BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF029E22

Length=716
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ACU87558.1|  PIP protein                                             247   2e-77   Gossypium hirsutum [American cotton]
ref|XP_009803290.1|  PREDICTED: probable aquaporin PIP2-4               242   2e-77   Nicotiana sylvestris
ref|XP_009624885.1|  PREDICTED: aquaporin PIP2-1-like                   247   2e-77   Nicotiana tomentosiformis
gb|KDP29110.1|  hypothetical protein JCGZ_16499                         245   1e-76   Jatropha curcas
ref|XP_008463943.1|  PREDICTED: aquaporin PIP2-7                        244   1e-76   Cucumis melo [Oriental melon]
ref|NP_001274381.1|  aquaporin PIP2-7-like                              244   1e-76   Cucumis sativus [cucumbers]
ref|XP_011094668.1|  PREDICTED: aquaporin PIP2-4-like                   244   1e-76   Sesamum indicum [beniseed]
gb|KJB26182.1|  hypothetical protein B456_004G229000                    244   2e-76   Gossypium raimondii
tpg|DAA64674.1|  TPA: aquaporin PIP2 2                                  244   2e-76   Nicotiana tabacum [American tobacco]
gb|AAO39007.1|  plasma intrinsic protein 2,1                            244   3e-76   Juglans regia
gb|AEQ20672.1|  PIP2;1                                                  244   3e-76   Karelinia caspia
ref|XP_009619670.1|  PREDICTED: aquaporin PIP2-1-like                   243   3e-76   Nicotiana tomentosiformis
gb|AAO39008.1|  plasma intrinsic protein 2,2                            244   4e-76   Juglans regia
gb|KDP44053.1|  hypothetical protein JCGZ_05520                         243   6e-76   Jatropha curcas
tpg|DAA64673.1|  TPA: aquaporin PIP2 1                                  243   7e-76   Nicotiana tabacum [American tobacco]
gb|AEQ29857.1|  aquaporin PIP2                                          243   7e-76   Malus prunifolia
ref|XP_008363507.1|  PREDICTED: aquaporin PIP2-2                        243   7e-76   Malus domestica [apple tree]
ref|XP_010043748.1|  PREDICTED: probable aquaporin PIP2-4               243   7e-76   Eucalyptus grandis [rose gum]
ref|XP_009760326.1|  PREDICTED: aquaporin PIP2-1-like                   243   8e-76   Nicotiana sylvestris
ref|XP_010046653.1|  PREDICTED: aquaporin PIP2-1-like                   243   9e-76   Eucalyptus grandis [rose gum]
ref|XP_009367074.1|  PREDICTED: aquaporin PIP2-2                        243   9e-76   Pyrus x bretschneideri [bai li]
dbj|BAG68661.1|  plasma membrane intrinsic protein                      242   1e-75   Tulipa gesneriana
ref|XP_010325988.1|  PREDICTED: aquaporin PIP2-1-like                   241   2e-75   
ref|XP_007205689.1|  hypothetical protein PRUPE_ppa009689mg             241   2e-75   Prunus persica
ref|NP_001289823.1|  aquaporin PIP2-1-like                              241   2e-75   Solanum lycopersicum
ref|XP_009792249.1|  PREDICTED: aquaporin PIP2-1-like                   241   3e-75   Nicotiana sylvestris
ref|XP_002519539.1|  Aquaporin PIP2.2, putative                         241   3e-75   Ricinus communis
ref|XP_009398603.1|  PREDICTED: probable aquaporin PIP2-2               241   5e-75   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009614931.1|  PREDICTED: aquaporin PIP2-1-like                   241   5e-75   Nicotiana tomentosiformis
gb|ABO69705.2|  aquaporin PIP2                                          240   6e-75   Prunus humilis
ref|NP_001280185.1|  aquaporin PIP2-2                                   240   6e-75   Prunus mume [ume]
gb|KCW88815.1|  hypothetical protein EUGRSUZ_A01153                     243   7e-75   Eucalyptus grandis [rose gum]
emb|CDP04351.1|  unnamed protein product                                237   8e-75   Coffea canephora [robusta coffee]
gb|EYU34445.1|  hypothetical protein MIMGU_mgv1a011350mg                240   9e-75   Erythranthe guttata [common monkey flower]
gb|EMT32724.1|  Aquaporin PIP2-1                                        235   9e-75   
gb|ABB88840.1|  aquaporin                                               240   1e-74   Stevia rebaudiana
gb|AEY75244.1|  plasma membrane intrinsic protein                       239   1e-74   Malus hupehensis
ref|XP_008449253.1|  PREDICTED: aquaporin PIP2-2-like isoform X3        240   1e-74   Cucumis melo [Oriental melon]
gb|AAW80918.1|  putative plasma membrane intrinsic protein              239   1e-74   Astragalus membranaceus
ref|XP_006367014.1|  PREDICTED: aquaporin PIP2-1-like                   239   2e-74   
ref|XP_004304427.1|  PREDICTED: aquaporin PIP2-1-like                   239   2e-74   Fragaria vesca subsp. vesca
gb|ACX37450.1|  plasma membrane intrinsic protein                       239   2e-74   Hevea brasiliensis [jebe]
ref|XP_002530280.1|  Aquaporin PIP2.1, putative                         239   2e-74   Ricinus communis
gb|EAY86778.1|  hypothetical protein OsI_08158                          239   2e-74   Oryza sativa Indica Group [Indian rice]
ref|XP_007027328.1|  Plasma membrane intrinsic protein 2                239   3e-74   Theobroma cacao [chocolate]
ref|XP_006367008.1|  PREDICTED: aquaporin PIP2-1-like isoform X2        239   3e-74   Solanum tuberosum [potatoes]
gb|AGC24024.1|  plasma membrane intrinsic protein 1                     239   3e-74   Lilium hybrid cultivar
ref|XP_006367007.1|  PREDICTED: aquaporin PIP2-1-like isoform X1        239   3e-74   Solanum tuberosum [potatoes]
ref|XP_007016740.1|  Plasma membrane intrinsic protein 2,4              239   3e-74   
gb|AAF65845.1|AF255795_1  aquaporin 1                                   238   5e-74   Allium cepa
gb|EAZ23886.1|  hypothetical protein OsJ_07605                          238   5e-74   Oryza sativa Japonica Group [Japonica rice]
dbj|BAB40141.1|  plasma membrane intrinsic protein 2-1                  238   6e-74   Pyrus communis
ref|XP_009335091.1|  PREDICTED: probable aquaporin PIP2-2               238   6e-74   Pyrus x bretschneideri [bai li]
ref|NP_001047491.1|  Os02g0629200                                       238   6e-74   
ref|XP_006381455.1|  hypothetical protein POPTR_0006s13000g             238   7e-74   Populus trichocarpa [western balsam poplar]
ref|XP_008385311.1|  PREDICTED: probable aquaporin PIP2-2               238   8e-74   
ref|XP_007151872.1|  hypothetical protein PHAVU_004G082700g             238   8e-74   Phaseolus vulgaris [French bean]
gb|KJB56128.1|  hypothetical protein B456_009G107200                    238   9e-74   Gossypium raimondii
gb|KHG00060.1|  putative aquaporin PIP2-2                               238   9e-74   Gossypium arboreum [tree cotton]
gb|KJB11823.1|  hypothetical protein B456_002G2484001                   232   9e-74   Gossypium raimondii
gb|KJB11822.1|  hypothetical protein B456_002G2484001                   234   1e-73   Gossypium raimondii
ref|XP_011048549.1|  PREDICTED: aquaporin PIP2-1-like                   237   1e-73   Populus euphratica
ref|XP_008791536.1|  PREDICTED: aquaporin PIP2-4-like                   237   1e-73   Phoenix dactylifera
ref|XP_011048552.1|  PREDICTED: aquaporin PIP2-2-like                   237   1e-73   Populus euphratica
gb|KHG29841.1|  putative aquaporin PIP2-2                               237   1e-73   Gossypium arboreum [tree cotton]
emb|CBI16313.3|  unnamed protein product                                234   1e-73   Vitis vinifera
ref|XP_007207344.1|  hypothetical protein PRUPE_ppa009630mg             237   1e-73   Prunus persica
ref|XP_010456647.1|  PREDICTED: probable aquaporin PIP2-4               237   1e-73   Camelina sativa [gold-of-pleasure]
emb|CAH60724.1|  putative plasma membrane intrinsic protein             237   1e-73   Populus tremula x Populus tremuloides
ref|XP_002461930.1|  hypothetical protein SORBIDRAFT_02g010760          237   2e-73   Sorghum bicolor [broomcorn]
ref|XP_004143245.1|  PREDICTED: aquaporin PIP2-2-like                   236   2e-73   
gb|AHB33479.1|  plasma intrinsic protein 2-3                            236   2e-73   Cucumis sativus [cucumbers]
ref|XP_008243934.1|  PREDICTED: probable aquaporin PIP2-5               236   2e-73   Prunus mume [ume]
gb|ACU00103.1|  plasma membrane intrinsic protein PIP2.1                236   2e-73   Populus trichocarpa x Populus deltoides
emb|CDX10333.1|  aquaporin                                              236   2e-73   Coffea arabica [arabica coffee]
ref|XP_004156296.1|  PREDICTED: aquaporin PIP2-2-like                   236   2e-73   
ref|XP_003625627.1|  Aquaporin PIP2-1                                   236   3e-73   Medicago truncatula
ref|XP_007151871.1|  hypothetical protein PHAVU_004G082600g             236   3e-73   Phaseolus vulgaris [French bean]
ref|XP_010098191.1|  Aquaporin PIP2-7                                   236   3e-73   Morus notabilis
gb|KJB20285.1|  hypothetical protein B456_003G141600                    237   3e-73   Gossypium raimondii
emb|CBI31462.3|  unnamed protein product                                233   3e-73   Vitis vinifera
gb|AAL49751.1|AF452013_1  aquaporin-like protein                        235   3e-73   Petunia x hybrida [garden petunia]
ref|XP_004304428.1|  PREDICTED: aquaporin PIP2-1-like                   236   3e-73   Fragaria vesca subsp. vesca
ref|XP_006424576.1|  hypothetical protein CICLE_v10028975mg             236   3e-73   Citrus clementina [clementine]
gb|AAW55294.1|  aquaporin 2                                             233   4e-73   Aegiceras corniculatum
gb|ACU24483.1|  unknown                                                 236   4e-73   Glycine max [soybeans]
gb|ADJ57599.1|  plasma membrane intrinsic protein PIP2;1                236   4e-73   Fragaria chiloensis
ref|XP_004291577.1|  PREDICTED: aquaporin PIP2-2                        235   5e-73   Fragaria vesca subsp. vesca
ref|XP_009345382.1|  PREDICTED: probable aquaporin PIP2-5               236   5e-73   Pyrus x bretschneideri [bai li]
gb|AFQ23186.1|  aquaporin PIP2;1                                        236   5e-73   Eustoma exaltatum subsp. russellianum [bluebells]
ref|XP_003556232.1|  PREDICTED: aquaporin PIP2-1-like                   235   5e-73   Glycine max [soybeans]
gb|ACZ06859.1|  plasma membrane intrinsic protein                       235   6e-73   Glycine soja [wild soybean]
dbj|BAG06231.1|  plasma membrane intrinsic protein                      236   6e-73   Hordeum vulgare [barley]
gb|AFK33316.1|  unknown                                                 235   6e-73   Medicago truncatula
gb|ABK60195.2|  PIP2 protein                                            235   6e-73   Gossypium hirsutum [American cotton]
gb|KHG08488.1|  putative aquaporin PIP2-2                               235   7e-73   Gossypium arboreum [tree cotton]
gb|KJB21561.1|  hypothetical protein B456_004G001400                    235   7e-73   Gossypium raimondii
ref|XP_007143702.1|  hypothetical protein PHAVU_007G094600g             235   7e-73   Phaseolus vulgaris [French bean]
ref|XP_011044357.1|  PREDICTED: probable aquaporin PIP2-4               235   8e-73   Populus euphratica
ref|XP_002313510.1|  hypothetical protein POPTR_0009s01940g             235   8e-73   Populus trichocarpa [western balsam poplar]
ref|XP_010042277.1|  PREDICTED: aquaporin PIP2-1-like                   234   8e-73   Eucalyptus grandis [rose gum]
ref|XP_006428786.1|  hypothetical protein CICLE_v10012379mg             235   9e-73   Citrus clementina [clementine]
ref|XP_006381453.1|  hypothetical protein POPTR_0006s12980g             235   9e-73   Populus trichocarpa [western balsam poplar]
ref|XP_011089904.1|  PREDICTED: LOW QUALITY PROTEIN: aquaporin PI...    234   9e-73   
ref|XP_010043747.1|  PREDICTED: probable aquaporin PIP2-5               235   9e-73   Eucalyptus grandis [rose gum]
gb|ABC70536.1|  aquaporin protein                                       230   9e-73   Vitis pseudoreticulata
ref|XP_008785285.1|  PREDICTED: aquaporin PIP2-4                        235   9e-73   Phoenix dactylifera
ref|XP_010443868.1|  PREDICTED: probable aquaporin PIP2-4               235   9e-73   Camelina sativa [gold-of-pleasure]
gb|AIA83106.1|  putative aquaporin PIP2                                 235   1e-72   Citrus trifoliata [hardy orange]
ref|XP_009413714.1|  PREDICTED: aquaporin PIP2-4-like isoform X1        234   1e-72   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010521765.1|  PREDICTED: aquaporin PIP2-7-like                   234   1e-72   Tarenaya hassleriana [spider flower]
ref|NP_001105024.1|  aquaporin PIP2-1                                   234   1e-72   Zea mays [maize]
ref|XP_008791535.1|  PREDICTED: aquaporin PIP2-4-like                   234   1e-72   Phoenix dactylifera
ref|XP_004956113.1|  PREDICTED: aquaporin PIP2-1-like                   234   1e-72   Setaria italica
ref|XP_003563177.1|  PREDICTED: probable aquaporin PIP2-1               234   1e-72   Brachypodium distachyon [annual false brome]
ref|XP_006648854.1|  PREDICTED: probable aquaporin PIP2-2-like          234   1e-72   
gb|ACG32567.1|  aquaporin PIP2.1                                        234   1e-72   Zea mays [maize]
gb|AIG92831.1|  aquaporin PIP2                                          234   1e-72   Chrysanthemum x morifolium [florist's chrysanthemum]
gb|ABU94631.1|  putative aquaporin PIP2;3                               234   1e-72   Phaseolus vulgaris [French bean]
gb|KHG30776.1|  Aquaporin PIP2-2 -like protein                          234   1e-72   Gossypium arboreum [tree cotton]
gb|AIA83104.1|  putative aquaporin PIP2                                 234   2e-72   Citrus sinensis x Citrus trifoliata [Carrizo citrange]
ref|NP_001274308.1|  aquaporin PIP2-1-like                              234   2e-72   Solanum lycopersicum
ref|XP_006481455.1|  PREDICTED: aquaporin PIP2-2-like                   234   2e-72   Citrus sinensis [apfelsine]
ref|XP_009342858.1|  PREDICTED: probable aquaporin PIP2-5 isoform X1    234   2e-72   Pyrus x bretschneideri [bai li]
gb|ABB13430.2|  plasma membrane intrinsic protein                       234   2e-72   Olea europaea
ref|XP_006339071.1|  PREDICTED: aquaporin PIP2-1-like                   234   2e-72   Solanum tuberosum [potatoes]
ref|XP_009342865.1|  PREDICTED: probable aquaporin PIP2-5 isoform X2    234   2e-72   
ref|XP_008387595.1|  PREDICTED: probable aquaporin PIP2-5               234   2e-72   Malus domestica [apple tree]
gb|AAV80229.1|  aquaporin 2                                             234   2e-72   Aegiceras corniculatum
ref|XP_011031744.1|  PREDICTED: probable aquaporin PIP2-5               234   2e-72   Populus euphratica
gb|AAB18227.1|  MipC                                                    234   2e-72   Mesembryanthemum crystallinum
ref|XP_010483715.1|  PREDICTED: probable aquaporin PIP2-4               234   2e-72   Camelina sativa [gold-of-pleasure]
ref|XP_010553324.1|  PREDICTED: aquaporin PIP2-2                        231   2e-72   Tarenaya hassleriana [spider flower]
dbj|BAB40143.1|  plasma membrane intrinsic protein 2-2                  234   2e-72   Pyrus communis
gb|ACG39551.1|  aquaporin PIP2.1                                        234   2e-72   Zea mays [maize]
gb|EYU36189.1|  hypothetical protein MIMGU_mgv1a011437mg                234   3e-72   Erythranthe guttata [common monkey flower]
ref|XP_009387242.1|  PREDICTED: aquaporin PIP2-5                        234   3e-72   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACG33001.1|  aquaporin PIP2.2                                        234   3e-72   Zea mays [maize]
gb|AEY75242.1|  plasma membrane intrinsic protein                       234   3e-72   Malus hupehensis
gb|ABH09326.1|  putative aquaporin                                      234   3e-72   Vitis vinifera
dbj|BAA22098.1|  unnamed protein product                                230   3e-72   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008365039.1|  PREDICTED: probable aquaporin PIP2-5               234   3e-72   
ref|XP_007218772.1|  hypothetical protein PRUPE_ppa009540mg             234   3e-72   Prunus persica
ref|XP_004304426.1|  PREDICTED: aquaporin PIP2-1-like                   233   3e-72   Fragaria vesca subsp. vesca
ref|XP_011015478.1|  PREDICTED: aquaporin PIP2-2-like                   233   3e-72   Populus euphratica
ref|NP_001105026.1|  aquaporin PIP2-4                                   234   3e-72   Zea mays [maize]
ref|XP_009803627.1|  PREDICTED: aquaporin PIP2-7-like                   233   3e-72   Nicotiana sylvestris
ref|XP_010920405.1|  PREDICTED: aquaporin PIP2-4 isoform X1             233   3e-72   Elaeis guineensis
ref|XP_002532756.1|  Aquaporin PIP2.1, putative                         233   3e-72   Ricinus communis
ref|NP_001105025.1|  aquaporin PIP2-3                                   233   3e-72   Zea mays [maize]
