGLFG+YHDWCESFSTYPR+YDLLHADHLFS++K++C L 
Sbjct  835  VWVFNVVNTDSPDTLPIIFERGLFGIYHDWCESFSTYPRTYDLLHADHLFSRLKKRCKLA  894

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++ EVDRI+RP GKLIVRD + T+ E+EN+LKS+ +++ +T+S   EGLL  QK  WRP
Sbjct  895  PVLAEVDRIVRPGGKLIVRDESSTIGEVENLLKSLRWEVHLTFSKDQEGLLSAQKGDWRP  954

Query  185  K  183
            +
Sbjct  955  Q  955



>gb|KJB29130.1| hypothetical protein B456_005G086100 [Gossypium raimondii]
Length=858

 Score =   288 bits (736),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 127/190 (67%), Positives = 157/190 (83%), Gaps = 0/190 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGK A EDF ADY HW  V+++SYL GMGI+WS+VRNVMDM AVYGGFAAALKDLK
Sbjct  668  QIGVYGKAAQEDFTADYNHWKTVISESYLKGMGIDWSSVRNVMDMKAVYGGFAAALKDLK  727

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V ID+ DTLP+IYERGLFG++HDWCESF+TYPR+YD+LHADHLFS I+ +C L+
Sbjct  728  VWVMNVVPIDAADTLPVIYERGLFGIHHDWCESFNTYPRTYDVLHADHLFSSIQNRCKLV  787

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++ EVDRILRPEGKLIVRD  ET++ +E++ KS+ ++IRM YS   EGLLCV+K  WRP
Sbjct  788  AVIAEVDRILRPEGKLIVRDKAETISAVESMAKSLQWEIRMIYSKDGEGLLCVRKKFWRP  847

Query  185  KEVQTLAYAI  156
               + +  AI
Sbjct  848  TVEEPIKSAI  857



>gb|KHG21530.1| hypothetical protein F383_05601 [Gossypium arboreum]
Length=810

 Score =   287 bits (734),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 127/190 (67%), Positives = 157/190 (83%), Gaps = 0/190 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + G+YGK A EDF ADY HW  VV++SYL GMGI+WS+VRNVMDM AVYGGFAAALKDLK
Sbjct  620  QIGIYGKAAQEDFTADYNHWKTVVSESYLKGMGIDWSSVRNVMDMKAVYGGFAAALKDLK  679

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V ID+ DTLP+IYERGLFG++HDWCESF+TYPR+YD+LHADHLFS I+ +C L+
Sbjct  680  VWVMNVVPIDAADTLPVIYERGLFGIHHDWCESFNTYPRAYDVLHADHLFSSIQNRCKLV  739

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++ EVDRILRPEGKLIVRD  ET++ +E++ KS+ ++IRM YS   EGLLCV+K  WRP
Sbjct  740  TVIAEVDRILRPEGKLIVRDKAETISAVESMAKSLQWEIRMIYSKDGEGLLCVRKKFWRP  799

Query  185  KEVQTLAYAI  156
               + +  AI
Sbjct  800  TVEEPIKAAI  809



>ref|XP_010413759.1| PREDICTED: probable methyltransferase PMT25 [Camelina sativa]
Length=779

 Score =   286 bits (732),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 123/189 (65%), Positives = 159/189 (84%), Gaps = 0/189 (0%)
 Frame = -2

Query  719  GVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLKVW  540
            GVYGKPA EDF AD + W  +V+KSYL+GM I+WS VRNVMDM AVYGGFAAALKDLK+W
Sbjct  591  GVYGKPAQEDFTADQEKWKTIVSKSYLSGMEIDWSNVRNVMDMRAVYGGFAAALKDLKLW  650

Query  539  VMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGL  360
            VMN+V +D+PDTLPIIYERGLFG+YHDWCESF+TYPR+YDLLHADHLFS ++++C+L+ +
Sbjct  651  VMNVVPVDAPDTLPIIYERGLFGIYHDWCESFNTYPRTYDLLHADHLFSTLRKRCSLVSV  710

Query  359  VVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKE  180
            + E+DRILRP+G  I+RD  ET+ E+E ++KSM ++++MT S  +EGLL +QK+ WRP E
Sbjct  711  MAEIDRILRPQGTFIIRDDMETIGEVEKMVKSMKWNVKMTQSKDNEGLLSIQKSWWRPAE  770

