BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF029F09

Length=557
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KDP37816.1|  hypothetical protein JCGZ_06718                         199   6e-56   Jatropha curcas
gb|KDP37817.1|  hypothetical protein JCGZ_06719                         192   2e-54   Jatropha curcas
ref|XP_011072475.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    193   3e-54   
ref|XP_011072398.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    193   5e-54   Sesamum indicum [beniseed]
gb|EYU29124.1|  hypothetical protein MIMGU_mgv1a001761mg                192   1e-53   Erythranthe guttata [common monkey flower]
ref|XP_010054021.1|  PREDICTED: long-chain-alcohol oxidase FAO4A        189   2e-52   Eucalyptus grandis [rose gum]
gb|KCW78402.1|  hypothetical protein EUGRSUZ_D02568                     189   2e-52   Eucalyptus grandis [rose gum]
gb|KDO72345.1|  hypothetical protein CISIN_1g0039902mg                  189   2e-52   Citrus sinensis [apfelsine]
ref|XP_006361221.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    188   2e-52   
gb|KCW78401.1|  hypothetical protein EUGRSUZ_D02566                     188   4e-52   Eucalyptus grandis [rose gum]
ref|XP_010054015.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    188   4e-52   Eucalyptus grandis [rose gum]
ref|XP_006482469.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    187   6e-52   Citrus sinensis [apfelsine]
emb|CDP07225.1|  unnamed protein product                                187   7e-52   Coffea canephora [robusta coffee]
ref|XP_006430998.1|  hypothetical protein CICLE_v10011111mg             187   1e-51   Citrus clementina [clementine]
ref|XP_010676697.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    187   1e-51   Beta vulgaris subsp. vulgaris [field beet]
gb|AGK82821.1|  alcohol oxidase                                         186   2e-51   Solanum pimpinellifolium [currant tomato]
gb|AGK82806.1|  alcohol oxidase                                         186   2e-51   Solanum lycopersicum
ref|XP_004244440.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    186   2e-51   
gb|AGK82832.1|  alcohol oxidase                                         186   2e-51   Solanum habrochaites
gb|KGN53996.1|  hypothetical protein Csa_4G246910                       173   2e-51   Cucumis sativus [cucumbers]
ref|XP_011078909.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    185   4e-51   Sesamum indicum [beniseed]
ref|XP_007040880.1|  Long-chain fatty alcohol dehydrogenase famil...    187   5e-51   
gb|AGK82825.1|  alcohol oxidase                                         184   8e-51   Solanum pennellii
ref|XP_010275157.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    184   9e-51   Nelumbo nucifera [Indian lotus]
gb|KHN11789.1|  Long-chain-alcohol oxidase FAO4A                        183   1e-50   Glycine soja [wild soybean]
ref|XP_010274418.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    183   3e-50   
ref|XP_010274420.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    182   3e-50   
ref|XP_003534338.2|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    183   3e-50   Glycine max [soybeans]
ref|XP_010676700.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    182   7e-50   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009626278.1|  PREDICTED: long-chain-alcohol oxidase FAO4A        181   1e-49   Nicotiana tomentosiformis
ref|XP_008237995.1|  PREDICTED: long-chain-alcohol oxidase FAO4A        181   2e-49   Prunus mume [ume]
ref|XP_011028488.1|  PREDICTED: long-chain-alcohol oxidase FAO4A        180   2e-49   Populus euphratica
ref|XP_007210564.1|  hypothetical protein PRUPE_ppa014756mg             179   5e-49   
ref|XP_002519938.1|  electron carrier, putative                         178   9e-49   Ricinus communis
ref|XP_006385149.1|  alcohol oxidase-related family protein             177   2e-48   
gb|AES95453.2|  long-chain-alcohol oxidase FAO1-like protein            177   3e-48   Medicago truncatula
ref|XP_010111511.1|  Long-chain-alcohol oxidase FAO4A                   177   3e-48   
ref|XP_003612495.1|  GMC-type oxidoreductase, putative                  177   3e-48   
gb|KHN27504.1|  Long-chain-alcohol oxidase FAO4A                        176   4e-48   Glycine soja [wild soybean]
ref|XP_003547733.2|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    176   6e-48   Glycine max [soybeans]
ref|XP_006359948.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    176   7e-48   Solanum tuberosum [potatoes]
ref|XP_003629014.1|  GMC-type oxidoreductase, putative                  176   8e-48   Medicago truncatula
ref|XP_006359947.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    175   8e-48   
ref|XP_007158083.1|  hypothetical protein PHAVU_002G122600g             176   1e-47   Phaseolus vulgaris [French bean]
gb|KHN41766.1|  Long-chain-alcohol oxidase FAO4A                        176   1e-47   Glycine soja [wild soybean]
ref|XP_003547818.2|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    176   1e-47   Glycine max [soybeans]
ref|XP_009759689.1|  PREDICTED: long-chain-alcohol oxidase FAO4A        175   1e-47   Nicotiana sylvestris
ref|XP_003517097.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    176   1e-47   Glycine max [soybeans]
ref|XP_006368110.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    170   2e-47   Solanum tuberosum [potatoes]
ref|XP_004246021.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    174   4e-47   Solanum lycopersicum
ref|XP_004509495.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    174   4e-47   Cicer arietinum [garbanzo]
gb|EPS61567.1|  hypothetical protein M569_13229                         173   6e-47   Genlisea aurea
emb|CBI29206.3|  unnamed protein product                                172   1e-46   Vitis vinifera
ref|XP_004512334.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    173   1e-46   Cicer arietinum [garbanzo]
ref|XP_004512333.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    173   1e-46   
ref|XP_002269629.1|  PREDICTED: long-chain-alcohol oxidase FAO4A        172   2e-46   Vitis vinifera
ref|XP_004150760.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    171   2e-46   Cucumis sativus [cucumbers]
ref|XP_004167305.1|  PREDICTED: LOW QUALITY PROTEIN: long-chain-a...    171   2e-46   
ref|XP_007156339.1|  hypothetical protein PHAVU_003G278200g             171   4e-46   Phaseolus vulgaris [French bean]
ref|XP_008444239.1|  PREDICTED: long-chain-alcohol oxidase FAO4A ...    170   8e-46   Cucumis melo [Oriental melon]
ref|XP_008444238.1|  PREDICTED: long-chain-alcohol oxidase FAO4A ...    170   1e-45   Cucumis melo [Oriental melon]
gb|EYU37432.1|  hypothetical protein MIMGU_mgv1a022390mg                168   3e-45   Erythranthe guttata [common monkey flower]
ref|XP_008382148.1|  PREDICTED: LOW QUALITY PROTEIN: long-chain-a...    167   1e-44   
ref|XP_006283178.1|  hypothetical protein CARUB_v10004208mg             165   3e-44   
ref|XP_002867943.1|  hypothetical protein ARALYDRAFT_914728             164   9e-44   
ref|XP_006283177.1|  hypothetical protein CARUB_v10004208mg             164   9e-44   Capsella rubella
ref|XP_009384756.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    164   1e-43   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAA18625.1|  putative protein                                       162   2e-43   Arabidopsis thaliana [mouse-ear cress]
emb|CDY66156.1|  BnaA01g34950D                                          161   3e-43   Brassica napus [oilseed rape]
ref|NP_193673.2|  Long-chain-alcohol oxidase FAO4A                      162   4e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008805948.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    162   7e-43   Phoenix dactylifera
ref|XP_009137007.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    162   8e-43   Brassica rapa
gb|EPS64229.1|  hypothetical protein M569_10552                         161   8e-43   Genlisea aurea
ref|XP_010538590.1|  PREDICTED: long-chain-alcohol oxidase FAO4A ...    161   2e-42   Tarenaya hassleriana [spider flower]
ref|XP_010439724.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    161   2e-42   Camelina sativa [gold-of-pleasure]
ref|XP_010434428.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    161   2e-42   Camelina sativa [gold-of-pleasure]
ref|XP_010449364.1|  PREDICTED: long-chain-alcohol oxidase FAO4A        161   2e-42   Camelina sativa [gold-of-pleasure]
emb|CDX99382.1|  BnaC01g11700D                                          158   5e-42   
ref|XP_009132755.1|  PREDICTED: long-chain-alcohol oxidase FAO4A        160   6e-42   Brassica rapa
gb|KFK28594.1|  hypothetical protein AALP_AA7G017800                    157   4e-41   Arabis alpina [alpine rockcress]
ref|XP_006413983.1|  hypothetical protein EUTSA_v10024528mg             155   1e-40   
emb|CDY01593.1|  BnaC07g35830D                                          156   1e-40   
ref|XP_010942998.1|  PREDICTED: long-chain-alcohol oxidase FAO4A        154   7e-40   Elaeis guineensis
ref|XP_008776965.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    144   2e-36   Phoenix dactylifera
ref|XP_006878629.1|  hypothetical protein AMTR_s00011p00262370          142   2e-35   Amborella trichopoda
ref|XP_010538591.1|  PREDICTED: long-chain-alcohol oxidase FAO4A ...    141   3e-35   Tarenaya hassleriana [spider flower]
ref|XP_001763007.1|  predicted protein                                  140   8e-35   
ref|XP_009396212.1|  PREDICTED: long-chain-alcohol oxidase FAO4A        136   1e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002961172.1|  hypothetical protein SELMODRAFT_73531              136   1e-33   
ref|XP_002966834.1|  hypothetical protein SELMODRAFT_87621              136   2e-33   
gb|ABR17814.1|  unknown                                                 131   8e-32   Picea sitchensis
ref|XP_007132926.1|  hypothetical protein PHAVU_011G136600g             128   1e-30   Phaseolus vulgaris [French bean]
ref|XP_001761391.1|  predicted protein                                  127   2e-30   
ref|XP_001753124.1|  predicted protein                                  126   5e-30   
ref|XP_009384649.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    125   1e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006582261.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like    125   2e-29   Glycine max [soybeans]
gb|KHN28101.1|  Long-chain-alcohol oxidase FAO1-like protein            125   2e-29   Glycine soja [wild soybean]
ref|XP_003540021.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like    124   3e-29   Glycine max [soybeans]
ref|XP_008785203.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    124   3e-29   Phoenix dactylifera
ref|XP_010102592.1|  Long-chain-alcohol oxidase FAO1                    124   3e-29   
ref|XP_006857358.1|  hypothetical protein AMTR_s00067p00112750          124   4e-29   
gb|KCW60303.1|  hypothetical protein EUGRSUZ_H03017                     122   1e-28   Eucalyptus grandis [rose gum]
ref|XP_010023906.1|  PREDICTED: long-chain-alcohol oxidase FAO1         122   1e-28   Eucalyptus grandis [rose gum]
gb|AAL31021.1|AC078948_5  putative alcohol oxidase                      121   1e-28   Oryza sativa Japonica Group [Japonica rice]
gb|EEE51131.1|  hypothetical protein OsJ_31875                          121   1e-28   Oryza sativa Japonica Group [Japonica rice]
gb|AAL31049.1|AC078893_12  putative oxidase                             121   1e-28   Oryza sativa Japonica Group [Japonica rice]
gb|AES89853.2|  long-chain-alcohol oxidase FAO2-like protein            121   3e-28   Medicago truncatula
ref|XP_004157702.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like    118   4e-28   
ref|XP_002528823.1|  disulfide oxidoreductase, putative                 120   6e-28   Ricinus communis
gb|EYU46424.1|  hypothetical protein MIMGU_mgv1a001883mg                120   6e-28   Erythranthe guttata [common monkey flower]
ref|XP_003571871.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    120   7e-28   Brachypodium distachyon [annual false brome]
ref|XP_009790215.1|  PREDICTED: long-chain-alcohol oxidase FAO1         120   8e-28   Nicotiana sylvestris
ref|XP_006354464.1|  PREDICTED: long-chain-alcohol oxidase FAO1-l...    120   8e-28   Solanum tuberosum [potatoes]
ref|XP_009610950.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like    119   1e-27   Nicotiana tomentosiformis
ref|XP_008438494.1|  PREDICTED: long-chain-alcohol oxidase FAO1         119   1e-27   Cucumis melo [Oriental melon]
sp|B5WWZ8.1|FAO1_LOTJA  RecName: Full=Long-chain-alcohol oxidase ...    119   1e-27   Lotus japonicus
ref|XP_006354463.1|  PREDICTED: long-chain-alcohol oxidase FAO1-l...    119   1e-27   Solanum tuberosum [potatoes]
gb|AES61079.2|  long-chain-alcohol oxidase FAO1-like protein            118   1e-27   Medicago truncatula
ref|XP_004247745.1|  PREDICTED: long-chain-alcohol oxidase FAO1         119   1e-27   Solanum lycopersicum
ref|XP_004493801.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    119   1e-27   Cicer arietinum [garbanzo]
emb|CDO99261.1|  unnamed protein product                                119   1e-27   Coffea canephora [robusta coffee]
ref|XP_010262397.1|  PREDICTED: long-chain-alcohol oxidase FAO2-l...    119   2e-27   Nelumbo nucifera [Indian lotus]
gb|EYU18303.1|  hypothetical protein MIMGU_mgv1a001896mg                119   2e-27   Erythranthe guttata [common monkey flower]
ref|XP_010262396.1|  PREDICTED: long-chain-alcohol oxidase FAO2-l...    119   2e-27   
ref|XP_010920358.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    119   2e-27   Elaeis guineensis
gb|KHG17178.1|  Long-chain-alcohol oxidase FAO1                         119   2e-27   Gossypium arboreum [tree cotton]
ref|XP_003607676.1|  Annotation was added to scaffolds in Novembe...    118   2e-27   
ref|XP_009376994.1|  PREDICTED: long-chain-alcohol oxidase FAO1         119   2e-27   Pyrus x bretschneideri [bai li]
ref|XP_004982881.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like    119   2e-27   Setaria italica
ref|XP_011030464.1|  PREDICTED: long-chain-alcohol oxidase FAO1         119   2e-27   Populus euphratica
emb|CDX77516.1|  BnaA07g06540D                                          112   2e-27   
ref|XP_009764096.1|  PREDICTED: long-chain-alcohol oxidase FAO2         119   2e-27   Nicotiana sylvestris
ref|XP_003590828.1|  Annotation was added to scaffolds in Novembe...    117   3e-27   
ref|XP_006420282.1|  hypothetical protein CICLE_v10004403mg             118   3e-27   Citrus clementina [clementine]
ref|XP_009336115.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    118   3e-27   Pyrus x bretschneideri [bai li]
ref|XP_006489686.1|  PREDICTED: long-chain-alcohol oxidase FAO1-l...    118   3e-27   Citrus sinensis [apfelsine]
ref|XP_010264984.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    118   3e-27   Nelumbo nucifera [Indian lotus]
ref|XP_007224435.1|  hypothetical protein PRUPE_ppa021498mg             118   3e-27   
ref|XP_006489687.1|  PREDICTED: long-chain-alcohol oxidase FAO1-l...    118   3e-27   
ref|XP_008224323.1|  PREDICTED: long-chain-alcohol oxidase FAO1         118   3e-27   Prunus mume [ume]
ref|XP_006379996.1|  hypothetical protein POPTR_0008s18750g             115   4e-27   
emb|CAN71289.1|  hypothetical protein VITISV_019349                     118   4e-27   Vitis vinifera
ref|XP_002285334.1|  PREDICTED: long-chain-alcohol oxidase FAO1         118   4e-27   Vitis vinifera
gb|KGN56837.1|  hypothetical protein Csa_3G134850                       117   5e-27   Cucumis sativus [cucumbers]
ref|XP_006489751.1|  PREDICTED: long-chain-alcohol oxidase FAO3-like    117   5e-27   
ref|XP_010684652.1|  PREDICTED: long-chain-alcohol oxidase FAO2         118   5e-27   Beta vulgaris subsp. vulgaris [field beet]
gb|KEH30749.1|  long-chain-alcohol oxidase FAO2-like protein            118   5e-27   Medicago truncatula
ref|XP_010934290.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    117   6e-27   Elaeis guineensis
ref|XP_010466677.1|  PREDICTED: long-chain-alcohol oxidase FAO3-like    117   6e-27   Camelina sativa [gold-of-pleasure]
ref|XP_011080082.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    117   6e-27   Sesamum indicum [beniseed]
ref|XP_004495357.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like    117   6e-27   Cicer arietinum [garbanzo]
ref|XP_004134405.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like    117   7e-27   Cucumis sativus [cucumbers]
ref|XP_002454188.1|  hypothetical protein SORBIDRAFT_04g026370          117   7e-27   Sorghum bicolor [broomcorn]
ref|XP_002981110.1|  hypothetical protein SELMODRAFT_114089             117   8e-27   
gb|EMS51759.1|  Long-chain-alcohol oxidase FAO2                         115   9e-27   Triticum urartu
ref|XP_002314488.2|  alcohol oxidase-related family protein             117   9e-27   
ref|XP_002994642.1|  hypothetical protein SELMODRAFT_138935             116   1e-26   
ref|XP_002982582.1|  hypothetical protein SELMODRAFT_116855             116   1e-26   
gb|KJB10007.1|  hypothetical protein B456_001G179800                    116   1e-26   Gossypium raimondii
ref|XP_007035186.1|  Alcohol oxidase, putative isoform 4                116   1e-26   
gb|KJB72415.1|  hypothetical protein B456_011G177100                    116   1e-26   Gossypium raimondii
ref|XP_011080081.1|  PREDICTED: long-chain-alcohol oxidase FAO2         116   1e-26   Sesamum indicum [beniseed]
gb|KJB72416.1|  hypothetical protein B456_011G177100                    116   1e-26   Gossypium raimondii
ref|XP_007035183.1|  Fatty alcohol oxidase 3 isoform 1                  116   2e-26   
gb|KJB10008.1|  hypothetical protein B456_001G179800                    116   2e-26   Gossypium raimondii
ref|XP_002272123.2|  PREDICTED: long-chain-alcohol oxidase FAO2-like    116   2e-26   Vitis vinifera
gb|KHN30591.1|  Long-chain-alcohol oxidase FAO1                         116   2e-26   Glycine soja [wild soybean]
gb|KJB10006.1|  hypothetical protein B456_001G179800                    116   2e-26   Gossypium raimondii
ref|XP_007162567.1|  hypothetical protein PHAVU_001G162800g             116   2e-26   Phaseolus vulgaris [French bean]
ref|XP_006589282.1|  PREDICTED: long-chain-alcohol oxidase FAO1-l...    115   2e-26   
ref|XP_008235630.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    116   2e-26   Prunus mume [ume]
emb|CDX94858.1|  BnaC03g43300D                                          116   2e-26   
ref|XP_010488398.1|  PREDICTED: long-chain-alcohol oxidase FAO3-like    116   2e-26   Camelina sativa [gold-of-pleasure]
ref|XP_011029789.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like    116   2e-26   Populus euphratica
ref|XP_010512451.1|  PREDICTED: long-chain-alcohol oxidase FAO3         116   2e-26   Camelina sativa [gold-of-pleasure]
ref|XP_006412937.1|  hypothetical protein EUTSA_v10024496mg             115   2e-26   
gb|KJB72414.1|  hypothetical protein B456_011G177100                    116   2e-26   Gossypium raimondii
ref|XP_007035188.1|  Fatty alcohol oxidase 3 isoform 6                  115   2e-26   
ref|XP_006589281.1|  PREDICTED: long-chain-alcohol oxidase FAO1-l...    115   2e-26   Glycine max [soybeans]
gb|EAY78905.1|  hypothetical protein OsI_34008                          115   3e-26   Oryza sativa Indica Group [Indian rice]
ref|XP_004289970.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    115   3e-26   Fragaria vesca subsp. vesca
emb|CDP11641.1|  unnamed protein product                                115   3e-26   Coffea canephora [robusta coffee]
ref|XP_010093072.1|  Long-chain-alcohol oxidase FAO2                    115   4e-26   Morus notabilis
ref|XP_007200494.1|  hypothetical protein PRUPE_ppa018458mg             115   4e-26   Prunus persica
tpg|DAA49655.1|  TPA: hypothetical protein ZEAMMB73_468308              113   4e-26   
ref|XP_010069617.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    115   4e-26   Eucalyptus grandis [rose gum]
gb|ACF88407.1|  unknown                                                 113   4e-26   Zea mays [maize]
gb|ACF22878.1|  alcohol oxidase                                         115   4e-26   Glycine max [soybeans]
gb|EEE51130.1|  hypothetical protein OsJ_31873                          114   4e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004247518.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    115   4e-26   Solanum lycopersicum
gb|AAL31027.1|AC078948_11  putative alcohol oxidase                     114   4e-26   Oryza sativa Japonica Group [Japonica rice]
gb|KHN02487.1|  Long-chain-alcohol oxidase FAO2                         115   4e-26   Glycine soja [wild soybean]
ref|XP_004982883.1|  PREDICTED: long-chain-alcohol oxidase FAO1-l...    115   4e-26   Setaria italica
ref|NP_001064839.2|  Os10g0474800                                       114   4e-26   
ref|XP_003554295.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    115   4e-26   Glycine max [soybeans]
ref|XP_003575383.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    115   5e-26   Brachypodium distachyon [annual false brome]
ref|XP_002311685.2|  alcohol oxidase-related family protein             115   5e-26   Populus trichocarpa [western balsam poplar]
gb|KEH23951.1|  long-chain-alcohol oxidase FAO1                         114   5e-26   Medicago truncatula
ref|XP_006412936.1|  hypothetical protein EUTSA_v10024496mg             115   5e-26   Eutrema salsugineum [saltwater cress]
ref|XP_009594479.1|  PREDICTED: long-chain-alcohol oxidase FAO2         115   5e-26   Nicotiana tomentosiformis
ref|XP_004982882.1|  PREDICTED: long-chain-alcohol oxidase FAO1-l...    115   6e-26   Setaria italica
ref|NP_001176205.1|  Os10g0474966                                       114   7e-26   
ref|XP_002960521.1|  hypothetical protein SELMODRAFT_74601              114   7e-26   
ref|XP_011091281.1|  PREDICTED: long-chain-alcohol oxidase FAO1         114   7e-26   Sesamum indicum [beniseed]
ref|XP_002967201.1|  hypothetical protein SELMODRAFT_87684              114   7e-26   
gb|EYU46421.1|  hypothetical protein MIMGU_mgv1a001868mg                114   8e-26   Erythranthe guttata [common monkey flower]
gb|AAP54248.2|  GMC oxidoreductase family protein, expressed            114   8e-26   Oryza sativa Japonica Group [Japonica rice]
gb|AAL31024.1|AC078948_8  putative alcohol oxidase                      114   8e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008364320.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    114   8e-26   
ref|XP_002454190.1|  hypothetical protein SORBIDRAFT_04g026390          114   9e-26   Sorghum bicolor [broomcorn]
ref|XP_004152057.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    114   9e-26   Cucumis sativus [cucumbers]
gb|EPS58840.1|  hypothetical protein M569_15969                         114   9e-26   Genlisea aurea
gb|ACR36076.1|  unknown                                                 113   9e-26   Zea mays [maize]
gb|KFK29401.1|  hypothetical protein AALP_AA7G128800                    114   9e-26   Arabis alpina [alpine rockcress]
sp|B5WWZ9.1|FAO2_LOTJA  RecName: Full=Long-chain-alcohol oxidase ...    114   1e-25   Lotus japonicus
tpg|DAA49654.1|  TPA: hypothetical protein ZEAMMB73_468308              113   1e-25   
ref|XP_009119340.1|  PREDICTED: long-chain-alcohol oxidase FAO1         114   1e-25   Brassica rapa
ref|XP_003574052.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like    114   1e-25   Brachypodium distachyon [annual false brome]
ref|NP_001142399.1|  uncharacterized protein LOC100274574               113   2e-25   Zea mays [maize]
gb|KEH23950.1|  long-chain-alcohol oxidase FAO1                         113   2e-25   Medicago truncatula
ref|XP_002464496.1|  hypothetical protein SORBIDRAFT_01g019480          113   2e-25   
ref|XP_008804287.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    113   2e-25   Phoenix dactylifera
ref|XP_007144044.1|  hypothetical protein PHAVU_007G124200g             113   2e-25   Phaseolus vulgaris [French bean]
emb|CDX89850.1|  BnaA10g02320D                                          113   2e-25   
gb|KJB38384.1|  hypothetical protein B456_006G252500                    113   3e-25   Gossypium raimondii
emb|CDX92884.1|  BnaC07g41420D                                          113   3e-25   
ref|XP_010036770.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    113   3e-25   Eucalyptus grandis [rose gum]
ref|XP_011459707.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    112   3e-25   Fragaria vesca subsp. vesca
ref|XP_002464494.1|  hypothetical protein SORBIDRAFT_01g019460          112   3e-25   
gb|EPS66779.1|  hypothetical protein M569_07992                         113   3e-25   Genlisea aurea
ref|XP_008668721.1|  PREDICTED: uncharacterized protein LOC100274...    113   3e-25   Zea mays [maize]
emb|CDY18199.1|  BnaC05g02220D                                          113   3e-25   Brassica napus [oilseed rape]
gb|KDP40361.1|  hypothetical protein JCGZ_02359                         113   3e-25   Jatropha curcas
gb|KDP26499.1|  hypothetical protein JCGZ_17657                         112   3e-25   Jatropha curcas
ref|XP_009137800.1|  PREDICTED: long-chain-alcohol oxidase FAO4B        112   3e-25   Brassica rapa
ref|XP_010532671.1|  PREDICTED: long-chain-alcohol oxidase FAO3-like    112   3e-25   Tarenaya hassleriana [spider flower]
ref|XP_008447391.1|  PREDICTED: LOW QUALITY PROTEIN: long-chain-a...    112   3e-25   
dbj|BAK02336.1|  predicted protein                                      112   3e-25   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006420281.1|  hypothetical protein CICLE_v10004405mg             112   4e-25   Citrus clementina [clementine]
ref|XP_006443786.1|  hypothetical protein CICLE_v10018992mg             112   4e-25   Citrus clementina [clementine]
ref|XP_010526493.1|  PREDICTED: long-chain-alcohol oxidase FAO4B-...    112   4e-25   Tarenaya hassleriana [spider flower]
ref|XP_010433200.1|  PREDICTED: long-chain-alcohol oxidase FAO4B        112   5e-25   Camelina sativa [gold-of-pleasure]
ref|XP_008382898.1|  PREDICTED: LOW QUALITY PROTEIN: long-chain-a...    112   5e-25   
ref|XP_006296686.1|  hypothetical protein CARUB_v10013046mg             112   5e-25   Capsella rubella
gb|KDO60414.1|  hypothetical protein CISIN_1g004496mg                   112   5e-25   Citrus sinensis [apfelsine]
ref|XP_011462285.1|  PREDICTED: long-chain-alcohol oxidase FAO1 i...    112   6e-25   Fragaria vesca subsp. vesca
ref|XP_004296386.1|  PREDICTED: long-chain-alcohol oxidase FAO1 i...    112   7e-25   Fragaria vesca subsp. vesca
ref|XP_002869492.1|  hypothetical protein ARALYDRAFT_491906             112   7e-25   Arabidopsis lyrata subsp. lyrata
ref|XP_009102621.1|  PREDICTED: long-chain-alcohol oxidase FAO3         111   8e-25   Brassica rapa
gb|KHG12235.1|  Long-chain-alcohol oxidase FAO1                         111   8e-25   Gossypium arboreum [tree cotton]
gb|ACF87929.1|  unknown                                                 109   8e-25   Zea mays [maize]
emb|CAC87643.1|  alcohol oxidase                                        111   8e-25   Arabidopsis thaliana [mouse-ear cress]
dbj|BAK00483.1|  predicted protein                                      110   9e-25   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDX85097.1|  BnaC07g08090D                                          111   9e-25   
emb|CDP03771.1|  unnamed protein product                                111   9e-25   Coffea canephora [robusta coffee]
ref|XP_006283182.1|  hypothetical protein CARUB_v10004212mg             111   1e-24   Capsella rubella
ref|XP_002464495.1|  hypothetical protein SORBIDRAFT_01g019470          111   1e-24   Sorghum bicolor [broomcorn]
ref|XP_010548742.1|  PREDICTED: long-chain-alcohol oxidase FAO4B-...    111   1e-24   Tarenaya hassleriana [spider flower]
emb|CDX92985.1|  BnaA03g37070D                                          111   1e-24   
ref|NP_566729.1|  long-chain-alcohol oxidase FAO3                       111   1e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007050220.1|  Alcohol oxidase                                    110   2e-24   
emb|CDY51703.1|  BnaA03g58930D                                          110   2e-24   Brassica napus [oilseed rape]
ref|XP_008664883.1|  PREDICTED: long-chain-alcohol oxidase FAO1         110   2e-24   Zea mays [maize]
ref|XP_009136067.1|  PREDICTED: long-chain-alcohol oxidase FAO3-like    110   3e-24   Brassica rapa
dbj|BAJ86655.1|  predicted protein                                      110   3e-24   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006367233.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    110   3e-24   Solanum tuberosum [potatoes]
ref|XP_002889487.1|  hypothetical protein ARALYDRAFT_470376             109   4e-24   Arabidopsis lyrata subsp. lyrata
ref|XP_010447958.1|  PREDICTED: long-chain-alcohol oxidase FAO4B-...    109   4e-24   Camelina sativa [gold-of-pleasure]
emb|CDX98614.1|  BnaA03g43990D                                          100   4e-24   
ref|XP_006306477.1|  hypothetical protein CARUB_v10012453mg             109   5e-24   Capsella rubella
gb|EMT04470.1|  Putative GMC-type oxidoreductase                        109   7e-24   
ref|XP_004953134.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    108   7e-24   Setaria italica
gb|KFK39637.1|  hypothetical protein AALP_AA3G269600                    108   7e-24   Arabis alpina [alpine rockcress]
ref|XP_010438427.1|  PREDICTED: long-chain-alcohol oxidase FAO4B-...    108   7e-24   Camelina sativa [gold-of-pleasure]
dbj|GAN00881.1|  conserved hypothetical protein                         108   8e-24   Mucor ambiguus
ref|NP_194586.1|  Long-chain-alcohol oxidase FAO4B                      108   8e-24   Arabidopsis thaliana [mouse-ear cress]
gb|AAK64154.1|  unknown protein                                         108   8e-24   Arabidopsis thaliana [mouse-ear cress]
gb|AAM63097.1|  unknown                                                 108   8e-24   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001148058.1|  oxidoreductase                                     108   1e-23   
gb|ACN27562.1|  unknown                                                 108   1e-23   
ref|XP_002883430.1|  hypothetical protein ARALYDRAFT_479855             108   1e-23   
ref|XP_010457422.1|  PREDICTED: long-chain-alcohol oxidase FAO1         108   1e-23   
ref|XP_010670985.1|  PREDICTED: long-chain-alcohol oxidase FAO1         108   1e-23   
ref|XP_006418179.1|  hypothetical protein EUTSA_v10006882mg             108   1e-23   
ref|XP_006406028.1|  hypothetical protein EUTSA_v10020141mg             108   1e-23   
emb|CEP11230.1|  hypothetical protein                                   108   2e-23   
ref|XP_010532672.1|  PREDICTED: long-chain-alcohol oxidase FAO3-like    107   2e-23   
ref|XP_004505474.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like    107   3e-23   
gb|KFK42743.1|  hypothetical protein AALP_AA1G034000                    106   4e-23   
ref|XP_004982885.1|  PREDICTED: long-chain-alcohol oxidase FAO1-l...    106   4e-23   
ref|XP_004982884.1|  PREDICTED: long-chain-alcohol oxidase FAO1-l...    106   4e-23   
gb|EEC73620.1|  hypothetical protein OsI_08118                          106   5e-23   
gb|AAD10696.1|  Unknown protein                                         106   6e-23   
ref|NP_001047464.1|  Os02g0621800                                       106   6e-23   
ref|NP_171895.2|  long-chain-alcohol oxidase FAO1                       106   6e-23   
gb|EPB87889.1|  hypothetical protein HMPREF1544_05296                   105   9e-23   
gb|EEE57396.1|  hypothetical protein OsJ_07570                          106   9e-23   
ref|XP_002529832.1|  electron carrier, putative                         105   1e-22   
ref|XP_010475034.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like    105   1e-22   
ref|XP_010532673.1|  PREDICTED: long-chain-alcohol oxidase FAO3-like    105   1e-22   
ref|XP_009369441.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    104   3e-22   
ref|XP_009369442.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    103   4e-22   
emb|CBI23676.3|  unnamed protein product                                103   5e-22   
gb|KFH71384.1|  hypothetical protein MVEG_01683                         102   2e-21   
gb|EXX66452.1|  hypothetical protein RirG_123640                        102   2e-21   
emb|CBI37146.3|  unnamed protein product                                101   2e-21   
gb|EIE83566.1|  hypothetical protein RO3G_08271                         101   3e-21   
emb|CEP11610.1|  hypothetical protein                                 99.8    9e-21   
gb|AGC65582.1|  fatty alcohol oxidase                                 98.6    3e-20   
ref|XP_004361070.1|  glucose-methanol-choline oxidoreductase          98.2    5e-20   
ref|WP_029214956.1|  hypothetical protein                             97.8    5e-20   
emb|CDS08066.1|  hypothetical protein LRAMOSA02015                    97.4    6e-20   
gb|KHN10761.1|  Long-chain-alcohol oxidase FAO2                       96.7    8e-20   
ref|XP_009831227.1|  hypothetical protein, variant 5                  96.7    1e-19   
ref|XP_009831226.1|  hypothetical protein, variant 4                  96.7    1e-19   
gb|EMT02982.1|  Putative GMC-type oxidoreductase                      96.7    1e-19   
gb|ESA06032.1|  hypothetical protein GLOINDRAFT_82554                 96.3    1e-19   
ref|XP_009831229.1|  hypothetical protein, variant 1                  96.7    2e-19   
ref|XP_009831225.1|  hypothetical protein H257_07411                  96.7    2e-19   
ref|WP_040443572.1|  hypothetical protein                             95.9    2e-19   
ref|WP_020101185.1|  hypothetical protein                             95.5    3e-19   
gb|EFH90466.1|  glucose-methanol-choline oxidoreductase               95.5    3e-19   
ref|WP_029120493.1|  GMC oxidoreductase                               95.1    4e-19   
ref|XP_008871235.1|  hypothetical protein H310_07607                  95.1    4e-19   
emb|CEJ01770.1|  hypothetical protein RMCBS344292_15791               95.1    4e-19   
gb|EPB86823.1|  hypothetical protein HMPREF1544_06348                 94.7    5e-19   
emb|CEG74394.1|  hypothetical protein RMATCC62417_09621               94.7    6e-19   
ref|XP_002622231.1|  long chain fatty alcohol oxidase                 94.7    6e-19   
emb|CEG67601.1|  hypothetical protein RMATCC62417_04004               94.7    6e-19   
emb|CEI89775.1|  hypothetical protein RMCBS344292_04123               94.7    6e-19   
gb|EEQ89581.1|  long chain fatty alcohol oxidase                      94.7    6e-19   
ref|XP_003071927.1|  GMC oxidoreductase family protein                94.0    1e-18   
gb|EFW14100.1|  long chain fatty alcohol oxidase                      94.0    1e-18   
ref|XP_001243546.1|  hypothetical protein CIMG_02987                  94.0    1e-18   
dbj|GAN06400.1|  long chain fatty acid oxidase                        93.6    1e-18   
ref|XP_010523169.1|  PREDICTED: LOW QUALITY PROTEIN: long-chain-a...  93.6    1e-18   
ref|WP_043738716.1|  oxidoreductase                                   93.2    1e-18   
ref|XP_002543430.1|  conserved hypothetical protein                   92.4    2e-18   
ref|XP_629786.1|  glucose-methanol-choline oxidoreductase             93.6    2e-18   
gb|KDO33323.1|  hypothetical protein SPRG_02132                       92.8    3e-18   
ref|WP_039798089.1|  oxidoreductase                                   91.7    5e-18   
ref|XP_003171263.1|  fatty alcohol oxidase                            92.0    6e-18   
emb|CBJ27378.1|  oxidoreductase                                       92.4    6e-18   
ref|WP_027004897.1|  hypothetical protein                             91.3    9e-18   
ref|XP_008615139.1|  hypothetical protein SDRG_10901                  91.3    9e-18   
gb|EKG12277.1|  Glucose-methanol-choline oxidoreductase               91.3    9e-18   
ref|WP_025352553.1|  oxidoreductase                                   90.9    9e-18   
ref|XP_002788971.1|  long chain fatty acid oxidase                    90.9    1e-17   
gb|EGD92018.2|  hypothetical protein TERG_08235                       87.8    1e-17   
ref|WP_018162755.1|  hypothetical protein                             90.5    2e-17   
ref|WP_043397728.1|  hypothetical protein                             90.1    2e-17   
ref|XP_003018036.1|  hypothetical protein TRV_07960                   90.5    2e-17   
ref|XP_002841296.1|  hypothetical protein                             90.1    2e-17   
ref|XP_006662436.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like  89.4    3e-17   
dbj|GAM23381.1|  hypothetical protein SAMD00019534_065560             89.7    3e-17   
gb|EEH19591.1|  hypothetical protein PABG_07795                       89.4    4e-17   
ref|XP_010762144.1|  hypothetical protein PADG_06552                  89.4    4e-17   
ref|XP_011124651.1|  hypothetical protein AOL_s00097g516              89.4    5e-17   
ref|XP_006692351.1|  hypothetical protein CTHT_0018560                89.4    5e-17   
gb|EGD99881.1|  long chain fatty alcohol oxidase                      89.0    5e-17   
gb|EMS48507.1|  Long-chain-alcohol oxidase FAO1                       88.6    5e-17   
gb|EZF29717.1|  hypothetical protein H101_06625                       89.0    5e-17   
ref|WP_026239882.1|  oxidoreductase                                   88.6    7e-17   
dbj|GAN00882.1|  long chain fatty acid oxidase                        88.6    7e-17   
ref|WP_021030799.1|  hypothetical protein                             88.6    7e-17   
gb|KEY78297.1|  long chain fatty alcohol oxidase                      88.6    8e-17   
ref|XP_753079.1|  long chain fatty alcohol oxidase                    88.6    8e-17   
ref|XP_008026917.1|  hypothetical protein SETTUDRAFT_20639            88.2    1e-16   
ref|XP_005644346.1|  FAD/NAD(P)-binding domain-containing protein     87.4    1e-16   
ref|WP_036542894.1|  oxidoreductase                                   88.2    1e-16   
ref|XP_009831231.1|  hypothetical protein H257_07412                  88.2    1e-16   
ref|XP_009038989.1|  hypothetical protein AURANDRAFT_9609             81.3    1e-16   
ref|WP_043692605.1|  oxidoreductase                                   87.8    1e-16   
ref|XP_003011696.1|  hypothetical protein ARB_02250                   87.8    1e-16   
ref|XP_005650828.1|  FAD/NAD(P)-binding domain-containing protein     87.4    1e-16   
ref|WP_040872144.1|  oxidoreductase                                   87.4    1e-16   
ref|WP_039822949.1|  oxidoreductase                                   87.4    1e-16   
ref|XP_003231449.1|  long chain fatty alcohol oxidase                 87.4    1e-16   
gb|KIX07916.1|  hypothetical protein Z518_02570                       87.8    2e-16   
ref|WP_013474775.1|  oxidoreductase                                   87.4    2e-16   
ref|WP_007506841.1|  oxidoreductase                                   87.4    2e-16   
ref|WP_040833364.1|  oxidoreductase                                   87.4    2e-16   
gb|EZF78359.1|  hypothetical protein H105_00612                       87.4    2e-16   
gb|EZF27387.1|  hypothetical protein H100_00625                       87.4    2e-16   
ref|WP_013285320.1|  oxidoreductase                                   87.0    2e-16   
ref|WP_030270415.1|  oxidoreductase                                   87.0    2e-16   
ref|XP_658227.1|  hypothetical protein AN0623.2                       87.4    2e-16   
ref|WP_006541316.1|  oxidoreductase                                   86.7    3e-16   
ref|WP_040786198.1|  oxidoreductase                                   86.7    3e-16   
ref|XP_002842592.1|  long chain fatty acid oxidase                    86.7    3e-16   
gb|EEC67160.1|  hypothetical protein OsI_34014                        86.7    4e-16   
ref|WP_030525445.1|  oxidoreductase                                   86.3    5e-16   
ref|XP_001821106.1|  long chain fatty alcohol oxidase                 86.3    5e-16   
gb|EIT74840.1|  choline dehydrogenase                                 86.3    5e-16   
ref|XP_001268562.1|  long chain fatty alcohol oxidase, putative       86.3    5e-16   
ref|XP_003294587.1|  hypothetical protein DICPUDRAFT_159608           85.9    6e-16   
ref|XP_001264046.1|  long chain fatty alcohol oxidase, putative       85.9    6e-16   
ref|WP_017869768.1|  MULTISPECIES: hypothetical protein               85.5    7e-16   
gb|EMS67203.1|  Long-chain-alcohol oxidase FAO2                       84.0    7e-16   
gb|EMS23820.1|  long chain fatty alcohol oxidase                      85.5    8e-16   
gb|EGU13115.1|  Long chain fatty alcohol oxidase                      85.5    8e-16   
emb|CDR40807.1|  RHTO0S05e07470g1_1                                   85.5    8e-16   
ref|XP_001904377.1|  hypothetical protein                             85.5    8e-16   
ref|WP_010889387.1|  GMC oxidoreductase                               85.5    9e-16   
ref|WP_034349962.1|  GMC oxidoreductase                               85.1    9e-16   
ref|XP_002479333.1|  long chain fatty alcohol oxidase, putative       85.9    9e-16   
ref|XP_003665019.1|  hypothetical protein MYCTH_103590                85.5    1e-15   
ref|WP_028073982.1|  hypothetical protein                             85.1    1e-15   
dbj|GAM91611.1|  hypothetical protein ANO11243_096630                 85.1    1e-15   
ref|WP_043523244.1|  hypothetical protein                             85.1    1e-15   
dbj|GAM35263.1|  hypothetical protein TCE0_017r03459                  85.1    1e-15   
dbj|BAD03162.1|  alcohol oxidase-like                                 80.9    1e-15   
ref|WP_040863732.1|  oxidoreductase                                   84.7    1e-15   
dbj|GAM49565.1|  oxidoreductase                                       84.7    1e-15   
ref|XP_007837981.1|  hypothetical protein PFICI_11209                 84.7    2e-15   
ref|WP_014351288.1|  oxidoreductase                                   84.3    2e-15   
ref|XP_006648845.1|  PREDICTED: LOW QUALITY PROTEIN: long-chain-a...  84.3    2e-15   
ref|WP_040721573.1|  oxidoreductase                                   84.3    2e-15   
gb|KFY48297.1|  hypothetical protein V495_01464                       84.7    2e-15   
ref|WP_042261336.1|  oxidoreductase                                   84.3    2e-15   
ref|WP_024806286.1|  oxidoreductase                                   84.3    2e-15   
ref|WP_032385620.1|  hypothetical protein                             84.3    2e-15   
ref|WP_015355043.1|  oxidoreductase GMC-type                          84.0    2e-15   
ref|WP_020786429.1|  GMC oxidoreductase                               84.0    3e-15   
ref|WP_011741213.1|  oxidoreductase                                   84.0    3e-15   
gb|EUA88017.1|  GMC oxidoreductase family protein                     84.0    3e-15   
gb|ERS99077.1|  hypothetical protein HMPREF1624_04272                 84.0    3e-15   
ref|WP_012826512.1|  glucose-methanol-choline oxidoreductase          84.0    3e-15   
ref|WP_027460446.1|  GMC oxidoreductase                               83.6    3e-15   
ref|WP_040816569.1|  oxidoreductase                                   83.6    4e-15   
gb|AFG69593.1|  hypothetical protein CL3357Contig1_03                 77.0    4e-15   
ref|WP_020728087.1|  GMC oxidoreductase                               83.2    4e-15   
ref|WP_012393436.1|  oxidoreductase                                   83.2    4e-15   
gb|KIW04861.1|  hypothetical protein PV09_04043                       83.6    4e-15   
ref|XP_002147053.1|  long chain fatty alcohol oxidase, putative       83.6    4e-15   
ref|WP_020724566.1|  GMC oxidoreductase                               83.2    4e-15   
gb|KFY79221.1|  hypothetical protein V499_01756                       83.6    5e-15   
gb|KIW55196.1|  hypothetical protein PV05_07498                       83.6    5e-15   
gb|ELR10689.1|  hypothetical protein GMDG_04950                       83.2    5e-15   
ref|WP_033245952.1|  MULTISPECIES: oxidoreductase                     83.2    5e-15   
gb|KFZ00641.1|  hypothetical protein V501_10589                       83.2    6e-15   
gb|EPB87888.1|  hypothetical protein HMPREF1544_05295                 82.8    6e-15   
ref|XP_001214264.1|  conserved hypothetical protein                   82.8    6e-15   
gb|KFX48806.1|  Long-chain-alcohol oxidase FAO2                       82.8    7e-15   
ref|WP_040788581.1|  oxidoreductase                                   82.4    7e-15   
ref|WP_020020150.1|  hypothetical protein                             82.0    1e-14   
ref|WP_036504871.1|  oxidoreductase                                   82.0    1e-14   
ref|WP_039780531.1|  oxidoreductase                                   82.0    1e-14   
gb|AFG69594.1|  hypothetical protein CL3357Contig1_03                 75.9    1e-14   
ref|WP_034404879.1|  GMC oxidoreductase                               82.0    1e-14   
gb|AGQ19884.1|  MedDCM-OCT-S43-C48-cds25                              82.0    1e-14   
gb|AGQ19576.1|  MedDCM-OCT-S38-C2-cds46                               82.0    1e-14   
ref|WP_033090122.1|  oxidoreductase                                   82.0    1e-14   
gb|EPE03522.1|  long chain fatty acid oxidase                         82.0    1e-14   
ref|XP_003654573.1|  hypothetical protein THITE_2117674               82.0    1e-14   
ref|WP_040863672.1|  oxidoreductase                                   81.6    1e-14   
dbj|BAD03777.1|  hypothetical protein                                 75.5    1e-14   
gb|AEW09036.1|  hypothetical protein CL3357Contig1_03                 75.5    1e-14   
gb|EZG10707.1|  long chain fatty alcohol oxidase                      81.6    2e-14   
ref|XP_009851267.1|  hypothetical protein NEUTE1DRAFT_82541           81.6    2e-14   
gb|EHK24705.1|  hypothetical protein TRIVIDRAFT_54537                 81.6    2e-14   
gb|KIH94120.1|  long-chain fatty alcohol dehydrogenase                82.0    2e-14   
gb|KIW40506.1|  hypothetical protein PV06_07697                       81.6    2e-14   
ref|XP_007684042.1|  GMC oxidoreductase                               81.6    2e-14   
emb|CEP11229.1|  hypothetical protein                                 81.3    2e-14   
ref|WP_019202088.1|  hypothetical protein                             81.3    2e-14   
gb|EWC47090.1|  hypothetical protein DRE_03459                        81.6    2e-14   
ref|XP_007804339.1|  hypothetical protein EPUS_03557                  81.3    2e-14   
ref|WP_040382972.1|  GMC oxidoreductase                               80.9    3e-14   
dbj|GAA82032.1|  long chain fatty alcohol oxidase                     80.9    3e-14   
ref|XP_011398074.1|  Long-chain-alcohol oxidase FAO1                  81.3    3e-14   
ref|WP_022566024.1|  MULTISPECIES: putative oxidoreductase            80.9    3e-14   
gb|KFZ24759.1|  hypothetical protein V502_00763                       80.1    3e-14   
ref|XP_007275142.1|  long chain fatty alcohol oxidase                 80.9    3e-14   
ref|XP_007680563.1|  hypothetical protein BAUCODRAFT_274597           80.9    3e-14   
gb|EHA26798.1|  long chain fatty alcohol oxidase                      80.9    3e-14   
ref|XP_959005.1|  long chain fatty alcohol oxidase                    80.9    3e-14   
ref|XP_001389382.1|  long chain fatty alcohol oxidase                 80.9    4e-14   
gb|EQB53611.1|  GMC oxidoreductase                                    80.9    4e-14   
ref|WP_014442627.1|  putative oxidoreductase                          80.5    4e-14   
ref|WP_040749116.1|  oxidoreductase                                   80.5    4e-14   
gb|KFY64266.1|  hypothetical protein V496_03367                       80.5    4e-14   
dbj|GAA98883.1|  hypothetical protein E5Q_05571                       80.5    4e-14   
ref|WP_033369528.1|  hypothetical protein                             80.1    5e-14   
gb|EME47783.1|  hypothetical protein DOTSEDRAFT_69651                 80.1    5e-14   
ref|WP_043664884.1|  oxidoreductase                                   80.1    6e-14   
ref|WP_030514867.1|  oxidoreductase                                   79.7    6e-14   
gb|KGO40669.1|  Alcohol dehydrogenase, long-chain fatty               80.1    6e-14   
ref|XP_002182547.1|  predicted protein                                80.1    6e-14   
gb|EGC44059.1|  long chain fatty acid oxidase                         80.1    6e-14   
ref|XP_003348911.1|  hypothetical protein SMAC_01933                  80.1    6e-14   
gb|EER37923.1|  long chain fatty acid oxidase                         79.7    7e-14   
gb|EEH09589.1|  long chain fatty acid oxidase                         79.7    7e-14   
gb|EPS25096.1|  hypothetical protein PDE_00027                        79.7    7e-14   
gb|EYE98796.1|  putative long chain fatty alcohol oxidase             79.7    7e-14   
ref|WP_025566542.1|  hypothetical protein                             79.3    7e-14   
ref|WP_040766272.1|  oxidoreductase                                   79.7    8e-14   
ref|WP_044018575.1|  hypothetical protein                             79.3    8e-14   
gb|ENH81120.1|  long chain fatty alcohol oxidase                      79.7    8e-14   
ref|XP_009217823.1|  long chain fatty acid oxidase                    79.7    8e-14   