ref|XP_010684101.1|  PREDICTED: aquaporin PIP2-1-like                   233   4e-72   Beta vulgaris subsp. vulgaris [field beet]
gb|KHN38765.1|  Aquaporin PIP2-7                                        233   4e-72   Glycine soja [wild soybean]
gb|KDP44363.1|  hypothetical protein JCGZ_20043                         233   4e-72   Jatropha curcas
gb|KJB11821.1|  hypothetical protein B456_002G2484001                   233   4e-72   Gossypium raimondii
ref|XP_003538174.1|  PREDICTED: aquaporin PIP2-7                        233   4e-72   Glycine max [soybeans]
ref|XP_007132257.1|  hypothetical protein PHAVU_011G079300g             233   4e-72   Phaseolus vulgaris [French bean]
ref|NP_001268056.1|  aquaporin PIP2                                     233   5e-72   Vitis vinifera
ref|XP_006481459.1|  PREDICTED: aquaporin PIP2-2-like                   233   5e-72   Citrus sinensis [apfelsine]
gb|AAO86707.1|  aquaporin                                               233   5e-72   Zea mays [maize]
ref|XP_010037961.1|  PREDICTED: probable aquaporin PIP2-2               233   6e-72   Eucalyptus grandis [rose gum]
ref|XP_002452483.1|  hypothetical protein SORBIDRAFT_04g026650          233   6e-72   Sorghum bicolor [broomcorn]
gb|ADJ67992.1|  aquaporin                                               233   6e-72   Fragaria x ananassa
ref|XP_007150204.1|  hypothetical protein PHAVU_005G135300g             233   6e-72   Phaseolus vulgaris [French bean]
ref|XP_003536353.1|  PREDICTED: aquaporin PIP2-1-like isoform 1         233   7e-72   
ref|XP_010107541.1|  Aquaporin PIP2-2                                   233   7e-72   Morus notabilis
ref|NP_001274386.1|  aquaporin PIP2-1-like                              233   7e-72   Cucumis sativus [cucumbers]
ref|XP_010264685.1|  PREDICTED: aquaporin PIP2-1-like                   233   8e-72   Nelumbo nucifera [Indian lotus]
emb|CAN75442.1|  hypothetical protein VITISV_019657                     232   9e-72   Vitis vinifera
gb|KHG10662.1|  Aquaporin PIP2-1 -like protein                          232   9e-72   Gossypium arboreum [tree cotton]
ref|NP_001267922.1|  aquaporin-like                                     232   9e-72   Vitis vinifera
gb|AAV69744.1|  aquaporin                                               232   9e-72   Vitis vinifera
gb|AEO13898.1|  aquaporin 7                                             232   9e-72   Triticum aestivum [Canadian hard winter wheat]
emb|CDQ12456.1|  plasma membrane intrinsic protein 2;1                  229   1e-71   Vicia faba var. minor [tick bean]
ref|XP_006400824.1|  hypothetical protein EUTSA_v10014299mg             232   1e-71   Eutrema salsugineum [saltwater cress]
ref|XP_010920407.1|  PREDICTED: probable aquaporin PIP2-2               232   1e-71   Elaeis guineensis
gb|AAC17529.1|  aquaporin 2                                             232   1e-71   Samanea saman [cow-tamarind]
dbj|BAD90699.1|  plasma membrane intrinsic protein 2;3                  232   1e-71   Mimosa pudica [sensitive-plant]
gb|KHN05685.1|  Aquaporin PIP2-7                                        232   1e-71   Glycine soja [wild soybean]
gb|AFH36337.1|  aquaporin PIP2;2                                        232   1e-71   Quercus petraea [durmast oak]
gb|AFB83068.1|  plasma intrinsic protein PIP2.2                         232   1e-71   Helianthemum almeriense
ref|XP_003591907.1|  Aquaporin PIP                                      230   1e-71   
gb|AHK05706.1|  plasma membrane intrinsic protein PIP2;3                232   1e-71   Hevea brasiliensis [jebe]
ref|XP_003518297.1|  PREDICTED: aquaporin PIP2-2-like                   232   1e-71   Glycine max [soybeans]
gb|AAB36949.1|  plasma membrane intrinsic protein PIP3                  232   1e-71   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009345759.1|  PREDICTED: probable aquaporin PIP2-5               232   1e-71   Pyrus x bretschneideri [bai li]
emb|CDP06739.1|  unnamed protein product                                232   1e-71   Coffea canephora [robusta coffee]
gb|AAB65787.1|  plasma membrane intrinsic protein                       231   1e-71   Arabidopsis thaliana [mouse-ear cress]
ref|NP_195236.1|  plasma membrane intrinsic protein 3                   231   1e-71   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002869108.1|  hypothetical protein ARALYDRAFT_491143             231   1e-71   
ref|NP_001240223.1|  prolactin-inducible protein                        232   1e-71   Glycine max [soybeans]
gb|AHA84284.1|  prolactin-inducible protein                             232   1e-71   Phaseolus vulgaris [French bean]
ref|XP_006436425.1|  hypothetical protein CICLE_v10032302mg             232   2e-71   Citrus clementina [clementine]
ref|XP_008449252.1|  PREDICTED: aquaporin PIP2-1-like isoform X2        232   2e-71   Cucumis melo [Oriental melon]
gb|AAF71816.1|AF141642_1  putative aquaporin PIP2-1                     231   2e-71   Vitis cinerea var. helleri x Vitis rupestris
gb|ACU20229.1|  unknown                                                 231   2e-71   Glycine max [soybeans]
emb|CDY70391.1|  BnaC03g72010D                                          227   2e-71   Brassica napus [oilseed rape]
gb|KDO44716.1|  hypothetical protein CISIN_1g0196812mg                  233   2e-71   Citrus sinensis [apfelsine]
gb|KHN32779.1|  Aquaporin PIP2-2                                        230   2e-71   Glycine soja [wild soybean]
gb|ABU94630.1|  putative aquaporin PIP2;2                               231   2e-71   Phaseolus vulgaris [French bean]
gb|AHG32323.1|  PIP2-2                                                  231   2e-71   Pisum sativum [garden pea]
ref|XP_008449251.1|  PREDICTED: aquaporin PIP2-1-like isoform X1        231   2e-71   
gb|AIK66515.1|  putative aquaporin                                      231   3e-71   Vitis vinifera
ref|XP_009600501.1|  PREDICTED: aquaporin PIP2-7-like                   231   3e-71   Nicotiana tomentosiformis
gb|KHN00691.1|  Aquaporin PIP2-2                                        231   3e-71   Glycine soja [wild soybean]
gb|ACR56613.1|  plasma intrinsic protein 2;3                            231   3e-71   Juglans regia
ref|NP_001240039.1|  uncharacterized protein LOC100782155               231   3e-71   Glycine max [soybeans]
ref|NP_001105639.1|  aquaporin PIP2-7                                   231   3e-71   
gb|KDO68093.1|  hypothetical protein CISIN_1g023370mg                   228   3e-71   Citrus sinensis [apfelsine]
ref|XP_010253676.1|  PREDICTED: aquaporin PIP2-4-like                   231   3e-71   Nelumbo nucifera [Indian lotus]
ref|XP_006280883.1|  hypothetical protein CARUB_v10026881mg             231   4e-71   
gb|AAG02208.1|AF290201_1  plasma membrane intrinsic protein PIP2        231   4e-71   Solanum chacoense
emb|CBI37861.3|  unnamed protein product                                228   4e-71   Vitis vinifera
gb|ADK25057.1|  plasma membrane intrinsic protein                       231   4e-71   Glycine max [soybeans]
dbj|BAF32141.1|  putative aquaporin                                     230   5e-71   Taxodium distichum [bald cypress]
dbj|BAA23744.1|  HvPIP2;1                                               231   5e-71   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001105638.1|  aquaporin PIP2-2                                   231   5e-71   Zea mays [maize]
ref|XP_007009830.1|  Plasma membrane intrinsic protein 2A               230   5e-71   
gb|ACF79873.1|  unknown                                                 231   5e-71   Zea mays [maize]
ref|XP_002311092.1|  plasma membrane intrinsic protein 1-1              230   5e-71   Populus trichocarpa [western balsam poplar]
dbj|BAE02729.1|  PIP aquaporin                                          230   5e-71   Hordeum vulgare [barley]
gb|KFK30134.1|  hypothetical protein AALP_AA7G221400                    230   5e-71   Arabis alpina [alpine rockcress]
ref|XP_008233329.1|  PREDICTED: probable aquaporin PIP2-5               230   5e-71   Prunus mume [ume]
ref|NP_001289999.1|  aquaporin PIP2-1                                   230   7e-71   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006846771.1|  hypothetical protein AMTR_s00148p00023270          230   7e-71   Amborella trichopoda
dbj|BAF32042.1|  putative aquaporin                                     229   7e-71   Cryptomeria japonica
gb|KJB15837.1|  hypothetical protein B456_002G198900                    228   7e-71   Gossypium raimondii
ref|XP_010529747.1|  PREDICTED: aquaporin PIP2-2-like                   230   8e-71   Tarenaya hassleriana [spider flower]
ref|XP_004307390.1|  PREDICTED: aquaporin PIP2-1                        230   8e-71   Fragaria vesca subsp. vesca
ref|XP_003606383.1|  Aquaporin PIP2-7                                   230   9e-71   Medicago truncatula
ref|XP_010032196.1|  PREDICTED: aquaporin PIP2-1                        229   1e-70   Eucalyptus grandis [rose gum]
ref|XP_006360898.1|  PREDICTED: aquaporin PIP2-7-like                   229   1e-70   
gb|AFK47442.1|  unknown                                                 229   1e-70   Medicago truncatula
ref|XP_011041003.1|  PREDICTED: probable aquaporin PIP2-5               229   1e-70   Populus euphratica
ref|XP_010920097.1|  PREDICTED: probable aquaporin PIP2-6               229   1e-70   Elaeis guineensis
dbj|BAD90698.1|  plasma membrane intrinsic protein 2;2                  229   1e-70   Mimosa pudica [sensitive-plant]
ref|XP_009131906.1|  PREDICTED: probable aquaporin PIP2-4               229   1e-70   Brassica rapa
ref|XP_009782764.1|  PREDICTED: aquaporin PIP2-7                        229   1e-70   Nicotiana sylvestris
gb|AAB67868.1|  plasma membrane major intrinsic protein 1               229   1e-70   Beta vulgaris [beet]
emb|CDY31523.1|  BnaA10g13480D                                          228   1e-70   Brassica napus [oilseed rape]
emb|CDX88767.1|  BnaA03g08820D                                          228   1e-70   
ref|NP_001237286.1|  PIP2,2                                             229   1e-70   
ref|XP_003591905.1|  Aquaporin PIP                                      229   1e-70   
gb|AAD31846.1|AF133530_1  water channel protein MipH                    229   2e-70   Mesembryanthemum crystallinum
ref|XP_003548071.1|  PREDICTED: aquaporin PIP2-2-like                   229   2e-70   Glycine max [soybeans]
gb|KHN02341.1|  Putative aquaporin PIP2-1                               226   2e-70   Glycine soja [wild soybean]
gb|KFK36804.1|  hypothetical protein AALP_AA4G173500                    229   2e-70   Arabis alpina [alpine rockcress]
gb|AAL49752.1|AF452014_1  aquaporin-like protein                        229   2e-70   Petunia x hybrida [garden petunia]
gb|ACU21481.1|  unknown                                                 229   2e-70   Glycine max [soybeans]
gb|EYU42155.1|  hypothetical protein MIMGU_mgv1a011301mg                229   2e-70   Erythranthe guttata [common monkey flower]
emb|CAB61749.1|  putative water channel protein                         227   2e-70   Cicer arietinum [garbanzo]
ref|XP_006412152.1|  hypothetical protein EUTSA_v10025940mg             228   2e-70   Eutrema salsugineum [saltwater cress]
ref|XP_003597235.1|  Aquaporin PIP2-7                                   229   2e-70   Medicago truncatula
ref|XP_009615212.1|  PREDICTED: aquaporin PIP2-7                        229   2e-70   Nicotiana tomentosiformis
gb|EAZ39662.1|  hypothetical protein OsJ_24090                          229   3e-70   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003575410.1|  PREDICTED: aquaporin PIP2-4                        229   3e-70   Brachypodium distachyon [annual false brome]
ref|XP_004953172.1|  PREDICTED: aquaporin PIP2-4-like                   229   3e-70   Setaria italica
gb|AAL32127.1|  aquaporin                                               228   3e-70   Medicago truncatula
ref|NP_001059545.1|  Os07g0448800                                       228   3e-70   
emb|CAC82712.1|  major intrinsic protein 1                              228   3e-70   Populus tremula x Populus tremuloides
gb|ABX83874.1|  plasma membrane intrinsic protein                       228   3e-70   Rhododendron catawbiense [Catawba rosebay]
ref|XP_002866389.1|  hypothetical protein ARALYDRAFT_919301             228   3e-70   Arabidopsis lyrata subsp. lyrata
gb|KHG06004.1|  Aquaporin PIP2-2 -like protein                          228   3e-70   Gossypium arboreum [tree cotton]
dbj|BAA92260.1|  Plasma membrane aquaporin 2b                           228   4e-70   Raphanus sativus
emb|CDX72515.1|  BnaC07g45370D                                          227   4e-70   
dbj|BAD90700.1|  plasma membrane intrinsic protein 2;4                  228   5e-70   Mimosa pudica [sensitive-plant]
ref|XP_010432340.1|  PREDICTED: aquaporin PIP2-7                        228   5e-70   Camelina sativa [gold-of-pleasure]
emb|CDX91340.1|  BnaC04g08100D                                          228   5e-70   
ref|XP_009143524.1|  PREDICTED: aquaporin PIP2-2                        228   5e-70   Brassica rapa
ref|XP_008367680.1|  PREDICTED: probable aquaporin PIP2-5               228   5e-70   
emb|CDY46759.1|  BnaA03g17030D                                          228   5e-70   Brassica napus [oilseed rape]
ref|XP_002879655.1|  aquaporin                                          227   5e-70   
gb|AGD98714.1|  aquaporin protein 11                                    228   5e-70   Camellia sinensis [black tea]
gb|ACB42440.1|  aquaporin PIP2;3                                        228   5e-70   Gossypium hirsutum [American cotton]
gb|AAC16545.1|  aquaporin                                               228   5e-70   Oryza sativa [red rice]
ref|XP_009133125.1|  PREDICTED: aquaporin PIP2-2-like                   228   5e-70   Brassica rapa
gb|ACU87555.1|  PIP protein                                             228   5e-70   Gossypium hirsutum [American cotton]
ref|NP_181434.1|  plasma membrane intrinsic protein 2E                  228   5e-70   Arabidopsis thaliana [mouse-ear cress]
gb|ABM54183.1|  aquaporin                                               228   5e-70   Jatropha curcas
ref|XP_009133124.1|  PREDICTED: aquaporin PIP2-2-like                   228   6e-70   Brassica rapa
gb|AFK47400.1|  unknown                                                 228   6e-70   
gb|AAL33586.1|AF440272_1  aquaporin                                     228   6e-70   
ref|XP_004487111.1|  PREDICTED: aquaporin PIP2-7-like                   228   6e-70   
gb|ABC69040.1|  aquaporin PIP2-1                                        228   6e-70   
gb|AAY22203.1|  putative aquaporin                                      228   7e-70   
dbj|BAA92261.1|  Plasma membrane aquaporin 2c                           228   7e-70   
ref|NP_001288933.1|  probable aquaporin PIP2-6                          228   7e-70   
gb|KJB62459.1|  hypothetical protein B456_009G418100                    228   7e-70   
ref|XP_003540176.1|  PREDICTED: aquaporin PIP2-7                        228   7e-70   
ref|XP_006294722.1|  hypothetical protein CARUB_v10023768mg             228   7e-70   
gb|AAM63463.1|  aquaporin (plasma membrane intrinsic protein 2B)        227   8e-70   
tpg|DAA33864.1|  TPA: aquaporin PIP2;4                                  227   8e-70   
ref|XP_009593453.1|  PREDICTED: aquaporin PIP2-2-like                   227   8e-70   
ref|XP_010509080.1|  PREDICTED: probable aquaporin PIP2-6               228   8e-70   
ref|XP_010505564.1|  PREDICTED: probable aquaporin PIP2-6               228   8e-70   
gb|AAX92685.1|  probable aquaporin                                      224   9e-70   
tpg|DAA64687.1|  TPA: aquaporin PIP2 10                                 227   9e-70   
ref|XP_009120600.1|  PREDICTED: LOW QUALITY PROTEIN: probable aqu...    227   9e-70   
gb|KJB32662.1|  hypothetical protein B456_005G254400                    227   9e-70   
gb|ABH09327.1|  putative aquaporin                                      227   9e-70   
gb|ACB42441.1|  aquaporin PIP2;4                                        227   9e-70   
gb|KHG20375.1|  putative aquaporin PIP2-5 -like protein                 227   9e-70   
ref|XP_004505993.1|  PREDICTED: aquaporin PIP2-7-like                   227   1e-69   
gb|AGG39693.1|  aquaporin protein AQU15                                 227   1e-69   
gb|KJB73580.1|  hypothetical protein B456_011G239500                    227   1e-69   
ref|NP_001267957.1|  aquaporin PIP2;2                                   227   1e-69   
ref|XP_010548112.1|  PREDICTED: probable aquaporin PIP2-8               227   1e-69   
gb|ACM50914.1|  aquaporin                                               227   1e-69   
ref|XP_010031998.1|  PREDICTED: aquaporin PIP2-7-like                   227   1e-69   