Query  179  VQTLAYAIA  153
             +T+  AI 
Sbjct  771  TETIKSAIG  779



>gb|EEE51778.1| hypothetical protein OsJ_33227 [Oryza sativa Japonica Group]
Length=867

 Score =   287 bits (735),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 125/185 (68%), Positives = 154/185 (83%), Gaps = 0/185 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGKPAPEDF AD +HW +VV  SYL GMGI+  TVRNVMDM AVYGGFAAAL+D+ 
Sbjct  682  QVGVYGKPAPEDFVADQEHWRKVVRNSYLTGMGIDLKTVRNVMDMRAVYGGFAAALRDMS  741

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V I+SPDTLP+IYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSK+K +C ++
Sbjct  742  VWVMNVVTINSPDTLPVIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSKLKSRCEVL  801

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++VEVDRILRP GKLIVRD  ET+ E++ +++S+ +++RMT S   E +LC +KT WRP
Sbjct  802  PVIVEVDRILRPNGKLIVRDDKETVDEIKGVVRSLQWEVRMTVSKNREAMLCARKTTWRP  861

Query  185  KEVQT  171
             E + 
Sbjct  862  TEAEA  866



>emb|CDP01948.1| unnamed protein product [Coffea canephora]
Length=793

 Score =   286 bits (731),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 123/180 (68%), Positives = 156/180 (87%), Gaps = 0/180 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + G+YGKPAPEDF ADY+HW +VV+K YL+G+GI+WS VRN+MDM AVYGGFAAALKDLK
Sbjct  607  QMGIYGKPAPEDFTADYEHWKQVVSKLYLSGLGISWSDVRNIMDMRAVYGGFAAALKDLK  666

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V ID+PDTLPIIYERGLFG+YHDWCESFS YPR+YDLLHAD LFS++K++C L+
Sbjct  667  VWVMNVVNIDAPDTLPIIYERGLFGIYHDWCESFSAYPRTYDLLHADRLFSRLKKRCKLI  726

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++ EVDRI+RP GK I+RD + T+ E+EN+LKS+H+++ +T+S   EG+L  QKT WRP
Sbjct  727  PVMAEVDRIVRPGGKFIMRDDSSTIREVENVLKSLHWEVHLTFSKNQEGILSAQKTEWRP  786



>gb|EMT24893.1| hypothetical protein F775_19481 [Aegilops tauschii]
Length=1022

 Score =   289 bits (740),  Expect = 5e-87, Method: Composition-based stats.
 Identities = 127/187 (68%), Positives = 150/187 (80%), Gaps = 0/187 (0%)
 Frame = -2

Query  725   ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
             + GVYGKPA +D AAD KHW   V  SYL+GMGI W  VRNV+DM +VYGG AAAL+D+K
Sbjct  836   QGGVYGKPAADDLAADTKHWREAVNSSYLSGMGIEWKNVRNVIDMRSVYGGLAAALRDMK  895

Query  545   VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
             VWVMNIV+++SPDTLPIIYERGL GMYHDWCES STYPRSYDL+HADHLFSK+K +C + 
Sbjct  896   VWVMNIVSVESPDTLPIIYERGLLGMYHDWCESLSTYPRSYDLVHADHLFSKLKYRCKVR  955

Query  365   GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
              ++ EVDRILRPEGK+IVRD  ET  E+E I KS+H+++RM  SN  E LLC  KTMWRP
Sbjct  956   LVMAEVDRILRPEGKMIVRDDRETAEEVERIAKSLHWEVRMAVSNQGERLLCFHKTMWRP  1015

Query  185   KEVQTLA  165
              +VQ L 
Sbjct  1016  TQVQPLG  1022



>ref|XP_010030876.1| PREDICTED: probable methyltransferase PMT27 [Eucalyptus grandis]
 gb|KCW56680.1| hypothetical protein EUGRSUZ_I02378 [Eucalyptus grandis]
Length=964

 Score =   288 bits (737),  Expect = 7e-87, Method: Composition-based stats.
 Identities = 119/180 (66%), Positives = 157/180 (87%), Gaps = 0/180 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            ++G+YGKPAP+DF+ADY+HW RVV+  Y++G+GI+WS VRNVMDM AVYGGFAAALKDL+
Sbjct  778  QSGIYGKPAPQDFSADYEHWKRVVSGLYMSGLGISWSGVRNVMDMRAVYGGFAAALKDLQ  837