>gb|KDP37816.1| hypothetical protein JCGZ_06718 [Jatropha curcas]
Length=760

 Score =   199 bits (505),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 98/124 (79%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAH  378
            GLEKVLRILAAAGAEEIGT H  G+ L  K AS  E D+FV++ESSR L +LST I SAH
Sbjct  632  GLEKVLRILAAAGAEEIGTHHSKGRSLNVKKASYKEFDKFVKRESSRSLRDLSTQICSAH  691

Query  377  QMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVL  198
            QMGSCRMG+DPR+SVVN MGETWEVEGLF+AD+SVFPTALGVNPMVTVQAIAYCTAQSVL
Sbjct  692  QMGSCRMGIDPRNSVVNEMGETWEVEGLFIADTSVFPTALGVNPMVTVQAIAYCTAQSVL  751

Query  197  KFLK  186
            + LK
Sbjct  752  QLLK  755



>gb|KDP37817.1| hypothetical protein JCGZ_06719 [Jatropha curcas]
Length=608

 Score =   192 bits (489),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 106/124 (85%), Gaps = 0/124 (0%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAH  378
            GLEK LRILAAAGAEEIGT H  G+ L  K AS  E D+FV++ESSR L +LST I SAH
Sbjct  480  GLEKGLRILAAAGAEEIGTHHSKGRSLNVKKASYKEFDKFVKRESSRSLRDLSTQICSAH  539

Query  377  QMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVL  198
            QMGSCRMG+DPR+SVVN MGETWEVEGLF+AD+SVFP ALGVNPMVTVQAIAYCTAQSVL
Sbjct  540  QMGSCRMGIDPRNSVVNEMGETWEVEGLFIADTSVFPAALGVNPMVTVQAIAYCTAQSVL  599

Query  197  KFLK  186
            + LK
Sbjct  600  QLLK  603



>ref|XP_011072475.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like isoform X2 [Sesamum 
indicum]
Length=671

 Score =   193 bits (490),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 107/123 (87%), Gaps = 0/123 (0%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAH  378
            GLEKV+RI+AAAGAEEIGT H  G++LK K AS +E + FV++ES R L  LS+ IGSAH
Sbjct  543  GLEKVMRIMAAAGAEEIGTQHTTGRVLKVKQASEEEFERFVKEESLRPLQKLSSPIGSAH  602

Query  377  QMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVL  198
            QMGSCRMGVDP+SS VNP GETWEVEGLF+ADSSVFPTALGVNPMVT+QAIAYCTAQSVL
Sbjct  603  QMGSCRMGVDPKSSAVNPKGETWEVEGLFVADSSVFPTALGVNPMVTIQAIAYCTAQSVL  662

Query  197  KFL  189
            + L
Sbjct  663  EVL  665



>ref|XP_011072398.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like isoform X1 [Sesamum 
indicum]
Length=761

 Score =   193 bits (490),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 107/123 (87%), Gaps = 0/123 (0%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAH  378
            GLEKV+RI+AAAGAEEIGT H  G++LK K AS +E + FV++ES R L  LS+ IGSAH
Sbjct  633  GLEKVMRIMAAAGAEEIGTQHTTGRVLKVKQASEEEFERFVKEESLRPLQKLSSPIGSAH  692

Query  377  QMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVL  198
            QMGSCRMGVDP+SS VNP GETWEVEGLF+ADSSVFPTALGVNPMVT+QAIAYCTAQSVL
Sbjct  693  QMGSCRMGVDPKSSAVNPKGETWEVEGLFVADSSVFPTALGVNPMVTIQAIAYCTAQSVL  752

Query  197  KFL  189
            + L
Sbjct  753  EVL  755



>gb|EYU29124.1| hypothetical protein MIMGU_mgv1a001761mg [Erythranthe guttata]
Length=763

 Score =   192 bits (488),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 97/123 (79%), Positives = 106/123 (86%), Gaps = 0/123 (0%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAH  378
            G+E+VLRILAAAGAEEIGT HR G +LK KGASR+E + FVE+ES R L NLST I SAH
Sbjct  635  GIERVLRILAAAGAEEIGTHHRDGGVLKVKGASREEFEGFVERESMRPLRNLSTPIASAH  694

Query  377  QMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVL  198
            QMGSCRMGVD   S V+P GETWEVEGLF+ADSSVFPTALGVNPMVTVQAIAYCTAQSVL
Sbjct  695  QMGSCRMGVDSGGSGVDPRGETWEVEGLFVADSSVFPTALGVNPMVTVQAIAYCTAQSVL  754

Query  197  KFL  189
            + L
Sbjct  755  EIL  757



>ref|XP_010054021.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Eucalyptus grandis]
Length=814

 Score =   189 bits (480),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 106/124 (85%), Gaps = 0/124 (0%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAH  378
            GLEKVLRILAAAGAEEIG+ H  GK LK K  S  E ++FV++ES+R +  LST I SAH
Sbjct  685  GLEKVLRILAAAGAEEIGSHHGEGKTLKVKQVSYHEFEQFVKEESARSIKGLSTPICSAH  744

Query  377  QMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVL  198
            QMGSCRMG DPRSS VNPMGETWEVEGL++AD+SVFPTALGVNPMVTVQAIAYCTAQSVL
Sbjct  745  QMGSCRMGPDPRSSAVNPMGETWEVEGLYVADTSVFPTALGVNPMVTVQAIAYCTAQSVL  804

Query  197  KFLK  186
            + L+
Sbjct  805  EALR  808



>gb|KCW78402.1| hypothetical protein EUGRSUZ_D02568 [Eucalyptus grandis]
Length=758

 Score =   189 bits (479),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 106/124 (85%), Gaps = 0/124 (0%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAH  378
            GLEKVLRILAAAGAEEIG+ H  GK LK K  S  E ++FV++ES+R +  LST I SAH
Sbjct  629  GLEKVLRILAAAGAEEIGSHHGEGKTLKVKQVSYHEFEQFVKEESARSIKGLSTPICSAH  688

Query  377  QMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVL  198
            QMGSCRMG DPRSS VNPMGETWEVEGL++AD+SVFPTALGVNPMVTVQAIAYCTAQSVL
Sbjct  689  QMGSCRMGPDPRSSAVNPMGETWEVEGLYVADTSVFPTALGVNPMVTVQAIAYCTAQSVL  748

Query  197  KFLK  186
            + L+
Sbjct  749  EALR  752



>gb|KDO72345.1| hypothetical protein CISIN_1g0039902mg, partial [Citrus sinensis]
Length=707

 Score =   189 bits (479),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAH  378
            G+EK+LRILAAAGAEEIGT H  GKI+  K AS +E + FV++ESSR L +LST + SAH
Sbjct  579  GIEKILRILAAAGAEEIGTHHCKGKIINVKKASSEEFERFVKEESSRPLRDLSTPLSSAH  638

Query  377  QMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVL  198
            QMGSCRMG+DP++SVVN MGETW VEGL+LAD+SVFPTALGVNPMVTVQAIAYCTAQSVL
Sbjct  639  QMGSCRMGIDPKTSVVNQMGETWGVEGLYLADTSVFPTALGVNPMVTVQAIAYCTAQSVL  698

Query  197  KFLK  186
              L+
Sbjct  699  DVLR  702



>ref|XP_006361221.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Solanum tuberosum]
Length=745

 Score =   188 bits (478),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 105/124 (85%), Gaps = 0/124 (0%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAH  378
            G+EK+LRILAAAGAEEIGT H  GK LK K +S DE + FV++ESSR   NLST I SAH
Sbjct  617  GIEKLLRILAAAGAEEIGTHHVKGKTLKVKESSVDEFESFVKEESSRGFKNLSTPICSAH  676

Query  377  QMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVL  198
            QMGSCRMG+DP+ SVVNP GETWEVE LF+ D+SVFPTALGVNPMVTVQAI+YCTAQ+VL
Sbjct  677  QMGSCRMGIDPKISVVNPKGETWEVEDLFIGDTSVFPTALGVNPMVTVQAISYCTAQNVL  736

Query  197  KFLK  186
            + LK
Sbjct  737  QVLK  740



>gb|KCW78401.1| hypothetical protein EUGRSUZ_D02566 [Eucalyptus grandis]
Length=748

 Score =   188 bits (477),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 105/124 (85%), Gaps = 0/124 (0%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAH  378
            GLEKVLRILAAAGAEEIGT H  GK LK K  S  E + FV++ES+R +   ST I SAH
Sbjct  619  GLEKVLRILAAAGAEEIGTHHNEGKTLKVKQVSYHEFERFVKEESARPIKGQSTPICSAH  678

Query  377  QMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVL  198
            QMGSCRMG +PRSSVVNPMGETWEVEGL++AD+SVFPTALGVNPMVTVQAIAYCTAQSVL
Sbjct  679  QMGSCRMGPNPRSSVVNPMGETWEVEGLYVADTSVFPTALGVNPMVTVQAIAYCTAQSVL  738

Query  197  KFLK  186
            + L+
Sbjct  739  EALR  742



>ref|XP_010054015.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Eucalyptus 
grandis]
Length=804

 Score =   188 bits (477),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 105/124 (85%), Gaps = 0/124 (0%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAH  378
            GLEKVLRILAAAGAEEIGT H  GK LK K  S  E + FV++ES+R +   ST I SAH
Sbjct  675  GLEKVLRILAAAGAEEIGTHHNEGKTLKVKQVSYHEFERFVKEESARPIKGQSTPICSAH  734

Query  377  QMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVL  198
            QMGSCRMG +PRSSVVNPMGETWEVEGL++AD+SVFPTALGVNPMVTVQAIAYCTAQSVL
Sbjct  735  QMGSCRMGPNPRSSVVNPMGETWEVEGLYVADTSVFPTALGVNPMVTVQAIAYCTAQSVL  794

Query  197  KFLK  186
            + L+
Sbjct  795  EALR  798



>ref|XP_006482469.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Citrus sinensis]
Length=788

 Score =   187 bits (476),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAH  378
            G+EK+LR+LAAAGAEEIGT H  GK +  K AS +E + FV++ESSR L +LST + SAH
Sbjct  660  GIEKILRMLAAAGAEEIGTHHCKGKTINVKKASSEEFERFVKEESSRPLRDLSTPLSSAH  719

Query  377  QMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVL  198
            QMGSCRMG+DP++SVVN MGETW+VEGL+LAD+SVFPTALGVNPMVTVQAIAYCTAQSVL
Sbjct  720  QMGSCRMGIDPKTSVVNQMGETWDVEGLYLADTSVFPTALGVNPMVTVQAIAYCTAQSVL  779

Query  197  KFLK  186
              L+
Sbjct  780  DVLR  783



>emb|CDP07225.1| unnamed protein product [Coffea canephora]
Length=829

 Score =   187 bits (476),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 106/124 (85%), Gaps = 0/124 (0%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAH  378
            GLEKVLRILA+AGAEEIGT H  G+ +  K  S  E D+FV++ESSR L +L+T I SAH
Sbjct  668  GLEKVLRILASAGAEEIGTHHVKGRSINVKKVSYTEFDKFVKEESSRSLKDLATPICSAH  727

Query  377  QMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVL  198
            QMGSCRMGVDP+ SV NP+GETWE+EGL+LADSSVFPTALGVNPMVTVQAIAYCTAQSVL
Sbjct  728  QMGSCRMGVDPKISVANPIGETWEIEGLYLADSSVFPTALGVNPMVTVQAIAYCTAQSVL  787

Query  197  KFLK  186
            + L+
Sbjct  788  ESLR  791



>ref|XP_006430998.1| hypothetical protein CICLE_v10011111mg [Citrus clementina]
 gb|ESR44238.1| hypothetical protein CICLE_v10011111mg [Citrus clementina]
Length=780

 Score =   187 bits (474),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 106/124 (85%), Gaps = 0/124 (0%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAH  378
            G+EK+LRILAAAGAEEIGT H  GK +  K AS +E + FV++ESSR L +LST + SAH
Sbjct  652  GIEKILRILAAAGAEEIGTHHCKGKTINVKKASSEEFERFVKEESSRPLRDLSTPLSSAH  711

Query  377  QMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVL  198
            QMGSCRMG+DP++SVVN MGETW VEGL+LAD+SVFPTALGVNPMVTVQAIAYCTAQSVL
Sbjct  712  QMGSCRMGIDPKTSVVNQMGETWGVEGLYLADTSVFPTALGVNPMVTVQAIAYCTAQSVL  771

Query  197  KFLK  186
              L+
Sbjct  772  DVLR  775



>ref|XP_010676697.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Beta vulgaris 
subsp. vulgaris]
Length=816

 Score =   187 bits (474),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAH  378
            G+EK+LRILAAAGAEEIGT H +G+ +  K A+  E ++FV++ESS+++  LST + SAH
Sbjct  689  GVEKMLRILAAAGAEEIGTHHNSGESINVKKATYHEFEKFVKRESSKEIQGLSTPVASAH  748

Query  377  QMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVL  198
            QMGSC+MGVDPR+SVVN MGE+W+VEGL++ADSSVFPTALGVNPMVTVQAI+YCTAQSVL
Sbjct  749  QMGSCKMGVDPRTSVVNQMGESWDVEGLYIADSSVFPTALGVNPMVTVQAISYCTAQSVL  808

Query  197  KFLK  186
            ++LK
Sbjct  809  EYLK  812



>gb|AGK82821.1| alcohol oxidase [Solanum pimpinellifolium]
Length=746

 Score =   186 bits (472),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 105/124 (85%), Gaps = 0/124 (0%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAH  378
            G+EK+LRILAAAGAEEIGT H  G+  K K +S DE + FV++ESSR L NLST I SAH
Sbjct  618  GIEKLLRILAAAGAEEIGTHHVKGRKFKVKESSVDEFESFVKEESSRGLKNLSTPICSAH  677

Query  377  QMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVL  198
            QMGSCRMG+DP+ SVVNP GETWEVE LF+ D+SVFPTALGVNPM+TVQAI+YCTAQ+VL
Sbjct  678  QMGSCRMGIDPKISVVNPKGETWEVEDLFIGDTSVFPTALGVNPMLTVQAISYCTAQNVL  737

Query  197  KFLK  186
            + LK
Sbjct  738  QLLK  741



>gb|AGK82806.1| alcohol oxidase [Solanum lycopersicum]
Length=746

 Score =   186 bits (472),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 105/124 (85%), Gaps = 0/124 (0%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAH  378
            G+EK+LRILAAAGAEEIGT H  G+  K K +S DE + FV++ESSR L NLST I SAH
Sbjct  618  GIEKLLRILAAAGAEEIGTHHVKGRKFKVKESSVDEFESFVKEESSRGLKNLSTPICSAH  677

Query  377  QMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVL  198
            QMGSCRMG+DP+ SVVNP GETWEVE LF+ D+SVFPTALGVNPM+TVQAI+YCTAQ+VL
Sbjct  678  QMGSCRMGIDPKISVVNPKGETWEVEDLFIGDTSVFPTALGVNPMLTVQAISYCTAQNVL  737

Query  197  KFLK  186
            + LK
Sbjct  738  QLLK  741



>ref|XP_004244440.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Solanum lycopersicum]
Length=774

 Score =   186 bits (472),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 105/124 (85%), Gaps = 0/124 (0%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAH  378
            G+EK+LRILAAAGAEEIGT H  G+  K K +S DE + FV++ESSR L NLST I SAH
Sbjct  646  GIEKLLRILAAAGAEEIGTHHVKGRKFKVKESSVDEFESFVKEESSRGLKNLSTPICSAH  705

Query  377  QMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVL  198
            QMGSCRMG+DP+ SVVNP GETWEVE LF+ D+SVFPTALGVNPM+TVQAI+YCTAQ+VL
Sbjct  706  QMGSCRMGIDPKISVVNPKGETWEVEDLFIGDTSVFPTALGVNPMLTVQAISYCTAQNVL  765

Query  197  KFLK  186
            + LK
Sbjct  766  QLLK  769



>gb|AGK82832.1| alcohol oxidase [Solanum habrochaites]
Length=746

 Score =   186 bits (471),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 90/127 (71%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAH  378
            G+EK+LRILAAAGAEEIGT H  G+  K K +S DE + FV++ESSR L +LST I SAH
Sbjct  618  GIEKLLRILAAAGAEEIGTHHVKGRKFKVKESSVDEFESFVKEESSRGLKDLSTPICSAH  677

Query  377  QMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVL  198
            QMGSCRMG+DP+ SVVNP GETWEVE LF+ D+SVFPTALGVNPM+TVQAI+YCTAQ+VL
Sbjct  678  QMGSCRMGIDPKISVVNPKGETWEVEDLFIGDTSVFPTALGVNPMLTVQAISYCTAQNVL  737

Query  197  KFLKTHN  177
            + LK  N
Sbjct  738  QLLKAKN  744



>gb|KGN53996.1| hypothetical protein Csa_4G246910 [Cucumis sativus]
Length=139

 Score =   173 bits (438),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 100/124 (81%), Gaps = 0/124 (0%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAH  378
            GLEK L+ILAAAGA EIGT H  G+ +  K  S  E ++FV++ESSR L +L T I SAH
Sbjct  12   GLEKALKILAAAGAVEIGTHHNKGRSINVKKVSFREYEKFVKEESSRPLKDLLTPICSAH  71

Query  377  QMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVL  198
            QMGSCRMG+  + SVVN  GETWEVEGLF+ADSSVFPTALGVNPMVTVQAIAYCTAQSVL
Sbjct  72   QMGSCRMGIGAKDSVVNQRGETWEVEGLFIADSSVFPTALGVNPMVTVQAIAYCTAQSVL  131

Query  197  KFLK  186
            + LK
Sbjct  132  ETLK  135



>ref|XP_011078909.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Sesamum indicum]
Length=755

 Score =   185 bits (470),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 102/124 (82%), Gaps = 0/124 (0%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAH  378
            GLEK +RILAAAGAEEIGT H  G++LK K AS  E + FV++ES R L  LS  I SAH
Sbjct  627  GLEKCMRILAAAGAEEIGTHHSTGRVLKVKQASEKEFERFVKEESLRPLQKLSAPIASAH  686

Query  377  QMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVL  198
            QMGSCRMGVDP+ SVVNP GETWEVEGLF+ADSSVFPTALGVNPMVTVQA AYC AQSVL
Sbjct  687  QMGSCRMGVDPKGSVVNPKGETWEVEGLFVADSSVFPTALGVNPMVTVQATAYCIAQSVL  746

Query  197  KFLK  186
            + L+
Sbjct  747  QILE  750



>ref|XP_007040880.1| Long-chain fatty alcohol dehydrogenase family protein [Theobroma 
cacao]
 gb|EOY25381.1| Long-chain fatty alcohol dehydrogenase family protein [Theobroma 
cacao]
Length=1140

 Score =   187 bits (475),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 105/124 (85%), Gaps = 0/124 (0%)
 Frame = -1

Query  557   GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAH  378
             GL+K+LRILAAAGAEEIGT H  GK +  K AS  E + FV++ESSR L +L+T I SAH
Sbjct  1011  GLDKILRILAAAGAEEIGTHHCKGKSINVKQASSHEFERFVKEESSRPLRDLNTQICSAH  1070

Query  377   QMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVL  198
             QMGSCRMG+DP+ SVVN MGETWEVEGLF+ADSSVFPTALGVNPMVT+QAIAYCTAQSVL
Sbjct  1071  QMGSCRMGIDPKQSVVNQMGETWEVEGLFVADSSVFPTALGVNPMVTIQAIAYCTAQSVL  1130

Query  197   KFLK  186
               LK
Sbjct  1131  DVLK  1134



>gb|AGK82825.1| alcohol oxidase [Solanum pennellii]
Length=746

 Score =   184 bits (467),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 105/124 (85%), Gaps = 0/124 (0%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAH  378
            G+EK+LRILAAAGAEEIGT H  G+  K K +S DE + FV++ESSR L +LST I SAH
Sbjct  618  GIEKLLRILAAAGAEEIGTHHVKGRKFKVKESSVDEFESFVKEESSRGLKDLSTPICSAH  677

Query  377  QMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVL  198
            QMGSCRMG+DP+ SVVNP GETWEVE LF+ D+SVFPTALGVNPM+TVQAI+YCTAQ+VL
Sbjct  678  QMGSCRMGIDPKISVVNPKGETWEVEDLFIGDTSVFPTALGVNPMLTVQAISYCTAQNVL  737

Query  197  KFLK  186
            + LK
Sbjct  738  QLLK  741



>ref|XP_010275157.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Nelumbo nucifera]
Length=807

 Score =   184 bits (467),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 104/124 (84%), Gaps = 0/124 (0%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAH  378
            GLEK+LRILAAAGAEEIGT H  G+ +  K  S +E + FV+KES R L +L T I SAH
Sbjct  673  GLEKILRILAAAGAEEIGTSHCLGRKVNVKKVSSNEFERFVKKESRRALRDLRTPIPSAH  732

Query  377  QMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVL  198
            QMGSCRMGVDP+SSVVN  GETWEVEGLFLADSSVFPTALGVNPMVT+Q+IAYCTAQSVL
Sbjct  733  QMGSCRMGVDPKSSVVNHRGETWEVEGLFLADSSVFPTALGVNPMVTIQSIAYCTAQSVL  792

Query  197  KFLK  186
            + L+
Sbjct  793  EVLR  796



>gb|KHN11789.1| Long-chain-alcohol oxidase FAO4A [Glycine soja]
Length=622

 Score =   183 bits (464),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 105/124 (85%), Gaps = 0/124 (0%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAH  378
            G+EKVLRILAAAGAEEIGT H  G+ L  K  S  E ++FV++ESSR L +L+T + SAH
Sbjct  494  GIEKVLRILAAAGAEEIGTHHNKGRTLNVKQVSYHEFEKFVKEESSRSLTDLTTPLCSAH  553

Query  377  QMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVL  198
            QMGSCRMG +P+ SVVNP GETWEVEGL++AD+SVFPTALGVNPMVTVQAIAYCTAQSV+
Sbjct  554  QMGSCRMGSNPKQSVVNPTGETWEVEGLYVADASVFPTALGVNPMVTVQAIAYCTAQSVV  613