ref|XP_009786071.1|  PREDICTED: aquaporin PIP2-7-like                   227   1e-69   
gb|AGD98707.1|  aquaporin protein 4                                     227   1e-69   
dbj|BAO18631.1|  plasmamembrane intrinsic protein 2;9                   227   1e-69   
dbj|BAK20223.1|  plasma membrane intrinsic protein 2                    227   1e-69   
ref|NP_181254.1|  aquaporin PIP2-2                                      227   1e-69   
emb|CDX69112.1|  BnaC01g03410D                                          227   1e-69   
ref|XP_006284279.1|  hypothetical protein CARUB_v10005443mg             227   1e-69   
ref|XP_011077012.1|  PREDICTED: probable aquaporin PIP2-5               227   1e-69   
emb|CDX71032.1|  BnaC03g11160D                                          226   1e-69   
gb|AAF71820.1|AF141900_1  putative aquaporin PIP2-2                     226   1e-69   
ref|NP_001233846.1|  putative PIP-type aquaporin                        227   1e-69   
emb|CDY14415.1|  BnaC03g21800D                                          227   1e-69   
ref|XP_009595123.1|  PREDICTED: aquaporin PIP2-4-like                   227   1e-69   
ref|XP_009615789.1|  PREDICTED: aquaporin PIP2-7-like                   227   1e-69   
gb|AAL49750.1|AF452012_1  aquaporin-like protein                        227   1e-69   
emb|CAA04654.1|  major intrinsic protein PIPC                           224   1e-69   
tpg|DAA64677.1|  TPA: aquaporin PIP2 4a                                 227   1e-69   
gb|ABK93567.1|  unknown                                                 227   1e-69   
gb|AAU43629.1|  putative aquaporin PIP-type                             223   2e-69   
gb|ABC01884.1|  plasma membrane intrinsic protein PIP2-like protein     226   2e-69   
emb|CAH60723.1|  putative plasma membrane intrinsic protein             226   2e-69   
ref|XP_006422584.1|  hypothetical protein CICLE_v10029003mg             226   2e-69   
pdb|1Z98|A  Chain A, Crystal Structure Of The Spinach Aquaporin S...    226   2e-69   
ref|XP_002316367.1|  putative aquaporin family protein                  226   2e-69   
pdb|2B5F|A  Chain A, Crystal Structure Of The Spinach Aquaporin S...    227   2e-69   
ref|XP_009344758.1|  PREDICTED: probable aquaporin PIP2-5               226   2e-69   
gb|KJB12139.1|  hypothetical protein B456_002G002500                    226   2e-69   
gb|ABK23750.1|  unknown                                                 226   2e-69   
ref|XP_009138343.1|  PREDICTED: aquaporin PIP2-7-like                   226   2e-69   
gb|ACB87734.1|  aquaporin                                               226   2e-69   
gb|KCW51592.1|  hypothetical protein EUGRSUZ_J01087                     229   2e-69   
ref|XP_002879778.1|  PIP2_6/PIP2E                                       226   2e-69   
ref|XP_010509371.1|  PREDICTED: aquaporin PIP2-2-like                   226   2e-69   
ref|XP_010266027.1|  PREDICTED: aquaporin PIP2-7-like                   226   2e-69   
gb|KJB73803.1|  hypothetical protein B456_011G253400                    225   2e-69   
ref|XP_006411124.1|  hypothetical protein EUTSA_v10017026mg             226   2e-69   
emb|CDP07111.1|  unnamed protein product                                226   2e-69   
gb|KDO41796.1|  hypothetical protein CISIN_1g023108mg                   226   2e-69   
ref|XP_006410897.1|  hypothetical protein EUTSA_v10017041mg             226   2e-69   
ref|XP_007162747.1|  hypothetical protein PHAVU_001G177000g             226   2e-69   
ref|XP_010505294.1|  PREDICTED: aquaporin PIP2-2-like                   226   2e-69   
emb|CAA53478.1|  plasma membrane intrinsic protein 2b                   226   2e-69   
ref|XP_009381972.1|  PREDICTED: probable aquaporin PIP2-2               226   2e-69   
gb|AEH76326.1|  plasma membrane intrinsic protein 2A                    226   2e-69   
ref|NP_190910.1|  aquaporin PIP2-1                                      226   3e-69   
ref|XP_009412922.1|  PREDICTED: probable aquaporin PIP2-6               226   3e-69   
ref|XP_010426989.1|  PREDICTED: aquaporin PIP2-1                        226   3e-69   
ref|XP_006357563.1|  PREDICTED: probable aquaporin PIP2-1-like          226   3e-69   
ref|NP_191042.1|  putative aquaporin PIP2-5                             226   3e-69   
ref|XP_009780213.1|  PREDICTED: aquaporin PIP2-4-like                   226   3e-69   
gb|ACJ85173.1|  unknown                                                 226   3e-69   
ref|XP_006294744.1|  hypothetical protein CARUB_v10023789mg             226   3e-69   
gb|ACU19125.1|  unknown                                                 226   3e-69   
ref|XP_002446796.1|  hypothetical protein SORBIDRAFT_06g022840          226   3e-69   
ref|XP_010504105.1|  PREDICTED: aquaporin PIP2-1-like                   226   3e-69   
pdb|3CLL|A  Chain A, Crystal Structure Of The Spinach Aquaporin S...    226   3e-69   
gb|AAG30607.1|AF314656_1  aquaporin                                     226   3e-69   
ref|XP_010526891.1|  PREDICTED: probable aquaporin PIP2-8               226   3e-69   
gb|AGD98708.1|  aquaporin protein 5                                     226   3e-69   
ref|XP_006291622.1|  hypothetical protein CARUB_v10017773mg             226   3e-69   
ref|NP_200874.1|  putative aquaporin PIP2-4                             226   3e-69   
ref|XP_010516024.1|  PREDICTED: probable aquaporin PIP2-5               226   3e-69   
gb|KHF98939.1|  putative aquaporin PIP2-8 -like protein                 225   3e-69   
ref|XP_009389186.1|  PREDICTED: probable aquaporin PIP2-6               226   3e-69   
gb|KFK36606.1|  hypothetical protein AALP_AA4G145300                    225   4e-69   
ref|XP_010690355.1|  PREDICTED: aquaporin PIP-type                      225   4e-69   
gb|EAY92738.1|  hypothetical protein OsI_14490                          220   4e-69   
ref|XP_006428788.1|  hypothetical protein CICLE_v10012375mg             225   4e-69   
ref|NP_179277.1|  putative aquaporin PIP2-8                             225   4e-69   
ref|XP_006481457.1|  PREDICTED: aquaporin PIP2-1-like isoform X1        225   5e-69   
ref|XP_008446888.1|  PREDICTED: aquaporin PIP2-1-like                   225   5e-69   
ref|XP_004493972.1|  PREDICTED: probable aquaporin PIP2-5-like          225   5e-69   
ref|XP_003554376.1|  PREDICTED: aquaporin PIP2-1-like                   225   5e-69   
emb|CCI55668.1|  EaPIP2,1                                               225   5e-69   
dbj|BAF63508.1|  plasma membrane intrinsic protein                      225   5e-69   
ref|XP_007137341.1|  hypothetical protein PHAVU_009G118900g             225   5e-69   
ref|XP_004157526.1|  PREDICTED: aquaporin PIP2-7-like                   225   6e-69   
ref|XP_004142421.1|  PREDICTED: LOW QUALITY PROTEIN: aquaporin PI...    225   6e-69   
gb|AAC32107.1|  probable aquaporin                                      225   6e-69   
ref|XP_010100853.1|  Aquaporin PIP2-1                                   225   6e-69   
gb|AAB67869.1|  plasma membrane major intrinsic protein 2               225   6e-69   
gb|AFH36338.1|  aquaporin PIP2;3                                        225   6e-69   
gb|AHA84128.1|  plasma membrane integral protein ZmPIP2-7               225   7e-69   
ref|XP_006403531.1|  hypothetical protein EUTSA_v10010603mg             225   7e-69   
gb|AAG44947.1|AF290620_1  putative PIP2                                 225   7e-69   
ref|XP_008340653.1|  PREDICTED: aquaporin PIP2-1-like                   222   7e-69   
ref|XP_011092966.1|  PREDICTED: aquaporin PIP2-7                        225   7e-69   
ref|XP_006410896.1|  hypothetical protein EUTSA_v10017874mg             225   7e-69   
ref|XP_009105909.1|  PREDICTED: aquaporin PIP2-7                        224   7e-69   
ref|XP_009772697.1|  PREDICTED: aquaporin PIP2-2-like                   225   8e-69   
ref|XP_010505293.1|  PREDICTED: aquaporin PIP2-2                        225   8e-69   
ref|XP_008377729.1|  PREDICTED: probable aquaporin PIP2-8               224   8e-69   
emb|CDY56697.1|  BnaCnng31040D                                          225   8e-69   
emb|CDX91341.1|  BnaC04g08090D                                          224   8e-69   
ref|XP_010516975.1|  PREDICTED: aquaporin PIP2-2-like                   224   9e-69   
ref|XP_009400343.1|  PREDICTED: probable aquaporin PIP2-6               224   9e-69   
emb|CAB45651.1|  putative plasma membrane intrinsic protein             224   9e-69   
ref|XP_006291609.1|  hypothetical protein CARUB_v10017763mg             224   9e-69   
ref|XP_002881493.1|  hypothetical protein ARALYDRAFT_482707             224   9e-69   
ref|XP_009116034.1|  PREDICTED: aquaporin PIP2-1                        224   1e-68   
ref|XP_002877918.1|  hypothetical protein ARALYDRAFT_485715             224   1e-68   
gb|ABK22173.1|  unknown                                                 224   1e-68   
gb|KCW55551.1|  hypothetical protein EUGRSUZ_I01429                     224   1e-68   
pdb|3CN6|A  Chain A, Crystal Structure Of The Spinach Aquaporin S...    225   1e-68   
pdb|3CN5|A  Chain A, Crystal Structure Of The Spinach Aquaporin S...    225   1e-68   
dbj|BAD90701.1|  plasma membrane intrinsic protein 2;5                  224   1e-68   
gb|ACN40330.1|  unknown                                                 224   1e-68   
gb|ABL76066.1|  aquaporin 2                                             224   1e-68   
ref|XP_009126591.1|  PREDICTED: probable aquaporin PIP2-4               224   1e-68   
ref|XP_009628968.1|  PREDICTED: probable aquaporin PIP2-1               224   1e-68   
ref|XP_002521292.1|  Aquaporin PIP2.7, putative                         224   1e-68   
gb|ACU87556.1|  PIP protein                                             224   1e-68   
ref|XP_004976254.1|  PREDICTED: aquaporin PIP2-5-like                   224   1e-68   
ref|XP_002322877.1|  major intrinsic protein 1                          224   1e-68   
gb|ADL16407.1|  aquaporin                                               224   1e-68   
gb|ABK24156.1|  unknown                                                 224   1e-68   
ref|XP_006403691.1|  hypothetical protein EUTSA_v10010598mg             224   1e-68   
ref|XP_010555818.1|  PREDICTED: probable aquaporin PIP2-5               224   1e-68   
dbj|BAA32778.1|  Plasma membrane aquaporin (PAQ2)                       224   1e-68   
gb|AFO63679.1|  plasma intrinsic protein 2                              224   1e-68   
ref|XP_010266854.1|  PREDICTED: probable aquaporin PIP2-8               224   2e-68   
gb|KFK36762.1|  hypothetical protein AALP_AA4G166800                    224   2e-68   
ref|XP_003521392.1|  PREDICTED: aquaporin PIP2-7-like                   224   2e-68   
ref|XP_010427203.1|  PREDICTED: probable aquaporin PIP2-5               224   2e-68   
ref|XP_004290727.1|  PREDICTED: aquaporin PIP2-7                        224   2e-68   
emb|CDY17511.1|  BnaC03g65520D                                          224   2e-68   
ref|XP_004496281.1|  PREDICTED: aquaporin PIP2-1-like                   224   2e-68   
ref|XP_010516976.1|  PREDICTED: aquaporin PIP2-2-like                   224   2e-68   
ref|XP_007041804.1|  Plasma membrane intrinsic protein 2,8 isoform 1    223   2e-68   
gb|ACE60220.1|  plasma membrane aquaporin                               223   2e-68   
emb|CDX76314.1|  BnaA08g10860D                                          223   2e-68   
gb|AFB83067.1|  plasma intrinsic protein PIP2.1                         223   2e-68   
gb|AAM61438.1|  aquaporin (plasma membrane intrinsic protein 2C)        224   2e-68   
gb|EPS68613.1|  hypothetical protein M569_06155                         223   2e-68   
gb|AEF32110.1|  aquaporin PIP2                                          223   2e-68   
ref|XP_008447947.1|  PREDICTED: aquaporin PIP2-7                        223   3e-68   
ref|NP_181255.1|  aquaporin PIP2-3                                      223   3e-68   
ref|NP_001274376.1|  aquaporin PIP2-7-like                              223   3e-68   
gb|EYU40445.1|  hypothetical protein MIMGU_mgv1a011413mg                223   3e-68   
emb|CDY13298.1|  BnaC06g14590D                                          223   3e-68   
ref|XP_010107654.1|  Aquaporin PIP2-7                                   223   3e-68   
emb|CDY09192.1|  BnaA02g06180D                                          222   3e-68   
gb|EMT33553.1|  hypothetical protein F775_44017                         221   3e-68   
ref|XP_006846905.1|  hypothetical protein AMTR_s00152p00041700          223   3e-68   
ref|XP_008236033.1|  PREDICTED: aquaporin PIP2-7                        223   3e-68   
ref|NP_001234625.1|  aquaporin                                          223   4e-68   
ref|XP_010489282.1|  PREDICTED: probable aquaporin PIP2-8               223   4e-68   
ref|XP_008809438.1|  PREDICTED: probable aquaporin PIP2-6               223   4e-68   
gb|ABK22146.1|  unknown                                                 223   4e-68   
ref|XP_008456476.1|  PREDICTED: probable aquaporin PIP2-5               223   5e-68   
ref|XP_003580150.1|  PREDICTED: aquaporin PIP2-5                        223   5e-68   
gb|AHG32324.1|  PIP2-3                                                  223   5e-68   
ref|XP_010554547.1|  PREDICTED: probable aquaporin PIP2-5               223   5e-68   
gb|ACR56614.1|  plasma intrinsic protein 2;4                            223   5e-68   
ref|XP_008366675.1|  PREDICTED: probable aquaporin PIP2-5               223   5e-68   
ref|XP_009116159.1|  PREDICTED: probable aquaporin PIP2-5               223   5e-68   
ref|XP_006359706.1|  PREDICTED: aquaporin PIP2-7-like                   223   6e-68   
gb|AHZ08398.1|  phosphatidylinosital biphosphate protein                223   6e-68   
ref|XP_006296058.1|  hypothetical protein CARUB_v10025207mg             223   6e-68   
ref|XP_007200557.1|  hypothetical protein PRUPE_ppa009691mg             222   6e-68   
gb|ACR56615.1|  plasma intrinsic protein 2;5                            222   6e-68   
dbj|BAA82258.1|  water channel protein                                  219   6e-68   
gb|ACU00104.1|  plasma membrane intrinsic protein PIP2.2                222   7e-68   
gb|ABK60196.1|  PIP2 protein                                            222   7e-68   
ref|NP_001274397.1|  aquaporin PIP2-1-like                              222   7e-68   
emb|CAB46351.1|  major intrinsic protein 2                              222   8e-68   
dbj|BAD90697.1|  plasma membrane intrinsic protein 2;1                  222   8e-68   
ref|XP_008449255.1|  PREDICTED: aquaporin PIP2-2-like                   222   8e-68   
ref|NP_001266257.1|  aquaporin PIP2-7-like                              222   8e-68   
ref|NP_001105616.1|  aquaporin PIP2-5                                   222   9e-68   
emb|CDX67611.1|  BnaA07g16510D                                          222   9e-68   
gb|ACV66986.1|  plasma membrane aquaporin 2                             222   9e-68   
dbj|BAO18630.1|  plasmamembrane intrinsic protein 2;8                   222   9e-68   
emb|CDY07519.1|  BnaC06g15450D                                          222   9e-68   
tpg|DAA60472.1|  TPA: plasma membrane intrinsic protein2                223   9e-68   
ref|NP_001275065.1|  major intrinsic protein 2                          222   9e-68   
ref|XP_009355655.1|  PREDICTED: probable aquaporin PIP2-8               222   1e-67   
ref|XP_010467415.1|  PREDICTED: probable aquaporin PIP2-8               221   1e-67   
ref|XP_002306187.1|  membrane intrinsic family protein                  221   1e-67   
gb|AFH36336.1|  aquaporin PIP2;1                                        221   1e-67   
ref|XP_011046666.1|  PREDICTED: probable aquaporin PIP2-8               221   1e-67   
gb|EEE67096.1|  hypothetical protein OsJ_24086                          219   1e-67   
gb|ACB71281.1|  plasma membrane intrinsic protein                       221   1e-67   
ref|XP_002884019.1|  PIP2_8/PIP3B                                       221   1e-67   
ref|XP_008382110.1|  PREDICTED: probable aquaporin PIP2-8               221   1e-67   
gb|AAS65964.1|  aquaporin PIP 2                                         221   1e-67   
emb|CAH60721.1|  putative plasma membrane intrinsic protein             221   2e-67   
emb|CDX73446.1|  BnaC08g25570D                                          221   2e-67   
emb|CBI32731.3|  unnamed protein product                                217   2e-67   
ref|XP_003522619.2|  PREDICTED: aquaporin PIP2-7                        223   2e-67   
gb|AFB82643.1|  aquaporin                                               221   2e-67   
ref|XP_009376943.1|  PREDICTED: probable aquaporin PIP2-8               221   2e-67   