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            +WV+N+V +DSPDTLPII+ERGLFG+YHDWCESFSTYPR+YDLLHADHLFSK++++C L 
Sbjct  838  MWVLNVVNVDSPDTLPIIFERGLFGIYHDWCESFSTYPRTYDLLHADHLFSKLRKRCKLA  897

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             ++ EVDRI+RP GK+IVRD +  + E+EN+LKS+H+++ +T+S   EG+L  QK  WRP
Sbjct  898  PVMAEVDRIVRPGGKIIVRDESGAIGEIENLLKSLHWEVHLTFSKDQEGILSAQKGDWRP  957



>gb|EAY80220.1| hypothetical protein OsI_35397 [Oryza sativa Indica Group]
Length=239

 Score =   270 bits (689),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 118/169 (70%), Positives = 144/169 (85%), Gaps = 0/169 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYGKPAPEDF AD +HW +VV  SYL GMGI+W TVRNVMDM AVYGGFAAAL+D+ 
Sbjct  12   QVGVYGKPAPEDFVADQEHWRKVVRNSYLTGMGIDWKTVRNVMDMRAVYGGFAAALRDMS  71

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            VWVMN+V I+SPDTLP+IYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSK+K +C ++
Sbjct  72   VWVMNVVTINSPDTLPVIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSKLKSRCEVL  131

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEG  219
             ++VEVDRILRP GKLIVRD  ET+ E++ +++S+ +++RMT S    G
Sbjct  132  PVIVEVDRILRPNGKLIVRDDKETVDEIKGVVRSLQWEVRMTVSKNRRG  180



>gb|AFW75800.1| hypothetical protein ZEAMMB73_544570 [Zea mays]
Length=915

 Score =   286 bits (732),  Expect = 2e-86, Method: Composition-based stats.
 Identities = 120/184 (65%), Positives = 154/184 (84%), Gaps = 0/184 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYG+PAPEDFA DY HW RVV  SYLNG+GI+WS VRNVMDM A YGGFAAAL + K
Sbjct  729  QAGVYGRPAPEDFAVDYDHWRRVVDGSYLNGLGIDWSRVRNVMDMRAAYGGFAAALWEKK  788

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            +WVMN+V +D+PDTLP+I+ERGL G+YHDWCESFSTYPRSYDLLHADHLFSKIK +C ++
Sbjct  789  IWVMNVVNVDAPDTLPVIFERGLLGIYHDWCESFSTYPRSYDLLHADHLFSKIKDRCAVL  848

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             +VVEVDRI+RP G ++VRD    + E+E +L+S+H+D+R+T+S  DEG++  +K+ WRP
Sbjct  849  PVVVEVDRIVRPGGSIVVRDEAGAVGEVEKLLRSLHWDVRLTFSKNDEGVMYAEKSGWRP  908

Query  185  KEVQ  174
            + V+
Sbjct  909  ELVE  912



>ref|XP_008648870.1| PREDICTED: probable methyltransferase PMT24 [Zea mays]
Length=920

 Score =   286 bits (731),  Expect = 3e-86, Method: Composition-based stats.
 Identities = 120/184 (65%), Positives = 154/184 (84%), Gaps = 0/184 (0%)
 Frame = -2

Query  725  ETGVYGKPAPEDFAADYKHWSRVVTKSYLNGMGINWSTVRNVMDMNAVYGGFAAALKDLK  546
            + GVYG+PAPEDFA DY HW RVV  SYLNG+GI+WS VRNVMDM A YGGFAAAL + K
Sbjct  734  QAGVYGRPAPEDFAVDYDHWRRVVDGSYLNGLGIDWSRVRNVMDMRAAYGGFAAALWEKK  793

Query  545  VWVMNIVAIDSPDTLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLM  366
            +WVMN+V +D+PDTLP+I+ERGL G+YHDWCESFSTYPRSYDLLHADHLFSKIK +C ++
Sbjct  794  IWVMNVVNVDAPDTLPVIFERGLLGIYHDWCESFSTYPRSYDLLHADHLFSKIKDRCAVL  853

Query  365  GLVVEVDRILRPEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  186
             +VVEVDRI+RP G ++VRD    + E+E +L+S+H+D+R+T+S  DEG++  +K+ WRP
Sbjct  854  PVVVEVDRIVRPGGSIVVRDEAGAVGEVEKLLRSLHWDVRLTFSKNDEGVMYAEKSGWRP  913

Query  185  KEVQ  174
            + V+
Sbjct  914  ELVE  917



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1300407706455