Query  197  KFLK  186
            + LK
Sbjct  614  EVLK  617



>ref|XP_010274418.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like isoform X1 [Nelumbo 
nucifera]
 ref|XP_010274419.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like isoform X1 [Nelumbo 
nucifera]
Length=775

 Score =   183 bits (464),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 90/127 (71%), Positives = 107/127 (84%), Gaps = 0/127 (0%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAH  378
            G+EK+LRILAAAGAEEIGT H  G+ L  K AS+DE ++FV++ES R LG LST + SAH
Sbjct  641  GVEKMLRILAAAGAEEIGTHHCEGRKLNVKRASKDEFEKFVKEESGRKLGGLSTPVASAH  700

Query  377  QMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVL  198
            QMGSCRMGVD   SVV P GETWEVEGLF+AD+SVFPTALGVNPMVTVQAI+YCTA SV+
Sbjct  701  QMGSCRMGVDRDKSVVCPRGETWEVEGLFVADTSVFPTALGVNPMVTVQAISYCTAHSVI  760

Query  197  KFLKTHN  177
            +FL+ ++
Sbjct  761  EFLERND  767



>ref|XP_010274420.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like isoform X2 [Nelumbo 
nucifera]
Length=728

 Score =   182 bits (463),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 90/127 (71%), Positives = 107/127 (84%), Gaps = 0/127 (0%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAH  378
            G+EK+LRILAAAGAEEIGT H  G+ L  K AS+DE ++FV++ES R LG LST + SAH
Sbjct  594  GVEKMLRILAAAGAEEIGTHHCEGRKLNVKRASKDEFEKFVKEESGRKLGGLSTPVASAH  653

Query  377  QMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVL  198
            QMGSCRMGVD   SVV P GETWEVEGLF+AD+SVFPTALGVNPMVTVQAI+YCTA SV+
Sbjct  654  QMGSCRMGVDRDKSVVCPRGETWEVEGLFVADTSVFPTALGVNPMVTVQAISYCTAHSVI  713

Query  197  KFLKTHN  177
            +FL+ ++
Sbjct  714  EFLERND  720



>ref|XP_003534338.2| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Glycine max]
Length=807

 Score =   183 bits (464),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 105/124 (85%), Gaps = 0/124 (0%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAH  378
            G+EKVLRILAAAGAEEIGT H  G+ L  K  S  E ++FV++ESSR L +L+T + SAH
Sbjct  679  GIEKVLRILAAAGAEEIGTHHNKGRTLNVKQVSYHEFEKFVKEESSRSLTDLTTPLCSAH  738

Query  377  QMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVL  198
            QMGSCRMG +P+ SVVNP GETWEVEGL++AD+SVFPTALGVNPMVTVQAIAYCTAQSV+
Sbjct  739  QMGSCRMGSNPKQSVVNPTGETWEVEGLYVADASVFPTALGVNPMVTVQAIAYCTAQSVV  798

Query  197  KFLK  186
            + LK
Sbjct  799  EVLK  802



>ref|XP_010676700.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Beta vulgaris 
subsp. vulgaris]
Length=808

 Score =   182 bits (461),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 105/124 (85%), Gaps = 0/124 (0%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAH  378
            G+EK+LRILAAAGAEEIGT H +G  +  K AS  E ++FV+KESS+ +  LS  I SAH
Sbjct  680  GIEKMLRILAAAGAEEIGTHHYSGSSINVKKASFHEFEKFVKKESSKAIQGLSMPIASAH  739

Query  377  QMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVL  198
            QMGSCRMG++PR+SVVN  GE+WEVEGL+LADSSVFPTALGVNPMVTVQAI+YCT QSVL
Sbjct  740  QMGSCRMGINPRTSVVNQRGESWEVEGLYLADSSVFPTALGVNPMVTVQAISYCTTQSVL  799

Query  197  KFLK  186
            +FL+
Sbjct  800  EFLR  803



>ref|XP_009626278.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Nicotiana tomentosiformis]
Length=773

 Score =   181 bits (459),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 90/126 (71%), Positives = 103/126 (82%), Gaps = 0/126 (0%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAH  378
            GLEK+LRILAAAGAEEIGT H  G+ LK K AS  E + FV++ESS ++GN S  I SAH
Sbjct  645  GLEKMLRILAAAGAEEIGTQHGKGRSLKVKDASLKEFERFVKEESSIEIGNHSVPICSAH  704

Query  377  QMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVL  198
            QMGSCRMGVDP +SVVN  GE WEVEGLFL DSSVFPTA+GVNPMVT+QAI+YCTAQSV+
Sbjct  705  QMGSCRMGVDPTTSVVNSKGELWEVEGLFLGDSSVFPTAIGVNPMVTIQAISYCTAQSVV  764

Query  197  KFLKTH  180
            + LK  
Sbjct  765  QLLKNQ  770



>ref|XP_008237995.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Prunus mume]
Length=752

 Score =   181 bits (458),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 104/124 (84%), Gaps = 0/124 (0%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAH  378
            GLEK LRILAAAGAE+IGT H  GK L  K A+ DE + FV++ESSR L  +S+ I SAH
Sbjct  621  GLEKSLRILAAAGAEDIGTHHFKGKGLHVKKANLDEFERFVKEESSRPLREISSAICSAH  680

Query  377  QMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVL  198
            QMGSCRMGVD + SVVN MGETWEVEGLF+AD+SVFPTALGVNPMVTVQAIAYCT+QS+L
Sbjct  681  QMGSCRMGVDSKQSVVNQMGETWEVEGLFVADTSVFPTALGVNPMVTVQAIAYCTSQSIL  740

Query  197  KFLK  186
            + L+
Sbjct  741  QVLR  744



>ref|XP_011028488.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Populus euphratica]
Length=806

 Score =   180 bits (457),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 91/129 (71%), Positives = 104/129 (81%), Gaps = 3/129 (2%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAH  378
            GLEK LRILAAAGAEEIGT H  GKIL  K  S  E + FV++ES+R L +L+  I SAH
Sbjct  677  GLEKTLRILAAAGAEEIGTHHSTGKILNVKKVSYREFERFVKEESARPLRDLTGQICSAH  736

Query  377  QMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVL  198
            QMGSCRMGV+P+ S VN MGE WEVEGLF+AD+SVFPTALGVNPMVTVQAIAYCTAQSV+
Sbjct  737  QMGSCRMGVNPKESAVNQMGEAWEVEGLFVADTSVFPTALGVNPMVTVQAIAYCTAQSVV  796

Query  197  KFL---KTH  180
            + L   +TH
Sbjct  797  QLLSRKRTH  805



>ref|XP_007210564.1| hypothetical protein PRUPE_ppa014756mg [Prunus persica]
 gb|EMJ11763.1| hypothetical protein PRUPE_ppa014756mg [Prunus persica]
Length=808

 Score =   179 bits (455),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 104/124 (84%), Gaps = 0/124 (0%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAH  378
            GLEK LRILAAAGAE+IGT H  GK L  K ++ DE + FV++ESSR L  LS+ I SAH
Sbjct  677  GLEKSLRILAAAGAEDIGTHHFKGKGLHVKKSNLDEFERFVKEESSRPLRELSSAICSAH  736

Query  377  QMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVL  198
            QMGSCRMGVD + SV+N MGETWEVEGLF+AD+SVFPTALGVNPMVTVQAIAYCT+QS+L
Sbjct  737  QMGSCRMGVDSKQSVLNQMGETWEVEGLFVADTSVFPTALGVNPMVTVQAIAYCTSQSIL  796

Query  197  KFLK  186
            + L+
Sbjct  797  QVLR  800



>ref|XP_002519938.1| electron carrier, putative [Ricinus communis]
 gb|EEF42542.1| electron carrier, putative [Ricinus communis]
Length=710

 Score =   178 bits (452),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 104/124 (84%), Gaps = 0/124 (0%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAH  378
            G+EK+LRILAAAGAEEIGT H  G+ L  K AS  E ++FV++E +R + +LS  I SAH
Sbjct  583  GIEKILRILAAAGAEEIGTHHCIGRRLNVKTASYHEFEKFVKEERARPMRDLSNQICSAH  642

Query  377  QMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVL  198
            QMGSCRMGV+P+ SVVN  GETWE+EGL+LAD+SVFPTALGVNPMVTVQAIAYCTAQSVL
Sbjct  643  QMGSCRMGVNPKHSVVNQTGETWEIEGLYLADASVFPTALGVNPMVTVQAIAYCTAQSVL  702

Query  197  KFLK  186
            + L+
Sbjct  703  EVLR  706



>ref|XP_006385149.1| alcohol oxidase-related family protein [Populus trichocarpa]
 gb|ERP62946.1| alcohol oxidase-related family protein [Populus trichocarpa]
Length=748

 Score =   177 bits (450),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 90/129 (70%), Positives = 103/129 (80%), Gaps = 3/129 (2%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAH  378
            GLEK LRILAAAGAEEIGT H  GK L  K  S  E + FV++ES+R L +L+  I SAH
Sbjct  619  GLEKTLRILAAAGAEEIGTHHSTGKSLNVKKVSYREFERFVKEESARPLRDLTGQICSAH  678

Query  377  QMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVL  198
            QMGSCRMGV+P+ S VN MGE WEVEGLF+AD+SVFPTALGVNPMVTVQAIAYCTAQSV+
Sbjct  679  QMGSCRMGVNPKESAVNQMGEAWEVEGLFVADTSVFPTALGVNPMVTVQAIAYCTAQSVV  738

Query  197  KFL---KTH  180
            + L   +TH
Sbjct  739  QLLSRKRTH  747



>gb|AES95453.2| long-chain-alcohol oxidase FAO1-like protein [Medicago truncatula]
Length=831

 Score =   177 bits (450),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 102/124 (82%), Gaps = 0/124 (0%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAH  378
            G++KVLRILAAAGAEEIGT H  G  L  K AS  E ++FV+KESSR L +LST + SAH
Sbjct  703  GIDKVLRILAAAGAEEIGTHHNKGNTLNVKNASYHEFEQFVKKESSRSLTDLSTPLCSAH  762

Query  377  QMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVL  198
            QMGSCRMG +P+ SVV   GETWEVE LF+AD+SVFPTALG+NPM+TVQ+IAYCTAQSVL
Sbjct  763  QMGSCRMGSNPKESVVKETGETWEVEDLFVADASVFPTALGMNPMITVQSIAYCTAQSVL  822

Query  197  KFLK  186
            + LK
Sbjct  823  QVLK  826



>ref|XP_010111511.1| Long-chain-alcohol oxidase FAO4A [Morus notabilis]
 gb|EXC31034.1| Long-chain-alcohol oxidase FAO4A [Morus notabilis]
Length=838

 Score =   177 bits (450),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 91/133 (68%), Positives = 103/133 (77%), Gaps = 0/133 (0%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAH  378
            G+EKVLRILAAAGAEEIGT H  GK +  K AS  E++ FV++ES R++  L   I SAH
Sbjct  706  GVEKVLRILAAAGAEEIGTHHGKGKSINVKSASYHELERFVKEESGREMRGLRWPICSAH  765

Query  377  QMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVL  198
            QMGSCRMGV   +S VNPMGETWEVEGLF+AD+SVFPTALGVNPMVTVQAIAYCTA SVL
Sbjct  766  QMGSCRMGVAAATSAVNPMGETWEVEGLFVADTSVFPTALGVNPMVTVQAIAYCTALSVL  825

Query  197  KFLKTHNHMQGYI  159
            + LK       YI
Sbjct  826  QLLKRKKIKTTYI  838



>ref|XP_003612495.1| GMC-type oxidoreductase, putative [Medicago truncatula]
Length=853

 Score =   177 bits (450),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 102/124 (82%), Gaps = 0/124 (0%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAH  378
            G++KVLRILAAAGAEEIGT H  G  L  K AS  E ++FV+KESSR L +LST + SAH
Sbjct  725  GIDKVLRILAAAGAEEIGTHHNKGNTLNVKNASYHEFEQFVKKESSRSLTDLSTPLCSAH  784

Query  377  QMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVL  198
            QMGSCRMG +P+ SVV   GETWEVE LF+AD+SVFPTALG+NPM+TVQ+IAYCTAQSVL
Sbjct  785  QMGSCRMGSNPKESVVKETGETWEVEDLFVADASVFPTALGMNPMITVQSIAYCTAQSVL  844

Query  197  KFLK  186
            + LK
Sbjct  845  QVLK  848



>gb|KHN27504.1| Long-chain-alcohol oxidase FAO4A [Glycine soja]
Length=638

 Score =   176 bits (446),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 103/124 (83%), Gaps = 0/124 (0%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAH  378
            GLEKVLRILAAAGAEEIGT +  G+ +  K  S  E ++FV++ESS  L ++ST + SAH
Sbjct  511  GLEKVLRILAAAGAEEIGTHNNKGRRINVKQVSYHEFEKFVKEESSMSLTDISTPLCSAH  570

Query  377  QMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVL  198
            QMGSC+MG +PR SVVN MGETWEVEGL+LADSSVFPTALGVNPMVTVQAI+YCTAQ VL
Sbjct  571  QMGSCKMGTNPRESVVNQMGETWEVEGLYLADSSVFPTALGVNPMVTVQAISYCTAQYVL  630

Query  197  KFLK  186
            + L+
Sbjct  631  EVLR  634



>ref|XP_003547733.2| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Glycine max]
Length=825

 Score =   176 bits (447),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 103/124 (83%), Gaps = 0/124 (0%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAH  378
            GLEKVLRILAAAGAEEIGT +  G+ +  K  S  E ++FV++ESS  L ++ST + SAH
Sbjct  698  GLEKVLRILAAAGAEEIGTHNNKGRRINVKQVSYHEFEKFVKEESSMSLTDISTPLCSAH  757

Query  377  QMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVL  198
            QMGSC+MG +PR SVVN MGETWEVEGL+LADSSVFPTALGVNPMVTVQAI+YCTAQ VL
Sbjct  758  QMGSCKMGTNPRESVVNQMGETWEVEGLYLADSSVFPTALGVNPMVTVQAISYCTAQYVL  817

Query  197  KFLK  186
            + L+
Sbjct  818  EVLR  821



>ref|XP_006359948.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Solanum tuberosum]
Length=707

 Score =   176 bits (445),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 88/126 (70%), Positives = 100/126 (79%), Gaps = 0/126 (0%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAH  378
            GLEK LRILAAAGAEEIGT    G+ LK   AS  E + FV++ESS ++G  S  I SAH
Sbjct  579  GLEKTLRILAAAGAEEIGTQQEKGRSLKVNEASLKEFERFVKEESSIEIGKHSVPICSAH  638

Query  377  QMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVL  198
            QMGSCRMGVDP++SVVN  GETWEVEGLFL DSSV PTA+GVNPMVT+QAI+YCTAQSVL
Sbjct  639  QMGSCRMGVDPKTSVVNSKGETWEVEGLFLGDSSVCPTAIGVNPMVTIQAISYCTAQSVL  698

Query  197  KFLKTH  180
            + LK  
Sbjct  699  QLLKNQ  704



>ref|XP_003629014.1| GMC-type oxidoreductase, putative [Medicago truncatula]
 gb|AET03490.1| long-chain-alcohol oxidase FAO1-like protein [Medicago truncatula]
Length=810

 Score =   176 bits (446),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 102/124 (82%), Gaps = 0/124 (0%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAH  378
            G+EKVLRILAAAGAEEIGT +  G+ L  K  S  E ++FV++ESS  L +LST + SAH
Sbjct  684  GIEKVLRILAAAGAEEIGTHNNKGRSLNVKEVSYHEFEKFVKEESSMPLTDLSTPVCSAH  743

Query  377  QMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVL  198
            QMGSCRMG +P+ SVVN  GETWEVEGL+LAD+SVFPTALGVNPMVTVQAIAYCTAQ VL
Sbjct  744  QMGSCRMGTNPKESVVNQTGETWEVEGLYLADTSVFPTALGVNPMVTVQAIAYCTAQHVL  803

Query  197  KFLK  186
            + LK
Sbjct  804  EVLK  807



>ref|XP_006359947.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Solanum tuberosum]
Length=702

 Score =   175 bits (444),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 88/126 (70%), Positives = 100/126 (79%), Gaps = 0/126 (0%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAH  378
            GLEK LRILAAAGAEEIGT    G+ LK   AS  E + FV++ESS ++G  S  I SAH
Sbjct  574  GLEKTLRILAAAGAEEIGTQQEKGRSLKVNEASLKEFERFVKEESSIEIGKHSVPICSAH  633

Query  377  QMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVL  198
            QMGSCRMGVDP++SVVN  GETWEVEGLFL DSSV PTA+GVNPMVT+QAI+YCTAQSVL
Sbjct  634  QMGSCRMGVDPKTSVVNSKGETWEVEGLFLGDSSVCPTAIGVNPMVTIQAISYCTAQSVL  693

Query  197  KFLKTH  180
            + LK  
Sbjct  694  QLLKNQ  699



>ref|XP_007158083.1| hypothetical protein PHAVU_002G122600g [Phaseolus vulgaris]
 gb|ESW30077.1| hypothetical protein PHAVU_002G122600g [Phaseolus vulgaris]
Length=807

 Score =   176 bits (445),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 102/124 (82%), Gaps = 0/124 (0%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAH  378
            G+EKVLRILAAAGAEEIGT H  G+ L  K  S  E ++FV++ESSR L +LST + SAH
Sbjct  680  GIEKVLRILAAAGAEEIGTHHNKGRTLNVKQVSYHEFEKFVKEESSRPLADLSTPLCSAH  739

Query  377  QMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVL  198
            QMGSCRMG +P+ SVVN  GETWE+EGL+LAD+SVFPTALGVNPMVTVQA AYC AQSV+
Sbjct  740  QMGSCRMGSNPKQSVVNQTGETWEMEGLYLADTSVFPTALGVNPMVTVQATAYCIAQSVV  799

Query  197  KFLK  186
            + L+
Sbjct  800  EVLR  803



>gb|KHN41766.1| Long-chain-alcohol oxidase FAO4A [Glycine soja]
Length=809

 Score =   176 bits (445),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 85/124 (69%), Positives = 102/124 (82%), Gaps = 0/124 (0%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAH  378
            G+EKVLRILAAAGAEEIGT H  G+ L  K     E ++FV++ESSR L +L+T + SAH
Sbjct  681  GIEKVLRILAAAGAEEIGTHHNKGRTLNVKQVRYHEFEKFVKEESSRSLTDLTTPLCSAH  740

Query  377  QMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVL  198
            QMGSCRMG +P+ S VN  GETWEVEGL++AD+SVFPTALGVNPMVTVQAIAYCTAQSV+
Sbjct  741  QMGSCRMGSNPKQSAVNQTGETWEVEGLYVADTSVFPTALGVNPMVTVQAIAYCTAQSVV  800

Query  197  KFLK  186
            + L+
Sbjct  801  EVLR  804



>ref|XP_003547818.2| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Glycine max]
 gb|KHN35528.1| Long-chain-alcohol oxidase FAO4A [Glycine soja]
Length=828

 Score =   176 bits (445),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 103/124 (83%), Gaps = 0/124 (0%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAH  378
            GLEKVLRILAAAGAEEIGT +  G+ +  K  S  E ++FV++ESS  L ++ST + SAH
Sbjct  701  GLEKVLRILAAAGAEEIGTHNNKGRSINVKQVSYHEFEKFVKEESSMSLTDISTPLCSAH  760

Query  377  QMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVL  198
            QMGSC+MG +PR SVVN MGETWEVEGL+LAD+SVFPTALGVNPMVTVQAI+YCTAQ VL
Sbjct  761  QMGSCKMGTNPRESVVNQMGETWEVEGLYLADTSVFPTALGVNPMVTVQAISYCTAQYVL  820

Query  197  KFLK  186
            + L+
Sbjct  821  EVLR  824



>ref|XP_009759689.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Nicotiana sylvestris]
Length=772

 Score =   175 bits (444),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 88/126 (70%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAH  378
            GLEK+LRILAAAGAE IGT H  G+ L  K  S  E + FV++ESS  +GN S  I SAH
Sbjct  644  GLEKMLRILAAAGAEAIGTQHGKGRSLNVKDESLKEFERFVKEESSIKIGNHSVPICSAH  703

Query  377  QMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVL  198
            QMGSCRMG DP +SVVN  GETWEVEGLFL DSSVFPTA+GVNPMVT+QAI+YCTAQSVL
Sbjct  704  QMGSCRMGEDPTTSVVNSKGETWEVEGLFLGDSSVFPTAIGVNPMVTIQAISYCTAQSVL  763

Query  197  KFLKTH  180
            + LK  
Sbjct  764  QLLKNQ  769



>ref|XP_003517097.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Glycine max]
Length=809

 Score =   176 bits (445),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 85/124 (69%), Positives = 102/124 (82%), Gaps = 0/124 (0%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAH  378
            G+EKVLRILAAAGAEEIGT H  G+ L  K     E ++FV++ESSR L +L+T + SAH
Sbjct  681  GIEKVLRILAAAGAEEIGTHHNKGRTLNVKQVRYHEFEKFVKEESSRSLTDLTTPLCSAH  740

Query  377  QMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVL  198
            QMGSCRMG +P+ S VN  GETWEVEGL++AD+SVFPTALGVNPMVTVQAIAYCTAQSV+
Sbjct  741  QMGSCRMGSNPKQSAVNQTGETWEVEGLYVADTSVFPTALGVNPMVTVQAIAYCTAQSVV  800

Query  197  KFLK  186
            + L+
Sbjct  801  EVLR  804



>ref|XP_006368110.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like, partial [Solanum 
tuberosum]
Length=389

 Score =   170 bits (431),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 97/120 (81%), Gaps = 0/120 (0%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAH  378
            GLEK LRILAAAGAEEIGT    G+ LK   AS  E + FV++ESS ++G  S  I SAH
Sbjct  270  GLEKTLRILAAAGAEEIGTQQEKGRSLKVNEASLKEFERFVKEESSIEIGKHSVPICSAH  329

Query  377  QMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVL  198
            QMGSCRMGVDP++SVVN  GETWEVEGLFL DSSV PTA+GVNPMVT+QAI+YCTAQSVL
Sbjct  330  QMGSCRMGVDPKTSVVNSKGETWEVEGLFLGDSSVCPTAIGVNPMVTIQAISYCTAQSVL  389



>ref|XP_004246021.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Solanum lycopersicum]
Length=776

 Score =   174 bits (441),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 87/126 (69%), Positives = 98/126 (78%), Gaps = 0/126 (0%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAH  378
            GLEK LRILAAAGAEEIGT    G+ LK   AS  E + FV +ESS ++G  S  I SAH
Sbjct  648  GLEKTLRILAAAGAEEIGTQQEKGRSLKVNEASTKEFERFVREESSIEIGKHSVPICSAH  707

Query  377  QMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVL  198
            QMGSCRMG DP++SVVN  GETWEVEGLFL DSSV PTA+GVNPMVT+QAI+YCTAQSVL
Sbjct  708  QMGSCRMGTDPKTSVVNSKGETWEVEGLFLGDSSVCPTAIGVNPMVTIQAISYCTAQSVL  767

Query  197  KFLKTH  180
            + LK  
Sbjct  768  QLLKNQ  773



>ref|XP_004509495.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Cicer arietinum]
Length=824

 Score =   174 bits (441),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 102/124 (82%), Gaps = 0/124 (0%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAH  378
            G+EKVLRILAAAGAEEIGT +  G  L  K  S  E ++FV++ESS +L +LST I SAH
Sbjct  698  GIEKVLRILAAAGAEEIGTHNNKGNRLNVKKVSYHEFEKFVKEESSMELTDLSTPICSAH  757

Query  377  QMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVL  198
            QMGSCRMG +P+ SVVN MGETWEVE L++AD+SVFPTALGVNPMVT+QAIAYCTAQ VL
Sbjct  758  QMGSCRMGNNPKDSVVNQMGETWEVEDLYIADASVFPTALGVNPMVTIQAIAYCTAQHVL  817

Query  197  KFLK  186
            + L+
Sbjct  818  EVLR  821



>gb|EPS61567.1| hypothetical protein M569_13229, partial [Genlisea aurea]
Length=735

 Score =   173 bits (439),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 83/124 (67%), Positives = 102/124 (82%), Gaps = 0/124 (0%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAH  378
            G+E VLRILAAAGAEEIGT H+ G++L  K A+ +E+++FV++ES R   NLS+ + SAH
Sbjct  611  GMEMVLRILAAAGAEEIGTQHKQGRVLNVKRATEEELEKFVKEESERGFRNLSSPMCSAH  670

Query  377  QMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVL  198
            QMGSCRMG  P  S V P GE+WEVEGL++ADSSVFPTALGVNPMVT+QAIAYCTAQS+L
Sbjct  671  QMGSCRMGASPAESAVAPDGESWEVEGLYVADSSVFPTALGVNPMVTIQAIAYCTAQSIL  730

Query  197  KFLK  186
              L+
Sbjct  731  TRLR  734



>emb|CBI29206.3| unnamed protein product [Vitis vinifera]
Length=658

 Score =   172 bits (436),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 86/123 (70%), Positives = 103/123 (84%), Gaps = 0/123 (0%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAH  378
            G+EK+LRILAAAGAEEIGT +  G+ +  K  S    ++FV++ESSR L +LST + SAH
Sbjct  522  GMEKLLRILAAAGAEEIGTHNCNGRSINVKKVSSHAFEKFVKEESSRALRDLSTPVCSAH  581

Query  377  QMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVL  198
            QMGSCRMGVDPRSS VN MGETWEVEGL++AD+SVFPTALGVNPMVTVQAIAY TA+SV+
Sbjct  582  QMGSCRMGVDPRSSAVNQMGETWEVEGLYVADTSVFPTALGVNPMVTVQAIAYSTAKSVV  641

Query  197  KFL  189
            + L
Sbjct  642  EML  644



>ref|XP_004512334.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like isoform X2 [Cicer 
arietinum]
Length=816

 Score =   173 bits (438),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 85/124 (69%), Positives = 102/124 (82%), Gaps = 0/124 (0%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAH  378
            G+EKVLRILAAAGAEEIGT H  G+ L  K AS+ E+++FV++ESSR L  LST + SAH
Sbjct  688  GIEKVLRILAAAGAEEIGTHHNKGRTLNVKQASKLELEKFVKEESSRPLTKLSTPLCSAH  747

Query  377  QMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVL  198
            QMGSCRMG +P+ S V   GETWEVE L++ADSSVFPTALG+NPM+T+Q+IAYCTAQSVL
Sbjct  748  QMGSCRMGSNPKESAVKQTGETWEVEDLYVADSSVFPTALGLNPMITIQSIAYCTAQSVL  807

Query  197  KFLK  186
              LK
Sbjct  808  HALK  811



>ref|XP_004512333.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like isoform X1 [Cicer 
arietinum]
Length=834

 Score =   173 bits (439),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 85/124 (69%), Positives = 102/124 (82%), Gaps = 0/124 (0%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAH  378
            G+EKVLRILAAAGAEEIGT H  G+ L  K AS+ E+++FV++ESSR L  LST + SAH
Sbjct  706  GIEKVLRILAAAGAEEIGTHHNKGRTLNVKQASKLELEKFVKEESSRPLTKLSTPLCSAH  765

Query  377  QMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVL  198
            QMGSCRMG +P+ S V   GETWEVE L++ADSSVFPTALG+NPM+T+Q+IAYCTAQSVL
Sbjct  766  QMGSCRMGSNPKESAVKQTGETWEVEDLYVADSSVFPTALGLNPMITIQSIAYCTAQSVL  825

Query  197  KFLK  186
              LK
Sbjct  826  HALK  829



>ref|XP_002269629.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Vitis vinifera]
Length=793

 Score =   172 bits (436),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 104/124 (84%), Gaps = 0/124 (0%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAH  378
            G+EK+LRILAAAGAEEIGT +  G+ +  K  S    ++FV++ESSR L +LST + SAH
Sbjct  661  GMEKLLRILAAAGAEEIGTHNCNGRSINVKKVSSHAFEKFVKEESSRALRDLSTPVCSAH  720

Query  377  QMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVL  198
            QMGSCRMGVDPRSS VN MGETWEVEGL++AD+SVFPTALGVNPMVTVQAIAY TA+SV+
Sbjct  721  QMGSCRMGVDPRSSAVNQMGETWEVEGLYVADTSVFPTALGVNPMVTVQAIAYSTAKSVV  780

Query  197  KFLK  186
            + L+
Sbjct  781  EVLR  784



>ref|XP_004150760.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Cucumis sativus]
Length=617

 Score =   171 bits (433),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 100/124 (81%), Gaps = 0/124 (0%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAH  378
            GLEK L+ILAAAGA EIGT H  G+ +  K  S  E ++FV++ESSR L +L T I SAH
Sbjct  490  GLEKALKILAAAGAVEIGTHHNKGRSINVKKVSFREYEKFVKEESSRPLKDLLTPICSAH  549

Query  377  QMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVL  198
            QMGSCRMG+  + SVVN  GETWEVEGLF+ADSSVFPTALGVNPMVTVQAIAYCTAQSVL
Sbjct  550  QMGSCRMGIGAKDSVVNQRGETWEVEGLFIADSSVFPTALGVNPMVTVQAIAYCTAQSVL  609

Query  197  KFLK  186
            + LK
Sbjct  610  ETLK  613



>ref|XP_004167305.1| PREDICTED: LOW QUALITY PROTEIN: long-chain-alcohol oxidase FAO4A-like, 
partial [Cucumis sativus]
Length=608

 Score =   171 bits (432),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 100/124 (81%), Gaps = 0/124 (0%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAH  378
            GLEK L+ILAAAGA EIGT H  G+ +  K  S  E ++FV++ESSR L +L T I SAH
Sbjct  481  GLEKALKILAAAGAVEIGTHHNKGRSINVKKVSFREYEKFVKEESSRPLKDLLTPICSAH  540

Query  377  QMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVL  198
            QMGSCRMG+  + SVVN  GETWEVEGLF+ADSSVFPTALGVNPMVTVQAIAYCTAQSVL
Sbjct  541  QMGSCRMGIGAKDSVVNQRGETWEVEGLFIADSSVFPTALGVNPMVTVQAIAYCTAQSVL  600

Query  197  KFLK  186
            + LK
Sbjct  601  ETLK  604



>ref|XP_007156339.1| hypothetical protein PHAVU_003G278200g [Phaseolus vulgaris]
 gb|ESW28333.1| hypothetical protein PHAVU_003G278200g [Phaseolus vulgaris]
Length=814

 Score =   171 bits (434),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 84/124 (68%), Positives = 101/124 (81%), Gaps = 0/124 (0%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAH  378
            G+EKVLRILAAAGAEEIGT +  G+ +  K  S  E ++FV++ESS  L +L+T + SAH
Sbjct  687  GIEKVLRILAAAGAEEIGTHNNKGRSINVKQVSYHEFEKFVKEESSMSLTDLTTPLCSAH  746

Query  377  QMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVL  198
            QMGSC+MG +P  SVVN MGETWEVEGL+LAD+SVFPTALGVNPMVTVQAIAYCTAQ V 
Sbjct  747  QMGSCKMGTNPSDSVVNQMGETWEVEGLYLADTSVFPTALGVNPMVTVQAIAYCTAQYVA  806

Query  197  KFLK  186
            + L+
Sbjct  807  EVLR  810



>ref|XP_008444239.1| PREDICTED: long-chain-alcohol oxidase FAO4A isoform X2 [Cucumis 
melo]
Length=731

 Score =   170 bits (430),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 99/124 (80%), Gaps = 0/124 (0%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAH  378
            GLEK L+ILAAAGA EIGT H  G+ +  K  S  E ++FV++ESSR L +L T I SAH
Sbjct  604  GLEKALKILAAAGAVEIGTHHNKGRSINVKKVSYREYEKFVKEESSRPLKDLLTPICSAH  663

Query  377  QMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVL  198
            QMGSCRMG   + SVVN  GETWEVEGLF+ADSSVFPTALGVNPMVTVQAIAYCTAQSVL
Sbjct  664  QMGSCRMGSGAKDSVVNQRGETWEVEGLFIADSSVFPTALGVNPMVTVQAIAYCTAQSVL  723

Query  197  KFLK  186
            + LK
Sbjct  724  ETLK  727



>ref|XP_008444238.1| PREDICTED: long-chain-alcohol oxidase FAO4A isoform X1 [Cucumis 
melo]
Length=821

 Score =   170 bits (431),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 99/124 (80%), Gaps = 0/124 (0%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAH  378
            GLEK L+ILAAAGA EIGT H  G+ +  K  S  E ++FV++ESSR L +L T I SAH
Sbjct  694  GLEKALKILAAAGAVEIGTHHNKGRSINVKKVSYREYEKFVKEESSRPLKDLLTPICSAH  753

Query  377  QMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVL  198
            QMGSCRMG   + SVVN  GETWEVEGLF+ADSSVFPTALGVNPMVTVQAIAYCTAQSVL
Sbjct  754  QMGSCRMGSGAKDSVVNQRGETWEVEGLFIADSSVFPTALGVNPMVTVQAIAYCTAQSVL  813

Query  197  KFLK  186
            + LK
Sbjct  814  ETLK  817



>gb|EYU37432.1| hypothetical protein MIMGU_mgv1a022390mg [Erythranthe guttata]
Length=740

 Score =   168 bits (426),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 100/124 (81%), Gaps = 1/124 (1%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLG-NLSTLIGSA  381
            G+E+VLR+LAAAGAEEIGT HR G++LK K A  +E++ FV +ESSR L  NLS  I SA
Sbjct  611  GIERVLRVLAAAGAEEIGTHHRNGRVLKVKEAGEEELERFVVEESSRVLEENLSWPISSA  670

Query  380  HQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSV  201
            HQMGSCRMGV PR S V P GE+WEV  LF+AD+SVFPTALGVNPMVTVQAIAYC AQ V
Sbjct  671  HQMGSCRMGVGPRGSAVGPTGESWEVGALFVADASVFPTALGVNPMVTVQAIAYCVAQCV  730

Query  200  LKFL  189
            ++ L
Sbjct  731  VQSL  734



>ref|XP_008382148.1| PREDICTED: LOW QUALITY PROTEIN: long-chain-alcohol oxidase FAO4A 
[Malus domestica]
Length=768

 Score =   167 bits (422),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 103/124 (83%), Gaps = 0/124 (0%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAH  378
            GLEK LRILAAAGAEEIGT H  GK L  K AS DE + FV++ESSR L +LS+ I  A+
Sbjct  638  GLEKSLRILAAAGAEEIGTHHFKGKSLAVKKASLDEFERFVKEESSRSLRDLSSAICLAY  697

Query  377  QMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVL  198
            QMGSCRMGVD + SVVN MGETWEVE LFLAD+SVFPTALGVNPMVTVQAIAYCTAQSVL
Sbjct  698  QMGSCRMGVDAKGSVVNQMGETWEVERLFLADTSVFPTALGVNPMVTVQAIAYCTAQSVL  757

Query  197  KFLK  186
            + L+
Sbjct  758  EVLR  761



>ref|XP_006283178.1| hypothetical protein CARUB_v10004208mg [Capsella rubella]
 gb|EOA16076.1| hypothetical protein CARUB_v10004208mg [Capsella rubella]
Length=598

 Score =   165 bits (417),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 98/127 (77%), Gaps = 0/127 (0%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAH  378
            GLE+VL+I+AAAGAEEIGT +  GK L  + AS  E + FV +ESS+ L NLS  I SAH
Sbjct  472  GLEEVLKIMAAAGAEEIGTHNSEGKSLNVRRASAVEFERFVREESSKPLKNLSGQICSAH  531

Query  377  QMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVL  198
            QMGSCRMG+ P  S V P GETWEVEGLF+AD+SVFPTALGVNPMVTVQ+IAYC   +V+
Sbjct  532  QMGSCRMGIRPEESAVRPTGETWEVEGLFVADTSVFPTALGVNPMVTVQSIAYCIGLNVV  591

Query  197  KFLKTHN  177
              LK +N
Sbjct  592  DVLKRNN  598



>ref|XP_002867943.1| hypothetical protein ARALYDRAFT_914728 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44202.1| hypothetical protein ARALYDRAFT_914728 [Arabidopsis lyrata subsp. 
lyrata]
Length=725