>gb|ACU87558.1| PIP protein [Gossypium hirsutum]
 gb|KHG24536.1| putative aquaporin PIP2-2 [Gossypium arboreum]
Length=282

 Score =   247 bits (630),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 118/129 (91%), Positives = 126/129 (98%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN LQDG++KGTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  154  GANELQDGFNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  213

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAVIY KDKAWDDQW+FWVGPF+GAAIAA+YHQY+LRAGA K
Sbjct  214  LATIPITGTGINPARSFGAAVIYNKDKAWDDQWMFWVGPFIGAAIAAIYHQYILRAGAMK  273

Query  319  ALGSYRSNA  293
            ALGS+RSNA
Sbjct  274  ALGSFRSNA  282



>ref|XP_009803290.1| PREDICTED: probable aquaporin PIP2-4, partial [Nicotiana sylvestris]
Length=139

 Score =   242 bits (617),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 117/129 (91%), Positives = 124/129 (96%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGY+ GTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  11   GANTLNDGYNTGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  70

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIP+TGTGINPARSFGAAVIYGK+KAWDDQWIFWVGPF+GAAIAA YHQ++LRAGA K
Sbjct  71   LATIPVTGTGINPARSFGAAVIYGKEKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVK  130

Query  319  ALGSYRSNA  293
            ALGS+RSNA
Sbjct  131  ALGSFRSNA  139



>ref|XP_009624885.1| PREDICTED: aquaporin PIP2-1-like [Nicotiana tomentosiformis]
Length=291

 Score =   247 bits (630),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 120/129 (93%), Positives = 124/129 (96%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGYS GTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  163  GANTLNDGYSSGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  222

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPF+GAAIAA YHQ++LRAGA K
Sbjct  223  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVK  282

Query  319  ALGSYRSNA  293
            ALGS+RSNA
Sbjct  283  ALGSFRSNA  291



>gb|KDP29110.1| hypothetical protein JCGZ_16499 [Jatropha curcas]
Length=284

 Score =   245 bits (625),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 118/129 (91%), Positives = 124/129 (96%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGYSKGTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  154  GANELADGYSKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  213

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAVIY KDKAWDDQWIFWVGPF+GAAIAA+YHQY+LRAGA K
Sbjct  214  LATIPITGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAAIAAIYHQYILRAGAVK  273

Query  319  ALGSYRSNA  293
            ALGS+RS +
Sbjct  274  ALGSFRSTS  282



>ref|XP_008463943.1| PREDICTED: aquaporin PIP2-7 [Cucumis melo]
Length=283

 Score =   244 bits (624),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 118/129 (91%), Positives = 125/129 (97%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGY+KGTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  155  GANMLSDGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  214

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAVI+ K+KAWDDQWIFWVGPF+GAAIAA+YHQYVLRAGA K
Sbjct  215  LATIPITGTGINPARSFGAAVIFNKEKAWDDQWIFWVGPFIGAAIAAIYHQYVLRAGAIK  274

Query  319  ALGSYRSNA  293
            ALGS+RSNA
Sbjct  275  ALGSFRSNA  283



>ref|NP_001274381.1| aquaporin PIP2-7-like [Cucumis sativus]
 ref|XP_004145740.1| PREDICTED: aquaporin PIP2-7-like [Cucumis sativus]
 ref|XP_004169567.1| PREDICTED: aquaporin PIP2-7-like [Cucumis sativus]
 gb|AHB33480.1| plasma intrinsic protein 2-4 [Cucumis sativus]
 gb|KGN46837.1| hypothetical protein Csa_6G140850 [Cucumis sativus]
Length=283

 Score =   244 bits (624),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 118/129 (91%), Positives = 125/129 (97%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGY+KGTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  155  GANMLSDGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  214

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAVI+ K+KAWDDQWIFWVGPF+GAAIAA+YHQYVLRAGA K
Sbjct  215  LATIPITGTGINPARSFGAAVIFNKEKAWDDQWIFWVGPFIGAAIAAIYHQYVLRAGAIK  274

Query  319  ALGSYRSNA  293
            ALGS+RSNA
Sbjct  275  ALGSFRSNA  283



>ref|XP_011094668.1| PREDICTED: aquaporin PIP2-4-like [Sesamum indicum]
Length=281

 Score =   244 bits (624),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 118/129 (91%), Positives = 125/129 (97%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGYS GTGL AEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  152  GANELADGYSTGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  211

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPF+GAAIAA+YHQY+LRAGAAK
Sbjct  212  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFIGAAIAAIYHQYILRAGAAK  271

Query  319  ALGSYRSNA  293
            ALGS+RS++
Sbjct  272  ALGSFRSSS  280



>gb|KJB26182.1| hypothetical protein B456_004G229000 [Gossypium raimondii]
Length=282