 Score =   164 bits (416),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 97/124 (78%), Gaps = 0/124 (0%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAH  378
            GL++VL+ILAAAGAEEIGT H  G+ L  + AS  EI+ FV +ESS+ L +LS  I SAH
Sbjct  599  GLDRVLKILAAAGAEEIGTHHSEGRSLNVRTASTLEIERFVREESSKPLKDLSGQICSAH  658

Query  377  QMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVL  198
            QMGSCRMG+ P  S V P GETWEVEGLF+AD+SVFPTALGVNPMVTVQ+IAYC   +V+
Sbjct  659  QMGSCRMGIRPEESAVRPTGETWEVEGLFVADTSVFPTALGVNPMVTVQSIAYCIGLNVV  718

Query  197  KFLK  186
              LK
Sbjct  719  DVLK  722



>ref|XP_006283177.1| hypothetical protein CARUB_v10004208mg [Capsella rubella]
 gb|EOA16075.1| hypothetical protein CARUB_v10004208mg [Capsella rubella]
Length=761

 Score =   164 bits (416),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 98/127 (77%), Gaps = 0/127 (0%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAH  378
            GLE+VL+I+AAAGAEEIGT +  GK L  + AS  E + FV +ESS+ L NLS  I SAH
Sbjct  635  GLEEVLKIMAAAGAEEIGTHNSEGKSLNVRRASAVEFERFVREESSKPLKNLSGQICSAH  694

Query  377  QMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVL  198
            QMGSCRMG+ P  S V P GETWEVEGLF+AD+SVFPTALGVNPMVTVQ+IAYC   +V+
Sbjct  695  QMGSCRMGIRPEESAVRPTGETWEVEGLFVADTSVFPTALGVNPMVTVQSIAYCIGLNVV  754

Query  197  KFLKTHN  177
              LK +N
Sbjct  755  DVLKRNN  761



>ref|XP_009384756.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Musa acuminata 
subsp. malaccensis]
Length=787

 Score =   164 bits (416),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 97/124 (78%), Gaps = 0/124 (0%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAH  378
            GLEK+LRI+AAAGAEEIGT H  G  L  + AS  + + FV+  S + L +L T + SAH
Sbjct  653  GLEKILRIMAAAGAEEIGTQHCHGDRLNVRSASSHQFERFVKATSGKGLMDLLTPVYSAH  712

Query  377  QMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVL  198
            QMGSCRMG+ PR+S VN  GETWEVEGLF+AD+SV PTALGVNPMVTVQAIAYCTA SVL
Sbjct  713  QMGSCRMGIHPRTSAVNSRGETWEVEGLFVADASVLPTALGVNPMVTVQAIAYCTAHSVL  772

Query  197  KFLK  186
            + L+
Sbjct  773  EELR  776



>emb|CAA18625.1| putative protein [Arabidopsis thaliana]
 emb|CAB78940.1| putative protein [Arabidopsis thaliana]
Length=678

 Score =   162 bits (411),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 96/124 (77%), Gaps = 0/124 (0%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAH  378
            GLE+VL+ILAAAGAEEIGT H  G+ L  + AS  EI+ FV +ESS+ L +LS  I SAH
Sbjct  552  GLERVLKILAAAGAEEIGTHHSEGRSLNVRTASSLEIERFVREESSKPLKDLSGQICSAH  611

Query  377  QMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVL  198
            QMGSCRMG+ P  S V P GETWEVE LF+AD+SVFPTALGVNPMVTVQ+IAYC   +V+
Sbjct  612  QMGSCRMGIRPEESAVRPTGETWEVERLFVADTSVFPTALGVNPMVTVQSIAYCIGLNVV  671

Query  197  KFLK  186
              LK
Sbjct  672  DVLK  675



>emb|CDY66156.1| BnaA01g34950D [Brassica napus]
Length=508

 Score =   161 bits (407),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 94/124 (76%), Gaps = 0/124 (0%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAH  378
            GLE+VL IL AAGAEEIGT +  GK L  K AS  EI+ FV +ESS+ L +LS  I SAH
Sbjct  382  GLERVLNILTAAGAEEIGTHNSEGKSLNVKTASAVEIERFVREESSKSLKDLSGQICSAH  441

Query  377  QMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVL  198
            QMGSCRMG  P  S V P GETWEVEGLF+AD+SVFPTALGVNPMVT+Q+IAYC   +V+
Sbjct  442  QMGSCRMGTSPEVSAVKPTGETWEVEGLFVADTSVFPTALGVNPMVTIQSIAYCIGLNVV  501

Query  197  KFLK  186
              LK
Sbjct  502  DALK  505



>ref|NP_193673.2| Long-chain-alcohol oxidase FAO4A [Arabidopsis thaliana]
 sp|O65709.2|FAO4A_ARATH RecName: Full=Long-chain-alcohol oxidase FAO4A; AltName: Full=Long-chain 
fatty alcohol oxidase 4A [Arabidopsis thaliana]
 gb|AEE84174.1| Long-chain-alcohol oxidase FAO4A [Arabidopsis thaliana]
Length=726

 Score =   162 bits (411),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 96/124 (77%), Gaps = 0/124 (0%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAH  378
            GLE+VL+ILAAAGAEEIGT H  G+ L  + AS  EI+ FV +ESS+ L +LS  I SAH
Sbjct  600  GLERVLKILAAAGAEEIGTHHSEGRSLNVRTASSLEIERFVREESSKPLKDLSGQICSAH  659

Query  377  QMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVL  198
            QMGSCRMG+ P  S V P GETWEVE LF+AD+SVFPTALGVNPMVTVQ+IAYC   +V+
Sbjct  660  QMGSCRMGIRPEESAVRPTGETWEVERLFVADTSVFPTALGVNPMVTVQSIAYCIGLNVV  719

Query  197  KFLK  186
              LK
Sbjct  720  DVLK  723



>ref|XP_008805948.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Phoenix dactylifera]
Length=793

 Score =   162 bits (411),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 80/124 (65%), Positives = 102/124 (82%), Gaps = 0/124 (0%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAH  378
            G+EK+LRI+AAAGAEE+GT H  G+  + K AS  E D FV++ S R +G+L+T + SAH
Sbjct  651  GVEKMLRIMAAAGAEEVGTQHCKGERFEVKRASAREWDSFVKEASRRGVGSLTTPVCSAH  710

Query  377  QMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVL  198
            QMGSCRMGV+  +S V+  GETWEVEGLF+AD+SVFPTALGVNPMVTVQAIAYCTA+S++
Sbjct  711  QMGSCRMGVEASTSAVDEGGETWEVEGLFVADTSVFPTALGVNPMVTVQAIAYCTARSIV  770

Query  197  KFLK  186
            + L+
Sbjct  771  QVLR  774



>ref|XP_009137007.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Brassica rapa]
Length=770

 Score =   162 bits (410),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 83/124 (67%), Positives = 95/124 (77%), Gaps = 0/124 (0%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAH  378
            GLE VL IL AAGAEEIGT +  GK L  + AS  EI+ FV +ESS+ L +LS  I SAH
Sbjct  645  GLESVLNILIAAGAEEIGTHNSKGKSLNVRTASAVEIERFVREESSKSLKDLSGQICSAH  704

Query  377  QMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVL  198
            QMGSCRMG+ P  S V PMGETWEVEGLF+AD+SVFPTALGVNPMVTVQ+IAYC   +V+
Sbjct  705  QMGSCRMGIRPEESAVRPMGETWEVEGLFVADTSVFPTALGVNPMVTVQSIAYCIGLNVV  764

Query  197  KFLK  186
              LK
Sbjct  765  GALK  768



>gb|EPS64229.1| hypothetical protein M569_10552, partial [Genlisea aurea]
Length=725

 Score =   161 bits (408),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 83/134 (62%), Positives = 104/134 (78%), Gaps = 6/134 (4%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDE----IDEFVEKESSRDLG--NLST  396
            GLE+VLR+LAAAGAEEIGT HR G+ LK K   RD+    ++ F+++ES + L   +LS+
Sbjct  591  GLEEVLRVLAAAGAEEIGTHHRDGRSLKVKKKDRDDQAALLERFIKEESRKPLEKESLSS  650

Query  395  LIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYC  216
             I SAHQMGSCRMG DP  S V+P GETWEV GLF+AD+SVFPTALGVNPM+TVQAI+YC
Sbjct  651  PICSAHQMGSCRMGTDPLRSAVDPNGETWEVGGLFVADTSVFPTALGVNPMLTVQAISYC  710

Query  215  TAQSVLKFLKTHNH  174
             ++SVL  LK + +
Sbjct  711  ISKSVLNHLKCNKY  724



>ref|XP_010538590.1| PREDICTED: long-chain-alcohol oxidase FAO4A isoform X1 [Tarenaya 
hassleriana]
Length=782

 Score =   161 bits (407),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 93/124 (75%), Gaps = 0/124 (0%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAH  378
            G+E++LRIL AAGAEEIGT +  GK L  K AS +E + FV +ESS+ L  LS  I SAH
Sbjct  657  GIERILRILTAAGAEEIGTHNLEGKSLNVKAASSEEYERFVREESSKPLKGLSGQICSAH  716

Query  377  QMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVL  198
            QMGSCRMGV    S V P GETWEVEGLF+AD+SVFPTALGVNPMVTVQAIAYC    V+
Sbjct  717  QMGSCRMGVAAEKSAVRPTGETWEVEGLFVADTSVFPTALGVNPMVTVQAIAYCVGSYVI  776

Query  197  KFLK  186
              LK
Sbjct  777  DVLK  780



>ref|XP_010439724.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like isoform X1 [Camelina 
sativa]
 ref|XP_010439725.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like isoform X2 [Camelina 
sativa]
Length=771

 Score =   161 bits (407),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 97/124 (78%), Gaps = 0/124 (0%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAH  378
            GLE+VL+ILAA+GAEEIGT +  GK L  + AS  EI+ FV +ESS+ L +LS  + SAH
Sbjct  646  GLERVLKILAASGAEEIGTHNLEGKSLNLRTASAVEIERFVREESSKPLKDLSGQLCSAH  705

Query  377  QMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVL  198
            QMGSCRMG+ P  S V P GETWEVEGLF+AD+SVFPTALGVNPMVTVQ+IAYC   +V+
Sbjct  706  QMGSCRMGIRPEESAVRPTGETWEVEGLFVADTSVFPTALGVNPMVTVQSIAYCIGLNVV  765

Query  197  KFLK  186
              LK
Sbjct  766  DVLK  769



>ref|XP_010434428.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Camelina sativa]
Length=771

 Score =   161 bits (407),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 97/124 (78%), Gaps = 0/124 (0%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAH  378
            GLE+VL+ILAA+GAEEIGT +  GK L  + AS  EI+ FV +ESS+ L +LS  + SAH
Sbjct  646  GLERVLKILAASGAEEIGTHNLEGKSLNLRTASAVEIERFVREESSKPLKDLSGQLCSAH  705

Query  377  QMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVL  198
            QMGSCRMG+ P  S V P GETWEVEGLF+AD+SVFPTALGVNPMVTVQ+IAYC   +V+
Sbjct  706  QMGSCRMGIRPEESAVRPTGETWEVEGLFVADTSVFPTALGVNPMVTVQSIAYCIGLNVV  765

Query  197  KFLK  186
              LK
Sbjct  766  DVLK  769



>ref|XP_010449364.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Camelina sativa]
Length=768

 Score =   161 bits (407),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 97/124 (78%), Gaps = 0/124 (0%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAH  378
            GLE+VL+ILAA+GAEEIGT +  GK L  + AS  EI+ FV +ESS+ L +LS  + SAH
Sbjct  643  GLERVLKILAASGAEEIGTHNLEGKSLNLRTASAVEIERFVREESSKPLKDLSGQLCSAH  702

Query  377  QMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVL  198
            QMGSCRMG+ P  S V P GETWEVEGLF+AD+SVFPTALGVNPMVTVQ+IAYC   +V+
Sbjct  703  QMGSCRMGIRPEESAVRPTGETWEVEGLFVADTSVFPTALGVNPMVTVQSIAYCIGLNVV  762

Query  197  KFLK  186
              LK
Sbjct  763  DVLK  766



>emb|CDX99382.1| BnaC01g11700D [Brassica napus]
Length=508

 Score =   158 bits (399),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 94/124 (76%), Gaps = 0/124 (0%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAH  378
            GLE+VL IL AAGAEEIGT +  GK L  + AS  EI+ FV +ESS+ L +LS  I SAH
Sbjct  382  GLERVLNILTAAGAEEIGTHNSEGKSLNVRTASAVEIERFVREESSKGLKDLSGQICSAH  441

Query  377  QMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVL  198
            QMGSCRMG  P  S V P GETWEVEGLF+AD+SVFPTALGVNPMV+VQ+IAYC   +V+
Sbjct  442  QMGSCRMGTRPEVSAVKPTGETWEVEGLFVADTSVFPTALGVNPMVSVQSIAYCIGLNVV  501

Query  197  KFLK  186
              LK
Sbjct  502  DALK  505



>ref|XP_009132755.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Brassica rapa]
Length=771

 Score =   160 bits (404),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 93/124 (75%), Gaps = 0/124 (0%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAH  378
            GLE+VL IL AAGAEEIGT +  GK L  K  S  EI+ FV +ESS+ L +LS  I SAH
Sbjct  645  GLERVLNILTAAGAEEIGTHNSEGKSLNVKTTSAVEIERFVREESSKSLKDLSGQICSAH  704

Query  377  QMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVL  198
            QMGSCRMG  P  S V P GETWEVEGLF+AD+SVFPTALGVNPMVTVQ+IAYC   +V+
Sbjct  705  QMGSCRMGTSPEVSAVKPTGETWEVEGLFVADTSVFPTALGVNPMVTVQSIAYCIGLNVV  764

Query  197  KFLK  186
              LK
Sbjct  765  DALK  768



>gb|KFK28594.1| hypothetical protein AALP_AA7G017800 [Arabis alpina]
Length=752

 Score =   157 bits (397),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 94/124 (76%), Gaps = 0/124 (0%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAH  378
            GLE+VL IL AAGAEEIGT +  GK L    A+  +I  FV +ESS+ L +LS  I SAH
Sbjct  626  GLERVLEILIAAGAEEIGTHNSEGKSLNITTANALQIARFVREESSKGLKDLSGQICSAH  685

Query  377  QMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVL  198
            QMGSCRMG+ P  S V P GETWEVEGLF+AD+SVFPTALGVNPMVTVQ+IAYC   +VL
Sbjct  686  QMGSCRMGIRPEESAVRPTGETWEVEGLFVADTSVFPTALGVNPMVTVQSIAYCIGLNVL  745

Query  197  KFLK  186
            + LK
Sbjct  746  EVLK  749



>ref|XP_006413983.1| hypothetical protein EUTSA_v10024528mg [Eutrema salsugineum]
 gb|ESQ55436.1| hypothetical protein EUTSA_v10024528mg [Eutrema salsugineum]
Length=728

 Score =   155 bits (393),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 78/124 (63%), Positives = 94/124 (76%), Gaps = 0/124 (0%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAH  378
            GLE+VL IL AAGAEEIGT +  GK L  + AS  EI+ FV +ESS+ L +L+  I SAH
Sbjct  602  GLERVLNILIAAGAEEIGTHNSEGKSLNVRTASEAEIERFVREESSKGLKDLAGQICSAH  661

Query  377  QMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVL  198
            QMGSCRMG+ P  S V P GETWEV GL++AD+SVFPTALGVNPMVTVQ+IAYC   +V+
Sbjct  662  QMGSCRMGIRPEESAVRPTGETWEVGGLYVADTSVFPTALGVNPMVTVQSIAYCIGLNVV  721

Query  197  KFLK  186
              L+
Sbjct  722  DVLR  725



>emb|CDY01593.1| BnaC07g35830D [Brassica napus]
Length=770

 Score =   156 bits (394),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 92/124 (74%), Gaps = 0/124 (0%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAH  378
            GL  VL IL AAGAEEIGT +  GK L  + AS  EI  FV +ESS+ L +LS  I SAH
Sbjct  645  GLGSVLNILIAAGAEEIGTHNSEGKSLNVRTASAVEIKRFVREESSKSLKDLSGQICSAH  704

Query  377  QMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVL  198
            QMGSCRMG+ P  S V P GETWEVEGLF+AD+SVFPTALGVNPMVTVQ+IAYC   +V+
Sbjct  705  QMGSCRMGIRPEESAVKPTGETWEVEGLFVADTSVFPTALGVNPMVTVQSIAYCIGLNVV  764

Query  197  KFLK  186
              LK
Sbjct  765  GALK  768



>ref|XP_010942998.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Elaeis guineensis]
Length=787

 Score =   154 bits (389),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 78/124 (63%), Positives = 97/124 (78%), Gaps = 0/124 (0%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAH  378
            G+EK+L I+A AGAEE+GT H  G+  + K AS  E + FV K S R +G L+T + SAH
Sbjct  655  GVEKMLWIMAGAGAEEVGTQHCKGERFEVKRASAREWERFVIKASRRVVGWLTTPVCSAH  714

Query  377  QMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVL  198
            QMGSCRMGV+  +S V+  GETWEVEGLF+AD+SVFPTALGVNPMVTVQAIAYCTA S++
Sbjct  715  QMGSCRMGVEDTTSAVDERGETWEVEGLFVADASVFPTALGVNPMVTVQAIAYCTAHSIV  774

Query  197  KFLK  186
            + L+
Sbjct  775  QVLR  778



>ref|XP_008776965.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Phoenix dactylifera]
Length=766

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 93/124 (75%), Gaps = 2/124 (2%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAH  378
            G+E ++RILAAAGAEE+GT H  G+  + +      ++  V++   R L +  T + +AH
Sbjct  640  GVEAMVRILAAAGAEEVGTLHCKGE--RVRVGEEGGVEWLVKEVRRRGLRDGGTPVSTAH  697

Query  377  QMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVL  198
            QMGSCRMG D R+  V+P GE WEVEGLF+AD+SVFPTALGVNPMVT QAIAYCTAQS+L
Sbjct  698  QMGSCRMGTDARAGAVSPTGEVWEVEGLFVADTSVFPTALGVNPMVTAQAIAYCTAQSIL  757

Query  197  KFLK  186
            +FL+
Sbjct  758  EFLE  761



>ref|XP_006878629.1| hypothetical protein AMTR_s00011p00262370 [Amborella trichopoda]
 gb|ERM94774.1| hypothetical protein AMTR_s00011p00262370 [Amborella trichopoda]
Length=814

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 88/123 (72%), Gaps = 4/123 (3%)
 Frame = -1

Query  554  LEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLST----LIG  387
            +EK+LRILAAAGAEEIGT    G+ +  K AS  E + FV + S + L   S      I 
Sbjct  682  MEKMLRILAAAGAEEIGTHGSNGERINVKVASSHEFERFVREVSRKPLQRFSNGYWRPIC  741

Query  386  SAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQ  207
            SAHQMG+CRMG  P  SVV+  GE WEVEGL++ADSSVFPTALGVNPM+TVQAIAYCTA 
Sbjct  742  SAHQMGTCRMGAHPNDSVVDQKGECWEVEGLYIADSSVFPTALGVNPMLTVQAIAYCTAH  801

Query  206  SVL  198
            + L
Sbjct  802  AAL  804



>ref|XP_010538591.1| PREDICTED: long-chain-alcohol oxidase FAO4A isoform X2 [Tarenaya 
hassleriana]
Length=765

 Score =   141 bits (355),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 82/107 (77%), Gaps = 0/107 (0%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAH  378
            G+E++LRIL AAGAEEIGT +  GK L  K AS +E + FV +ESS+ L  LS  I SAH
Sbjct  657  GIERILRILTAAGAEEIGTHNLEGKSLNVKAASSEEYERFVREESSKPLKGLSGQICSAH  716

Query  377  QMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVT  237
            QMGSCRMGV    S V P GETWEVEGLF+AD+SVFPTALGVNPMVT
Sbjct  717  QMGSCRMGVAAEKSAVRPTGETWEVEGLFVADTSVFPTALGVNPMVT  763



>ref|XP_001763007.1| predicted protein [Physcomitrella patens]
 gb|EDQ72212.1| predicted protein [Physcomitrella patens]
Length=775

 Score =   140 bits (352),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 66/126 (52%), Positives = 91/126 (72%), Gaps = 0/126 (0%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAH  378
            G+EK LR+L AAGA EIGT  + G+    KGA+  +I+ ++++  SR +     +IGS H
Sbjct  642  GIEKGLRVLIAAGATEIGTHQQDGERFCVKGANSRDIEAYIKRVRSRGVKKNKIIIGSGH  701

Query  377  QMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVL  198
             MGSC+MG DPR S V+  GETWEVEGL+++D SV P+A+GVNPMVT+Q++AYC A SVL
Sbjct  702  HMGSCKMGSDPRRSAVDGEGETWEVEGLYVSDGSVLPSAIGVNPMVTIQSVAYCIAHSVL  761

Query  197  KFLKTH  180
            + L + 
Sbjct  762  QSLDSQ  767



>ref|XP_009396212.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Musa acuminata subsp. 
malaccensis]
Length=745

 Score =   136 bits (343),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 76/128 (59%), Positives = 92/128 (72%), Gaps = 1/128 (1%)
 Frame = -1

Query  554  LEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDE-FVEKESSRDLGNLSTLIGSAH  378
            LE  +RILAAAGAEE+GT H  G+ +K  G    E  E  V +   R L +  T I +AH
Sbjct  615  LEAAVRILAAAGAEEVGTHHGKGERVKVGGRGGGEGVEELVTEVVRRGLRDGKTPISTAH  674

Query  377  QMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVL  198
            QMGSCRM  D +   V+P GETWEVEGL++AD+SVFPTALGVNPMVTVQAIAYCTAQS+L
Sbjct  675  QMGSCRMAADAKEGAVSPRGETWEVEGLYVADTSVFPTALGVNPMVTVQAIAYCTAQSIL  734

Query  197  KFLKTHNH  174
            + L+  N+
Sbjct  735  QVLQGSNN  742



>ref|XP_002961172.1| hypothetical protein SELMODRAFT_73531 [Selaginella moellendorffii]
 gb|EFJ38711.1| hypothetical protein SELMODRAFT_73531 [Selaginella moellendorffii]
Length=747

 Score =   136 bits (343),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 87/124 (70%), Gaps = 0/124 (0%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAH  378
            G EK +R+L AAGA E+GT H  G  L  +G+    +++F+    S+ L + +    SAH
Sbjct  620  GAEKAIRVLIAAGAVEVGTQHPDGDSLVVEGSDEKALEKFLRVIDSKQLTHAAMATASAH  679

Query  377  QMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVL  198
            QMGSCRMG DP SS V+P GE WE  GLF+AD+SVFPTALGVNPMVT Q++A C A+SV 
Sbjct  680  QMGSCRMGNDPASSAVDPRGEAWESTGLFVADTSVFPTALGVNPMVTAQSVALCIAKSVH  739

Query  197  KFLK  186
            +FL+
Sbjct  740  RFLE  743



>ref|XP_002966834.1| hypothetical protein SELMODRAFT_87621 [Selaginella moellendorffii]
 gb|EFJ31433.1| hypothetical protein SELMODRAFT_87621 [Selaginella moellendorffii]
Length=747

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 87/124 (70%), Gaps = 0/124 (0%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAH  378
            G EK +R+L AAGA E+GT H  G  L  +G+    +++F+    S+ L + +    SAH
Sbjct  620  GAEKAIRVLIAAGAVEVGTQHPDGDSLVVEGSDEKALEKFLRVIGSKQLTHAAMATASAH  679

Query  377  QMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVL  198
            QMGSCRMG DP SS V+P GE WE  GLF+AD+SVFPTALGVNPMVT Q++A C A+SV 
Sbjct  680  QMGSCRMGNDPASSAVDPRGEAWESTGLFVADTSVFPTALGVNPMVTAQSVALCIAKSVH  739

Query  197  KFLK  186
            +FL+
Sbjct  740  RFLE  743



>gb|ABR17814.1| unknown [Picea sitchensis]
Length=743

 Score =   131 bits (330),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 89/127 (70%), Gaps = 1/127 (1%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAH  378
            GL + ++IL AAGA E+GT    G+ L  KGA+ DEI+EF+  +     G   T   SAH
Sbjct  610  GLRRCVQILIAAGATEVGTHRSDGERLAVKGATDDEIEEFLNNKGKGRRGVWPTFF-SAH  668

Query  377  QMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVL  198
            QMGSCRMG D  S  V+  GE+WEVEGLF+ D S+ PT++GVNPM+T+Q++A+C A  +L
Sbjct  669  QMGSCRMGKDEESGGVDWKGESWEVEGLFVCDGSLLPTSVGVNPMITIQSLAFCVANYIL  728

Query  197  KFLKTHN  177
            +FL+T++
Sbjct  729  QFLRTNS  735



>ref|XP_007132926.1| hypothetical protein PHAVU_011G136600g [Phaseolus vulgaris]
 gb|ESW04920.1| hypothetical protein PHAVU_011G136600g [Phaseolus vulgaris]
Length=755

 Score =   128 bits (322),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/127 (48%), Positives = 86/127 (68%), Gaps = 4/127 (3%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEK----ESSRDLGNLSTLI  390
            G+++ LRIL AAGA E+GT    G+ L+  G S D++ EF++     E +   G+   L 
Sbjct  620  GMQQALRILIAAGAVEVGTHRSDGQRLRCSGVSEDKVQEFLDSVCPMEGALSPGDKWNLY  679

Query  389  GSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTA  210
             SAHQMGSCRMGV+ +   V+  GETWE EGLF+ D+SV PTA+GVNPM+T+Q+ AYC +
Sbjct  680  SSAHQMGSCRMGVNEKEGAVDENGETWEAEGLFVCDASVLPTAVGVNPMITIQSTAYCIS  739

Query  209  QSVLKFL  189
              ++ +L
Sbjct  740  NRIVDYL  746



>ref|XP_001761391.1| predicted protein [Physcomitrella patens]
 gb|EDQ73780.1| predicted protein [Physcomitrella patens]
Length=685

 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/124 (47%), Positives = 83/124 (67%), Gaps = 0/124 (0%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAH  378
            G+ + LR+L AAGA E+G+     +    KGAS  +I+ ++ +   R     +  I SAH
Sbjct  558  GMVQSLRVLVAAGAVEVGSQQLGAERFNAKGASPSDIEAYLNRVERRGASETTAQIISAH  617

Query  377  QMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVL  198
            Q+GSCRMG  P +S  +P GE WEVEGLF+ D SV PTA GVNPMVT+Q++A+CTA+ ++
Sbjct  618  QLGSCRMGTSPSTSAADPRGEIWEVEGLFVGDGSVLPTAPGVNPMVTIQSVAFCTAEHIV  677

Query  197  KFLK  186
            ++L 
Sbjct  678  QYLN  681



>ref|XP_001753124.1| predicted protein [Physcomitrella patens]
 gb|EDQ82165.1| predicted protein [Physcomitrella patens]
Length=699

 Score =   126 bits (316),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 68/141 (48%), Positives = 86/141 (61%), Gaps = 18/141 (13%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILK------------------PKGASRDEIDEFVE  432
            G+ + LRIL AAGA EIGT    G+  K                    GA+  +I+E+++
Sbjct  552  GMIQSLRILVAAGAVEIGTQQLDGERFKHCNSNWPIRTDSSNCIVVTAGATPAQIEEYLD  611

Query  431  KESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGV  252
            +   R     S  I SAHQ+GSCRMG  PR+S V+  GETWE EG+F+AD SV PT+ GV
Sbjct  612  RVKRRRARQSSIQIASAHQLGSCRMGTSPRTSAVDARGETWEAEGVFVADGSVLPTSSGV  671

Query  251  NPMVTVQAIAYCTAQSVLKFL  189
            NPMVT+Q+IAYCTA SV  FL
Sbjct  672  NPMVTIQSIAYCTADSVAHFL  692



>ref|XP_009384649.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Musa acuminata 
subsp. malaccensis]
Length=752

 Score =   125 bits (315),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 63/128 (49%), Positives = 85/128 (66%), Gaps = 4/128 (3%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESS----RDLGNLSTLI  390
            GL + LRIL AAGA E+GT    G+ +K KG   +E++EF++   S    R   ++ TL 
Sbjct  622  GLRRALRILVAAGAAEVGTHRSDGQTIKCKGMKEEELEEFLDGIDSVGGPRSRSDVWTLH  681

Query  389  GSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTA  210
             SAHQMGSCRMG       V+  GE+WE  GLF+ D SV PTA+GVNPM+T+QAIAYC +
Sbjct  682  CSAHQMGSCRMGASEEEGGVDERGESWEAGGLFVCDGSVVPTAVGVNPMITIQAIAYCLS  741

Query  209  QSVLKFLK  186
            + + ++LK
Sbjct  742  EGIAEYLK  749



>ref|XP_006582261.1| PREDICTED: long-chain-alcohol oxidase FAO1-like [Glycine max]
Length=749

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/128 (48%), Positives = 84/128 (66%), Gaps = 4/128 (3%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEK----ESSRDLGNLSTLI  390
            GL++ LRIL AAGA E+GT    G+ LK  G   +E+ EF++     E +   G    + 
Sbjct  620  GLKQALRILIAAGAVEVGTHRSDGQRLKCDGIGENEVQEFLDSVCPMEGALSPGEKWNIY  679

Query  389  GSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTA  210
             SAHQMGSCRMGV  +   V+  GETWE EGLF+ D+SV P+A+GVNPM+TVQ+ AYC +
Sbjct  680  SSAHQMGSCRMGVSEKEGAVDENGETWEAEGLFVCDASVLPSAVGVNPMITVQSTAYCIS  739

Query  209  QSVLKFLK  186
              ++ +L+
Sbjct  740  NRIVDYLR  747



>gb|KHN28101.1| Long-chain-alcohol oxidase FAO1-like protein [Glycine soja]
Length=749

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/128 (48%), Positives = 84/128 (66%), Gaps = 4/128 (3%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEK----ESSRDLGNLSTLI  390
            GL++ LRIL AAGA E+GT    G+ LK  G   +E+ EF++     E +   G    + 
Sbjct  620  GLKQALRILIAAGAVEVGTHRSDGQRLKCDGIGENEVQEFLDSVCPMEGALSPGEKWNIY  679

Query  389  GSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTA  210
             SAHQMGSCRMGV  +   V+  GETWE EGLF+ D+SV P+A+GVNPM+TVQ+ AYC +
Sbjct  680  SSAHQMGSCRMGVSEKEGAVDENGETWEAEGLFVCDASVLPSAVGVNPMITVQSTAYCIS  739

Query  209  QSVLKFLK  186
              ++ +L+
Sbjct  740  NRIVDYLR  747



>ref|XP_003540021.1| PREDICTED: long-chain-alcohol oxidase FAO1-like [Glycine max]
 gb|KHN27785.1| Long-chain-alcohol oxidase FAO1 [Glycine soja]
Length=751

 Score =   124 bits (312),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 60/128 (47%), Positives = 84/128 (66%), Gaps = 4/128 (3%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEK----ESSRDLGNLSTLI  390
            GL++ L+IL AAGA E+GT    G+ LK  G   +E+ EF++     E +   G    + 
Sbjct  622  GLKQALKILIAAGAVEVGTHRSDGQRLKCDGIGENEVQEFLDSVCPMEGALSPGEYWNIY  681

Query  389  GSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTA  210
             SAHQMGSCRMGV+ +   V+  GETWE EGLF+ D+SV P+A+GVNPM+TVQ+ AYC +
Sbjct  682  SSAHQMGSCRMGVNEKEGAVDENGETWEAEGLFVCDASVLPSAVGVNPMITVQSTAYCIS  741

Query  209  QSVLKFLK  186
              +  +L+
Sbjct  742  NRIADYLR  749



>ref|XP_008785203.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Phoenix dactylifera]
Length=758

 Score =   124 bits (311),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 60/127 (47%), Positives = 86/127 (68%), Gaps = 4/127 (3%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESS----RDLGNLSTLI  390
            GL + LRIL AAGA E+GT    G+ +K KG   ++++EF++  ++    R    L T+ 
Sbjct  627  GLRRALRILVAAGAVEVGTHRSDGQRIKCKGIKEEDLEEFLDGITAVGGPRSRSELWTIY  686

Query  389  GSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTA  210
            GSAHQMGSCRMGV      V+  GE+WE +GLF+ D SV PTALG+NPM+T+Q++AYC +
Sbjct  687  GSAHQMGSCRMGVSEEEGGVDERGESWEAQGLFVCDGSVLPTALGINPMITIQSVAYCLS  746

Query  209  QSVLKFL  189
            + + + L
Sbjct  747  KGIAESL  753



>ref|XP_010102592.1| Long-chain-alcohol oxidase FAO1 [Morus notabilis]
 gb|EXB93709.1| Long-chain-alcohol oxidase FAO1 [Morus notabilis]
Length=742

 Score =   124 bits (311),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 88/127 (69%), Gaps = 4/127 (3%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEK----ESSRDLGNLSTLI  390
            GL + LRIL AAGA E+GT    G+ +K KG +++E+DEF++       + ++    T  
Sbjct  611  GLRQALRILVAAGAVEVGTHRSDGQRIKCKGINKNELDEFLDSVYAVGGAMEMSECWTNY  670

Query  389  GSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTA  210
            GSAHQ+GSCRMGV+ +   V+  GE+WE EGLF+ D+SV P+A+GVNPM+T+Q+ AYC +
Sbjct  671  GSAHQLGSCRMGVNEKEGAVDENGESWEAEGLFVCDASVLPSAVGVNPMITIQSTAYCLS  730

Query  209  QSVLKFL  189
            + + + L
Sbjct  731  KKIAESL  737



>ref|XP_006857358.1| hypothetical protein AMTR_s00067p00112750 [Amborella trichopoda]
 gb|ERN18825.1| hypothetical protein AMTR_s00067p00112750 [Amborella trichopoda]
Length=798

 Score =   124 bits (311),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 86/131 (66%), Gaps = 10/131 (8%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVE-------KESSRDLGNLS  399
            GL   LRIL AAGA E+GT    G+ +K KG   ++ +EF++         S  +  NL 
Sbjct  649  GLRTALRILVAAGAVEVGTHRSDGQRIKTKGMRDEDFEEFLDGIEVFGGAYSGEEKWNLY  708

Query  398  TLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAY  219
            T   SAHQMGSCRMG D   S V+  GE+WE EGLF+ D S+ PTALGVNPM+TVQ+IA+
Sbjct  709  T---SAHQMGSCRMGADEEKSAVDERGESWEAEGLFVCDGSLMPTALGVNPMITVQSIAH  765

Query  218  CTAQSVLKFLK  186
            C + ++++FL+
Sbjct  766  CISDNMVEFLR  776



>gb|KCW60303.1| hypothetical protein EUGRSUZ_H03017 [Eucalyptus grandis]
Length=781

 Score =   122 bits (307),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 92/140 (66%), Gaps = 10/140 (7%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKG--ASRDEIDEFVEKESSRD----LGNLST  396
            GL + LRIL AAGA+E+GT    G  +K +G  AS  +++EF+++ S+ D    +    T
Sbjct  628  GLRQSLRILIAAGADEVGTHRSDGLRMKCRGGTASEYQVEEFLDRVSAEDGPLAMDEKWT  687

Query  395  LIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYC  216
               SAHQMGSCRMG++ +   V+  GE+WE EGLF+ D+SV PTA+GVNPM+T+++ AYC
Sbjct  688  FYTSAHQMGSCRMGINEKEGAVDENGESWEAEGLFVCDASVLPTAVGVNPMITIESTAYC  747

Query  215  TAQSVLKFLKTHNHMQGYIK  156
             A  + ++L      QG +K
Sbjct  748  IANRIAEYLSK----QGLLK  763



>ref|XP_010023906.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Eucalyptus grandis]
 gb|KCW60304.1| hypothetical protein EUGRSUZ_H03017 [Eucalyptus grandis]
Length=776