 Score =   244 bits (624),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 118/129 (91%), Positives = 125/129 (97%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN LQDG++KGTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  154  GANELQDGFNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  213

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAVIY KDKAWDDQW+FWVGPF+GAAIAA YHQY+LRAGA K
Sbjct  214  LATIPITGTGINPARSFGAAVIYNKDKAWDDQWMFWVGPFIGAAIAANYHQYILRAGAMK  273

Query  319  ALGSYRSNA  293
            ALGS+RSNA
Sbjct  274  ALGSFRSNA  282



>tpg|DAA64674.1| TPA_exp: aquaporin PIP2 2 [Nicotiana tabacum]
Length=283

 Score =   244 bits (623),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 118/129 (91%), Positives = 124/129 (96%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGYS GTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  155  GANTLNDGYSTGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  214

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIP+TGTGINPARSFGAAVIYGK+KAWDDQWIFWVGPF+GAAIAA YHQ++LRAGA K
Sbjct  215  LATIPVTGTGINPARSFGAAVIYGKEKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVK  274

Query  319  ALGSYRSNA  293
            ALGS+RSNA
Sbjct  275  ALGSFRSNA  283



>gb|AAO39007.1| plasma intrinsic protein 2,1 [Juglans regia]
Length=287

 Score =   244 bits (622),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 118/129 (91%), Positives = 125/129 (97%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGYSKGTGL AEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  157  GANELADGYSKGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  216

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAVIYGKDKAW+DQWIFWVGPF+GAAIAA YHQY+LRAGAAK
Sbjct  217  LATIPITGTGINPARSFGAAVIYGKDKAWNDQWIFWVGPFIGAAIAAFYHQYILRAGAAK  276

Query  319  ALGSYRSNA  293
            ALGS+RS++
Sbjct  277  ALGSFRSSS  285



>gb|AEQ20672.1| PIP2;1 [Karelinia caspia]
Length=284

 Score =   244 bits (622),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 118/129 (91%), Positives = 123/129 (95%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGYS GTGLGAEI+GTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  156  GANELADGYSNGTGLGAEIVGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  215

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAVIYGKDKAWDDQW+FWVGP +GAAIAA YHQYVLRAGA K
Sbjct  216  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWLFWVGPMIGAAIAAFYHQYVLRAGAVK  275

Query  319  ALGSYRSNA  293
            ALGS+RSNA
Sbjct  276  ALGSFRSNA  284



>ref|XP_009619670.1| PREDICTED: aquaporin PIP2-1-like [Nicotiana tomentosiformis]
Length=283

 Score =   243 bits (621),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 117/129 (91%), Positives = 124/129 (96%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGYS GTGLGAEIIGTFVLVYTVFAATDPKRNARDSH+PVLAPLPIGFAVFMVH
Sbjct  155  GANMLNDGYSTGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHIPVLAPLPIGFAVFMVH  214

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIP+TGTGINPARSFGAAVIYGK+KAWDDQWIFWVGPF+GAAIAA YHQ++LRAGA K
Sbjct  215  LATIPVTGTGINPARSFGAAVIYGKEKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVK  274

Query  319  ALGSYRSNA  293
            ALGS+RSNA
Sbjct  275  ALGSFRSNA  283



>gb|AAO39008.1| plasma intrinsic protein 2,2 [Juglans regia]
Length=287

 Score =   244 bits (622),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 118/129 (91%), Positives = 124/129 (96%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGYSKGTGL AEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  157  GANELADGYSKGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  216

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPF+GAAIAA YHQY+LRA AAK
Sbjct  217  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFIGAAIAAFYHQYILRAAAAK  276

Query  319  ALGSYRSNA  293
            ALGS+RS++
Sbjct  277  ALGSFRSSS  285



>gb|KDP44053.1| hypothetical protein JCGZ_05520 [Jatropha curcas]
Length=286

 Score =   243 bits (620),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 119/129 (92%), Positives = 123/129 (95%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGY+KGTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  158  GANELADGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  217

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAVIY KDKAWDDQWIFWVGPFVGAAIAA YHQY+LRA A K
Sbjct  218  LATIPITGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFVGAAIAAFYHQYILRAAAIK  277

Query  319  ALGSYRSNA  293
            ALGS+RSNA
Sbjct  278  ALGSFRSNA  286



>tpg|DAA64673.1| TPA_exp: aquaporin PIP2 1 [Nicotiana tabacum]
Length=291

 Score =   243 bits (620),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 117/129 (91%), Positives = 124/129 (96%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGY+ GTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  163  GANTLNDGYNTGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  222

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIP+TGTGINPARSFGAAVIYGK+KAWDDQWIFWVGPF+GAAIAA YHQ++LRAGA K
Sbjct  223  LATIPVTGTGINPARSFGAAVIYGKEKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVK  282

Query  319  ALGSYRSNA  293
            ALGS+RSNA
Sbjct  283  ALGSFRSNA  291



>gb|AEQ29857.1| aquaporin PIP2 [Malus prunifolia]
Length=281

 Score =   243 bits (619),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 117/129 (91%), Positives = 124/129 (96%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGY+KGTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVF+VH
Sbjct  153  GANELADGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFIVH  212

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAVIY KDKAWDDQWIFW+GPF+GAAIAA YHQY+LRAGA K
Sbjct  213  LATIPITGTGINPARSFGAAVIYNKDKAWDDQWIFWLGPFIGAAIAAFYHQYILRAGAIK  272

Query  319  ALGSYRSNA  293
            ALGS+RSNA
Sbjct  273  ALGSFRSNA  281



>ref|XP_008363507.1| PREDICTED: aquaporin PIP2-2 [Malus domestica]
Length=281

 Score =   243 bits (619),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 117/129 (91%), Positives = 124/129 (96%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGY+KGTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVF+VH
Sbjct  153  GANELADGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFIVH  212

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAVIY KDKAWDDQWIFW+GPF+GAAIAA YHQY+LRAGA K
Sbjct  213  LATIPITGTGINPARSFGAAVIYNKDKAWDDQWIFWLGPFIGAAIAAFYHQYILRAGAIK  272

Query  319  ALGSYRSNA  293
            ALGS+RSNA
Sbjct  273  ALGSFRSNA  281



>ref|XP_010043748.1| PREDICTED: probable aquaporin PIP2-4 [Eucalyptus grandis]
 gb|KCW85737.1| hypothetical protein EUGRSUZ_B02499 [Eucalyptus grandis]
Length=284

 Score =   243 bits (619),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 117/129 (91%), Positives = 123/129 (95%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGYSKG GLGAEI+GTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  156  GANELADGYSKGVGLGAEIVGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  215

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAVIY KDKAWDDQW+FWVGPF+GAAIAA YHQY+LRAGA K
Sbjct  216  LATIPITGTGINPARSFGAAVIYNKDKAWDDQWMFWVGPFIGAAIAAFYHQYILRAGAVK  275

Query  319  ALGSYRSNA  293
            ALGS+RSNA
Sbjct  276  ALGSFRSNA  284



>ref|XP_009760326.1| PREDICTED: aquaporin PIP2-1-like [Nicotiana sylvestris]
Length=283

 Score =   243 bits (619),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 117/129 (91%), Positives = 124/129 (96%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGY+ GTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  155  GANTLNDGYNTGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  214

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIP+TGTGINPARSFGAAVIYGK+KAWDDQWIFWVGPF+GAAIAA YHQ++LRAGA K
Sbjct  215  LATIPVTGTGINPARSFGAAVIYGKEKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVK  274

Query  319  ALGSYRSNA  293
            ALGS+RSNA
Sbjct  275  ALGSFRSNA  283



>ref|XP_010046653.1| PREDICTED: aquaporin PIP2-1-like [Eucalyptus grandis]
Length=286

 Score =   243 bits (619),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = -2

Query  691  DMAAGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAV  512
            +   GANGL +GYS GTGL AEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAV
Sbjct  152  EQGGGANGLSEGYSTGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAV  211

Query  511  FMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRA  332
            FMVHLATIPITGTGINPARSFGAAV+YGK KAWD+QWIFWVGPF+GAAIAA YHQY+LRA
Sbjct  212  FMVHLATIPITGTGINPARSFGAAVMYGKQKAWDEQWIFWVGPFIGAAIAAFYHQYILRA  271

Query  331  GAAKALGSYRSNA  293
            GAAKALGS+RS++
Sbjct  272  GAAKALGSFRSSS  284



>ref|XP_009367074.1| PREDICTED: aquaporin PIP2-2 [Pyrus x bretschneideri]
Length=288

 Score =   243 bits (619),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 117/129 (91%), Positives = 124/129 (96%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGY+KGTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVF+VH
Sbjct  160  GANELADGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFIVH  219

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAVIY KDKAWDDQWIFW+GPF+GAAIAA YHQY+LRAGA K
Sbjct  220  LATIPITGTGINPARSFGAAVIYNKDKAWDDQWIFWLGPFIGAAIAAFYHQYILRAGAIK  279

Query  319  ALGSYRSNA  293
            ALGS+RSNA
Sbjct  280  ALGSFRSNA  288



>dbj|BAG68661.1| plasma membrane intrinsic protein [Tulipa gesneriana]
Length=288

 Score =   242 bits (618),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 120/129 (93%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L  GYSKGTGL AEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  160  GANELSAGYSKGTGLAAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  219

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAVIY KDKAWDDQWIFWVGPF+GAAIAA YHQYVLRAGA K
Sbjct  220  LATIPITGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAAIAAAYHQYVLRAGAIK  279

Query  319  ALGSYRSNA  293
            ALGS+RSNA
Sbjct  280  ALGSFRSNA  288



>ref|XP_010325988.1| PREDICTED: aquaporin PIP2-1-like [Solanum lycopersicum]
Length=269

 Score =   241 bits (615),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 116/129 (90%), Positives = 123/129 (95%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGYS GTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  141  GANTLNDGYSTGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  200

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIP+TGTGINPARSFGAAV+YG +KAWDDQWIFWVGPF+GAAIAA YHQ++LRAGA K
Sbjct  201  LATIPVTGTGINPARSFGAAVVYGHNKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVK  260

Query  319  ALGSYRSNA  293
            ALGS+RSNA
Sbjct  261  ALGSFRSNA  269



>ref|XP_007205689.1| hypothetical protein PRUPE_ppa009689mg [Prunus persica]
 gb|EMJ06888.1| hypothetical protein PRUPE_ppa009689mg [Prunus persica]
Length=281

 Score =   241 bits (616),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = -2

Query  691  DMAAGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAV  512
            +   GAN L  GY+KGTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAV
Sbjct  149  EYGGGANELAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAV  208

Query  511  FMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRA  332
            F+VHLATIPITGTGINPARSFGAAVIY KDKAWDDQWIFW+GPF+GAAIAA+YHQY+LRA
Sbjct  209  FIVHLATIPITGTGINPARSFGAAVIYNKDKAWDDQWIFWLGPFIGAAIAALYHQYILRA  268

Query  331  GAAKALGSYRSNA  293
            GA KALGS+RSNA
Sbjct  269  GAIKALGSFRSNA  281



>ref|NP_001289823.1| aquaporin PIP2-1-like [Solanum lycopersicum]
 dbj|BAO18626.1| plasmamembrane intrinsic protein 2;1 [Solanum lycopersicum]
Length=279

 Score =   241 bits (616),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 116/129 (90%), Positives = 123/129 (95%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGYS GTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  151  GANTLNDGYSTGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  210

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIP+TGTGINPARSFGAAV+YG +KAWDDQWIFWVGPF+GAAIAA YHQ++LRAGA K
Sbjct  211  LATIPVTGTGINPARSFGAAVVYGHNKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVK  270

Query  319  ALGSYRSNA  293
            ALGS+RSNA
Sbjct  271  ALGSFRSNA  279



>ref|XP_009792249.1| PREDICTED: aquaporin PIP2-1-like [Nicotiana sylvestris]
 tpg|DAA64675.1| TPA_exp: aquaporin PIP2 3a [Nicotiana tabacum]
Length=285

 Score =   241 bits (616),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 117/129 (91%), Positives = 123/129 (95%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L  GYS GTGL AEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  157  GANELATGYSTGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  216

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAVIYGK+KAWDDQWIFWVGPF+GAAIAA+YHQY+LRAGA K
Sbjct  217  LATIPITGTGINPARSFGAAVIYGKEKAWDDQWIFWVGPFIGAAIAALYHQYILRAGAVK  276

Query  319  ALGSYRSNA  293
            ALGS+RSNA
Sbjct  277  ALGSFRSNA  285



>ref|XP_002519539.1| Aquaporin PIP2.2, putative [Ricinus communis]
 gb|EEF42953.1| Aquaporin PIP2.2, putative [Ricinus communis]
Length=288

 Score =   241 bits (615),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 117/129 (91%), Positives = 124/129 (96%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGYS GTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  158  GANELADGYSTGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  217

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIP+TGTGINPARSFGAAVIY K+KAWDDQWIFWVGPF+GAAIAA+YHQYVLRA AAK
Sbjct  218  LATIPVTGTGINPARSFGAAVIYNKEKAWDDQWIFWVGPFIGAAIAAIYHQYVLRASAAK  277

Query  319  ALGSYRSNA  293
            ALGS+RS++
Sbjct  278  ALGSFRSSS  286



>ref|XP_009398603.1| PREDICTED: probable aquaporin PIP2-2 [Musa acuminata subsp. malaccensis]
Length=288

 Score =   241 bits (614),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 117/129 (91%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGYSKGTGL AEIIGTFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVH
Sbjct  160  GANELSDGYSKGTGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVH  219

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAVIY KDKAWDDQWIFWVGP +GAAIAA YHQY+LRAGA K
Sbjct  220  LATIPITGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPLIGAAIAAAYHQYILRAGAVK  279

Query  319  ALGSYRSNA  293
            ALGS+RSNA
Sbjct  280  ALGSFRSNA  288



>ref|XP_009614931.1| PREDICTED: aquaporin PIP2-1-like [Nicotiana tomentosiformis]
 tpg|DAA64676.1| TPA_exp: aquaporin PIP2 3b [Nicotiana tabacum]
Length=285

 Score =   241 bits (614),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 117/129 (91%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L  GYS GTGL AEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  157  GANELATGYSTGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  216

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGP +GAAIAA+YHQY+LRAGA K
Sbjct  217  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPLIGAAIAALYHQYILRAGAVK  276