 Score =   122 bits (307),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 92/140 (66%), Gaps = 10/140 (7%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKG--ASRDEIDEFVEKESSRD----LGNLST  396
            GL + LRIL AAGA+E+GT    G  +K +G  AS  +++EF+++ S+ D    +    T
Sbjct  628  GLRQSLRILIAAGADEVGTHRSDGLRMKCRGGTASEYQVEEFLDRVSAEDGPLAMDEKWT  687

Query  395  LIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYC  216
               SAHQMGSCRMG++ +   V+  GE+WE EGLF+ D+SV PTA+GVNPM+T+++ AYC
Sbjct  688  FYTSAHQMGSCRMGINEKEGAVDENGESWEAEGLFVCDASVLPTAVGVNPMITIESTAYC  747

Query  215  TAQSVLKFLKTHNHMQGYIK  156
             A  + ++L      QG +K
Sbjct  748  IANRIAEYLSK----QGLLK  763



>gb|AAL31021.1|AC078948_5 putative alcohol oxidase [Oryza sativa Japonica Group]
Length=590

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/124 (48%), Positives = 81/124 (65%), Gaps = 5/124 (4%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEF-----VEKESSRDLGNLSTL  393
            GL + LRIL AAGA E+GT    G  L+ KGA   +++ F     VEK       +  ++
Sbjct  456  GLRRALRILVAAGAAEVGTHRSDGARLRCKGARDADVEAFLDEVTVEKGPMHSTTDKWSV  515

Query  392  IGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCT  213
            + SAHQMGSCRMG  PR   V+  GE+WE EGL++ D S+ PTA+GVNPM+T+Q+IAYC 
Sbjct  516  LCSAHQMGSCRMGASPRDGAVDVAGESWEAEGLYVCDGSLLPTAVGVNPMITIQSIAYCV  575

Query  212  AQSV  201
            A+ +
Sbjct  576  AKGI  579



>gb|EEE51131.1| hypothetical protein OsJ_31875 [Oryza sativa Japonica Group]
Length=611

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/124 (48%), Positives = 81/124 (65%), Gaps = 5/124 (4%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEF-----VEKESSRDLGNLSTL  393
            GL + LRIL AAGA E+GT    G  L+ KGA   +++ F     VEK       +  ++
Sbjct  477  GLRRALRILVAAGAAEVGTHRSDGARLRCKGARDADVEAFLDEVTVEKGPMHSTTDKWSV  536

Query  392  IGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCT  213
            + SAHQMGSCRMG  PR   V+  GE+WE EGL++ D S+ PTA+GVNPM+T+Q+IAYC 
Sbjct  537  LCSAHQMGSCRMGASPRDGAVDVAGESWEAEGLYVCDGSLLPTAVGVNPMITIQSIAYCV  596

Query  212  AQSV  201
            A+ +
Sbjct  597  AKGI  600



>gb|AAL31049.1|AC078893_12 putative oxidase [Oryza sativa Japonica Group]
 gb|ABB47786.2| GMC oxidoreductase family protein, expressed [Oryza sativa Japonica 
Group]
Length=595

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/124 (48%), Positives = 81/124 (65%), Gaps = 5/124 (4%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEF-----VEKESSRDLGNLSTL  393
            GL + LRIL AAGA E+GT    G  L+ KGA   +++ F     VEK       +  ++
Sbjct  461  GLRRALRILVAAGAAEVGTHRSDGARLRCKGARDADVEAFLDEVTVEKGPMHSTTDKWSV  520

Query  392  IGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCT  213
            + SAHQMGSCRMG  PR   V+  GE+WE EGL++ D S+ PTA+GVNPM+T+Q+IAYC 
Sbjct  521  LCSAHQMGSCRMGASPRDGAVDVAGESWEAEGLYVCDGSLLPTAVGVNPMITIQSIAYCV  580

Query  212  AQSV  201
            A+ +
Sbjct  581  AKGI  584



>gb|AES89853.2| long-chain-alcohol oxidase FAO2-like protein [Medicago truncatula]
Length=754

 Score =   121 bits (304),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 62/130 (48%), Positives = 88/130 (68%), Gaps = 7/130 (5%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAG--KILKPKGASRDEIDEFVEK----ESSRDLGNLST  396
            G+++ LRIL AAGA E+GT HR+G  +I   +  S  EI+EF++     E +   G    
Sbjct  621  GIQQALRILIAAGAVEVGT-HRSGGQRIKCNENTSEKEIEEFIDSVYPMEGALWPGENWN  679

Query  395  LIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYC  216
            L  SAHQMGSCRMGV+ +   V+  GE+WE EGLF+ D+SV PTA+GVNPM+T+Q+ A+C
Sbjct  680  LYTSAHQMGSCRMGVNEKEGAVDENGESWEAEGLFVCDASVLPTAVGVNPMITIQSTAFC  739

Query  215  TAQSVLKFLK  186
             +  ++ FL+
Sbjct  740  ISNRIVDFLR  749



>ref|XP_004157702.1| PREDICTED: long-chain-alcohol oxidase FAO1-like, partial [Cucumis 
sativus]
Length=349

 Score =   118 bits (295),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 83/128 (65%), Gaps = 4/128 (3%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSR----DLGNLSTLI  390
            GL + LRIL AAGA E+GT    G+ L+ KG  ++E++EF++  S+      L     + 
Sbjct  221  GLRQSLRILVAAGATEVGTHRSDGQRLECKGIGKEELEEFLDSVSAEGGLLSLSKDWNVY  280

Query  389  GSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTA  210
             SAHQMGSC++GV      ++  GE+WE EGLF+ D+SV PTA+GVNPM+T+Q+ AYC +
Sbjct  281  TSAHQMGSCKIGVSETEGAIDQNGESWEAEGLFVCDASVLPTAVGVNPMITIQSTAYCIS  340

Query  209  QSVLKFLK  186
              +   L+
Sbjct  341  NRIAALLR  348



>ref|XP_002528823.1| disulfide oxidoreductase, putative [Ricinus communis]
 gb|EEF33557.1| disulfide oxidoreductase, putative [Ricinus communis]
Length=747

 Score =   120 bits (301),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 88/130 (68%), Gaps = 6/130 (5%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLS-----TL  393
            GL + LRIL AAGA E+GT    G+ LK +G ++ +++EF++  S    G LS       
Sbjct  616  GLRQSLRILVAAGAVEVGTHRSDGQRLKCQGITKKQLEEFLDTVSP-PRGPLSPGKDWVA  674

Query  392  IGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCT  213
              SAHQ+GSCRMG+  +   V+  GE+WE EGLF+ D+SV P+A+GVNPM+T+Q+ AYC 
Sbjct  675  YTSAHQLGSCRMGISEKEGAVDENGESWEAEGLFVCDASVLPSAIGVNPMITIQSTAYCL  734

Query  212  AQSVLKFLKT  183
            ++ + K+L+T
Sbjct  735  SERISKYLRT  744



>gb|EYU46424.1| hypothetical protein MIMGU_mgv1a001883mg [Erythranthe guttata]
Length=744

 Score =   120 bits (301),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 61/128 (48%), Positives = 81/128 (63%), Gaps = 4/128 (3%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESS----RDLGNLSTLI  390
            GL + LRIL AAGAEE+GT    G+ +K +G   +E+DEF++   +    R      T+ 
Sbjct  611  GLRRALRILIAAGAEEVGTFRSDGQRIKCRGIKDEELDEFLDNVGAVGGPRSRSEYWTIY  670

Query  389  GSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTA  210
             SAHQMGSCRMG       V+  GE WE +GLF+ D SV P+ALGVNPMVT+Q+ AYC +
Sbjct  671  CSAHQMGSCRMGESDEDGAVDENGECWEAKGLFVCDGSVLPSALGVNPMVTIQSTAYCIS  730

Query  209  QSVLKFLK  186
            + +   LK
Sbjct  731  KRLAASLK  738



>ref|XP_003571871.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Brachypodium 
distachyon]
Length=786

 Score =   120 bits (301),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 82/128 (64%), Gaps = 5/128 (4%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEF-----VEKESSRDLGNLSTL  393
            GL +VLRIL AAGA E+GT    G  L+ KG   ++++ F     +EK       +   L
Sbjct  653  GLRRVLRILVAAGAAEVGTHRSDGLRLRCKGVRDEDLEAFLDEVTIEKGPMHSTTDKWAL  712

Query  392  IGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCT  213
              SAHQMGSCRMG  PR   V+  GE+WE EGL++ D S+ PTA+GVNPM+T+Q++AYC 
Sbjct  713  FSSAHQMGSCRMGSSPREGAVDGSGESWEAEGLYVCDGSLLPTAVGVNPMITIQSVAYCL  772

Query  212  AQSVLKFL  189
            ++ + + L
Sbjct  773  SKDIAQAL  780



>ref|XP_009790215.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Nicotiana sylvestris]
Length=742

 Score =   120 bits (300),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 83/128 (65%), Gaps = 4/128 (3%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEK----ESSRDLGNLSTLI  390
            GL++ LRIL AAGA+E+GT    G+ +K KG S  EI+ F+      E  + L    T  
Sbjct  609  GLKQALRILIAAGADEVGTQRSDGQRMKCKGKSEKEIEAFLNTVTAAEGPKSLVKNFTTY  668

Query  389  GSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTA  210
             SAHQMGSCRMG+  +   V+  GE+WE  GLF+ D+SV P A+GVNPM+T+Q+ AYC +
Sbjct  669  SSAHQMGSCRMGMSEKDGAVDENGESWEANGLFVCDASVLPGAVGVNPMITIQSTAYCLS  728

Query  209  QSVLKFLK  186
            + + + +K
Sbjct  729  KKIAEMIK  736



>ref|XP_006354464.1| PREDICTED: long-chain-alcohol oxidase FAO1-like isoform X2 [Solanum 
tuberosum]
Length=667

 Score =   120 bits (300),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 84/128 (66%), Gaps = 4/128 (3%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEK----ESSRDLGNLSTLI  390
            GL + LRIL AAGA E+GT    G+ +K KG S   ++ F++     E  + L    T  
Sbjct  534  GLRQALRILIAAGAAEVGTQRSDGQRIKCKGQSEKALESFLDTVTAAEGPKSLVKDFTTY  593

Query  389  GSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTA  210
             SAHQMGSCRMG++ + S V+  GE+WE EGLF+ D+SV P A+GVNPM+T+Q+ AYC +
Sbjct  594  CSAHQMGSCRMGMNEKDSAVDENGESWEAEGLFVCDASVLPGAVGVNPMITIQSTAYCLS  653

Query  209  QSVLKFLK  186
            + + + +K
Sbjct  654  KKIAEMIK  661



>ref|XP_009610950.1| PREDICTED: long-chain-alcohol oxidase FAO1-like [Nicotiana tomentosiformis]
Length=742

 Score =   119 bits (299),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 83/128 (65%), Gaps = 4/128 (3%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEK----ESSRDLGNLSTLI  390
            GL + LRIL AAGA+E+GT    G+ +K KG S  EI+ F++     E  + L    T  
Sbjct  609  GLRQALRILIAAGADEVGTQRSDGQRMKCKGKSEKEIEAFLDTVTAAEGPKSLVKNFTTY  668

Query  389  GSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTA  210
             SAHQMGSCRMG+  +   V+  GE+WE  GLF+ D+SV P A+GVNPM+T+Q+ AYC +
Sbjct  669  SSAHQMGSCRMGMSKKDGAVDENGESWEANGLFVCDASVLPGAVGVNPMITIQSTAYCLS  728

Query  209  QSVLKFLK  186
            + + + +K
Sbjct  729  KKIAETIK  736



>ref|XP_008438494.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Cucumis melo]
Length=737

 Score =   119 bits (299),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/128 (45%), Positives = 84/128 (66%), Gaps = 4/128 (3%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSR----DLGNLSTLI  390
            GL + LRIL AAGA E+GT    G+ L+ KG  ++E++EF++  S+      L     + 
Sbjct  609  GLRQSLRILVAAGATEVGTHRSDGQRLECKGIGKEELEEFLDNVSAEGGLLSLSRNWNVY  668

Query  389  GSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTA  210
             SAHQMGSC++GV  +   V+  GE+WE EGLF+ D+SV PTA+GVNPM+T+Q+ AYC +
Sbjct  669  TSAHQMGSCKIGVSEKEGAVDENGESWEAEGLFVCDASVLPTAVGVNPMITIQSTAYCIS  728

Query  209  QSVLKFLK  186
              +   L+
Sbjct  729  NRIAALLR  736



>sp|B5WWZ8.1|FAO1_LOTJA RecName: Full=Long-chain-alcohol oxidase FAO1; AltName: Full=Long-chain 
fatty alcohol oxidase 1 [Lotus japonicus]
 emb|CAP15762.1| long chain fatty alcohol oxidase FAO1 [Lotus japonicus]
Length=749

 Score =   119 bits (299),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/128 (45%), Positives = 85/128 (66%), Gaps = 4/128 (3%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEK----ESSRDLGNLSTLI  390
            GL++ LRIL AAGA E+GT    G+ +K    S +E+ EF++     E +   G    + 
Sbjct  618  GLQQALRILKAAGAVEVGTHRSDGQRVKCGEVSENEMAEFIDSVCPMEGALSPGENWNIY  677

Query  389  GSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTA  210
             SAHQMGSCRMG++ +   V+  GE+WE +GLF+ D+S+ PTA+GVNPM+T+Q+ AYC +
Sbjct  678  TSAHQMGSCRMGMNEKEGAVDENGESWEAQGLFVCDASLLPTAVGVNPMITIQSTAYCIS  737

Query  209  QSVLKFLK  186
              V+ +LK
Sbjct  738  NRVVDYLK  745



>ref|XP_006354463.1| PREDICTED: long-chain-alcohol oxidase FAO1-like isoform X1 [Solanum 
tuberosum]
Length=741

 Score =   119 bits (299),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 84/128 (66%), Gaps = 4/128 (3%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEK----ESSRDLGNLSTLI  390
            GL + LRIL AAGA E+GT    G+ +K KG S   ++ F++     E  + L    T  
Sbjct  608  GLRQALRILIAAGAAEVGTQRSDGQRIKCKGQSEKALESFLDTVTAAEGPKSLVKDFTTY  667

Query  389  GSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTA  210
             SAHQMGSCRMG++ + S V+  GE+WE EGLF+ D+SV P A+GVNPM+T+Q+ AYC +
Sbjct  668  CSAHQMGSCRMGMNEKDSAVDENGESWEAEGLFVCDASVLPGAVGVNPMITIQSTAYCLS  727

Query  209  QSVLKFLK  186
            + + + +K
Sbjct  728  KKIAEMIK  735



>gb|AES61079.2| long-chain-alcohol oxidase FAO1-like protein [Medicago truncatula]
Length=538

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/128 (44%), Positives = 82/128 (64%), Gaps = 4/128 (3%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEK----ESSRDLGNLSTLI  390
            GL++ LRIL AAGA E+GT    G+ +   G +  E+++FVE     E          + 
Sbjct  409  GLQRALRILIAAGAVEVGTHRSDGQRIVCSGTNEMELNKFVESVYAAEGPMSHQETWNMY  468

Query  389  GSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTA  210
             SAHQMGSCR+G+  +   V+  G+ WE EGLF+ D+S+FPTA+G+NPM+T+Q+IAYC A
Sbjct  469  ASAHQMGSCRIGITDKEGTVDENGQNWEAEGLFVCDASLFPTAIGINPMITIQSIAYCVA  528

Query  209  QSVLKFLK  186
            + +   L+
Sbjct  529  KRIALILR  536



>ref|XP_004247745.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Solanum lycopersicum]
Length=741

 Score =   119 bits (299),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 83/128 (65%), Gaps = 4/128 (3%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEK----ESSRDLGNLSTLI  390
            GL + LRIL AAGA E+GT    G+ +K  G S   ++ F+E     E  + L    T  
Sbjct  608  GLRQALRILIAAGAAEVGTQRSDGQRIKCTGQSEKALESFLETVTAAEGPKSLVKDFTTY  667

Query  389  GSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTA  210
             SAHQMGSCRMG++ + S V+  GE+WE EGLF+ D+SV P A+GVNPM+T+Q+ AYC +
Sbjct  668  SSAHQMGSCRMGMNEKDSAVDENGESWEAEGLFVCDASVLPGAVGVNPMITIQSTAYCLS  727

Query  209  QSVLKFLK  186
            + + + +K
Sbjct  728  KKIAEMIK  735



>ref|XP_004493801.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Cicer arietinum]
Length=738

 Score =   119 bits (299),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/128 (45%), Positives = 83/128 (65%), Gaps = 4/128 (3%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKES----SRDLGNLSTLI  390
            GL + LRIL AAGA E+GT    G+ +K +G    +++EF++  +     R  G + T+ 
Sbjct  609  GLRQSLRILVAAGAVEVGTYRSDGQRIKCRGIKDKDLEEFLDNVAVVGGPRSRGEVWTVF  668

Query  389  GSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTA  210
             SAHQMGSCRMG +     V+  GE+WE +GLF+ D SV P+A+GVNPM+T+Q+ AYC A
Sbjct  669  SSAHQMGSCRMGANEEEGAVDENGESWEAKGLFVCDGSVLPSAVGVNPMITIQSTAYCIA  728

Query  209  QSVLKFLK  186
              + + LK
Sbjct  729  SKIAESLK  736



>emb|CDO99261.1| unnamed protein product [Coffea canephora]
Length=749

 Score =   119 bits (299),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 60/128 (47%), Positives = 83/128 (65%), Gaps = 4/128 (3%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESS----RDLGNLSTLI  390
            GL + LRIL AAGA E+GT    G+  K KG S  E++EF+++ ++    + L    T  
Sbjct  616  GLRQALRILVAAGAVEVGTLQSDGQKFKCKGTSEGELEEFLDEVTAAGGPKSLVQNWTTY  675

Query  389  GSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTA  210
             SAHQMGSCRMG   +   V+  GE+WE EGLF+ D+SV P A+GVNPM+T+Q+ AYC +
Sbjct  676  FSAHQMGSCRMGKSEKVGAVDENGESWEAEGLFVCDASVLPGAVGVNPMITIQSTAYCLS  735

Query  209  QSVLKFLK  186
              + + LK
Sbjct  736  NKIAEILK  743



>ref|XP_010262397.1| PREDICTED: long-chain-alcohol oxidase FAO2-like isoform X2 [Nelumbo 
nucifera]
Length=757

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 62/136 (46%), Positives = 87/136 (64%), Gaps = 6/136 (4%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLS-----TL  393
            GL++ LRIL AAGA E+GT    G+ +K KG   ++++EF+E  ++   G LS     TL
Sbjct  622  GLQQALRILIAAGAVEVGTHRNDGQRIKCKGIKEEDLEEFLETVTTAG-GFLSGEENWTL  680

Query  392  IGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCT  213
              SAHQMGSCRM    +   V+  GE+WE EGL++ D SV P A+GVNPM+T+Q+IAYC 
Sbjct  681  YSSAHQMGSCRMSSTEKEGAVDENGESWEAEGLYVCDGSVLPNAVGVNPMITIQSIAYCL  740

Query  212  AQSVLKFLKTHNHMQG  165
            ++ + K L      +G
Sbjct  741  SKKIAKSLNKGKFSEG  756



>gb|EYU18303.1| hypothetical protein MIMGU_mgv1a001896mg [Erythranthe guttata]
Length=742

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/128 (48%), Positives = 83/128 (65%), Gaps = 4/128 (3%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEF----VEKESSRDLGNLSTLI  390
            GL + LRIL AAGA E+GT    G+ +K +G   + ++EF    V  E  + +    +  
Sbjct  615  GLVRALRILIAAGAVEVGTHQSDGQRVKCEGGDDEGVEEFLKGVVAPEGPKSMVEKWSTY  674

Query  389  GSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTA  210
             SAHQMGSCRMGVD R   V+  GE+WE EGLF+ D+SV P A+GVNPM+T+QA AYC +
Sbjct  675  CSAHQMGSCRMGVDERCGAVDTWGESWEAEGLFVCDASVLPGAVGVNPMITIQATAYCIS  734

Query  209  QSVLKFLK  186
            + + + LK
Sbjct  735  KKIAEKLK  742



>ref|XP_010262396.1| PREDICTED: long-chain-alcohol oxidase FAO2-like isoform X1 [Nelumbo 
nucifera]
Length=763

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 62/136 (46%), Positives = 87/136 (64%), Gaps = 6/136 (4%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLS-----TL  393
            GL++ LRIL AAGA E+GT    G+ +K KG   ++++EF+E  ++   G LS     TL
Sbjct  628  GLQQALRILIAAGAVEVGTHRNDGQRIKCKGIKEEDLEEFLETVTTAG-GFLSGEENWTL  686

Query  392  IGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCT  213
              SAHQMGSCRM    +   V+  GE+WE EGL++ D SV P A+GVNPM+T+Q+IAYC 
Sbjct  687  YSSAHQMGSCRMSSTEKEGAVDENGESWEAEGLYVCDGSVLPNAVGVNPMITIQSIAYCL  746

Query  212  AQSVLKFLKTHNHMQG  165
            ++ + K L      +G
Sbjct  747  SKKIAKSLNKGKFSEG  762



>ref|XP_010920358.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Elaeis guineensis]
Length=756

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 85/130 (65%), Gaps = 8/130 (6%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLG------NLST  396
            GL + LRIL AAGA E+GT    G+ +K KG   +E++EF++    R +G       L T
Sbjct  625  GLRRALRILVAAGAVEVGTHRSDGQRIKCKGMKEEELEEFLD--GIRTVGGPMSKSELWT  682

Query  395  LIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYC  216
            +  SAHQMGSCRMGV      V+  GE+WE +GLF+ D SV PTA+G+NP++T+Q+ AYC
Sbjct  683  MYASAHQMGSCRMGVSEEEGGVDEKGESWEAQGLFVCDGSVLPTAVGINPLITIQSTAYC  742

Query  215  TAQSVLKFLK  186
             ++ + + LK
Sbjct  743  LSKGIAESLK  752



>gb|KHG17178.1| Long-chain-alcohol oxidase FAO1 [Gossypium arboreum]
Length=746

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 86/130 (66%), Gaps = 4/130 (3%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEK----ESSRDLGNLSTLI  390
            GL + LRIL AAGA E+GT    G+ ++ KG S +E+DEF++      S    G    + 
Sbjct  616  GLRQSLRILVAAGAVEVGTHRSDGQRIRCKGISNEELDEFLDSVSMLTSPLCTGENWVVH  675

Query  389  GSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTA  210
             +AHQMGSCRMG++ +   V+  GE+WE EGLF+ D+S+ P+A+GVNPM+TVQ+ AYC +
Sbjct  676  TTAHQMGSCRMGINEKEGAVDENGESWEAEGLFVCDASILPSAVGVNPMITVQSTAYCLS  735

Query  209  QSVLKFLKTH  180
            + + + L+  
Sbjct  736  KKIAESLRQQ  745



>ref|XP_003607676.1| Annotation was added to scaffolds in November 2011~Long chain 
fatty alcohol oxidase FAO1 [Medicago truncatula]
Length=606

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 85/129 (66%), Gaps = 5/129 (4%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILK-PKGASRDEIDEFVEK----ESSRDLGNLSTL  393
            GL++ LRIL AAGA E+GT    G+ +K  +     EI+EF++     E +   G    L
Sbjct  473  GLQQGLRILIAAGAVEVGTHRSDGQRIKCNENTGEKEIEEFIDSVYPMEGALWPGENWNL  532

Query  392  IGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCT  213
              SAHQMGSCRMGV+ +   V+  GE+WE EGLF+ D+SV PTA+GVNPM+T+Q+ A+C 
Sbjct  533  YTSAHQMGSCRMGVNEKEGAVDENGESWEAEGLFVCDASVLPTAVGVNPMITIQSTAFCI  592

Query  212  AQSVLKFLK  186
            +  ++ FL+
Sbjct  593  SNRIVDFLR  601



>ref|XP_009376994.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Pyrus x bretschneideri]
Length=749

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 83/128 (65%), Gaps = 4/128 (3%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVE----KESSRDLGNLSTLI  390
            GL + LRIL AAGA E+GT    G  LK KG  ++E++EF++     E  + L    T  
Sbjct  620  GLRQALRILIAAGAIEVGTHRSDGLRLKCKGIDKEELEEFLDMVIANEGPQSLVENWTTY  679

Query  389  GSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTA  210
             SAHQMGSCRMG++ +   V+  GE+WE E LF+ D SV P+A+GVNPM+T+Q+ AYC +
Sbjct  680  SSAHQMGSCRMGINAKEGAVDENGESWEAESLFVCDGSVLPSAVGVNPMITIQSTAYCLS  739

Query  209  QSVLKFLK  186
            + +   L+
Sbjct  740  KRIADSLR  747



>ref|XP_004982881.1| PREDICTED: long-chain-alcohol oxidase FAO1-like [Setaria italica]
Length=761

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 60/128 (47%), Positives = 82/128 (64%), Gaps = 5/128 (4%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEF-----VEKESSRDLGNLSTL  393
            GL +VLRIL AAGA E+GT    G  L+ KG   ++++ F     +EK       +   L
Sbjct  628  GLRRVLRILVAAGAAEVGTHRSDGLRLRCKGLRDEDLEAFLDEVTIEKGPMHSTADKWAL  687

Query  392  IGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCT  213
              SAHQMGSCRMG  PR   V+  GE+WE EGL++ D S+ PTA+GVNPM+T+Q+IAYC 
Sbjct  688  HCSAHQMGSCRMGSSPRDGAVDGRGESWEAEGLYVCDGSLLPTAVGVNPMITIQSIAYCL  747

Query  212  AQSVLKFL  189
            ++ + + L
Sbjct  748  SKGIAETL  755



>ref|XP_011030464.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Populus euphratica]
Length=745

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/128 (44%), Positives = 86/128 (67%), Gaps = 4/128 (3%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSR----DLGNLSTLI  390
            GL + LRIL AAGA E+GT    G+ +K +G  +++++EF++   +      L     L 
Sbjct  614  GLRQALRILVAAGAVEVGTHRSDGQRIKCRGIKKEDLEEFLDTVYATAGPLSLAEDWMLY  673

Query  389  GSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTA  210
             SAHQMGSCRMG++ +   V+  GE+WE EGLF+ D+SV P+A+GVNPM+T+Q+ AYC +
Sbjct  674  TSAHQMGSCRMGINKKEGAVDENGESWEAEGLFICDASVLPSAVGVNPMITIQSTAYCLS  733

Query  209  QSVLKFLK  186
            + + + L+
Sbjct  734  KKIAESLR  741



>emb|CDX77516.1| BnaA07g06540D [Brassica napus]
Length=180

 Score =   112 bits (280),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 81/129 (63%), Gaps = 4/129 (3%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVE----KESSRDLGNLSTLI  390
            GL + LRIL AAGAEE+GT    G+ L  KG     I+EF++    +E  + +     + 
Sbjct  47   GLRQSLRILIAAGAEEVGTHRSDGQKLVCKGVDEKSIEEFLDSVSAEEGPKAMTEKWGVY  106

Query  389  GSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTA  210
             SAHQMGSCR+G D +   ++  GE+WE E LF+ D SV P+A+GVNPM+T+ + AYC +
Sbjct  107  SSAHQMGSCRIGEDEKEGALDLNGESWEAERLFVCDGSVLPSAVGVNPMITIMSTAYCIS  166

Query  209  QSVLKFLKT  183
              ++K + T
Sbjct  167  TRIVKSMTT  175



>ref|XP_009764096.1| PREDICTED: long-chain-alcohol oxidase FAO2 [Nicotiana sylvestris]
Length=733

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 83/131 (63%), Gaps = 6/131 (5%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESS----RDLGNLSTLI  390
            GL + LRIL AAGA E+GT    G+ +  KG   +E++EF++   +       G   T+ 
Sbjct  596  GLRRALRILVAAGAVEVGTYQSDGQKISCKGIKNEELEEFLDTVRATGGPNSKGEQWTIY  655

Query  389  GSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTA  210
            GSAHQMGSCRMG +     V+  GE WE +GL++ D SV PTA+GVNPM+T+Q+ AYC A
Sbjct  656  GSAHQMGSCRMGANEEDGAVDENGECWEAKGLYVCDGSVLPTAVGVNPMITIQSTAYCIA  715

Query  209  QSVLKFLKTHN  177
            + + + +  HN
Sbjct  716  KRIAESM--HN  724



>ref|XP_003590828.1| Annotation was added to scaffolds in November 2011~Long chain 
fatty alcohol oxidase FAO1 [Medicago truncatula]
Length=576

 Score =   117 bits (294),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 56/128 (44%), Positives = 82/128 (64%), Gaps = 4/128 (3%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEK----ESSRDLGNLSTLI  390
            GL++ LRIL AAGA E+GT    G+ +   G +  E+++FVE     E          + 
Sbjct  447  GLQRALRILIAAGAVEVGTHRSDGQRIVCSGTNEMELNKFVESVYAAEGPMSHQETWNMY  506

Query  389  GSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTA  210
             SAHQMGSCR+G+  +   V+  G+ WE EGLF+ D+S+FPTA+G+NPM+T+Q+IAYC A
Sbjct  507  ASAHQMGSCRIGITDKEGTVDENGQNWEAEGLFVCDASLFPTAIGINPMITIQSIAYCVA  566

Query  209  QSVLKFLK  186
            + +   L+
Sbjct  567  KRIALILR  574



>ref|XP_006420282.1| hypothetical protein CICLE_v10004403mg [Citrus clementina]
 gb|ESR33522.1| hypothetical protein CICLE_v10004403mg [Citrus clementina]
Length=744

 Score =   118 bits (296),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 56/128 (44%), Positives = 87/128 (68%), Gaps = 4/128 (3%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEK----ESSRDLGNLSTLI  390
            GL + LRIL AAGA E+GT    G+ LK +G +  E+++F++     E  +       + 
Sbjct  613  GLRQALRILIAAGAVEVGTHRSDGQQLKCEGITEKEVEQFLDTVYAAEGPKSPVENWMVY  672

Query  389  GSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTA  210
            G+AHQMGSCRMGV+ +   V+  G++WE EGL++ D+SVFP+A+GVNPM+T+Q+ AYC +
Sbjct  673  GTAHQMGSCRMGVNEKEGAVDENGQSWEAEGLYVCDASVFPSAVGVNPMITIQSTAYCLS  732

Query  209  QSVLKFLK  186
            + + + L+
Sbjct  733  KRIAESLR  740



>ref|XP_009336115.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Pyrus x bretschneideri]
Length=750

 Score =   118 bits (296),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 60/135 (44%), Positives = 87/135 (64%), Gaps = 8/135 (6%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEK------ESSRDLGNLST  396
            GL + LRIL AAGA E+GT    G+ LK KG   ++++EF++        S+R+   L T
Sbjct  616  GLRQALRILIAAGAVEVGTYRNDGQRLKCKGVKEEDLEEFLDTVVTSAGPSARE--ELWT  673

Query  395  LIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYC  216
            +  SAHQMGSCRMG       V+  GE+WE +GLF+ D+S+ PTA+GVNPM+TV++ AYC
Sbjct  674  IYSSAHQMGSCRMGATEEEGGVDENGESWEAKGLFVCDASLLPTAVGVNPMITVESTAYC  733

Query  215  TAQSVLKFLKTHNHM  171
             A+ + + L    ++
Sbjct  734  IAKKIAQSLDKQKYI  748



>ref|XP_006489686.1| PREDICTED: long-chain-alcohol oxidase FAO1-like isoform X1 [Citrus 
sinensis]
Length=744

 Score =   118 bits (296),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 56/128 (44%), Positives = 87/128 (68%), Gaps = 4/128 (3%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEK----ESSRDLGNLSTLI  390
            GL + LRIL AAGA E+GT    G+ LK +G +  E+++F++     E  +       + 
Sbjct  613  GLRQALRILLAAGAVEVGTHRSDGQRLKCEGITEKEVEQFLDTVYAAEGPKSSVENWMVY  672

Query  389  GSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTA  210
            G+AHQMGSCRMGV+ +   V+  G++WE EGL++ D+SVFP+A+GVNPM+T+Q+ AYC +
Sbjct  673  GTAHQMGSCRMGVNDKEGAVDENGQSWEAEGLYVCDASVFPSAVGVNPMITIQSTAYCLS  732

Query  209  QSVLKFLK  186
            + + + L+
Sbjct  733  KRIAESLR  740



>ref|XP_010264984.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Nelumbo nucifera]
Length=750

 Score =   118 bits (296),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 59/129 (46%), Positives = 87/129 (67%), Gaps = 6/129 (5%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLS-----TL  393
            GL + LRIL AAGA E+GT    G+ +K +G   ++++EF++  S+ + G +S     T+
Sbjct  615  GLRRALRILIAAGAVEVGTHRSDGQRIKCRGIKEEDLEEFLDTVSAVE-GPMSREEHWTI  673

Query  392  IGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCT  213
              SAHQMGSCRM    +   V+  GE+WE EGL++ D SVFP ALGVNPM+T+Q+IAYC 
Sbjct  674  YASAHQMGSCRMSAKEKDGAVDENGESWEAEGLYVCDGSVFPNALGVNPMITIQSIAYCL  733

Query  212  AQSVLKFLK  186
            ++ + + L+
Sbjct  734  SKKIAESLE  742



>ref|XP_007224435.1| hypothetical protein PRUPE_ppa021498mg, partial [Prunus persica]
 gb|EMJ25634.1| hypothetical protein PRUPE_ppa021498mg, partial [Prunus persica]
Length=721

 Score =   118 bits (296),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 86/128 (67%), Gaps = 4/128 (3%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESS----RDLGNLSTLI  390
            GL + LRIL AAGA E+GT    G  +K KG  +++++EF++  S+    + L    T  
Sbjct  590  GLRQALRILIAAGAVEVGTHRSDGLRIKCKGIEKEKLEEFLDMVSAEKGPQSLVENWTTY  649

Query  389  GSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTA  210
             SAHQMGSCRMG++ +   V+  GE+WE EGLF+ D+SV P+A+GVNPM+T+Q+ AYC +
Sbjct  650  SSAHQMGSCRMGINEKEGAVDENGESWEAEGLFVCDASVLPSAVGVNPMITIQSTAYCLS  709

Query  209  QSVLKFLK  186
            + +   LK
Sbjct  710  KRIAGSLK  717



>ref|XP_006489687.1| PREDICTED: long-chain-alcohol oxidase FAO1-like isoform X2 [Citrus 
sinensis]
Length=744

 Score =   118 bits (296),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 56/131 (43%), Positives = 88/131 (67%), Gaps = 4/131 (3%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEK----ESSRDLGNLSTLI  390
            GL + LRIL AAGA E+GT    G+ LK +G +  E+++F++     E  +       + 
Sbjct  613  GLRQALRILLAAGAVEVGTHRSDGQRLKCEGITEKEVEQFLDTVYAAEGPKSSVENWMVY  672

Query  389  GSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTA  210
            G+AHQMGSCRMGV+ +   V+  G++WE EGL++ D+SVFP+A+GVNPM+T+Q+ AYC +
Sbjct  673  GTAHQMGSCRMGVNDKEGAVDENGQSWEAEGLYVCDASVFPSAVGVNPMITIQSTAYCLS  732

Query  209  QSVLKFLKTHN  177
            + + + L+  +
Sbjct  733  KRIAESLREQS  743



>ref|XP_008224323.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Prunus mume]
Length=751

 Score =   118 bits (296),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 86/128 (67%), Gaps = 4/128 (3%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESS----RDLGNLSTLI  390
            GL + LRIL AAGA E+GT    G  +K KG  +++++EF++  S+    + L    T  
Sbjct  616  GLRQALRILIAAGAVEVGTHRSDGLRIKCKGIEKEKLEEFLDMVSAEKGPQSLVENWTTY  675

Query  389  GSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTA  210
             SAHQMGSCRMG++ +   V+  GE+WE EGLF+ D+SV P+A+GVNPM+T+Q+ AYC +
Sbjct  676  SSAHQMGSCRMGINEKEGAVDENGESWEAEGLFVCDASVLPSAVGVNPMITIQSTAYCLS  735

Query  209  QSVLKFLK  186
            + +   LK
Sbjct  736  KRIAGSLK  743



>ref|XP_006379996.1| hypothetical protein POPTR_0008s18750g, partial [Populus trichocarpa]
 gb|ERP57793.1| hypothetical protein POPTR_0008s18750g, partial [Populus trichocarpa]
Length=388

 Score =   115 bits (288),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 57/129 (44%), Positives = 86/129 (67%), Gaps = 6/129 (5%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLS-----TL  393
            GL + LRIL AAGA E+GT    G+ +K +G   ++++EF++   +   G LS       
Sbjct  259  GLRQALRILVAAGAVEVGTHRSDGQRIKCRGIKIEDLEEFLDTVYATG-GALSLEEDWMF  317

Query  392  IGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCT  213
              SAHQMGSCRMG++ +   V+  GE+WE EGLF+ D+SV P+A+GVNPM+T+Q+ AYC 
Sbjct  318  YSSAHQMGSCRMGINEKEGAVDENGESWEAEGLFVCDASVLPSAVGVNPMITIQSTAYCL  377

Query  212  AQSVLKFLK  186
            ++ + + L+
Sbjct  378  SKKIAESLR  386



>emb|CAN71289.1| hypothetical protein VITISV_019349 [Vitis vinifera]
Length=741

 Score =   118 bits (295),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 81/123 (66%), Gaps = 4/123 (3%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEK----ESSRDLGNLSTLI  390
            G+ + LRIL AAGA E+GT    G+ LK KG +  E++EF++     E  +   +  T+ 
Sbjct  609  GVRQGLRILIAAGAVEVGTYRSDGQRLKSKGINEKELEEFLDSVSAVEGPQSFVDKWTIT  668

Query  389  GSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTA  210
            G+AHQMGSCRMG   +   V+  GE+WE  GLF+ D SV PTA+GVNPM+T+Q+ AYC +
Sbjct  669  GTAHQMGSCRMGQSEKEGAVDENGESWEAAGLFVCDGSVLPTAVGVNPMITIQSTAYCLS  728

Query  209  QSV  201
            + +
Sbjct  729  KKI  731



>ref|XP_002285334.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Vitis vinifera]
Length=741

 Score =   118 bits (295),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 81/123 (66%), Gaps = 4/123 (3%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEK----ESSRDLGNLSTLI  390
            G+ + LRIL AAGA E+GT    G+ LK KG +  E++EF++     E  +   +  T+ 
Sbjct  609  GVRQGLRILIAAGAVEVGTYRSDGQRLKSKGINEKELEEFLDSVSAAEGPQSFVDKWTIT  668

Query  389  GSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTA  210
            G+AHQMGSCRMG   +   V+  GE+WE  GLF+ D SV PTA+GVNPM+T+Q+ AYC +
Sbjct  669  GTAHQMGSCRMGKSEKEGAVDENGESWEAAGLFVCDGSVLPTAVGVNPMITIQSTAYCLS  728

Query  209  QSV  201
            + +
Sbjct  729  KKI  731



>gb|KGN56837.1| hypothetical protein Csa_3G134850 [Cucumis sativus]
Length=669

 Score =   117 bits (294),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 83/128 (65%), Gaps = 4/128 (3%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSR----DLGNLSTLI  390
            GL + LRIL AAGA E+GT    G+ L+ KG  ++E++EF++  S+      L     + 
Sbjct  541  GLRQSLRILVAAGATEVGTHRSDGQRLECKGIGKEELEEFLDSVSAEGGLLSLSKDWNVY  600

Query  389  GSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTA  210
             SAHQMGSC++GV      ++  GE+WE EGLF+ D+SV PTA+GVNPM+T+Q+ AYC +
Sbjct  601  TSAHQMGSCKIGVSETEGAIDQNGESWEAEGLFVCDASVLPTAVGVNPMITIQSTAYCIS  660

Query  209  QSVLKFLK  186
              +   L+
Sbjct  661  NRIAALLR  668



>ref|XP_006489751.1| PREDICTED: long-chain-alcohol oxidase FAO3-like, partial [Citrus 
sinensis]
Length=580

 Score =   117 bits (292),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 55/128 (43%), Positives = 87/128 (68%), Gaps = 4/128 (3%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEK----ESSRDLGNLSTLI  390
            GL + LRIL AAGA E+GT    G+ LK +G ++ E+++F++     E  +       + 
Sbjct  449  GLRQALRILIAAGAVEVGTHRSDGQRLKCEGITKKEVEQFLDTVYAAEGPKSPVENWMVY  508

Query  389  GSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTA  210
            G+AHQMGSCRMGV+ +   V+  G++WE EGL++ D+SV P+A+GVNPM+T+Q+ AYC +
Sbjct  509  GTAHQMGSCRMGVNEKEGAVDENGQSWEAEGLYVCDASVLPSAVGVNPMITIQSTAYCLS  568

Query  209  QSVLKFLK  186
            + + + L+
Sbjct  569  KRIAESLR  576



>ref|XP_010684652.1| PREDICTED: long-chain-alcohol oxidase FAO2 [Beta vulgaris subsp. 
vulgaris]
Length=750

 Score =   118 bits (295),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 58/131 (44%), Positives = 80/131 (61%), Gaps = 4/131 (3%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEK----ESSRDLGNLSTLI  390
            GL + LRIL AAGA E+GT    G+ L  KG   +E++EF++       +R      T+ 
Sbjct  616  GLRQCLRILVAAGAVEVGTYRSDGQRLNCKGVKEEEMEEFLDSVIAPGGARSRTEHWTMY  675

Query  389  GSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTA  210
            G AHQM SCRMG       V+  GETWE +GL++ D SV PTALGVNPM+T++++AYC +
Sbjct  676  GCAHQMSSCRMGASKEDGAVDENGETWEAKGLYVCDGSVLPTALGVNPMITIESVAYCIS  735

Query  209  QSVLKFLKTHN  177
              +   L+  N
Sbjct  736  TRIASVLEEEN  746



>gb|KEH30749.1| long-chain-alcohol oxidase FAO2-like protein [Medicago truncatula]
Length=766

 Score =   118 bits (295),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 85/129 (66%), Gaps = 5/129 (4%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILK-PKGASRDEIDEFVEK----ESSRDLGNLSTL  393
            GL++ LRIL AAGA E+GT    G+ +K  +     EI+EF++     E +   G    L
Sbjct  630  GLQQGLRILIAAGAVEVGTHRSDGQRIKCNENTGEKEIEEFIDSVYPMEGALWPGENWNL  689

Query  392  IGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCT  213
              SAHQMGSCRMGV+ +   V+  GE+WE EGLF+ D+SV PTA+GVNPM+T+Q+ A+C 
Sbjct  690  YTSAHQMGSCRMGVNEKEGAVDENGESWEAEGLFVCDASVLPTAVGVNPMITIQSTAFCI  749

Query  212  AQSVLKFLK  186
            +  ++ FL+
Sbjct  750  SNRIVDFLR  758



>ref|XP_010934290.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Elaeis guineensis]
Length=755

 Score =   117 bits (294),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 58/128 (45%), Positives = 82/128 (64%), Gaps = 4/128 (3%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKES----SRDLGNLSTLI  390
            GL + LRIL AAGA E+GT    G+ ++ KG    E++EF++  +     R    L T  
Sbjct  624  GLRRALRILVAAGAVEVGTHRSDGQRIQCKGIKEAELEEFLDGITMVGGPRSRNELWTFY  683

Query  389  GSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTA  210
              AHQMGSCRMGV      V+  GE+WE +GLF+ D SV P+A+G+NPM+T+Q+IAYC +
Sbjct  684  CCAHQMGSCRMGVSEEEGGVDETGESWEAQGLFVCDGSVLPSAVGINPMITIQSIAYCLS  743

Query  209  QSVLKFLK  186
            + + K L+
Sbjct  744  KGIAKSLR  751



>ref|XP_010466677.1| PREDICTED: long-chain-alcohol oxidase FAO3-like [Camelina sativa]
Length=746

 Score =   117 bits (294),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 59/129 (46%), Positives = 83/129 (64%), Gaps = 4/129 (3%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRD----LGNLSTLI  390
            GL + LRIL AAGAEE+GT    GKILK KG   + I+EF++  SS +    +     + 
Sbjct  614  GLRQSLRILIAAGAEEVGTHRSDGKILKCKGVDENSIEEFLDSVSSEEGPKGMTEKWNIY  673

Query  389  GSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTA  210
             SAHQMGSCR+G + +   ++  GE+WE E LF+ D+S  P+A+GVNPM+TV + AYC +
Sbjct  674  CSAHQMGSCRIGENEKEGAIDLNGESWEAERLFVCDASALPSAVGVNPMITVMSTAYCIS  733

Query  209  QSVLKFLKT  183
              + K + T
Sbjct  734  TRIAKSMTT  742



>ref|XP_011080082.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Sesamum indicum]
Length=742

 Score =   117 bits (294),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 81/128 (63%), Gaps = 4/128 (3%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESS----RDLGNLSTLI  390
            GL + LRIL  AGA E+GT    G+ ++ KG   ++++EF++  ++    R      TL 
Sbjct  610  GLRRALRILVGAGAAEVGTFRSDGQRIRCKGTKNEDLEEFLDAVTAVGGPRTRSEYWTLY  669

Query  389  GSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTA  210
             SAHQMGSCRMG +     V+  GE WE +GLF+ D SV PTA+GVNPM+T+Q+ AYC +
Sbjct  670  CSAHQMGSCRMGANEEDGAVDENGECWEAKGLFVCDGSVLPTAVGVNPMITIQSTAYCIS  729

Query  209  QSVLKFLK  186
            + +   LK
Sbjct  730  KRLADSLK  737



>ref|XP_004495357.1| PREDICTED: long-chain-alcohol oxidase FAO1-like [Cicer arietinum]
Length=744

 Score =   117 bits (294),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 84/128 (66%), Gaps = 4/128 (3%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSR----DLGNLSTLI  390
            GL++ LRIL AAGA E+GT    G+ +   G++  E+++FVE   +       G   ++ 
Sbjct  616  GLQQALRILIAAGAVEVGTHRSDGQRIACSGSNEKELNKFVESVYATGGPMSHGENWSIY  675

Query  389  GSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTA  210
             SAHQMGSCR+GV  +   V+  G++WE EGLF+ DSS+ PTA+GVNPM+T+Q++AYC A
Sbjct  676  ASAHQMGSCRVGVTEKEGAVDENGQSWEAEGLFVCDSSLLPTAIGVNPMITIQSVAYCIA  735

Query  209  QSVLKFLK  186
              +   L+
Sbjct  736  NRIAVILR  743



>ref|XP_004134405.1| PREDICTED: long-chain-alcohol oxidase FAO1-like [Cucumis sativus]
Length=738

 Score =   117 bits (293),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 83/128 (65%), Gaps = 4/128 (3%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSR----DLGNLSTLI  390
            GL + LRIL AAGA E+GT    G+ L+ KG  ++E++EF++  S+      L     + 
Sbjct  610  GLRQSLRILVAAGATEVGTHRSDGQRLECKGIGKEELEEFLDSVSAEGGLLSLSKDWNVY  669

Query  389  GSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTA  210
             SAHQMGSC++GV      ++  GE+WE EGLF+ D+SV PTA+GVNPM+T+Q+ AYC +
Sbjct  670  TSAHQMGSCKIGVSETEGAIDQNGESWEAEGLFVCDASVLPTAVGVNPMITIQSTAYCIS  729

Query  209  QSVLKFLK  186
              +   L+
Sbjct  730  NRIAALLR  737



>ref|XP_002454188.1| hypothetical protein SORBIDRAFT_04g026370 [Sorghum bicolor]
 gb|EES07164.1| hypothetical protein SORBIDRAFT_04g026370 [Sorghum bicolor]
Length=773

 Score =   117 bits (294),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 82/128 (64%), Gaps = 4/128 (3%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEK----ESSRDLGNLSTLI  390
            GL + LRILAAAGA EIGT    G+    +GA+   ++EF++        +      +L 
Sbjct  637  GLRRALRILAAAGAAEIGTHRSDGQRFACRGATEAALEEFLDGVDVVRGPQSKAEAWSLC  696

Query  389  GSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTA  210
             +AHQMGSCRMGV  R   V+  GE+WEVE L++ D SV P+A+GVNPMVT+Q++AYC A
Sbjct  697  CTAHQMGSCRMGVTARDGAVDARGESWEVESLYVCDGSVLPSAVGVNPMVTIQSVAYCLA  756

Query  209  QSVLKFLK  186
              + + L+
Sbjct  757  TGIAESLR  764



>ref|XP_002981110.1| hypothetical protein SELMODRAFT_114089, partial [Selaginella 
moellendorffii]
 gb|EFJ17811.1| hypothetical protein SELMODRAFT_114089, partial [Selaginella 
moellendorffii]
Length=656

 Score =   117 bits (292),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 84/130 (65%), Gaps = 5/130 (4%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHR-AGKILKPKGASRDE----IDEFVEKESSRDLGNLSTL  393
            G EK LR+L AAGA E+GT H  A      K  S  E     +E++    S+ L      
Sbjct  525  GAEKGLRVLKAAGAVEVGTHHHDAESFTFGKSTSWKEEKKRFEEYLASVRSKGLKPNRLP  584

Query  392  IGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCT  213
            + S H +GSCRMG  P +SV++  GETW+ EGLFL D+SVFPT  G+NPMVT+Q+IAYCT
Sbjct  585  MVSYHLLGSCRMGSSPENSVIDAKGETWDAEGLFLTDASVFPTPTGLNPMVTIQSIAYCT  644

Query  212  AQSVLKFLKT  183
            AQ+V++ +K+
Sbjct  645  AQNVVEHVKS  654



>gb|EMS51759.1| Long-chain-alcohol oxidase FAO2 [Triticum urartu]
Length=515

 Score =   115 bits (288),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 57/124 (46%), Positives = 79/124 (64%), Gaps = 5/124 (4%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEF-----VEKESSRDLGNLSTL  393
            GL  VLRIL AAGA E GT    G  L+ KG   ++++ F     +EK       +   +
Sbjct  381  GLRHVLRILVAAGAAEGGTHRSDGLRLRCKGVRDEDLEAFLDEVTIEKGPMHSTADKWAV  440

Query  392  IGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCT  213
              SAHQMGSCRMG  P+ S V+  GE+WE EGL++ D S+ PTA+GVNPM+T+Q++AYC 
Sbjct  441  FSSAHQMGSCRMGSSPKDSAVDGSGESWEAEGLYVCDGSLLPTAVGVNPMITIQSVAYCL  500

Query  212  AQSV  201
            ++ +
Sbjct  501  SKGI  504



>ref|XP_002314488.2| alcohol oxidase-related family protein [Populus trichocarpa]
 gb|EEF00659.2| alcohol oxidase-related family protein [Populus trichocarpa]
Length=743

 Score =   117 bits (293),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 58/128 (45%), Positives = 87/128 (68%), Gaps = 6/128 (5%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLS-----TL  393
            GL + LRIL AAGA E+GT    G+ +K +G  +++++EF++   +   G LS      L
Sbjct  614  GLRQALRILVAAGAVEVGTHRSDGQRIKCRGIKKEDLEEFLDTVYA-TAGPLSPVEDWML  672

Query  392  IGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCT  213
              SAHQMGSCRMG++ +   V+  GE+WE EGLF+ D+SV P+A+GVNPM+T+Q+ AYC 
Sbjct  673  YTSAHQMGSCRMGINKKEGAVDENGESWEAEGLFVCDASVLPSAVGVNPMITIQSTAYCL  732

Query  212  AQSVLKFL  189
            ++ + + L
Sbjct  733  SKKIAESL  740



>ref|XP_002994642.1| hypothetical protein SELMODRAFT_138935, partial [Selaginella 
moellendorffii]
 gb|EFJ04292.1| hypothetical protein SELMODRAFT_138935, partial [Selaginella 
moellendorffii]
Length=656

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 62/130 (48%), Positives = 84/130 (65%), Gaps = 5/130 (4%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHR-AGKILKPKGASRDE----IDEFVEKESSRDLGNLSTL  393
            G EK LR+L AAGA E+GT H  A      K  S  E     +E++    S+ L      
Sbjct  525  GAEKGLRVLKAAGAVEVGTHHHDAESFTFGKSTSWKEEKKRFEEYLASVRSKGLKPNRLP  584

Query  392  IGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCT  213
            + S H +GSCRMG  P +SV++  GETW+ EGLFL D+SVFPT  G+NPMVT+Q+IAYCT
Sbjct  585  MVSYHLLGSCRMGSSPENSVIDAKGETWDAEGLFLTDASVFPTPTGLNPMVTIQSIAYCT  644

Query  212  AQSVLKFLKT  183
            AQ++++ +K+
Sbjct  645  AQNIVEHVKS  654



>ref|XP_002982582.1| hypothetical protein SELMODRAFT_116855, partial [Selaginella 
moellendorffii]
 gb|EFJ16335.1| hypothetical protein SELMODRAFT_116855, partial [Selaginella 
moellendorffii]
Length=656

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 62/130 (48%), Positives = 84/130 (65%), Gaps = 5/130 (4%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHR-AGKILKPKGASRDE----IDEFVEKESSRDLGNLSTL  393
            G EK LR+L AAGA E+GT H  A      K  S  E     +E++    S+ L      
Sbjct  525  GAEKGLRVLKAAGAVEVGTHHHDAESFTFGKSTSWKEEKKRFEEYLASVRSKGLKPNRLP  584

Query  392  IGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCT  213
            + S H +GSCRMG  P +SV++  GETW+ EGLFL D+SVFPT  G+NPMVT+Q+IAYCT
Sbjct  585  MVSYHLLGSCRMGSSPENSVIDAKGETWDAEGLFLTDASVFPTPTGLNPMVTIQSIAYCT  644

Query  212  AQSVLKFLKT  183
            AQ++++ +K+
Sbjct  645  AQNIVEHVKS  654



>gb|KJB10007.1| hypothetical protein B456_001G179800 [Gossypium raimondii]
Length=665

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 84/130 (65%), Gaps = 8/130 (6%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKE------SSRDLGNLST  396
            GL +VLR+L AAGA E+GT    G+ +K KG + + + EF++        SS+D     T
Sbjct  536  GLRQVLRVLIAAGAVEVGTHRSDGQRIKCKGLTEESLQEFLDNVPVVGGLSSKD--EYWT  593

Query  395  LIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYC  216
            L  +AHQ+GSCRMG       V+  G++WE EGLF+ D+SV PTA+GVNPM+T+Q+ +YC
Sbjct  594  LYLTAHQIGSCRMGATEEEGAVDENGQSWEAEGLFVCDASVLPTAIGVNPMITIQSTSYC  653

Query  215  TAQSVLKFLK  186
             +  + + LK
Sbjct  654  ISNKIAQLLK  663



>ref|XP_007035186.1| Alcohol oxidase, putative isoform 4, partial [Theobroma cacao]
 ref|XP_007035187.1| Alcohol oxidase, putative isoform 4, partial [Theobroma cacao]
 gb|EOY06112.1| Alcohol oxidase, putative isoform 4, partial [Theobroma cacao]
 gb|EOY06113.1| Alcohol oxidase, putative isoform 4, partial [Theobroma cacao]
Length=657

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 83/128 (65%), Gaps = 4/128 (3%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRD----LGNLSTLI  390
            GL + LRIL AAGA E+GT    G+ ++ KG S  E++EF+E  S  +            
Sbjct  528  GLRQALRILVAAGAVEVGTHRSDGQSIRCKGISNKELEEFLESVSPVEGPMFPAEKWVTH  587

Query  389  GSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTA  210
             SAHQMGSCRMG++ +   V+  GE+WE EGLF+ D+SV P A+GVNPM+TVQ+ AYC +
Sbjct  588  TSAHQMGSCRMGINEKEGAVDENGESWEAEGLFVCDASVLPGAIGVNPMITVQSTAYCLS  647

Query  209  QSVLKFLK  186
            + + + L+
Sbjct  648  KRIAESLR  655



>gb|KJB72415.1| hypothetical protein B456_011G177100 [Gossypium raimondii]
Length=654

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/130 (45%), Positives = 84/130 (65%), Gaps = 4/130 (3%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEK----ESSRDLGNLSTLI  390
            GL + LRIL AAGA E+GT    G+  + KG S +E++EF++      S    G    + 
Sbjct  524  GLRQSLRILVAAGAVEVGTHRSDGQRKRCKGISNEELEEFLDSVSMLTSPLCTGENWVVH  583

Query  389  GSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTA  210
             SAHQMGSCRMG++     V+  GE+WE EGLF+ D+SV P+A+GVNPM+TVQ+ AYC +
Sbjct  584  TSAHQMGSCRMGINEEEGAVDENGESWEAEGLFVCDASVLPSAVGVNPMITVQSTAYCLS  643

Query  209  QSVLKFLKTH  180
            + + + L+  
Sbjct  644  KKIAESLRQQ  653



>ref|XP_011080081.1| PREDICTED: long-chain-alcohol oxidase FAO2 [Sesamum indicum]
Length=742

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/128 (44%), Positives = 81/128 (63%), Gaps = 4/128 (3%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESS----RDLGNLSTLI  390
            GL + LRIL  AGA E+GT    G+ ++ KG   ++++EF++  ++    R      TL 
Sbjct  610  GLRRALRILVGAGAAEVGTFRSDGQRIRCKGTKNEDLEEFLDTVTAVGGPRSRSEYWTLY  669

Query  389  GSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTA  210
             SAHQMGSCRMG +     V+  GE WE +GLF+ D SV P+A+GVNPM+T+Q+ AYC +
Sbjct  670  CSAHQMGSCRMGANEEDGAVDENGECWEAKGLFVCDGSVLPSAVGVNPMITIQSTAYCIS  729

Query  209  QSVLKFLK  186
            + +   LK
Sbjct  730  KRLADSLK  737



>gb|KJB72416.1| hypothetical protein B456_011G177100 [Gossypium raimondii]
Length=677

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/130 (45%), Positives = 84/130 (65%), Gaps = 4/130 (3%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEK----ESSRDLGNLSTLI  390
            GL + LRIL AAGA E+GT    G+  + KG S +E++EF++      S    G    + 
Sbjct  547  GLRQSLRILVAAGAVEVGTHRSDGQRKRCKGISNEELEEFLDSVSMLTSPLCTGENWVVH  606

Query  389  GSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTA  210
             SAHQMGSCRMG++     V+  GE+WE EGLF+ D+SV P+A+GVNPM+TVQ+ AYC +
Sbjct  607  TSAHQMGSCRMGINEEEGAVDENGESWEAEGLFVCDASVLPSAVGVNPMITVQSTAYCLS  666

Query  209  QSVLKFLKTH  180
            + + + L+  
Sbjct  667  KKIAESLRQQ  676



>ref|XP_007035183.1| Fatty alcohol oxidase 3 isoform 1 [Theobroma cacao]
 ref|XP_007035184.1| Fatty alcohol oxidase 3 isoform 1 [Theobroma cacao]
 ref|XP_007035185.1| Fatty alcohol oxidase 3 isoform 1 [Theobroma cacao]
 gb|EOY06109.1| Fatty alcohol oxidase 3 isoform 1 [Theobroma cacao]
 gb|EOY06110.1| Fatty alcohol oxidase 3 isoform 1 [Theobroma cacao]
 gb|EOY06111.1| Fatty alcohol oxidase 3 isoform 1 [Theobroma cacao]
Length=750

 Score =   116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 83/128 (65%), Gaps = 4/128 (3%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRD----LGNLSTLI  390
            GL + LRIL AAGA E+GT    G+ ++ KG S  E++EF+E  S  +            
Sbjct  618  GLRQALRILVAAGAVEVGTHRSDGQSIRCKGISNKELEEFLESVSPVEGPMFPAEKWVTH  677

Query  389  GSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTA  210
             SAHQMGSCRMG++ +   V+  GE+WE EGLF+ D+SV P A+GVNPM+TVQ+ AYC +
Sbjct  678  TSAHQMGSCRMGINEKEGAVDENGESWEAEGLFVCDASVLPGAIGVNPMITVQSTAYCLS  737

Query  209  QSVLKFLK  186
            + + + L+
Sbjct  738  KRIAESLR  745



>gb|KJB10008.1| hypothetical protein B456_001G179800 [Gossypium raimondii]
Length=749

 Score =   116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 84/130 (65%), Gaps = 8/130 (6%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKE------SSRDLGNLST  396
            GL +VLR+L AAGA E+GT    G+ +K KG + + + EF++        SS+D     T
Sbjct  620  GLRQVLRVLIAAGAVEVGTHRSDGQRIKCKGLTEESLQEFLDNVPVVGGLSSKD--EYWT  677

Query  395  LIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYC  216
            L  +AHQ+GSCRMG       V+  G++WE EGLF+ D+SV PTA+GVNPM+T+Q+ +YC
Sbjct  678  LYLTAHQIGSCRMGATEEEGAVDENGQSWEAEGLFVCDASVLPTAIGVNPMITIQSTSYC  737

Query  215  TAQSVLKFLK  186
             +  + + LK
Sbjct  738  ISNKIAQLLK  747



>ref|XP_002272123.2| PREDICTED: long-chain-alcohol oxidase FAO2-like [Vitis vinifera]
Length=749

 Score =   116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 60/135 (44%), Positives = 83/135 (61%), Gaps = 8/135 (6%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEK------ESSRDLGNLST  396
            GL + LRIL AAGA E+GT    G+ +K KG   + ++EF++         SR  G+  T
Sbjct  615  GLRQALRILIAAGAVEVGTYRSDGQSIKCKGVKEEAVEEFLDGVVAGGGPCSR--GDHWT  672

Query  395  LIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYC  216
            L  SAHQMGSCRMG       V+  GETWE +GLF+ D SV P+A+G+NPM+T+Q  AYC
Sbjct  673  LYCSAHQMGSCRMGATEEEGAVDENGETWEAKGLFVCDGSVLPSAVGINPMITIQTTAYC  732

Query  215  TAQSVLKFLKTHNHM  171
             ++ + + LK    +
Sbjct  733  ISKRIAESLKKQEFL  747



>gb|KHN30591.1| Long-chain-alcohol oxidase FAO1 [Glycine soja]
Length=649

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/129 (45%), Positives = 85/129 (66%), Gaps = 6/129 (5%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLS-----TL  393
            G+++ LRIL AAGA E+GT    G  ++  G +  E++ FVE   + + G +S     ++
Sbjct  520  GVKQALRILIAAGAVEVGTHRSDGHRIECNGKNEKELERFVESVYATE-GLMSHEEKWSI  578

Query  392  IGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCT  213
              SAHQMGSCRMG+  +   V+  G +WE EGLF+ D+S+ PTA+GVNPM+T+Q+ AYC 
Sbjct  579  YSSAHQMGSCRMGMSEKEGAVDENGMSWEAEGLFVCDASLLPTAIGVNPMITIQSTAYCV  638

Query  212  AQSVLKFLK  186
            A+ +  FLK
Sbjct  639  AKRIAAFLK  647



>gb|KJB10006.1| hypothetical protein B456_001G179800 [Gossypium raimondii]
Length=742

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 84/130 (65%), Gaps = 8/130 (6%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKE------SSRDLGNLST  396
            GL +VLR+L AAGA E+GT    G+ +K KG + + + EF++        SS+D     T
Sbjct  613  GLRQVLRVLIAAGAVEVGTHRSDGQRIKCKGLTEESLQEFLDNVPVVGGLSSKD--EYWT  670

Query  395  LIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYC  216
            L  +AHQ+GSCRMG       V+  G++WE EGLF+ D+SV PTA+GVNPM+T+Q+ +YC
Sbjct  671  LYLTAHQIGSCRMGATEEEGAVDENGQSWEAEGLFVCDASVLPTAIGVNPMITIQSTSYC  730

Query  215  TAQSVLKFLK  186
             +  + + LK
Sbjct  731  ISNKIAQLLK  740



>ref|XP_007162567.1| hypothetical protein PHAVU_001G162800g [Phaseolus vulgaris]
 gb|ESW34561.1| hypothetical protein PHAVU_001G162800g [Phaseolus vulgaris]
Length=729

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/127 (46%), Positives = 79/127 (62%), Gaps = 4/127 (3%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKES----SRDLGNLSTLI  390
            GL K LRIL AAGA E+GT    G+  K +G   ++++EF++        R    L T++
Sbjct  594  GLRKALRILVAAGAVEVGTYRSDGQRFKCRGVKEEDLEEFLDTVKIVGGPRSRNELWTVL  653

Query  389  GSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTA  210
             SAHQM SCRMG       V+  GE+WE +GL++ D SV PTA+GVNPMVT+Q+ AYC A
Sbjct  654  TSAHQMTSCRMGATEEEGAVDETGESWEAKGLYVCDGSVLPTAVGVNPMVTIQSTAYCIA  713

Query  209  QSVLKFL  189
              + + L
Sbjct  714  SKIAESL  720



>ref|XP_006589282.1| PREDICTED: long-chain-alcohol oxidase FAO1-like isoform X2 [Glycine 
max]
Length=649

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/129 (45%), Positives = 85/129 (66%), Gaps = 6/129 (5%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLS-----TL  393
            G+++ LRIL AAGA E+GT    G  ++  G +  E++ FVE   + + G +S     ++
Sbjct  520  GVKQALRILIAAGAVEVGTHRSDGHRIECNGKNEKELERFVESVYATE-GLMSHEEKWSI  578

Query  392  IGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCT  213
              SAHQMGSCRMG+  +   V+  G +WE EGLF+ D+S+ PTA+GVNPM+T+Q+ AYC 
Sbjct  579  YSSAHQMGSCRMGMSEKEGAVDENGMSWEAEGLFVCDASLLPTAIGVNPMITIQSTAYCV  638

Query  212  AQSVLKFLK  186
            A+ +  FLK
Sbjct  639  AKRIAAFLK  647



>ref|XP_008235630.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Prunus mume]
Length=760

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/135 (43%), Positives = 86/135 (64%), Gaps = 8/135 (6%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEK------ESSRDLGNLST  396
            GL + LRIL AAGA E+GT    G+ +K KG   ++++EF++        SSR+   L T
Sbjct  621  GLRQALRILIAAGAVEVGTYRNDGQRIKCKGTKHEDLEEFLDTVVAPAGPSSRE--ELWT  678

Query  395  LIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYC  216
            +  SAHQMGSCRM        V+  GE+WE +GLF+ D S+ PTA+GVNPM+T+Q+ AYC
Sbjct  679  IYSSAHQMGSCRMSASEEEGGVDENGESWEAKGLFVCDGSLLPTAIGVNPMITIQSTAYC  738

Query  215  TAQSVLKFLKTHNHM  171
             ++ + + L+   ++
Sbjct  739  ISKKIAESLEKEKYI  753



>emb|CDX94858.1| BnaC03g43300D [Brassica napus]
Length=741

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/129 (45%), Positives = 82/129 (64%), Gaps = 4/129 (3%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVE----KESSRDLGNLSTLI  390
            GL + LRIL AAGAEE+GT    G+ L  KG     IDEF++    +E  + +    ++ 
Sbjct  612  GLRQSLRILIAAGAEEVGTHRSDGQKLICKGVDEKSIDEFLDSVSAEEGPKAMTENWSVY  671

Query  389  GSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTA  210
             SAHQMGSCR+GVD     ++  GE+WE + LF+ D SV P+A+GVNPM+T+ + AYC A
Sbjct  672  SSAHQMGSCRIGVDEDEGAIDLNGESWEADKLFVCDGSVLPSAVGVNPMITIMSTAYCIA  731

Query  209  QSVLKFLKT  183
              ++K + T
Sbjct  732  TRIVKSMTT  740



>ref|XP_010488398.1| PREDICTED: long-chain-alcohol oxidase FAO3-like [Camelina sativa]
Length=750

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/129 (45%), Positives = 82/129 (64%), Gaps = 4/129 (3%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRD----LGNLSTLI  390
            GL + LRIL AAGAEE+GT    G+ILK KG     I+EF++  SS +    +     + 
Sbjct  618  GLRQSLRILIAAGAEEVGTHRSDGQILKCKGVDEKSIEEFLDSVSSEEGPKGMTEKWNIY  677

Query  389  GSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTA  210
             SAHQMGSCR+G + +   ++  GE+WE E LF+ D+S  P+A+GVNPM+TV + AYC +
Sbjct  678  CSAHQMGSCRIGENEKEGAIDVNGESWEAEKLFVCDASALPSAVGVNPMITVMSTAYCIS  737

Query  209  QSVLKFLKT  183
              + K + T
Sbjct  738  TRIAKSMTT  746



>ref|XP_011029789.1| PREDICTED: long-chain-alcohol oxidase FAO1-like [Populus euphratica]
Length=744

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/129 (44%), Positives = 86/129 (67%), Gaps = 6/129 (5%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLST-----L  393
            GL + LRIL AAGA E+GT    G+ +K +G  +++++EF++   +   G LS       
Sbjct  615  GLRQALRILVAAGAVEVGTHRSDGQRIKCRGIKKEDLEEFLDTVYATG-GALSMEEDWMF  673

Query  392  IGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCT  213
              SAHQMGSCRMG+  +   V+  GE+WE EGLF+ D+SV P+A+GVNPM+T+Q+ AYC 
Sbjct  674  YSSAHQMGSCRMGIKEKEGAVDENGESWEAEGLFVCDASVLPSAVGVNPMITIQSTAYCL  733

Query  212  AQSVLKFLK  186
            ++ + + L+
Sbjct  734  SKKIAESLR  742



>ref|XP_010512451.1| PREDICTED: long-chain-alcohol oxidase FAO3 [Camelina sativa]
Length=749

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/129 (45%), Positives = 82/129 (64%), Gaps = 4/129 (3%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRD----LGNLSTLI  390
            GL + LRIL AAGAEE+GT    G+ILK KG     I+EF++  SS +    +     + 
Sbjct  617  GLRQSLRILIAAGAEEVGTHRSDGQILKCKGVDEKSIEEFLDSVSSEEGPKGMTEKWNIY  676

Query  389  GSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTA  210
             SAHQMGSCR+G + +   ++  GE+WE E LF+ D+S  P+A+GVNPM+TV + AYC +
Sbjct  677  CSAHQMGSCRIGENEKEGAIDVNGESWEAEKLFVCDASALPSAVGVNPMITVMSTAYCIS  736

Query  209  QSVLKFLKT  183
              + K + T
Sbjct  737  TRIAKSMTT  745



>ref|XP_006412937.1| hypothetical protein EUTSA_v10024496mg [Eutrema salsugineum]
 gb|ESQ54390.1| hypothetical protein EUTSA_v10024496mg [Eutrema salsugineum]
Length=600

 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 87/136 (64%), Gaps = 8/136 (6%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLST------  396
            G+ + LR+L AAGA EIGT    G+ +K +G +R+ ++EF+++  +   G +ST      
Sbjct  465  GIRQALRVLVAAGAVEIGTYRSDGQRMKCEGVTREAVEEFLDRVDAD--GGVSTNREYWT  522

Query  395  LIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYC  216
               SAHQMGSCRMG       V+  GE+WE EGLF+ D SV P+A+GVNPM+T+Q+ AYC
Sbjct  523  TYFSAHQMGSCRMGHTEEEGAVDENGESWEAEGLFVCDGSVLPSAVGVNPMITIQSAAYC  582

Query  215  TAQSVLKFLKTHNHMQ  168
             ++ ++  L+   + +
Sbjct  583  ISKRIVDSLQRQKNKE  598



>gb|KJB72414.1| hypothetical protein B456_011G177100 [Gossypium raimondii]
Length=746

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/130 (45%), Positives = 84/130 (65%), Gaps = 4/130 (3%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEK----ESSRDLGNLSTLI  390
            GL + LRIL AAGA E+GT    G+  + KG S +E++EF++      S    G    + 
Sbjct  616  GLRQSLRILVAAGAVEVGTHRSDGQRKRCKGISNEELEEFLDSVSMLTSPLCTGENWVVH  675