Query  319  ALGSYRSNA  293
            ALGS+RSNA
Sbjct  277  ALGSFRSNA  285



>gb|ABO69705.2| aquaporin PIP2 [Prunus humilis]
Length=281

 Score =   240 bits (613),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = -2

Query  691  DMAAGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAV  512
            +   GAN L  GY+KGTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAV
Sbjct  149  EYGGGANELAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAV  208

Query  511  FMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRA  332
            F+VHLATIPITGTGINPARSFGAAVIY KDKAWDDQWIFW+GPF+GAAIAA+YHQY+LRA
Sbjct  209  FIVHLATIPITGTGINPARSFGAAVIYNKDKAWDDQWIFWLGPFIGAAIAALYHQYILRA  268

Query  331  GAAKALGSYRSNA  293
            GA KALGS+RSNA
Sbjct  269  GAIKALGSFRSNA  281



>ref|NP_001280185.1| aquaporin PIP2-2 [Prunus mume]
 dbj|BAE48656.1| aquaporin [Prunus mume]
Length=281

 Score =   240 bits (613),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = -2

Query  691  DMAAGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAV  512
            +   GAN L  GY+KGTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAV
Sbjct  149  EYGGGANELAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAV  208

Query  511  FMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRA  332
            F+VHLATIPITGTGINPARSFGAAVIY KDKAWDDQWIFW+GPF+GAAIAA+YHQY+LRA
Sbjct  209  FIVHLATIPITGTGINPARSFGAAVIYNKDKAWDDQWIFWLGPFIGAAIAALYHQYILRA  268

Query  331  GAAKALGSYRSNA  293
            GA KALGS+RSNA
Sbjct  269  GAIKALGSFRSNA  281



>gb|KCW88815.1| hypothetical protein EUGRSUZ_A01153 [Eucalyptus grandis]
Length=356

 Score =   243 bits (619),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = -2

Query  691  DMAAGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAV  512
            +   GANGL +GYS GTGL AEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAV
Sbjct  222  EQGGGANGLSEGYSTGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAV  281

Query  511  FMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRA  332
            FMVHLATIPITGTGINPARSFGAAV+YGK KAWD+QWIFWVGPF+GAAIAA YHQY+LRA
Sbjct  282  FMVHLATIPITGTGINPARSFGAAVMYGKQKAWDEQWIFWVGPFIGAAIAAFYHQYILRA  341

Query  331  GAAKALGSYRSNA  293
            GAAKALGS+RS++
Sbjct  342  GAAKALGSFRSSS  354



>emb|CDP04351.1| unnamed protein product [Coffea canephora]
Length=199

 Score =   237 bits (605),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 112/129 (87%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN LQDGYS GTGL AEIIGTFVLVYTVF+ATDPKR+ARDSHVP+LAPLPIGFAVFMVH
Sbjct  68   GANQLQDGYSTGTGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPILAPLPIGFAVFMVH  127

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIP+TGTGINPARS GAAVIY KDKAWDDQWIFWVGPF+GAAIAA YHQ++LRAGA K
Sbjct  128  LATIPVTGTGINPARSLGAAVIYNKDKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVK  187

Query  319  ALGSYRSNA  293
            ALGS+RS++
Sbjct  188  ALGSFRSSS  196



>gb|EYU34445.1| hypothetical protein MIMGU_mgv1a011350mg [Erythranthe guttata]
Length=284

 Score =   240 bits (612),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = -2

Query  691  DMAAGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAV  512
            +   GAN L  GYSKGTGL AEIIGTFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAV
Sbjct  150  EHGGGANELALGYSKGTGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAV  209

Query  511  FMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRA  332
            FMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPF+GAAIAA+YHQY+LRA
Sbjct  210  FMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFIGAAIAAIYHQYILRA  269

Query  331  GAAKALGSYRSNA  293
            GA KALGS+RS++
Sbjct  270  GAVKALGSFRSSS  282



>gb|EMT32724.1| Aquaporin PIP2-1 [Aegilops tauschii]
Length=143

 Score =   235 bits (599),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 114/129 (88%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L  G+SKGTGL AEIIGTFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVH
Sbjct  15   GANELSSGFSKGTGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVH  74

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARS GAAVIY KDKAWDDQWIFWVGP +GAAIAA YHQY+LRAGA K
Sbjct  75   LATIPITGTGINPARSLGAAVIYNKDKAWDDQWIFWVGPMIGAAIAAFYHQYILRAGAIK  134

Query  319  ALGSYRSNA  293
            ALGS+RSNA
Sbjct  135  ALGSFRSNA  143



>gb|ABB88840.1| aquaporin [Stevia rebaudiana]
Length=281

 Score =   240 bits (612),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 117/129 (91%), Positives = 123/129 (95%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGY+KGTGLG EIIGTFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVH
Sbjct  153  GANELADGYNKGTGLGTEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVH  212

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAVIY KDKAWDDQWIFWVGPF+GAAIAA YHQ+VLRAGA K
Sbjct  213  LATIPITGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAAIAAFYHQFVLRAGAIK  272

Query  319  ALGSYRSNA  293
            ALGS+RSNA
Sbjct  273  ALGSFRSNA  281



>gb|AEY75244.1| plasma membrane intrinsic protein [Malus hupehensis]
Length=281

 Score =   239 bits (611),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 116/129 (90%), Positives = 123/129 (95%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L  GY+KGTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVF+VH
Sbjct  153  GANELSAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFIVH  212

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAVIY KDKAWDDQWIFW+GPF+GAAIAA YHQY+LRAGA K
Sbjct  213  LATIPITGTGINPARSFGAAVIYNKDKAWDDQWIFWLGPFIGAAIAAFYHQYILRAGAIK  272

Query  319  ALGSYRSNA  293
            ALGS+RSNA
Sbjct  273  ALGSFRSNA  281



>ref|XP_008449253.1| PREDICTED: aquaporin PIP2-2-like isoform X3 [Cucumis melo]
Length=284

 Score =   240 bits (612),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 116/128 (91%), Positives = 121/128 (95%), Gaps = 0/128 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGYS GTGL AEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  154  GANSLADGYSTGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  213

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAVIY KDKAWDDQWIFWVGPF+GAAIAA+YHQ VLRAGA K
Sbjct  214  LATIPITGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAAIAAIYHQIVLRAGAVK  273

Query  319  ALGSYRSN  296
            ALGS+RS+
Sbjct  274  ALGSFRSS  281



>gb|AAW80918.1| putative plasma membrane intrinsic protein [Astragalus membranaceus]
Length=283

 Score =   239 bits (611),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 117/129 (91%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGY+KGTGL AEIIGTFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVH
Sbjct  153  GANELADGYNKGTGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVH  212

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAVIY KDKAWDDQWIFWVGPFVGAAIAA YHQ+VLRA A K
Sbjct  213  LATIPITGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFVGAAIAAFYHQFVLRAAAIK  272

Query  319  ALGSYRSNA  293
            ALGS+RSNA
Sbjct  273  ALGSFRSNA  281



>ref|XP_006367014.1| PREDICTED: aquaporin PIP2-1-like, partial [Solanum tuberosum]
Length=279

 Score =   239 bits (610),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/129 (90%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGYS GTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  151  GANMLNDGYSTGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  210

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIP+TGTGINPARSFGAAVIYG  KAW+DQWIFWVGPF+GAAIAA YHQ++LRAGA K
Sbjct  211  LATIPVTGTGINPARSFGAAVIYGHHKAWNDQWIFWVGPFIGAAIAAFYHQFILRAGAVK  270

Query  319  ALGSYRSNA  293
            ALGS+RSNA
Sbjct  271  ALGSFRSNA  279



>ref|XP_004304427.1| PREDICTED: aquaporin PIP2-1-like [Fragaria vesca subsp. vesca]
Length=287

 Score =   239 bits (610),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 124/133 (93%), Gaps = 0/133 (0%)
 Frame = -2

Query  691  DMAAGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAV  512
            +   GANGL DGYSKGTGL AEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAV
Sbjct  153  NYGGGANGLADGYSKGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAV  212

Query  511  FMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRA  332
            FMVHLATIPITGTGINPARSFGAAVIY  +KAWDD WIFWVGPF+GAAIAA+YHQY+LRA
Sbjct  213  FMVHLATIPITGTGINPARSFGAAVIYNNEKAWDDHWIFWVGPFIGAAIAALYHQYILRA  272

Query  331  GAAKALGSYRSNA  293
            GA KALGS+RS++
Sbjct  273  GAVKALGSFRSSS  285



>gb|ACX37450.1| plasma membrane intrinsic protein [Hevea brasiliensis]
Length=288

 Score =   239 bits (610),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/129 (89%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGYSKGTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  158  GANELADGYSKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  217

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIP+TGTGINPARSFGAAVIY +DKAWDDQWIFWVGPF+GAAIAA YHQY+LRA A K
Sbjct  218  LATIPVTGTGINPARSFGAAVIYNQDKAWDDQWIFWVGPFIGAAIAAFYHQYILRAAAVK  277

Query  319  ALGSYRSNA  293
            ALGS+RS +
Sbjct  278  ALGSFRSTS  286



>ref|XP_002530280.1| Aquaporin PIP2.1, putative [Ricinus communis]
 gb|EEF32087.1| Aquaporin PIP2.1, putative [Ricinus communis]
Length=287

 Score =   239 bits (610),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/129 (90%), Positives = 123/129 (95%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGY+KGTGLGAEIIGTFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVH
Sbjct  159  GANELADGYNKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVH  218

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAVIY K+KAWDDQWIFWVGPF+GAAIAA YHQY+LRA A K
Sbjct  219  LATIPITGTGINPARSFGAAVIYNKEKAWDDQWIFWVGPFIGAAIAAFYHQYILRAAAIK  278

Query  319  ALGSYRSNA  293
            ALGS+RSNA
Sbjct  279  ALGSFRSNA  287



>gb|EAY86778.1| hypothetical protein OsI_08158 [Oryza sativa Indica Group]
Length=288

 Score =   239 bits (610),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 118/129 (91%), Positives = 121/129 (94%), Gaps = 1/129 (1%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGYSKGTGLGAEIIGTFVLVYTVF+ATDPKRNARDSH+PVLAPLPIGFAVFMVH
Sbjct  161  GANELSDGYSKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHIPVLAPLPIGFAVFMVH  220

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARS GAAVIY KDKAWDDQWIFWVGP +GAAIAA YHQYVLRA AAK
Sbjct  221  LATIPITGTGINPARSLGAAVIYNKDKAWDDQWIFWVGPLIGAAIAAAYHQYVLRASAAK  280

Query  319  ALGSYRSNA  293
             LGSYRSNA
Sbjct  281  -LGSYRSNA  288



>ref|XP_007027328.1| Plasma membrane intrinsic protein 2 [Theobroma cacao]
 gb|EOY07830.1| Plasma membrane intrinsic protein 2 [Theobroma cacao]
Length=283

 Score =   239 bits (609),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 114/129 (88%), Positives = 123/129 (95%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGYS GTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  153  GANSLADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  212

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAV+Y +DK WDDQWIFWVGPF+GAAIAA+YHQY+LRA AAK
Sbjct  213  LATIPITGTGINPARSFGAAVMYNQDKPWDDQWIFWVGPFIGAAIAAIYHQYILRAAAAK  272

Query  319  ALGSYRSNA  293
            ALGS+RS++
Sbjct  273  ALGSFRSSS  281



>ref|XP_006367008.1| PREDICTED: aquaporin PIP2-1-like isoform X2 [Solanum tuberosum]
Length=279

 Score =   239 bits (609),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 115/129 (89%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGYS GTGLGAEIIGTF+LVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  151  GANKLNDGYSTGTGLGAEIIGTFILVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  210

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIP+TGTGINPARSFGAAVIYG  KAW+DQWIFWVGPF+GAAIAA YHQ++LRAGA K
Sbjct  211  LATIPVTGTGINPARSFGAAVIYGHHKAWNDQWIFWVGPFIGAAIAAFYHQFILRAGAVK  270

Query  319  ALGSYRSNA  293
            ALGS+RSNA
Sbjct  271  ALGSFRSNA  279



>gb|AGC24024.1| plasma membrane intrinsic protein 1 [Lilium hybrid cultivar]
Length=288

 Score =   239 bits (609),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 118/129 (91%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L  GYSKGTGL AEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  160  GANELSAGYSKGTGLAAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  219

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAVIY K KAWDDQWIFWVGPF+GAAIAA YHQY+LRAGA K
Sbjct  220  LATIPITGTGINPARSFGAAVIYNKSKAWDDQWIFWVGPFIGAAIAAGYHQYILRAGAIK  279

Query  319  ALGSYRSNA  293
            ALGS+RSNA
Sbjct  280  ALGSFRSNA  288



>ref|XP_006367007.1| PREDICTED: aquaporin PIP2-1-like isoform X1 [Solanum tuberosum]
Length=287

 Score =   239 bits (609),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 115/129 (89%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGYS GTGLGAEIIGTF+LVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  159  GANKLNDGYSTGTGLGAEIIGTFILVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  218

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIP+TGTGINPARSFGAAVIYG  KAW+DQWIFWVGPF+GAAIAA YHQ++LRAGA K
Sbjct  219  LATIPVTGTGINPARSFGAAVIYGHHKAWNDQWIFWVGPFIGAAIAAFYHQFILRAGAVK  278

Query  319  ALGSYRSNA  293
            ALGS+RSNA
Sbjct  279  ALGSFRSNA  287



>ref|XP_007016740.1| Plasma membrane intrinsic protein 2,4 [Theobroma cacao]
 gb|EOY34359.1| Plasma membrane intrinsic protein 2,4 [Theobroma cacao]
Length=289

 Score =   239 bits (609),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 115/129 (89%), Positives = 123/129 (95%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN LQ GY+KGTGLGAEIIGTFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVH
Sbjct  161  GANELQPGYNKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVH  220

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAVIY ++KAWDDQWIFWVGPF+GAAIAA YHQY+LRA A K
Sbjct  221  LATIPITGTGINPARSFGAAVIYNREKAWDDQWIFWVGPFIGAAIAAFYHQYILRAAAIK  280

Query  319  ALGSYRSNA  293
            ALGS+RSNA
Sbjct  281  ALGSFRSNA  289



>gb|AAF65845.1|AF255795_1 aquaporin 1 [Allium cepa]
Length=291

 Score =   238 bits (608),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 118/129 (91%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L  GYSKGTGL AEIIGTFVLVYTVFAATDPKR+ARDSHVPVLAPLPIGFAVFMVH
Sbjct  163  GANTLNAGYSKGTGLAAEIIGTFVLVYTVFAATDPKRSARDSHVPVLAPLPIGFAVFMVH  222

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAVIY KDKAWDDQWIFWVGPF+GAAIAA YHQYVLRAGA K
Sbjct  223  LATIPITGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAAIAAAYHQYVLRAGAVK  282

Query  319  ALGSYRSNA  293
            ALGS+ SNA
Sbjct  283  ALGSFGSNA  291



>gb|EAZ23886.1| hypothetical protein OsJ_07605 [Oryza sativa Japonica Group]
Length=280

 Score =   238 bits (607),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 117/129 (91%), Positives = 120/129 (93%), Gaps = 1/129 (1%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGYSKGTGLGAEIIGTFVLVYTVF+ATDPKRNARDSH+PVLAPLPIGFAVFMVH
Sbjct  153  GANELSDGYSKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHIPVLAPLPIGFAVFMVH  212

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARS G AVIY KDKAWDDQWIFWVGP +GAAIAA YHQYVLRA AAK
Sbjct  213  LATIPITGTGINPARSLGTAVIYNKDKAWDDQWIFWVGPLIGAAIAAAYHQYVLRASAAK  272

Query  319  ALGSYRSNA  293
             LGSYRSNA
Sbjct  273  -LGSYRSNA  280



>dbj|BAB40141.1| plasma membrane intrinsic protein 2-1 [Pyrus communis]
Length=281

 Score =   238 bits (607),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 115/129 (89%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L  GY+KGTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVF+VH
Sbjct  153  GANELSAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFIVH  212

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARS GAAVIY KDKAWDDQWIFW+GPF+GAAIAA YHQY+LRAGA K
Sbjct  213  LATIPITGTGINPARSLGAAVIYNKDKAWDDQWIFWLGPFIGAAIAAFYHQYILRAGAIK  272

Query  319  ALGSYRSNA  293
            ALGS+RSNA
Sbjct  273  ALGSFRSNA  281



>ref|XP_009335091.1| PREDICTED: probable aquaporin PIP2-2 [Pyrus x bretschneideri]
Length=281

 Score =   238 bits (606),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 115/129 (89%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L  GY+KGTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVF+VH
Sbjct  153  GANELSAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFIVH  212

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARS GAAVIY KDKAWDDQWIFW+GPF+GAAIAA YHQY+LRAGA K
Sbjct  213  LATIPITGTGINPARSLGAAVIYNKDKAWDDQWIFWLGPFIGAAIAAFYHQYILRAGAIK  272

Query  319  ALGSYRSNA  293
            ALGS+RSNA
Sbjct  273  ALGSFRSNA  281



>ref|NP_001047491.1| Os02g0629200 [Oryza sativa Japonica Group]
 sp|Q6K215.1|PIP22_ORYSJ RecName: Full=Probable aquaporin PIP2-2; AltName: Full=OsPIP2;2; 
AltName: Full=Plasma membrane intrinsic protein 2-2 [Oryza 
sativa Japonica Group]
 dbj|BAD23735.1| putative plasma membrane integral protein [Oryza sativa Japonica 
Group]
 dbj|BAF09405.1| Os02g0629200 [Oryza sativa Japonica Group]
 dbj|BAG88109.1| unnamed protein product [Oryza sativa Japonica Group]
Length=288

 Score =   238 bits (607),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 117/129 (91%), Positives = 120/129 (93%), Gaps = 1/129 (1%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGYSKGTGLGAEIIGTFVLVYTVF+ATDPKRNARDSH+PVLAPLPIGFAVFMVH
Sbjct  161  GANELSDGYSKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHIPVLAPLPIGFAVFMVH  220

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARS G AVIY KDKAWDDQWIFWVGP +GAAIAA YHQYVLRA AAK
Sbjct  221  LATIPITGTGINPARSLGTAVIYNKDKAWDDQWIFWVGPLIGAAIAAAYHQYVLRASAAK  280

Query  319  ALGSYRSNA  293
             LGSYRSNA
Sbjct  281  -LGSYRSNA  288



>ref|XP_006381455.1| hypothetical protein POPTR_0006s13000g [Populus trichocarpa]
 gb|ABK94847.1| unknown [Populus trichocarpa]
 gb|ERP59252.1| hypothetical protein POPTR_0006s13000g [Populus trichocarpa]
Length=285

 Score =   238 bits (606),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 115/129 (89%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L  G+SKGTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  155  GANELATGFSKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  214

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAVIY KDKAWDD WIFWVGPF+GAAIAA+YHQYVLRA A K
Sbjct  215  LATIPITGTGINPARSFGAAVIYNKDKAWDDHWIFWVGPFIGAAIAALYHQYVLRAAAVK  274

Query  319  ALGSYRSNA  293
            ALGS+RS++
Sbjct  275  ALGSFRSSS  283



>ref|XP_008385311.1| PREDICTED: probable aquaporin PIP2-2 [Malus domestica]
Length=281

 Score =   238 bits (606),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 115/129 (89%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L  GY+KGTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVF+VH
Sbjct  153  GANELSAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFIVH  212

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAVIY  DKAWDDQWIFW+GPF+GAAIAA YHQY+LRAGA K
Sbjct  213  LATIPITGTGINPARSFGAAVIYNXDKAWDDQWIFWLGPFIGAAIAAFYHQYILRAGAIK  272

Query  319  ALGSYRSNA  293
            ALGS+RSNA
Sbjct  273  ALGSFRSNA  281



>ref|XP_007151872.1| hypothetical protein PHAVU_004G082700g [Phaseolus vulgaris]
 gb|ESW23866.1| hypothetical protein PHAVU_004G082700g [Phaseolus vulgaris]
Length=285

 Score =   238 bits (606),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 114/128 (89%), Positives = 121/128 (95%), Gaps = 0/128 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGYS G GLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  155  GANELSDGYSTGVGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  214

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIP+TGTGINPARS GAAVIY K+KAWDDQWIFWVGPF+GAAIAA YHQ++LRAGAAK
Sbjct  215  LATIPVTGTGINPARSLGAAVIYNKEKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAAK  274

Query  319  ALGSYRSN  296
            ALGS+RSN
Sbjct  275  ALGSFRSN  282



>gb|KJB56128.1| hypothetical protein B456_009G107200 [Gossypium raimondii]
Length=289

 Score =   238 bits (606),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 115/129 (89%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN LQ G++KGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  161  GANELQPGFNKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  220

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIP+TGTGINPARSFGAAVIY K+KAWDDQWIFWVGPF+GAA AA YHQY+LRA A K
Sbjct  221  LATIPVTGTGINPARSFGAAVIYNKEKAWDDQWIFWVGPFIGAAAAAFYHQYILRAAAIK  280

Query  319  ALGSYRSNA  293
            ALGS+RSNA
Sbjct  281  ALGSFRSNA  289



>gb|KHG00060.1| putative aquaporin PIP2-2 [Gossypium arboreum]
Length=289

 Score =   238 bits (606),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 115/129 (89%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN LQ G++KGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  161  GANELQPGFNKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  220

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIP+TGTGINPARSFGAAVIY K+KAWDDQWIFWVGPF+GAA AA YHQY+LRA A K
Sbjct  221  LATIPVTGTGINPARSFGAAVIYNKEKAWDDQWIFWVGPFIGAAAAAFYHQYILRAAAIK  280

Query  319  ALGSYRSNA  293
            ALGS+RSNA
Sbjct  281  ALGSFRSNA  289



>gb|KJB11823.1| hypothetical protein B456_002G2484001, partial [Gossypium raimondii]
Length=143

 Score =   232 bits (592),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 111/129 (86%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGYS GTGL AEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  13   GANSLADGYSTGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  72

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAV++ +DK WDD WIFWVGP +GAAIAA+YHQY+LRAGAAK
Sbjct  73   LATIPITGTGINPARSFGAAVMFNQDKPWDDHWIFWVGPLIGAAIAAIYHQYILRAGAAK  132

Query  319  ALGSYRSNA  293
            ALGS+RS++
Sbjct  133  ALGSFRSSS  141



>gb|KJB11822.1| hypothetical protein B456_002G2484001, partial [Gossypium raimondii]
Length=184

 Score =   234 bits (596),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 111/129 (86%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGYS GTGL AEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  54   GANSLADGYSTGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  113

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAV++ +DK WDD WIFWVGP +GAAIAA+YHQY+LRAGAAK
Sbjct  114  LATIPITGTGINPARSFGAAVMFNQDKPWDDHWIFWVGPLIGAAIAAIYHQYILRAGAAK  173

Query  319  ALGSYRSNA  293
            ALGS+RS++
Sbjct  174  ALGSFRSSS  182



>ref|XP_011048549.1| PREDICTED: aquaporin PIP2-1-like [Populus euphratica]
 ref|XP_011048550.1| PREDICTED: aquaporin PIP2-1-like [Populus euphratica]
 ref|XP_011048551.1| PREDICTED: aquaporin PIP2-1-like [Populus euphratica]
Length=285

 Score =   237 bits (605),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 115/129 (89%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L  G+SKGTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  155  GANELATGFSKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  214

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAVIY KDKAWDD WIFWVGPF+GAAIAA+YHQYVLRA A K
Sbjct  215  LATIPITGTGINPARSFGAAVIYNKDKAWDDHWIFWVGPFIGAAIAALYHQYVLRAAAVK  274

Query  319  ALGSYRSNA  293
            ALGS+RS++
Sbjct  275  ALGSFRSSS  283



>ref|XP_008791536.1| PREDICTED: aquaporin PIP2-4-like [Phoenix dactylifera]
Length=288

 Score =   237 bits (605),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 115/129 (89%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L  GYSKGTGL AEIIGTFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVH
Sbjct  158  GANELSSGYSKGTGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVH  217

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAVIY K+KAWDDQWIFWVGPF+GAAIA  YHQ+VLRAGA K
Sbjct  218  LATIPITGTGINPARSFGAAVIYDKEKAWDDQWIFWVGPFIGAAIATAYHQFVLRAGAVK  277

Query  319  ALGSYRSNA  293
            ALGS+RSNA
Sbjct  278  ALGSFRSNA  286



>ref|XP_011048552.1| PREDICTED: aquaporin PIP2-2-like [Populus euphratica]
Length=285

 Score =   237 bits (605),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 115/129 (89%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L  G+SKGTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  155  GANELATGFSKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  214

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAVIY KDKAWDD WIFWVGPF+GAAIAA+YHQYVLRA A K
Sbjct  215  LATIPITGTGINPARSFGAAVIYNKDKAWDDHWIFWVGPFIGAAIAALYHQYVLRAAAVK  274

Query  319  ALGSYRSNA  293
            ALGS+RS++
Sbjct  275  ALGSFRSSS  283



>gb|KHG29841.1| putative aquaporin PIP2-2 [Gossypium arboreum]
Length=291

 Score =   237 bits (605),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 113/129 (88%), Positives = 123/129 (95%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN LQDG++KGTGLGAEIIGTFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVH
Sbjct  163  GANELQDGFNKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVH  222

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAVIY ++KAWDDQWIFWVGPF+GA +AA YHQY+LRA A K
Sbjct  223  LATIPITGTGINPARSFGAAVIYNQEKAWDDQWIFWVGPFIGAFVAAFYHQYILRAAAIK  282

Query  319  ALGSYRSNA  293
            ALGS+RSNA
Sbjct  283  ALGSFRSNA  291



>emb|CBI16313.3| unnamed protein product [Vitis vinifera]
Length=196

 Score =   234 bits (596),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 113/129 (88%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L  GY+KG GLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  68   GANELAGGYNKGVGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  127

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAVIY  DKAWDD W+FWVGPF+GAAIAA YHQY+LRA A K
Sbjct  128  LATIPITGTGINPARSFGAAVIYNNDKAWDDHWMFWVGPFIGAAIAAFYHQYILRAAAIK  187

Query  319  ALGSYRSNA  293
            ALGS+RSNA
Sbjct  188  ALGSFRSNA  196



>ref|XP_007207344.1| hypothetical protein PRUPE_ppa009630mg [Prunus persica]
 gb|EMJ08543.1| hypothetical protein PRUPE_ppa009630mg [Prunus persica]
Length=284

 Score =   237 bits (604),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 114/129 (88%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GANGL DGYS+GTGL AEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVF+VH
Sbjct  154  GANGLADGYSQGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFIVH  213

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARS GAAVIY  DKAWDDQWIFWVGPF+GAAIAA YHQY+LRAGA K
Sbjct  214  LATIPITGTGINPARSLGAAVIYNNDKAWDDQWIFWVGPFIGAAIAAFYHQYILRAGAVK  273

Query  319  ALGSYRSNA  293
            ALGS+RS++
Sbjct  274  ALGSFRSSS  282



>ref|XP_010456647.1| PREDICTED: probable aquaporin PIP2-4 [Camelina sativa]
Length=285

 Score =   237 bits (604),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 114/129 (88%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGY+KGTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  157  GANELADGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  216

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAVIY K+KAWDDQWIFWVGP +GAA AA+YHQ++LRA A K
Sbjct  217  LATIPITGTGINPARSFGAAVIYNKEKAWDDQWIFWVGPMIGAAAAALYHQFILRAAAIK  276

Query  319  ALGSYRSNA  293
            ALGS+RSNA
Sbjct  277  ALGSFRSNA  285



>emb|CAH60724.1| putative plasma membrane intrinsic protein [Populus tremula x 
Populus tremuloides]
Length=285

 Score =   237 bits (604),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 114/129 (88%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GANGL  G+SKGT LGAEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  155  GANGLASGFSKGTALGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  214

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAVIY +DKAWDD WIFWVGPF+GAAIAA+YHQYVLRA A K
Sbjct  215  LATIPITGTGINPARSFGAAVIYNEDKAWDDHWIFWVGPFIGAAIAALYHQYVLRAAAVK  274

Query  319  ALGSYRSNA  293
            ALGS+RS++
Sbjct  275  ALGSFRSSS  283



>ref|XP_002461930.1| hypothetical protein SORBIDRAFT_02g010760 [Sorghum bicolor]
 gb|EER98451.1| hypothetical protein SORBIDRAFT_02g010760 [Sorghum bicolor]
Length=290

 Score =   237 bits (604),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/129 (89%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L  GYS+GTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  162  GANSLASGYSRGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  221

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIP+TGTGINPARS GAAVIY KDK WDD WIFWVGPFVGAAIAA YHQY+LRAGA K
Sbjct  222  LATIPVTGTGINPARSLGAAVIYNKDKPWDDHWIFWVGPFVGAAIAAFYHQYILRAGAIK  281