Query  389  GSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTA  210
             SAHQMGSCRMG++     V+  GE+WE EGLF+ D+SV P+A+GVNPM+TVQ+ AYC +
Sbjct  676  TSAHQMGSCRMGINEEEGAVDENGESWEAEGLFVCDASVLPSAVGVNPMITVQSTAYCLS  735

Query  209  QSVLKFLKTH  180
            + + + L+  
Sbjct  736  KKIAESLRQQ  745



>ref|XP_007035188.1| Fatty alcohol oxidase 3 isoform 6, partial [Theobroma cacao]
 gb|EOY06114.1| Fatty alcohol oxidase 3 isoform 6, partial [Theobroma cacao]
Length=655

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 82/127 (65%), Gaps = 4/127 (3%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRD----LGNLSTLI  390
            GL + LRIL AAGA E+GT    G+ ++ KG S  E++EF+E  S  +            
Sbjct  529  GLRQALRILVAAGAVEVGTHRSDGQSIRCKGISNKELEEFLESVSPVEGPMFPAEKWVTH  588

Query  389  GSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTA  210
             SAHQMGSCRMG++ +   V+  GE+WE EGLF+ D+SV P A+GVNPM+TVQ+ AYC +
Sbjct  589  TSAHQMGSCRMGINEKEGAVDENGESWEAEGLFVCDASVLPGAIGVNPMITVQSTAYCLS  648

Query  209  QSVLKFL  189
            + + + L
Sbjct  649  KRIAESL  655



>ref|XP_006589281.1| PREDICTED: long-chain-alcohol oxidase FAO1-like isoform X1 [Glycine 
max]
Length=740

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/129 (45%), Positives = 85/129 (66%), Gaps = 6/129 (5%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLS-----TL  393
            G+++ LRIL AAGA E+GT    G  ++  G +  E++ FVE   + + G +S     ++
Sbjct  611  GVKQALRILIAAGAVEVGTHRSDGHRIECNGKNEKELERFVESVYATE-GLMSHEEKWSI  669

Query  392  IGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCT  213
              SAHQMGSCRMG+  +   V+  G +WE EGLF+ D+S+ PTA+GVNPM+T+Q+ AYC 
Sbjct  670  YSSAHQMGSCRMGMSEKEGAVDENGMSWEAEGLFVCDASLLPTAIGVNPMITIQSTAYCV  729

Query  212  AQSVLKFLK  186
            A+ +  FLK
Sbjct  730  AKRIAAFLK  738



>gb|EAY78905.1| hypothetical protein OsI_34008 [Oryza sativa Indica Group]
Length=564

 Score =   115 bits (287),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEF-----VEKESSRDLGNLSTL  393
            GL + LRIL AAGA E+GT    G  L+ KGA  ++++ F     VEK       +   L
Sbjct  414  GLRRALRILVAAGAAEVGTNRSDGLRLRCKGARDEDVEAFLDEVSVEKGPMHPGSDKWAL  473

Query  392  IGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCT  213
            + SAHQMGSCRMG   +   V+  GE+WE EGL++ D S+ PTA+GVNPM+T++++AYC 
Sbjct  474  LASAHQMGSCRMGRSAKHGGVDGGGESWEAEGLYVCDGSLLPTAVGVNPMITIESVAYCV  533

Query  212  AQSVLKFLKT  183
            A+ + + L +
Sbjct  534  AKGIAESLAS  543



>ref|XP_004289970.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Fragaria vesca 
subsp. vesca]
Length=743

 Score =   115 bits (289),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/128 (43%), Positives = 82/128 (64%), Gaps = 4/128 (3%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEK----ESSRDLGNLSTLI  390
            GL + +RIL AAGA E+GT    G+ +  KG  +++++EF++        R  G   T+ 
Sbjct  610  GLRQAVRILIAAGAVEVGTYRNDGQRIVCKGTKKEDLEEFLDSVIAVGGPRTRGEYWTMY  669

Query  389  GSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTA  210
             +AHQMGSC+MG   +   V+  GE+WE EGLF+ D S+ PTA+GVNPM+T+Q+ AYC +
Sbjct  670  STAHQMGSCKMGATEKEGGVDENGESWEAEGLFVCDGSLLPTAIGVNPMITIQSTAYCVS  729

Query  209  QSVLKFLK  186
            + +   LK
Sbjct  730  KKIADSLK  737



>emb|CDP11641.1| unnamed protein product [Coffea canephora]
Length=749

 Score =   115 bits (289),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 81/128 (63%), Gaps = 4/128 (3%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEK----ESSRDLGNLSTLI  390
            GL + L IL AAGA E+GT    G+  K KG S  E++EF+++    E  + L    T  
Sbjct  616  GLRQALMILVAAGAVEVGTLQSNGQKFKCKGTSERELEEFLDEVTAAEGPKSLVQNWTTY  675

Query  389  GSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTA  210
             SAHQMGSCRMG   + S V+  GE+WE E LF+ D+SV P A+GVNPM+T+Q+ A+C +
Sbjct  676  FSAHQMGSCRMGKSEKVSAVDENGESWEAEDLFVCDASVLPGAVGVNPMITIQSTAFCLS  735

Query  209  QSVLKFLK  186
              + + LK
Sbjct  736  NKIAEILK  743



>ref|XP_010093072.1| Long-chain-alcohol oxidase FAO2 [Morus notabilis]
 gb|EXB53500.1| Long-chain-alcohol oxidase FAO2 [Morus notabilis]
Length=743

 Score =   115 bits (288),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 57/133 (43%), Positives = 83/133 (62%), Gaps = 4/133 (3%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESS----RDLGNLSTLI  390
            GL + LRIL AAGA E+GT    G+ +K KG    + +EF++  ++       G   T+ 
Sbjct  609  GLRQALRILVAAGAVEVGTYRSDGQRIKCKGLKEKDFEEFLDTVTAVGGPGTRGEHWTIY  668

Query  389  GSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTA  210
             SAHQMGSCRMG +     V+  GE+WE E LF+ D SV PTA GVNPM+++++ A+C +
Sbjct  669  CSAHQMGSCRMGANEEEGAVDENGESWEAESLFVCDGSVLPTAAGVNPMISIESTAFCIS  728

Query  209  QSVLKFLKTHNHM  171
              ++K LK  +H+
Sbjct  729  TRIVKSLKRQSHV  741



>ref|XP_007200494.1| hypothetical protein PRUPE_ppa018458mg [Prunus persica]
 gb|EMJ01693.1| hypothetical protein PRUPE_ppa018458mg [Prunus persica]
Length=754

 Score =   115 bits (288),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 58/135 (43%), Positives = 85/135 (63%), Gaps = 8/135 (6%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEK------ESSRDLGNLST  396
            GL + LRIL AAGA E+GT    G+ +K KG   ++++EF++        SSR+   L T
Sbjct  621  GLRQALRILIAAGAVEVGTYRNDGQRIKCKGTKHEDLEEFLDSVVAAAGPSSRE--ELWT  678

Query  395  LIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYC  216
               SAHQMGSCRM        V+  GE+WE +GLF+ D S+ PTA+GVNPM+T+Q+ AYC
Sbjct  679  TYSSAHQMGSCRMSASEEEGGVDENGESWEAKGLFVCDGSLLPTAIGVNPMITIQSTAYC  738

Query  215  TAQSVLKFLKTHNHM  171
             ++ + + L+   ++
Sbjct  739  ISKKIAESLEKEKYI  753



>tpg|DAA49655.1| TPA: hypothetical protein ZEAMMB73_468308 [Zea mays]
Length=448

 Score =   113 bits (282),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 57/124 (46%), Positives = 80/124 (65%), Gaps = 5/124 (4%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEF-----VEKESSRDLGNLSTL  393
            GL +VLRIL AAGA E+GT    G  L+ KG   ++++ F     +EK       +   L
Sbjct  313  GLRRVLRILVAAGAAEVGTHRSDGLRLRCKGLRDEDLEGFLDEVTIEKGPMHSRVDKWAL  372

Query  392  IGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCT  213
              SAHQMGSCRMG  P+   V+  GE+WE EGL++ D S+ PTA+GVNPM+T+Q+IA+C 
Sbjct  373  HCSAHQMGSCRMGSSPKDGAVDGRGESWEAEGLYVCDGSLLPTAVGVNPMITIQSIAFCL  432

Query  212  AQSV  201
            ++ +
Sbjct  433  SKGI  436



>ref|XP_010069617.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Eucalyptus grandis]
 gb|KCW58025.1| hypothetical protein EUGRSUZ_H00753 [Eucalyptus grandis]
Length=746

 Score =   115 bits (288),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 89/128 (70%), Gaps = 4/128 (3%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRD-LGNLS---TLI  390
            GL + LRIL AAGA E+GT    G+ +K +GA +++I+EF++  ++   LG+     T+ 
Sbjct  611  GLRQALRILIAAGAVEVGTYRSDGQRIKCRGAKQEDIEEFLDSITTPGGLGSRQEHWTMY  670

Query  389  GSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTA  210
             SAHQMGSCRMG +  +  V+  GE+WE +GLF+ D S+ P+A+GVNPM+T+Q+ AYC +
Sbjct  671  CSAHQMGSCRMGANEGAGAVDENGESWEAKGLFVCDGSMLPSAVGVNPMITIQSTAYCIS  730

Query  209  QSVLKFLK  186
            + + + L+
Sbjct  731  KRIAESLR  738



>gb|ACF88407.1| unknown [Zea mays]
Length=466

 Score =   113 bits (282),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 57/124 (46%), Positives = 80/124 (65%), Gaps = 5/124 (4%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEF-----VEKESSRDLGNLSTL  393
            GL +VLRIL AAGA E+GT    G  L+ KG   ++++ F     +EK       +   L
Sbjct  331  GLRRVLRILVAAGAAEVGTHRSDGLRLRCKGLRDEDLEGFLDEVTIEKGPMHSRVDKWAL  390

Query  392  IGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCT  213
              SAHQMGSCRMG  P+   V+  GE+WE EGL++ D S+ PTA+GVNPM+T+Q+IA+C 
Sbjct  391  HCSAHQMGSCRMGSSPKDGAVDGRGESWEAEGLYVCDGSLLPTAVGVNPMITIQSIAFCL  450

Query  212  AQSV  201
            ++ +
Sbjct  451  SKGI  454



>gb|ACF22878.1| alcohol oxidase [Glycine max]
Length=723

 Score =   115 bits (288),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 56/127 (44%), Positives = 80/127 (63%), Gaps = 4/127 (3%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKES----SRDLGNLSTLI  390
            GL K LRIL AAGA E+GT    G+ +K KG   ++++EF++  +     R    + T+ 
Sbjct  590  GLRKALRILVAAGAMEVGTYRSDGQRIKCKGMKEEDLEEFLDTVTIVGGPRSRNEVWTVF  649

Query  389  GSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTA  210
             +AHQM SCRMG       ++  GETWE EGL++ D SV P+A+GVNPMVT+Q+ +YC A
Sbjct  650  TTAHQMSSCRMGASEEEGALDENGETWEAEGLYVCDGSVLPSAVGVNPMVTIQSTSYCIA  709

Query  209  QSVLKFL  189
              + + L
Sbjct  710  SKIAESL  716



>gb|EEE51130.1| hypothetical protein OsJ_31873 [Oryza sativa Japonica Group]
Length=621

 Score =   114 bits (286),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 58/128 (45%), Positives = 78/128 (61%), Gaps = 5/128 (4%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEF-----VEKESSRDLGNLSTL  393
            GL + LRIL AAGA E+GT    G  L+ KG    +++ F     +EK       +   +
Sbjct  492  GLRRALRILVAAGAAEVGTHRSDGLRLRCKGVRDADVEAFLDEVTIEKGPMYPGSDKWAI  551

Query  392  IGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCT  213
              SAHQMGSCRMG  PR   V+  GE+WE EGL++ D S+ PTA+GVNPM+T+Q+IAYC 
Sbjct  552  FCSAHQMGSCRMGASPRDGAVDGAGESWEAEGLYVCDGSLLPTAVGVNPMITIQSIAYCL  611

Query  212  AQSVLKFL  189
            +  +   L
Sbjct  612  SNGIADTL  619



>ref|XP_004247518.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Solanum lycopersicum]
Length=731

 Score =   115 bits (288),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 61/133 (46%), Positives = 84/133 (63%), Gaps = 8/133 (6%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLS-----TL  393
            GL + LRIL AAGA E+GT    G+ +K K    +E++EFV+   + + G +S     T+
Sbjct  599  GLRRALRILIAAGAVEVGTYRSDGQKIKCKDIKNEELEEFVDTVEAPE-GPMSKEENWTV  657

Query  392  IGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCT  213
              SAHQMGSCRMG       V+  GE WE +GL++ D SV PTA+GVNPM+T+Q+ AYC 
Sbjct  658  YASAHQMGSCRMGSSKEDGAVDENGECWEAKGLYVCDGSVLPTAVGVNPMITIQSTAYCI  717

Query  212  AQSVLKFLKTHNH  174
            A+ + + L  HN 
Sbjct  718  AKRIAESL--HNE  728



>gb|AAL31027.1|AC078948_11 putative alcohol oxidase [Oryza sativa Japonica Group]
 gb|AAP54254.1| GMC oxidoreductase family protein [Oryza sativa Japonica Group]
Length=637

 Score =   114 bits (286),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 58/128 (45%), Positives = 78/128 (61%), Gaps = 5/128 (4%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEF-----VEKESSRDLGNLSTL  393
            GL + LRIL AAGA E+GT    G  L+ KG    +++ F     +EK       +   +
Sbjct  508  GLRRALRILVAAGAAEVGTHRSDGLRLRCKGVRDADVEAFLDEVTIEKGPMYPGSDKWAI  567

Query  392  IGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCT  213
              SAHQMGSCRMG  PR   V+  GE+WE EGL++ D S+ PTA+GVNPM+T+Q+IAYC 
Sbjct  568  FCSAHQMGSCRMGASPRDGAVDGAGESWEAEGLYVCDGSLLPTAVGVNPMITIQSIAYCL  627

Query  212  AQSVLKFL  189
            +  +   L
Sbjct  628  SNGIADTL  635



>gb|KHN02487.1| Long-chain-alcohol oxidase FAO2 [Glycine soja]
Length=744

 Score =   115 bits (288),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 56/127 (44%), Positives = 80/127 (63%), Gaps = 4/127 (3%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKES----SRDLGNLSTLI  390
            GL K LRIL AAGA E+GT    G+ +K KG   ++++EF++  +     R    + T+ 
Sbjct  611  GLRKALRILVAAGAMEVGTYRSDGQRIKCKGMKEEDLEEFLDTVTIVGGPRSRNEVWTVF  670

Query  389  GSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTA  210
             +AHQM SCRMG       ++  GETWE EGL++ D SV P+A+GVNPMVT+Q+ +YC A
Sbjct  671  TTAHQMSSCRMGASEEEGALDENGETWEAEGLYVCDGSVLPSAVGVNPMVTIQSTSYCIA  730

Query  209  QSVLKFL  189
              + + L
Sbjct  731  SKIAESL  737



>ref|XP_004982883.1| PREDICTED: long-chain-alcohol oxidase FAO1-like isoform X2 [Setaria 
italica]
Length=685

 Score =   115 bits (287),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 61/130 (47%), Positives = 83/130 (64%), Gaps = 8/130 (6%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRD-EIDEFVEKESSRDLGNL------S  399
            GL + LRIL AAGA E+GT    G  L+  G  RD E+D F++ E +   G +       
Sbjct  551  GLRRALRILVAAGAAEVGTHRSDGHRLRCDGGVRDDELDAFLD-EVTVATGPMLPGSDKW  609

Query  398  TLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAY  219
             L+ SAHQMGSCRMG  PR   V+  GE+WE EGL++ D S+ PTA+GVNPM+T+Q+ AY
Sbjct  610  ALLCSAHQMGSCRMGSSPRDGAVDGRGESWEAEGLYVCDGSLLPTAVGVNPMITIQSTAY  669

Query  218  CTAQSVLKFL  189
            C ++ + + L
Sbjct  670  CLSEGIAESL  679



>ref|NP_001064839.2| Os10g0474800 [Oryza sativa Japonica Group]
 dbj|BAF26753.2| Os10g0474800 [Oryza sativa Japonica Group]
Length=614

 Score =   114 bits (286),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEF-----VEKESSRDLGNLSTL  393
            GL + LRIL AAGA E+GT    G  L+ KGA  ++++ F     VEK       +   L
Sbjct  464  GLRRALRILVAAGAAEVGTNRSDGLRLRCKGARDEDVEAFLDEVSVEKGPMHPGSDKWAL  523

Query  392  IGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCT  213
            + SAHQMGSCRMG   +   V+  GE+WE EGL++ D S+ PTA+GVNPM+T++++AYC 
Sbjct  524  LASAHQMGSCRMGRSAKHGGVDGGGESWEAEGLYVCDGSLLPTAVGVNPMITIESVAYCV  583

Query  212  AQSVLKFLKT  183
            A+ + + L +
Sbjct  584  AKGIAESLAS  593



>ref|XP_003554295.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Glycine max]
Length=744

 Score =   115 bits (288),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 56/127 (44%), Positives = 80/127 (63%), Gaps = 4/127 (3%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKES----SRDLGNLSTLI  390
            GL K LRIL AAGA E+GT    G+ +K KG   ++++EF++  +     R    + T+ 
Sbjct  611  GLRKALRILVAAGAMEVGTYRSDGQRIKCKGMKEEDLEEFLDTVTIVGGPRSRNEVWTVF  670

Query  389  GSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTA  210
             +AHQM SCRMG       ++  GETWE EGL++ D SV P+A+GVNPMVT+Q+ +YC A
Sbjct  671  TTAHQMSSCRMGASEEEGALDENGETWEAEGLYVCDGSVLPSAVGVNPMVTIQSTSYCIA  730

Query  209  QSVLKFL  189
              + + L
Sbjct  731  SKIAESL  737



>ref|XP_003575383.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Brachypodium 
distachyon]
Length=766

 Score =   115 bits (288),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 82/128 (64%), Gaps = 4/128 (3%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEK----ESSRDLGNLSTLI  390
            GL + LR+L AAGA EIGT    G+ +K KGA+ +E++EF++        +      +L 
Sbjct  631  GLRRALRVLVAAGATEIGTHRSDGQRMKCKGATEEEVEEFLDGVTVLRGPQSKSENWSLC  690

Query  389  GSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTA  210
             +AHQMGSCRM        V+  GE+WE E L++ D+SV P+A+GVNPM+T+QA+AYC A
Sbjct  691  CTAHQMGSCRMAATALDGAVDARGESWEAERLYVCDASVLPSAVGVNPMITIQAVAYCLA  750

Query  209  QSVLKFLK  186
              + + LK
Sbjct  751  NGIAEQLK  758



>ref|XP_002311685.2| alcohol oxidase-related family protein [Populus trichocarpa]
 gb|EEE89052.2| alcohol oxidase-related family protein [Populus trichocarpa]
Length=744

 Score =   115 bits (287),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 57/129 (44%), Positives = 86/129 (67%), Gaps = 6/129 (5%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLS-----TL  393
            GL + LRIL AAGA E+GT    G+ +K +G   ++++EF++   +   G LS       
Sbjct  615  GLRQALRILVAAGAVEVGTHRSDGQRIKCRGIKIEDLEEFLDTVYATG-GALSLEEDWMF  673

Query  392  IGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCT  213
              SAHQMGSCRMG++ +   V+  GE+WE EGLF+ D+SV P+A+GVNPM+T+Q+ AYC 
Sbjct  674  YSSAHQMGSCRMGINEKEGAVDENGESWEAEGLFVCDASVLPSAVGVNPMITIQSTAYCL  733

Query  212  AQSVLKFLK  186
            ++ + + L+
Sbjct  734  SKKIAESLR  742



>gb|KEH23951.1| long-chain-alcohol oxidase FAO1 [Medicago truncatula]
Length=567

 Score =   114 bits (285),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 61/128 (48%), Positives = 83/128 (65%), Gaps = 4/128 (3%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKES----SRDLGNLSTLI  390
            GL K LRIL AAGA E+GT    G+ +K +G   +E++EF++  S     R    L T+ 
Sbjct  438  GLRKSLRILVAAGAVEVGTYRSDGQKIKCEGIKEEELEEFLDTVSVVGGPRSRSELWTMF  497

Query  389  GSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTA  210
             SAHQMGSCRMG +     V+  GE+WE +GL++ D SV P+A+GVNPMVT+Q+ AYC A
Sbjct  498  SSAHQMGSCRMGKNEEEGAVDENGESWEAKGLYVCDGSVLPSAVGVNPMVTIQSTAYCIA  557

Query  209  QSVLKFLK  186
              + + LK
Sbjct  558  SKIAESLK  565



>ref|XP_006412936.1| hypothetical protein EUTSA_v10024496mg [Eutrema salsugineum]
 gb|ESQ54389.1| hypothetical protein EUTSA_v10024496mg [Eutrema salsugineum]
Length=756

 Score =   115 bits (287),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 57/135 (42%), Positives = 86/135 (64%), Gaps = 6/135 (4%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLG-----NLSTL  393
            G+ + LR+L AAGA EIGT    G+ +K +G +R+ ++EF+++  + D G        T 
Sbjct  621  GIRQALRVLVAAGAVEIGTYRSDGQRMKCEGVTREAVEEFLDRVDA-DGGVSTNREYWTT  679

Query  392  IGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCT  213
              SAHQMGSCRMG       V+  GE+WE EGLF+ D SV P+A+GVNPM+T+Q+ AYC 
Sbjct  680  YFSAHQMGSCRMGHTEEEGAVDENGESWEAEGLFVCDGSVLPSAVGVNPMITIQSAAYCI  739

Query  212  AQSVLKFLKTHNHMQ  168
            ++ ++  L+   + +
Sbjct  740  SKRIVDSLQRQKNKE  754



>ref|XP_009594479.1| PREDICTED: long-chain-alcohol oxidase FAO2 [Nicotiana tomentosiformis]
Length=745

 Score =   115 bits (287),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 57/125 (46%), Positives = 80/125 (64%), Gaps = 8/125 (6%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEK------ESSRDLGNLST  396
            G+ + LRIL AAGA E+GT    G+ +  KG + +E++EF++        SS+  G    
Sbjct  608  GVRRALRILVAAGAAEVGTYRSDGQKISCKGITNEELEEFLDTVGATGGPSSK--GEQWA  665

Query  395  LIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYC  216
            + GSAHQMGSCRMG +     V+  GE WE +GL++ D SV PTA+GVNPM+T+Q+ AYC
Sbjct  666  IYGSAHQMGSCRMGANEEDGAVDENGECWEAKGLYVCDGSVLPTAVGVNPMITIQSTAYC  725

Query  215  TAQSV  201
             A  +
Sbjct  726  IANRI  730



>ref|XP_004982882.1| PREDICTED: long-chain-alcohol oxidase FAO1-like isoform X1 [Setaria 
italica]
Length=762

 Score =   115 bits (287),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 82/129 (64%), Gaps = 6/129 (5%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRD-EIDEFVEKESSRDLGNLS-----T  396
            GL + LRIL AAGA E+GT    G  L+  G  RD E+D F+++ +      L       
Sbjct  628  GLRRALRILVAAGAAEVGTHRSDGHRLRCDGGVRDDELDAFLDEVTVATGPMLPGSDKWA  687

Query  395  LIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYC  216
            L+ SAHQMGSCRMG  PR   V+  GE+WE EGL++ D S+ PTA+GVNPM+T+Q+ AYC
Sbjct  688  LLCSAHQMGSCRMGSSPRDGAVDGRGESWEAEGLYVCDGSLLPTAVGVNPMITIQSTAYC  747

Query  215  TAQSVLKFL  189
             ++ + + L
Sbjct  748  LSEGIAESL  756



>ref|NP_001176205.1| Os10g0474966 [Oryza sativa Japonica Group]
 dbj|BAH94933.1| Os10g0474966 [Oryza sativa Japonica Group]
Length=760

 Score =   114 bits (286),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 58/128 (45%), Positives = 78/128 (61%), Gaps = 5/128 (4%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEF-----VEKESSRDLGNLSTL  393
            GL + LRIL AAGA E+GT    G  L+ KG    +++ F     +EK       +   +
Sbjct  631  GLRRALRILVAAGAAEVGTHRSDGLRLRCKGVRDADVEAFLDEVTIEKGPMYPGSDKWAI  690

Query  392  IGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCT  213
              SAHQMGSCRMG  PR   V+  GE+WE EGL++ D S+ PTA+GVNPM+T+Q+IAYC 
Sbjct  691  FCSAHQMGSCRMGASPRDGAVDGAGESWEAEGLYVCDGSLLPTAVGVNPMITIQSIAYCL  750

Query  212  AQSVLKFL  189
            +  +   L
Sbjct  751  SNGIADTL  758



>ref|XP_002960521.1| hypothetical protein SELMODRAFT_74601 [Selaginella moellendorffii]
 gb|EFJ38060.1| hypothetical protein SELMODRAFT_74601 [Selaginella moellendorffii]
Length=724

 Score =   114 bits (286),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 63/128 (49%), Positives = 81/128 (63%), Gaps = 5/128 (4%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGA-----SRDEIDEFVEKESSRDLGNLSTL  393
            G E  +R L AAGAE +G    AG+I     +        E++ F+++   R    LST 
Sbjct  594  GTELAVRALVAAGAEAVGLHSVAGEIFSVDQSWTPLQREKELEIFLKRVLGRMFQRLSTP  653

Query  392  IGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCT  213
            I SAHQMGSCRMG D R SVV+P  E+WEVEGLF+ D SV PTA GVNPM+T+Q+IA+ T
Sbjct  654  IISAHQMGSCRMGTDQRCSVVDPNCESWEVEGLFVGDGSVLPTASGVNPMITIQSIAHST  713

Query  212  AQSVLKFL  189
            A  + + L
Sbjct  714  ATRIARSL  721



>ref|XP_011091281.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Sesamum indicum]
Length=748

 Score =   114 bits (286),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 56/128 (44%), Positives = 82/128 (64%), Gaps = 4/128 (3%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVE----KESSRDLGNLSTLI  390
            GL + LRIL AAGA E+GT    G+ LK KG +  E+++F++    ++  + +    T  
Sbjct  614  GLRRALRILIAAGAVEVGTHQSDGQKLKCKGITEKEVEKFLDNVIAEDGPKSMVEKWTTY  673

Query  389  GSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTA  210
             SAHQMGSCRM    +   V+  GE+WE EGLF+ D+SV P A+GVNPM+T+Q  +YC +
Sbjct  674  SSAHQMGSCRMAKSEKDGAVDENGESWEAEGLFVCDASVLPGAVGVNPMITIQTTSYCLS  733

Query  209  QSVLKFLK  186
            + + + LK
Sbjct  734  KKIAEKLK  741



>ref|XP_002967201.1| hypothetical protein SELMODRAFT_87684 [Selaginella moellendorffii]
 gb|EFJ31800.1| hypothetical protein SELMODRAFT_87684 [Selaginella moellendorffii]
Length=724

 Score =   114 bits (286),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 63/128 (49%), Positives = 81/128 (63%), Gaps = 5/128 (4%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGA-----SRDEIDEFVEKESSRDLGNLSTL  393
            G E  +R L AAGAE +G    AG+I     +        E++ F+++   R    LST 
Sbjct  594  GTELAVRALVAAGAEAVGLHSVAGEIFSVDQSWTPLQREKELEIFLKRVLGRMFQRLSTP  653

Query  392  IGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCT  213
            I SAHQMGSCRMG D R SVV+P  E+WEVEGLF+ D SV PTA GVNPM+T+Q+IA+ T
Sbjct  654  IISAHQMGSCRMGTDQRCSVVDPNCESWEVEGLFVGDGSVLPTASGVNPMITIQSIAHST  713

Query  212  AQSVLKFL  189
            A  + + L
Sbjct  714  ATRIARSL  721



>gb|EYU46421.1| hypothetical protein MIMGU_mgv1a001868mg [Erythranthe guttata]
Length=747

 Score =   114 bits (286),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 55/127 (43%), Positives = 81/127 (64%), Gaps = 4/127 (3%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESS----RDLGNLSTLI  390
            GL + LRI+ AAGA E+GT    G+ L+ +G   +++++F+EK  +       G      
Sbjct  615  GLRQCLRIMIAAGAAEVGTFQNNGQRLECEGVGGEDVEKFLEKVMAAGGPSSGGQYWNTY  674

Query  389  GSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTA  210
             SAHQM SCRMG D R   V+  GE+WE +GLF+ D SV PTA+GVNPM+T+++ AYC +
Sbjct  675  ASAHQMSSCRMGADERDGAVDGNGESWEGKGLFVCDGSVLPTAVGVNPMITIESTAYCIS  734

Query  209  QSVLKFL  189
            + +  +L
Sbjct  735  KRIADYL  741



>gb|AAP54248.2| GMC oxidoreductase family protein, expressed [Oryza sativa Japonica 
Group]
Length=784

 Score =   114 bits (286),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 58/131 (44%), Positives = 83/131 (63%), Gaps = 5/131 (4%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEF-----VEKESSRDLGNLSTL  393
            GL + LRIL AAGA E+GT    G  L+ KGA  ++++ F     VEK       +   L
Sbjct  634  GLRRALRILVAAGAAEVGTNRSDGLRLRCKGARDEDVEAFLDEVSVEKGPMHPGSDKWAL  693

Query  392  IGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCT  213
            + SAHQMGSCRMG   +   V+  GE+WE EGL++ D S+ PTA+GVNPM+T++++AYC 
Sbjct  694  LASAHQMGSCRMGRSAKHGGVDGGGESWEAEGLYVCDGSLLPTAVGVNPMITIESVAYCV  753

Query  212  AQSVLKFLKTH  180
            A+ + + L + 
Sbjct  754  AKGIAESLASR  764



>gb|AAL31024.1|AC078948_8 putative alcohol oxidase [Oryza sativa Japonica Group]
Length=756

 Score =   114 bits (286),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 58/131 (44%), Positives = 83/131 (63%), Gaps = 5/131 (4%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEF-----VEKESSRDLGNLSTL  393
            GL + LRIL AAGA E+GT    G  L+ KGA  ++++ F     VEK       +   L
Sbjct  606  GLRRALRILVAAGAAEVGTNRSDGLRLRCKGARDEDVEAFLDEVSVEKGPMHPGSDKWAL  665

Query  392  IGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCT  213
            + SAHQMGSCRMG   +   V+  GE+WE EGL++ D S+ PTA+GVNPM+T++++AYC 
Sbjct  666  LASAHQMGSCRMGRSAKHGGVDGGGESWEAEGLYVCDGSLLPTAVGVNPMITIESVAYCV  725

Query  212  AQSVLKFLKTH  180
            A+ + + L + 
Sbjct  726  AKGIAESLASR  736



>ref|XP_008364320.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Malus domestica]
Length=743

 Score =   114 bits (285),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 57/129 (44%), Positives = 85/129 (66%), Gaps = 8/129 (6%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEK------ESSRDLGNLST  396
            GL + LRIL AAGA E+GT    G+ +K KG   ++++EF++        S+R+   L T
Sbjct  614  GLRQALRILIAAGAVEVGTYRNDGQRIKCKGVKEEDLEEFLDTVVTSAGPSARE--ELWT  671

Query  395  LIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYC  216
            +  SAHQMGSCRMG       V+  GE+WE +GLF+ D+S+ PTA+GVNPM+T+++ AYC
Sbjct  672  IYSSAHQMGSCRMGATEEEGGVDENGESWEAKGLFVCDASLLPTAVGVNPMITIESTAYC  731

Query  215  TAQSVLKFL  189
             ++ + + L
Sbjct  732  ISKKIAQSL  740



>ref|XP_002454190.1| hypothetical protein SORBIDRAFT_04g026390 [Sorghum bicolor]
 gb|EES07166.1| hypothetical protein SORBIDRAFT_04g026390 [Sorghum bicolor]
Length=776

 Score =   114 bits (286),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 81/128 (63%), Gaps = 4/128 (3%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEK----ESSRDLGNLSTLI  390
            GL + LR+LAAAGA EIGT    G+    +GA+   ++EF++        +      +L 
Sbjct  644  GLRRALRVLAAAGAAEIGTHRSDGQRFVCRGATEAALEEFLDGVDVVRGPQSKAEAWSLC  703

Query  389  GSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTA  210
             +AHQMGSCRMG   R   V+  GE+WEVE L++ D SV P+A+GVNPMVT+Q++AYC A
Sbjct  704  CTAHQMGSCRMGATARDGAVDARGESWEVESLYVCDGSVLPSAVGVNPMVTIQSVAYCLA  763

Query  209  QSVLKFLK  186
              + + L+
Sbjct  764  TGIAESLR  771



>ref|XP_004152057.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Cucumis sativus]
 ref|XP_004172632.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Cucumis sativus]
 gb|KGN58167.1| Electron carrier [Cucumis sativus]
Length=738

 Score =   114 bits (285),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 58/128 (45%), Positives = 84/128 (66%), Gaps = 6/128 (5%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLS-----TL  393
            GL + LRIL AAGA E+GT    G+ ++ +G +++E++EF++   +   G LS     T+
Sbjct  611  GLRQALRILIAAGATEVGTYRSDGQRIRCQGTNKEELEEFLDSVEAVG-GPLSRQKYWTM  669

Query  392  IGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCT  213
              SAHQM SCRMG       V+  GE+WE EGLF+ D SV PTA+GVNPM+T+Q+ AYC 
Sbjct  670  YCSAHQMSSCRMGSTKEEGAVDENGESWEAEGLFVCDGSVLPTAVGVNPMITIQSTAYCI  729

Query  212  AQSVLKFL  189
            ++ + + L
Sbjct  730  SKKIAESL  737



>gb|EPS58840.1| hypothetical protein M569_15969, partial [Genlisea aurea]
Length=668

 Score =   114 bits (284),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 82/128 (64%), Gaps = 4/128 (3%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVE----KESSRDLGNLSTLI  390
            GL   LRIL +AGA E+GT    G+ LK +G S  EI+EF++     E  + +    ++ 
Sbjct  538  GLRTALRILISAGAVEVGTHRSDGQRLKCRGISEKEIEEFLDGVTAPEGPKSMVRDWSVY  597

Query  389  GSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTA  210
             SAHQMGSCRMG +     V+  GE+WE EGLF+ DSS+ P A+GVNPM+T+QA +YC +
Sbjct  598  CSAHQMGSCRMGRNEEEGGVDENGESWEAEGLFVCDSSLLPGAIGVNPMITIQATSYCIS  657

Query  209  QSVLKFLK  186
             ++   LK
Sbjct  658  LNIADNLK  665



>gb|ACR36076.1| unknown [Zea mays]
 tpg|DAA49651.1| TPA: hypothetical protein ZEAMMB73_468308 [Zea mays]
Length=544

 Score =   113 bits (282),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 82/128 (64%), Gaps = 5/128 (4%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEF-----VEKESSRDLGNLSTL  393
            GL +VLRIL AAGA E+GT    G  L+ KG   ++++ F     +EK       +   L
Sbjct  409  GLRRVLRILVAAGAAEVGTHRSDGLRLRCKGLRDEDLEGFLDEVTIEKGPMHSRVDKWAL  468

Query  392  IGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCT  213
              SAHQMGSCRMG  P+   V+  GE+WE EGL++ D S+ PTA+GVNPM+T+Q+IA+C 
Sbjct  469  HCSAHQMGSCRMGSSPKDGAVDGRGESWEAEGLYVCDGSLLPTAVGVNPMITIQSIAFCL  528

Query  212  AQSVLKFL  189
            ++ + + +
Sbjct  529  SKGIAETM  536



>gb|KFK29401.1| hypothetical protein AALP_AA7G128800 [Arabis alpina]
Length=745

 Score =   114 bits (285),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 56/134 (42%), Positives = 83/134 (62%), Gaps = 4/134 (3%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESS----RDLGNLSTLI  390
            GL + LR+L AAGA E+GT    G+ +K +G S++ ++EF++   +       G   T  
Sbjct  608  GLRQALRVLVAAGAVEVGTYRSDGQRIKCEGISKEAMEEFLDGVDAVGGVSTKGEYWTSY  667

Query  389  GSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTA  210
             SAHQMGSCRMG       ++  GE+WE EGLF+ D SV P+A+GVNPM+T+Q+ AYC +
Sbjct  668  FSAHQMGSCRMGHSTEEGALDDNGESWEAEGLFVCDGSVLPSAVGVNPMITIQSTAYCIS  727

Query  209  QSVLKFLKTHNHMQ  168
              ++  L+T    +
Sbjct  728  TRIVHLLQTRQKYR  741



>sp|B5WWZ9.1|FAO2_LOTJA RecName: Full=Long-chain-alcohol oxidase FAO2; AltName: Full=Long-chain 
fatty alcohol oxidase 2 [Lotus japonicus]
 emb|CAP15763.1| long chain fatty alcohol oxidase FAO2 [Lotus japonicus]
Length=750

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 83/133 (62%), Gaps = 8/133 (6%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEK------ESSRDLGNLST  396
            GL K LRIL AAGA E+GT    G+ +K +G    +++EF++        SSR+   + T
Sbjct  620  GLRKALRILVAAGAVEVGTYRSDGQRIKCRGIKESDLEEFLDSVRVVGGPSSRN--EVWT  677

Query  395  LIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYC  216
            +  SAHQM SCRM        V+  GE+WE +GL++ D SV P+A+GVNPM+T+Q+ AYC
Sbjct  678  VFTSAHQMTSCRMSATEEEGAVDENGESWEAKGLYVCDGSVLPSAVGVNPMITIQSTAYC  737

Query  215  TAQSVLKFLKTHN  177
             A ++ + LK  N
Sbjct  738  IASNIAESLKKQN  750



>tpg|DAA49654.1| TPA: hypothetical protein ZEAMMB73_468308 [Zea mays]
Length=590

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/124 (46%), Positives = 80/124 (65%), Gaps = 5/124 (4%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEF-----VEKESSRDLGNLSTL  393
            GL +VLRIL AAGA E+GT    G  L+ KG   ++++ F     +EK       +   L
Sbjct  455  GLRRVLRILVAAGAAEVGTHRSDGLRLRCKGLRDEDLEGFLDEVTIEKGPMHSRVDKWAL  514

Query  392  IGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCT  213
              SAHQMGSCRMG  P+   V+  GE+WE EGL++ D S+ PTA+GVNPM+T+Q+IA+C 
Sbjct  515  HCSAHQMGSCRMGSSPKDGAVDGRGESWEAEGLYVCDGSLLPTAVGVNPMITIQSIAFCL  574

Query  212  AQSV  201
            ++ +
Sbjct  575  SKGI  578



>ref|XP_009119340.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Brassica rapa]
Length=761

 Score =   114 bits (284),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/134 (43%), Positives = 81/134 (60%), Gaps = 4/134 (3%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSR----DLGNLSTLI  390
            GL + LRIL AAGAEE+GT    G+ LK  G   +++++F+E   +      +    T  
Sbjct  627  GLRRALRILVAAGAEEVGTYRSDGQRLKCGGVKEEDLEKFLETVDAPAGVVSMSRRWTHS  686

Query  389  GSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTA  210
             +AHQMG CRMG       V+  GE+WE EGL++ D+SV PTALGVNPMVT+Q+ AYC +
Sbjct  687  FTAHQMGCCRMGATEEEGAVDGYGESWEAEGLYVCDASVLPTALGVNPMVTIQSTAYCIS  746

Query  209  QSVLKFLKTHNHMQ  168
            + +   +  +   Q
Sbjct  747  KRLAALMMKNKKKQ  760



>ref|XP_003574052.1| PREDICTED: long-chain-alcohol oxidase FAO1-like [Brachypodium 
distachyon]
Length=757

 Score =   114 bits (284),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/128 (44%), Positives = 83/128 (65%), Gaps = 5/128 (4%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEF-----VEKESSRDLGNLSTL  393
            GL + LRI+ AAGA E+GT    G  L+ KG   ++++ F     V +   +   +   L
Sbjct  624  GLRRALRIMVAAGAAEVGTHRSDGLRLRCKGVRDEDLEAFLDDVAVARGPMQAGTDTWAL  683

Query  392  IGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCT  213
            + SAHQMGSCRMG  PR   V+  GE+WE EGL++ D S+ PTA+GVNPM+T+Q++AYC 
Sbjct  684  LCSAHQMGSCRMGSSPREGAVDGSGESWEAEGLYVCDGSLLPTAVGVNPMITIQSLAYCL  743

Query  212  AQSVLKFL  189
            ++++ + L
Sbjct  744  SKNIAESL  751



>ref|NP_001142399.1| uncharacterized protein LOC100274574 [Zea mays]
 gb|ACN25897.1| unknown [Zea mays]
 tpg|DAA49653.1| TPA: hypothetical protein ZEAMMB73_468308 [Zea mays]
Length=675

 Score =   113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/124 (46%), Positives = 80/124 (65%), Gaps = 5/124 (4%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEF-----VEKESSRDLGNLSTL  393
            GL +VLRIL AAGA E+GT    G  L+ KG   ++++ F     +EK       +   L
Sbjct  540  GLRRVLRILVAAGAAEVGTHRSDGLRLRCKGLRDEDLEGFLDEVTIEKGPMHSRVDKWAL  599

Query  392  IGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCT  213
              SAHQMGSCRMG  P+   V+  GE+WE EGL++ D S+ PTA+GVNPM+T+Q+IA+C 
Sbjct  600  HCSAHQMGSCRMGSSPKDGAVDGRGESWEAEGLYVCDGSLLPTAVGVNPMITIQSIAFCL  659

Query  212  AQSV  201
            ++ +
Sbjct  660  SKGI  663



>gb|KEH23950.1| long-chain-alcohol oxidase FAO1 [Medicago truncatula]
Length=737

 Score =   113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 61/128 (48%), Positives = 83/128 (65%), Gaps = 4/128 (3%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKES----SRDLGNLSTLI  390
            GL K LRIL AAGA E+GT    G+ +K +G   +E++EF++  S     R    L T+ 
Sbjct  608  GLRKSLRILVAAGAVEVGTYRSDGQKIKCEGIKEEELEEFLDTVSVVGGPRSRSELWTMF  667

Query  389  GSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTA  210
             SAHQMGSCRMG +     V+  GE+WE +GL++ D SV P+A+GVNPMVT+Q+ AYC A
Sbjct  668  SSAHQMGSCRMGKNEEEGAVDENGESWEAKGLYVCDGSVLPSAVGVNPMVTIQSTAYCIA  727

Query  209  QSVLKFLK  186
              + + LK
Sbjct  728  SKIAESLK  735



>ref|XP_002464496.1| hypothetical protein SORBIDRAFT_01g019480 [Sorghum bicolor]
 gb|EER91494.1| hypothetical protein SORBIDRAFT_01g019480 [Sorghum bicolor]
Length=732

 Score =   113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 61/129 (47%), Positives = 79/129 (61%), Gaps = 6/129 (5%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNL------ST  396
            GL + LRIL AAGA E+GT    G  L+  G  RDE  E   KE +   G +        
Sbjct  598  GLRQALRILVAAGAAEVGTHRSDGLRLRCDGGLRDEDLEAFLKEVTVGEGPMLPGPDKWA  657

Query  395  LIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYC  216
            L  SAHQMGSCRMG  P+   V+  GE+WE EGL++ D SV PTA+GVNPM+T+Q+ AYC
Sbjct  658  LHCSAHQMGSCRMGCSPKDGAVDGRGESWEAEGLYVCDGSVLPTAVGVNPMITIQSTAYC  717

Query  215  TAQSVLKFL  189
             ++ + + L
Sbjct  718  VSKGIAESL  726



>ref|XP_008804287.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Phoenix dactylifera]
Length=759

 Score =   113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 56/128 (44%), Positives = 84/128 (66%), Gaps = 4/128 (3%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESS----RDLGNLSTLI  390
            GL + LRIL AAGA E+GT    G+ +K KG    +++EF++  S+         L TL 
Sbjct  628  GLRRALRILVAAGAVEVGTHRSDGQRMKCKGIEEKDLEEFLDGISAVGGPMSRRELWTLH  687

Query  389  GSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTA  210
             SAHQ+GSCR+G       V+  GE+WE +GLF+ D+SV P+A+G+NPM+T+Q++AYC +
Sbjct  688  ASAHQIGSCRIGASEEEGGVDESGESWEAQGLFVCDASVLPSAVGINPMITIQSVAYCLS  747

Query  209  QSVLKFLK  186
            + + + LK
Sbjct  748  KGIAESLK  755



>ref|XP_007144044.1| hypothetical protein PHAVU_007G124200g [Phaseolus vulgaris]
 gb|ESW16038.1| hypothetical protein PHAVU_007G124200g [Phaseolus vulgaris]
Length=741

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 56/128 (44%), Positives = 85/128 (66%), Gaps = 6/128 (5%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLS-----TL  393
            G+++ LRIL AAGA E+GT    G+ ++  G +  E++ FVE   +   G++S     ++
Sbjct  612  GVKQALRILIAAGAVEVGTHRSDGQRIECNGNNEKELERFVESIYATG-GSMSQEEKWSI  670

Query  392  IGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCT  213
              SAHQMGSC+MG+  +   V+  G +WE EGLF+ D+S+ PTA+GVNPM+T+Q+ AYC 
Sbjct  671  YSSAHQMGSCKMGMSEKEGAVDENGMSWEAEGLFVCDASLLPTAIGVNPMITIQSTAYCV  730

Query  212  AQSVLKFL  189
            A+ +  FL
Sbjct  731  AKRIAAFL  738



>emb|CDX89850.1| BnaA10g02320D [Brassica napus]
Length=752

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 56/127 (44%), Positives = 80/127 (63%), Gaps = 4/127 (3%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSR----DLGNLSTLI  390
            GL + LRIL AAGAEE+GT    G+ LK  G   +++++F+E   +      +    T  
Sbjct  620  GLRRALRILVAAGAEEVGTYRSDGQRLKCGGVKEEDLEKFLETVDAPAGVVSMSRRWTHS  679

Query  389  GSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTA  210
             +AHQMG CRMG       V+  GE+WE EGL++ D+SV PTALGVNPMVT+Q+ AYC +
Sbjct  680  FTAHQMGCCRMGATEEEGAVDGYGESWEAEGLYVCDASVLPTALGVNPMVTIQSTAYCIS  739

Query  209  QSVLKFL  189
            + + + +
Sbjct  740  KRLAELM  746



>gb|KJB38384.1| hypothetical protein B456_006G252500 [Gossypium raimondii]
Length=748

 Score =   113 bits (282),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 56/123 (46%), Positives = 83/123 (67%), Gaps = 4/123 (3%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRD----LGNLSTLI  390
            GL + LR+L AAGA E+GT    G+ LK KG S++E++EF++   S       G+   + 
Sbjct  619  GLRRSLRVLVAAGAVEVGTHRSDGQKLKCKGVSKEELEEFLDTVFSVGGPLFWGDKWMVH  678

Query  389  GSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTA  210
             +AHQMGSC+MG + +   V+  GE+WE EGL++ D+SV PTA+GVNPM+TV + AYC +
Sbjct  679  TTAHQMGSCKMGRNEKDGGVDENGESWEAEGLYVCDASVLPTAIGVNPMITVMSTAYCLS  738

Query  209  QSV  201
            + +
Sbjct  739  KRI  741



>emb|CDX92884.1| BnaC07g41420D [Brassica napus]
Length=742

 Score =   113 bits (282),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 56/127 (44%), Positives = 80/127 (63%), Gaps = 4/127 (3%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESS----RDLGNLSTLI  390
            GL + LR+L AAGA E+GT    G+ +K +G +R+ ++EF++   +       G   T  
Sbjct  611  GLRQALRVLVAAGAVEVGTYRSDGQRIKCEGITREAMEEFLDSVDAVGGVSTKGEYWTTY  670

Query  389  GSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTA  210
             SAHQMGSCRMG       V+  GE+WE EGLF+ D SV P+A+GVNPM+T+Q+ AYC +
Sbjct  671  FSAHQMGSCRMGRTAEEGAVDEKGESWEAEGLFVCDGSVLPSAVGVNPMITIQSTAYCIS  730

Query  209  QSVLKFL  189
              ++  L
Sbjct  731  TRIVASL  737



>ref|XP_010036770.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Eucalyptus grandis]
 gb|KCW48412.1| hypothetical protein EUGRSUZ_K02114 [Eucalyptus grandis]
Length=748

 Score =   113 bits (282),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 57/131 (44%), Positives = 83/131 (63%), Gaps = 8/131 (6%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEK------ESSRDLGNLST  396
            GL + LRIL AAGAEE+GT    G+ +K +G   ++I+EF+         +SR+   L  
Sbjct  615  GLRQALRILIAAGAEEVGTHRSDGQRMKCQGTKEEDIEEFLNDIVISGGPTSRE--ELWN  672

Query  395  LIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYC  216
            L   AH MGSCR+G   R   V+  GE+WE +GLF+ D S+ PTA+GVNPM+T+++ AYC
Sbjct  673  LYCCAHPMGSCRIGASERDGAVDESGESWEAKGLFVCDGSLMPTAIGVNPMITIESTAYC  732

Query  215  TAQSVLKFLKT  183
             A+ + + L +
Sbjct  733  IAKKIAESLSS  743



>ref|XP_011459707.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Fragaria vesca 
subsp. vesca]
Length=546

 Score =   112 bits (279),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 84/130 (65%), Gaps = 8/130 (6%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEK------ESSRDLGNLST  396
            GL + +RIL AAGA E+GT    G+ +  KG  +++++EF++        S+R  G   T
Sbjct  413  GLRQAVRILIAAGAVEVGTYRNDGQRIVCKGTKKEDLEEFLDSVIAVGGPSTR--GEHWT  470

Query  395  LIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYC  216
            +  SAHQMGSC+MG   +   V+  GE+WE +GLF+ D S+ PTA+GVNPM+T+Q+ AYC
Sbjct  471  MYSSAHQMGSCKMGATEKEGGVDENGESWEAKGLFVCDGSLLPTAVGVNPMITIQSTAYC  530

Query  215  TAQSVLKFLK  186
             ++ +   LK
Sbjct  531  LSKKIADSLK  540



>ref|XP_002464494.1| hypothetical protein SORBIDRAFT_01g019460 [Sorghum bicolor]
 gb|EER91492.1| hypothetical protein SORBIDRAFT_01g019460 [Sorghum bicolor]
Length=587

 Score =   112 bits (280),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 56/124 (45%), Positives = 79/124 (64%), Gaps = 5/124 (4%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEF-----VEKESSRDLGNLSTL  393
            GL + LRIL AAGA E+GT    G  L+ KG   ++++ F     +EK       +   L
Sbjct  454  GLRRTLRILVAAGAVEVGTHRSDGLRLRCKGLRDEDLEAFLDEVTIEKGPMHSRTDKWAL  513

Query  392  IGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCT  213
              SAHQMGSCRMG  P+   V+  GE+WE EGL++ D S+ PTA+GVNPM+T+Q+IA+C 
Sbjct  514  HCSAHQMGSCRMGSSPKDGAVDGRGESWEAEGLYVCDGSLLPTAVGVNPMITIQSIAFCL  573

Query  212  AQSV  201
            ++ +
Sbjct  574  SKGI  577



>gb|EPS66779.1| hypothetical protein M569_07992, partial [Genlisea aurea]
Length=724

 Score =   113 bits (282),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 56/128 (44%), Positives = 79/128 (62%), Gaps = 4/128 (3%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEK----ESSRDLGNLSTLI  390
            G+ + LRIL AAGA E GT    G+ +  KG + D ++EF++     +  R       + 
Sbjct  596  GMRRALRILIAAGATEAGTFRSDGQRIWCKGTNDDAVEEFLDTVVAADGPRTKSMFWNIY  655

Query  389  GSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTA  210
            GSAHQMGSCRMG +     V+  GE+WE +GLF+ D S+ PTA+GVNPMV++ A AYC A
Sbjct  656  GSAHQMGSCRMGRNEDEGAVDERGESWEAKGLFVCDGSLLPTAVGVNPMVSILATAYCVA  715

Query  209  QSVLKFLK  186
              + + +K
Sbjct  716  NRIAESMK  723



>ref|XP_008668721.1| PREDICTED: uncharacterized protein LOC100274574 isoform X1 [Zea 
mays]
 gb|ACR36691.1| unknown [Zea mays]
 tpg|DAA49652.1| TPA: hypothetical protein ZEAMMB73_468308 [Zea mays]
Length=783

 Score =   113 bits (282),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 57/124 (46%), Positives = 80/124 (65%), Gaps = 5/124 (4%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEF-----VEKESSRDLGNLSTL  393
            GL +VLRIL AAGA E+GT    G  L+ KG   ++++ F     +EK       +   L
Sbjct  648  GLRRVLRILVAAGAAEVGTHRSDGLRLRCKGLRDEDLEGFLDEVTIEKGPMHSRVDKWAL  707

Query  392  IGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCT  213
              SAHQMGSCRMG  P+   V+  GE+WE EGL++ D S+ PTA+GVNPM+T+Q+IA+C 
Sbjct  708  HCSAHQMGSCRMGSSPKDGAVDGRGESWEAEGLYVCDGSLLPTAVGVNPMITIQSIAFCL  767

Query  212  AQSV  201
            ++ +
Sbjct  768  SKGI  771



>emb|CDY18199.1| BnaC05g02220D [Brassica napus]
Length=752

 Score =   113 bits (282),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 55/128 (43%), Positives = 79/128 (62%), Gaps = 4/128 (3%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSR----DLGNLSTLI  390
            GL + LRIL AAGAEE+GT    G+ L+  G   +++++F+E   +      +    T  
Sbjct  621  GLRRALRILVAAGAEEVGTYRSDGQRLRCDGVEEEDLEKFLETVDAPPGVVSMSRWWTHS  680

Query  389  GSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTA  210
             +AHQMG CRMG       V+  GE+WE EGL++ D+SV PTALGVNPM+T Q+ AYC +
Sbjct  681  FTAHQMGCCRMGATEEEGAVDGYGESWEAEGLYVCDASVMPTALGVNPMITTQSTAYCIS  740

Query  209  QSVLKFLK  186
            + +   +K
Sbjct  741  KRLAALMK  748



>gb|KDP40361.1| hypothetical protein JCGZ_02359 [Jatropha curcas]
Length=755

 Score =   113 bits (282),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 57/129 (44%), Positives = 87/129 (67%), Gaps = 6/129 (5%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLS-----TL  393
            GL + LRIL AAGA E+GT    G+ L+ +G ++ +++EF++       G LS      +
Sbjct  611  GLRQSLRILVAAGAVEVGTHRSDGQRLQCQGITKKDLEEFLDTVFPCR-GILSPVKDWMI  669

Query  392  IGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCT  213
              SAHQMGSC+MG++ +   V+  GE+WE EGLF+ D+SV P+A+GVNPM+T+Q+ AYC 
Sbjct  670  YSSAHQMGSCKMGINEKEGAVDENGESWEAEGLFVCDASVLPSAVGVNPMITIQSTAYCL  729

Query  212  AQSVLKFLK  186
            ++ + + LK
Sbjct  730  SKGIAESLK  738



>gb|KDP26499.1| hypothetical protein JCGZ_17657 [Jatropha curcas]
Length=659

 Score =   112 bits (281),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 55/127 (43%), Positives = 82/127 (65%), Gaps = 3/127 (2%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLS---TLIG  387
            GL + LRIL  AGA E+GT    G+ +  KG    ++++F++  +   L +     TL+ 
Sbjct  532  GLRQALRILVGAGAVEVGTYRSDGQKIACKGIQDKDLEDFLDTVTVSGLTSKEEHWTLLF  591

Query  386  SAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQ  207
            SAHQMGSCRMG   +   V+  GE+WE + LF+ D SV PTA+GVNPM+T+Q+ AYC ++
Sbjct  592  SAHQMGSCRMGATEKEGAVDENGESWEAKDLFVCDGSVLPTAIGVNPMITIQSTAYCISR  651

Query  206  SVLKFLK  186
             +++ LK
Sbjct  652  KIVESLK  658



>ref|XP_009137800.1| PREDICTED: long-chain-alcohol oxidase FAO4B [Brassica rapa]
Length=744

 Score =   112 bits (281),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 56/127 (44%), Positives = 80/127 (63%), Gaps = 4/127 (3%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESS----RDLGNLSTLI  390
            GL + LR+L AAGA E+GT    G+ +K +G +R+ ++EF++   +       G   T  
Sbjct  613  GLRQALRVLVAAGAVEVGTYRSDGQRIKCEGMTREAMEEFLDGVDAVGGVSTKGEYWTTY  672

Query  389  GSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTA  210
             SAHQMGSCRMG       V+  GE+WE EGLF+ D SV P+A+GVNPM+T+Q+ AYC +
Sbjct  673  FSAHQMGSCRMGRTAEEGAVDEKGESWEAEGLFVCDGSVLPSAVGVNPMITIQSTAYCIS  732

Query  209  QSVLKFL  189
              ++  L
Sbjct  733  TRIVASL  739



>ref|XP_010532671.1| PREDICTED: long-chain-alcohol oxidase FAO3-like [Tarenaya hassleriana]
Length=741

 Score =   112 bits (281),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 80/129 (62%), Gaps = 4/129 (3%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRD----LGNLSTLI  390
            GL + LRIL +AGA E+GT    G+ LK KG     I+EF++  ++ D          + 
Sbjct  612  GLRQSLRILISAGAVEVGTHRSDGQSLKCKGIDEKAIEEFLDTVTAEDGPGSFTEKWMVY  671

Query  389  GSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTA  210
            G+  QMGSCR+GV+     ++P GE+WE E LF+ D SV P+A+GVNPM+TV A AYC +
Sbjct  672  GTTQQMGSCRIGVNEEEGALDPNGESWEAEKLFVCDGSVLPSAIGVNPMITVMATAYCIS  731

Query  209  QSVLKFLKT  183
              + K ++T
Sbjct  732  TGIAKSIRT  740



>ref|XP_008447391.1| PREDICTED: LOW QUALITY PROTEIN: long-chain-alcohol oxidase FAO2-like 
[Cucumis melo]
Length=739

 Score =   112 bits (281),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 57/131 (44%), Positives = 82/131 (63%), Gaps = 8/131 (6%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLG------NLST  396
            GL + LRIL AAGA EIGT    G+ ++ +G  +++++EF++  S   +G         T
Sbjct  611  GLRQALRILIAAGATEIGTYRSDGQRIRCQGTKKEDLEEFLD--SVEAVGGPWSRQKYWT  668

Query  395  LIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYC  216
            +  SAHQM SCRMG       V+  GE+WE EGLF+ D SV PTA+GVNPM+T+Q+ AYC
Sbjct  669  MYCSAHQMSSCRMGSTKEEGAVDENGESWEAEGLFVCDGSVLPTAVGVNPMITIQSTAYC  728

Query  215  TAQSVLKFLKT  183
             ++ + + L  
Sbjct  729  ISKKIAESLNN  739



>dbj|BAK02336.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=759

 Score =   112 bits (281),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 82/128 (64%), Gaps = 4/128 (3%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESS----RDLGNLSTLI  390
            GL + LRIL AAGA E+GT    G+ L+ KGA+ +E++EF++  S     +      +L 
Sbjct  624  GLRRALRILVAAGATEVGTHRSDGQKLRCKGATDEEVEEFLDGVSGVRGPQSKSEKWSLC  683

Query  389  GSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTA  210
             +AHQMGSCRM        V+  GE+WEVE L++ D SV P A+GVNPM+T+Q++AYC A
Sbjct  684  CTAHQMGSCRMAATAGDGAVDTRGESWEVERLYVCDGSVLPGAVGVNPMITIQSVAYCLA  743

Query  209  QSVLKFLK  186
              + + L+
Sbjct  744  TGIAEQLR  751



>ref|XP_006420281.1| hypothetical protein CICLE_v10004405mg [Citrus clementina]
 gb|ESR33521.1| hypothetical protein CICLE_v10004405mg [Citrus clementina]
Length=744

 Score =   112 bits (281),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 85/128 (66%), Gaps = 4/128 (3%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEK----ESSRDLGNLSTLI  390
            GL + LRIL AAGA E+GT    G+ LK +G +  E+++F++     E  +       + 
Sbjct  613  GLRQALRILIAAGAVEVGTHRSDGQRLKCEGITEKEVEQFLDTVYAAEGPKSPVENWMVY  672

Query  389  GSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTA  210
             +AHQMGSCRMGV+ +   V+  G++WE EGL++ D+SV P+A+GVNPM+T+Q+ AYC +
Sbjct  673  ATAHQMGSCRMGVNEKEGGVDENGQSWEAEGLYVCDASVLPSAVGVNPMITIQSTAYCLS  732

Query  209  QSVLKFLK  186
            + + + L+
Sbjct  733  KRIAESLR  740



>ref|XP_006443786.1| hypothetical protein CICLE_v10018992mg [Citrus clementina]
 ref|XP_006479488.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Citrus sinensis]
 gb|ESR57026.1| hypothetical protein CICLE_v10018992mg [Citrus clementina]
Length=748

 Score =   112 bits (280),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 82/130 (63%), Gaps = 8/130 (6%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEK------ESSRDLGNLST  396
            GL + LRIL AAGAEE+GT    G  ++ KG   ++++EF+         +SR  G   +
Sbjct  613  GLRQALRILVAAGAEEVGTYRSDGHRIRCKGIKEEDLEEFIGSIEVVGGMASR--GEHWS  670

Query  395  LIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYC  216
            +  SAHQMGSCRMG       V+  GE+WE EGLF+ D SV P+A+G+NPM+T+++ +YC
Sbjct  671  VYFSAHQMGSCRMGATEEDGAVDENGESWEAEGLFVCDGSVLPSAIGINPMITIESTSYC  730

Query  215  TAQSVLKFLK  186
             ++ +   LK
Sbjct  731  ISKKIADSLK  740



>ref|XP_010526493.1| PREDICTED: long-chain-alcohol oxidase FAO4B-like [Tarenaya hassleriana]
Length=761

 Score =   112 bits (280),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 55/128 (43%), Positives = 81/128 (63%), Gaps = 4/128 (3%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESS----RDLGNLSTLI  390
            GL + LRIL AAGA E+GT    G+ +K KG ++  ++EF++   +    R  G   T  
Sbjct  630  GLRQALRILIAAGAVEVGTYRSDGQRMKCKGLTKQAMEEFLDSVDAVGGVRTRGEHWTTY  689

Query  389  GSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTA  210
             SAHQMGSCRMG       V+  GE+WE +GLF+ D SV P+A+G+NPM+T+Q+ +YC +
Sbjct  690  FSAHQMGSCRMGASAGEGAVDENGESWETQGLFVCDGSVLPSAVGINPMITIQSTSYCIS  749

Query  209  QSVLKFLK  186
              + + L+
Sbjct  750  TRIAESLQ  757



>ref|XP_010433200.1| PREDICTED: long-chain-alcohol oxidase FAO4B [Camelina sativa]
Length=748

 Score =   112 bits (280),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 56/127 (44%), Positives = 79/127 (62%), Gaps = 4/127 (3%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESS----RDLGNLSTLI  390
            GL + LR+L AAGA E+GT    G+ +K +G +R+ I+EF+++          G   T  
Sbjct  616  GLRQALRVLIAAGAVEVGTYRSDGQRMKCEGTTRESIEEFLDEVDVVGGVSTKGEYWTSY  675

Query  389  GSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTA  210
             SAHQM SCRMG       ++  GE+WE EGLF+ D SV P+A+GVNPM+T+Q+ AYC A
Sbjct  676  FSAHQMSSCRMGATEEEGALDENGESWEAEGLFVCDGSVLPSAVGVNPMITIQSTAYCIA  735

Query  209  QSVLKFL  189
              ++  L
Sbjct  736  TRIVNSL  742



>ref|XP_008382898.1| PREDICTED: LOW QUALITY PROTEIN: long-chain-alcohol oxidase FAO2 
[Malus domestica]
Length=674

 Score =   112 bits (279),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 56/135 (41%), Positives = 85/135 (63%), Gaps = 8/135 (6%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEK------ESSRDLGNLST  396
            GL + LRIL AAGA E+GT    G+ +K KG   ++++ F++        S+R+   L T
Sbjct  541  GLRQTLRILIAAGAVEVGTYRNDGQRIKCKGVEEEDLEVFLDTVVAAAGPSARE--ELWT  598

Query  395  LIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYC  216
               SAHQMGSCRMG       V+  GE+WE +GLF+ D S+ PTA+GVNPM+T+++ AYC
Sbjct  599  TYSSAHQMGSCRMGATEEEGGVDENGESWEAKGLFVCDGSLLPTAVGVNPMITIESTAYC  658

Query  215  TAQSVLKFLKTHNHM  171
             ++ + + L+   ++
Sbjct  659  ISKRIAQSLEKQKYI  673



>ref|XP_006296686.1| hypothetical protein CARUB_v10013046mg [Capsella rubella]
 gb|EOA29584.1| hypothetical protein CARUB_v10013046mg [Capsella rubella]
Length=744

 Score =   112 bits (279),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 80/129 (62%), Gaps = 4/129 (3%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVE----KESSRDLGNLSTLI  390
            GL + LRIL AAGAEE+GT    G+ L  KG   D I EF++    +E  + +     + 
Sbjct  612  GLRQSLRILIAAGAEEVGTHRSDGQRLICKGVDEDSIQEFLDAVSTEEGPKGMTEKWNVY  671

Query  389  GSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTA  210
             SAHQMGSCR+G + +   ++  GE+WE E LF+ D+S  P+A+GVNPM+TV + AYC +
Sbjct  672  SSAHQMGSCRIGENEKEGAIDLNGESWEAEKLFVCDASALPSAVGVNPMITVMSTAYCIS  731

Query  209  QSVLKFLKT  183
              + K + T
Sbjct  732  TRIAKSMTT  740



>gb|KDO60414.1| hypothetical protein CISIN_1g004496mg [Citrus sinensis]
Length=748

 Score =   112 bits (279),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 82/130 (63%), Gaps = 8/130 (6%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEK------ESSRDLGNLST  396
            GL + LRIL AAGAEE+GT    G  ++ KG   ++++EF+         +SR  G   +
Sbjct  613  GLRQALRILIAAGAEEVGTYRSDGHRIRCKGIKEEDLEEFIGSIEVVGGMASR--GEHWS  670

Query  395  LIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYC  216
            +  SAHQMGSCRMG       V+  GE+WE EGLF+ D SV P+A+G+NPM+T+++ +YC
Sbjct  671  VYFSAHQMGSCRMGATEEDGAVDENGESWEAEGLFVCDGSVLPSAIGINPMITIESTSYC  730

Query  215  TAQSVLKFLK  186
             ++ +   LK
Sbjct  731  ISKKIADSLK  740



>ref|XP_011462285.1| PREDICTED: long-chain-alcohol oxidase FAO1 isoform X2 [Fragaria 
vesca subsp. vesca]
 ref|XP_011462286.1| PREDICTED: long-chain-alcohol oxidase FAO1 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=697

 Score =   112 bits (279),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 84/130 (65%), Gaps = 4/130 (3%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEK----ESSRDLGNLSTLI  390
            G+ + LRIL AAGA E+GT    G  LK +G  ++ ++EF++K    E  + L    T  
Sbjct  557  GMRQALRILIAAGAVEVGTHRSDGLRLKCEGIDKEGLEEFLDKVSAEEGPQSLVEKWTPY  616

Query  389  GSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTA  210
             SAHQMGSCRMG++ +   V+  GE+WE EGLF+ D SV P+A+GVNPM+T+++ AY  +
Sbjct  617  SSAHQMGSCRMGINEKEGAVDQNGESWEAEGLFVCDGSVLPSAVGVNPMITIESTAYYLS  676

Query  209  QSVLKFLKTH  180
            + + + L+  
Sbjct  677  KRLAESLRNQ  686



>ref|XP_004296386.1| PREDICTED: long-chain-alcohol oxidase FAO1 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=765

 Score =   112 bits (279),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 56/131 (43%), Positives = 84/131 (64%), Gaps = 4/131 (3%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEK----ESSRDLGNLSTLI  390
            G+ + LRIL AAGA E+GT    G  LK +G  ++ ++EF++K    E  + L    T  
Sbjct  625  GMRQALRILIAAGAVEVGTHRSDGLRLKCEGIDKEGLEEFLDKVSAEEGPQSLVEKWTPY  684

Query  389  GSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTA  210
             SAHQMGSCRMG++ +   V+  GE+WE EGLF+ D SV P+A+GVNPM+T+++ AY  +
Sbjct  685  SSAHQMGSCRMGINEKEGAVDQNGESWEAEGLFVCDGSVLPSAVGVNPMITIESTAYYLS  744

Query  209  QSVLKFLKTHN  177
            + + + L+   
Sbjct  745  KRLAESLRNQK  755



>ref|XP_002869492.1| hypothetical protein ARALYDRAFT_491906 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45751.1| hypothetical protein ARALYDRAFT_491906 [Arabidopsis lyrata subsp. 
lyrata]
Length=748

 Score =   112 bits (279),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 83/129 (64%), Gaps = 4/129 (3%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESS----RDLGNLSTLI  390
            GL + LR+  AAGA E+GT    G+ +K +G +++ ++EF+++  +       G   T  
Sbjct  616  GLRQALRVSVAAGAVEVGTYRSDGQRMKCEGITKEAMEEFLDEVDAVGGVSTKGEYWTTY  675

Query  389  GSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTA  210
             SAHQMGSCRMG       ++ +GE+WE EGLF+ D SV P+A+GVNPM+T+Q+ AYC +
Sbjct  676  FSAHQMGSCRMGATAEEGALDEIGESWEAEGLFVCDGSVLPSAVGVNPMITIQSTAYCIS  735

Query  209  QSVLKFLKT  183
              ++  L++
Sbjct  736  SKIVDSLQS  744



>ref|XP_009102621.1| PREDICTED: long-chain-alcohol oxidase FAO3 [Brassica rapa]
Length=745

 Score =   111 bits (278),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 81/129 (63%), Gaps = 4/129 (3%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVE----KESSRDLGNLSTLI  390
            GL + LRIL AAGAEE+GT    G+ L  KG     I+EF++    +E  + +     + 
Sbjct  612  GLRQSLRILIAAGAEEVGTHRSDGQKLVCKGVDEKSIEEFLDSVSAEEGPKAMTEKWGVY  671

Query  389  GSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTA  210
             SAHQMGSCR+G D +   ++  GE+WE E LF+ D SV P+A+GVNPM+T+ + AYC +
Sbjct  672  SSAHQMGSCRIGEDEKEGALDLNGESWEAERLFVCDGSVLPSAVGVNPMITIMSTAYCIS  731

Query  209  QSVLKFLKT  183
              ++K + T
Sbjct  732  TRIVKSMTT  740



>gb|KHG12235.1| Long-chain-alcohol oxidase FAO1 [Gossypium arboreum]
Length=748

 Score =   111 bits (278),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 56/123 (46%), Positives = 83/123 (67%), Gaps = 4/123 (3%)
 Frame = -1

Query  557  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDL----GNLSTLI  390
            GL + LR+L AAGA E+GT    G+ LK KG S++E++EF++   S       G+   + 
Sbjct  619  GLRRSLRVLVAAGAVEVGTHRSDGQKLKCKGVSKEELEEFLDTVFSVGGPLFGGDKWMVH  678

Query  389  GSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTA  210
             +AHQMGSC+MG + +   V+  GE+WE EGL++ D+SV PTA+GVNPM+TV + AYC +
Sbjct  679  TTAHQMGSCKMGRNEKDGGVDENGESWEAEGLYVCDASVLPTAIGVNPMITVMSTAYCLS  738

Query  209  QSV  201
            + +
Sbjct  739  KRI  741



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 617525281800