Query  319  ALGSYRSNA  293
            ALGS+RSNA
Sbjct  282  ALGSFRSNA  290



>ref|XP_004143245.1| PREDICTED: aquaporin PIP2-2-like [Cucumis sativus]
Length=284

 Score =   236 bits (603),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 114/128 (89%), Positives = 120/128 (94%), Gaps = 0/128 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGYS GTGL AEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  154  GANSLADGYSTGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  213

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAVI+ KDK WDDQWIFWVGPF+GAAIAA+YHQ VLRAGA K
Sbjct  214  LATIPITGTGINPARSFGAAVIFNKDKPWDDQWIFWVGPFIGAAIAAIYHQVVLRAGAVK  273

Query  319  ALGSYRSN  296
            ALGS+RS+
Sbjct  274  ALGSFRSS  281



>gb|AHB33479.1| plasma intrinsic protein 2-3 [Cucumis sativus]
 gb|KGN48149.1| hypothetical protein Csa_6G445140 [Cucumis sativus]
Length=284

 Score =   236 bits (603),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 114/128 (89%), Positives = 120/128 (94%), Gaps = 0/128 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGYS GTGL AEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  154  GANSLADGYSTGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  213

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAVI+ KDK WDDQWIFWVGPF+GAAIAA+YHQ VLRAGA K
Sbjct  214  LATIPITGTGINPARSFGAAVIFNKDKPWDDQWIFWVGPFIGAAIAAIYHQVVLRAGAVK  273

Query  319  ALGSYRSN  296
            ALGS+RS+
Sbjct  274  ALGSFRSS  281



>ref|XP_008243934.1| PREDICTED: probable aquaporin PIP2-5 [Prunus mume]
Length=284

 Score =   236 bits (603),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 114/129 (88%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GANGL DGYS+GTGL AEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVF+VH
Sbjct  154  GANGLADGYSQGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFIVH  213

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARS GAAVIY  DKAWDDQWIFWVGPF+GAAIAA YHQY+LRAGA K
Sbjct  214  LATIPITGTGINPARSLGAAVIYDNDKAWDDQWIFWVGPFIGAAIAAFYHQYILRAGAVK  273

Query  319  ALGSYRSNA  293
            ALGS+RS++
Sbjct  274  ALGSFRSSS  282



>gb|ACU00103.1| plasma membrane intrinsic protein PIP2.1 [Populus trichocarpa 
x Populus deltoides]
Length=285

 Score =   236 bits (603),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 114/129 (88%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L  G+SKGTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  155  GANELATGFSKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  214

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAVIY +DKAWDD WIFWVGPF+GAAIAA+YHQYVLRA A K
Sbjct  215  LATIPITGTGINPARSFGAAVIYNEDKAWDDHWIFWVGPFIGAAIAALYHQYVLRAAAVK  274

Query  319  ALGSYRSNA  293
            ALGS+RS++
Sbjct  275  ALGSFRSSS  283



>emb|CDX10333.1| aquaporin [Coffea arabica]
Length=288

 Score =   236 bits (603),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/129 (87%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN LQDGYS GTGL AEIIGTFVLVYTVF+ATDPKR+ARDSHVP+LAPLPIGFAVFMVH
Sbjct  157  GANQLQDGYSTGTGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPILAPLPIGFAVFMVH  216

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIP+TGTGINPARS GAAVIY KDKAWDDQWIFWVGPF+GAAIAA YHQ++LRAGA K
Sbjct  217  LATIPVTGTGINPARSLGAAVIYNKDKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVK  276

Query  319  ALGSYRSNA  293
            ALGS+RS++
Sbjct  277  ALGSFRSSS  285



>ref|XP_004156296.1| PREDICTED: aquaporin PIP2-2-like [Cucumis sativus]
Length=284

 Score =   236 bits (603),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 114/128 (89%), Positives = 120/128 (94%), Gaps = 0/128 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGYS GTGL AEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  154  GANSLADGYSTGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  213

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAVI+ KDK WDDQWIFWVGPF+GAAIAA+YHQ VLRAGA K
Sbjct  214  LATIPITGTGINPARSFGAAVIFNKDKPWDDQWIFWVGPFIGAAIAAIYHQVVLRAGAVK  273

Query  319  ALGSYRSN  296
            ALGS+RS+
Sbjct  274  ALGSFRSS  281



>ref|XP_003625627.1| Aquaporin PIP2-1 [Medicago truncatula]
 gb|ABD32807.1| Major intrinsic protein [Medicago truncatula]
 gb|AES81845.1| major intrinsic protein (MIP) family transporter [Medicago truncatula]
Length=287

 Score =   236 bits (603),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 116/131 (89%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L  GYSKGTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  157  GANMLSAGYSKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  216

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAVIY  +KAWDDQWIFWVGPF+GAAIAA+YHQ+VLRA AAK
Sbjct  217  LATIPITGTGINPARSFGAAVIYNNEKAWDDQWIFWVGPFIGAAIAAIYHQFVLRAQAAK  276

Query  319  ALGSYRSNA*L  287
            ALGS+RS++ L
Sbjct  277  ALGSFRSSSNL  287



>ref|XP_007151871.1| hypothetical protein PHAVU_004G082600g [Phaseolus vulgaris]
 gb|ESW23865.1| hypothetical protein PHAVU_004G082600g [Phaseolus vulgaris]
Length=285

 Score =   236 bits (602),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 113/128 (88%), Positives = 121/128 (95%), Gaps = 0/128 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L +GYS G GLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  155  GANELSEGYSTGVGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  214

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIP+TGTGINPARS GAAVIY K+KAWDDQWIFWVGPF+GAAIAA YHQ++LRAGAAK
Sbjct  215  LATIPVTGTGINPARSLGAAVIYNKEKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAAK  274

Query  319  ALGSYRSN  296
            ALGS+RSN
Sbjct  275  ALGSFRSN  282



>ref|XP_010098191.1| Aquaporin PIP2-7 [Morus notabilis]
 gb|EXB74647.1| Aquaporin PIP2-7 [Morus notabilis]
Length=281

 Score =   236 bits (602),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 115/129 (89%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L D Y+KG GLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  153  GANTLADHYNKGVGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  212

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAVIY  DKAWDDQWIFWVGPF+GAAIAA YHQY+LRAGA K
Sbjct  213  LATIPITGTGINPARSFGAAVIYNNDKAWDDQWIFWVGPFIGAAIAAFYHQYILRAGAIK  272

Query  319  ALGSYRSNA  293
            ALGS+RS A
Sbjct  273  ALGSFRSTA  281



>gb|KJB20285.1| hypothetical protein B456_003G141600 [Gossypium raimondii]
Length=320

 Score =   237 bits (605),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 113/129 (88%), Positives = 123/129 (95%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN LQDG++KGTGLGAEIIGTFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVH
Sbjct  192  GANELQDGFNKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVH  251

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAVIY ++KAWDDQWIFWVGPF+GA +AA YHQY+LRA A K
Sbjct  252  LATIPITGTGINPARSFGAAVIYNQEKAWDDQWIFWVGPFIGAFVAAFYHQYILRAAAIK  311

Query  319  ALGSYRSNA  293
            ALGS+RSNA
Sbjct  312  ALGSFRSNA  320



>emb|CBI31462.3| unnamed protein product [Vitis vinifera]
Length=198

 Score =   233 bits (594),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 112/128 (88%), Positives = 119/128 (93%), Gaps = 0/128 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L  GYSKGTGLGAEIIGTFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVH
Sbjct  68   GANELSTGYSKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVH  127

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARS GAAVIY  +KAWDDQWIFWVGPF+GAAIAA YHQ++LRAGA K
Sbjct  128  LATIPITGTGINPARSLGAAVIYNNEKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVK  187

Query  319  ALGSYRSN  296
            ALGS+RS 
Sbjct  188  ALGSFRST  195



>gb|AAL49751.1|AF452013_1 aquaporin-like protein [Petunia x hybrida]
Length=256

 Score =   235 bits (599),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 112/132 (85%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = -2

Query  691  DMAAGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAV  512
             +  GAN +  GY+KGT LGAEIIGTFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAV
Sbjct  122  SLGGGANEVASGYNKGTALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAV  181

Query  511  FMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRA  332
            FMVHLATIPITGTGINPARSFGAAVIY +DKAWDDQWIFWVGPF+GA IAA+YHQ+VLRA
Sbjct  182  FMVHLATIPITGTGINPARSFGAAVIYNQDKAWDDQWIFWVGPFIGALIAALYHQFVLRA  241

Query  331  GAAKALGSYRSN  296
            GA KALGS+RSN
Sbjct  242  GAVKALGSFRSN  253



>ref|XP_004304428.1| PREDICTED: aquaporin PIP2-1-like [Fragaria vesca subsp. vesca]
Length=284

 Score =   236 bits (602),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 113/129 (88%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GANGL DGY+KGTGL AEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  154  GANGLADGYNKGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  213

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARS GAAVIY  +KAWDD WIFWVGPF+GAAIAA+YHQY+LRAGA K
Sbjct  214  LATIPITGTGINPARSLGAAVIYNNEKAWDDHWIFWVGPFIGAAIAAMYHQYILRAGAVK  273

Query  319  ALGSYRSNA  293
            ALGS+RS++
Sbjct  274  ALGSFRSSS  282



>ref|XP_006424576.1| hypothetical protein CICLE_v10028975mg [Citrus clementina]
 ref|XP_006488095.1| PREDICTED: aquaporin PIP2-1-like [Citrus sinensis]
 gb|ESR37816.1| hypothetical protein CICLE_v10028975mg [Citrus clementina]
 gb|KDO73274.1| hypothetical protein CISIN_1g022966mg [Citrus sinensis]
Length=289

 Score =   236 bits (602),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 114/129 (88%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGY+KGTGLGAEIIGTFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVH
Sbjct  161  GANELADGYNKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVH  220

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAVIY K+KAWDDQWIFWVGPF+GA +AA YHQY+LRA A K
Sbjct  221  LATIPITGTGINPARSFGAAVIYNKEKAWDDQWIFWVGPFIGAFVAAFYHQYILRAAAIK  280

Query  319  ALGSYRSNA  293
            ALGS+RSNA
Sbjct  281  ALGSFRSNA  289



>gb|AAW55294.1| aquaporin 2 [Aegiceras corniculatum]
Length=193

 Score =   233 bits (593),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 113/129 (88%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGY+KGTGLGAEIIGTFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVH
Sbjct  65   GANYLHDGYNKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVH  124

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARS GAAVIY K K WDDQWIFW GPF+GA IAA YHQ++LRAGA K
Sbjct  125  LATIPITGTGINPARSLGAAVIYNKKKTWDDQWIFWGGPFIGAPIAAFYHQFILRAGAIK  184

Query  319  ALGSYRSNA  293
            ALGSYRSNA
Sbjct  185  ALGSYRSNA  193



>gb|ACU24483.1| unknown [Glycine max]
Length=284

 Score =   236 bits (601),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 113/128 (88%), Positives = 120/128 (94%), Gaps = 0/128 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGYS GTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  154  GANSLADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  213

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIP+TGTGINPARS GAAVIY +DK WDD WIFWVGPF+GAAIAA YHQ++LRAGAAK
Sbjct  214  LATIPVTGTGINPARSLGAAVIYNQDKPWDDHWIFWVGPFIGAAIAAFYHQFILRAGAAK  273

Query  319  ALGSYRSN  296
            ALGS+RSN
Sbjct  274  ALGSFRSN  281



>gb|ADJ57599.1| plasma membrane intrinsic protein PIP2;1 [Fragaria chiloensis]
Length=284

 Score =   236 bits (601),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 114/133 (86%), Positives = 122/133 (92%), Gaps = 0/133 (0%)
 Frame = -2

Query  691  DMAAGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAV  512
            +   GAN L  GYSKGTGL AEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAV
Sbjct  152  EYGGGANSLAPGYSKGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAV  211

Query  511  FMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRA  332
            FMVHLATIPITGTGINPARSFGAAVIY +DKAWDD W+FW+GPF+GAAIAA YHQ+VLRA
Sbjct  212  FMVHLATIPITGTGINPARSFGAAVIYNQDKAWDDHWMFWLGPFIGAAIAAFYHQFVLRA  271

Query  331  GAAKALGSYRSNA  293
            GA KALGS+RSNA
Sbjct  272  GAIKALGSFRSNA  284



>ref|XP_004291577.1| PREDICTED: aquaporin PIP2-2 [Fragaria vesca subsp. vesca]
Length=281

 Score =   235 bits (600),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 114/133 (86%), Positives = 122/133 (92%), Gaps = 0/133 (0%)
 Frame = -2

Query  691  DMAAGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAV  512
            +   GAN L  GYSKGTGL AEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAV
Sbjct  149  EYGGGANTLAPGYSKGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAV  208

Query  511  FMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRA  332
            FMVHLATIPITGTGINPARSFGAAVIY +DKAWDD W+FW+GPF+GAAIAA YHQ+VLRA
Sbjct  209  FMVHLATIPITGTGINPARSFGAAVIYNQDKAWDDHWMFWLGPFIGAAIAAFYHQFVLRA  268

Query  331  GAAKALGSYRSNA  293
            GA KALGS+RSNA
Sbjct  269  GAIKALGSFRSNA  281



>ref|XP_009345382.1| PREDICTED: probable aquaporin PIP2-5 [Pyrus x bretschneideri]
Length=287

 Score =   236 bits (601),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 113/128 (88%), Positives = 120/128 (94%), Gaps = 0/128 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGYS G GLGAEIIGTFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVF+VH
Sbjct  157  GANSLSDGYSTGVGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFIVH  216

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARS GAAVIY KDKAWDDQWIFWVGPF+GAAIAA YHQ++LRAGA K
Sbjct  217  LATIPITGTGINPARSLGAAVIYNKDKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVK  276

Query  319  ALGSYRSN  296
            ALGS+RSN
Sbjct  277  ALGSFRSN  284



>gb|AFQ23186.1| aquaporin PIP2;1 [Eustoma exaltatum subsp. russellianum]
Length=286

 Score =   236 bits (601),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 115/128 (90%), Positives = 121/128 (95%), Gaps = 0/128 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN +  GY+KG GL AEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  158  GANMVAPGYTKGVGLSAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  217

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAVIYG DKAWDDQWIFWVGPFVGAAIAA+YHQY+LRAGA K
Sbjct  218  LATIPITGTGINPARSFGAAVIYGADKAWDDQWIFWVGPFVGAAIAALYHQYILRAGAIK  277

Query  319  ALGSYRSN  296
            ALGS+RSN
Sbjct  278  ALGSFRSN  285



>ref|XP_003556232.1| PREDICTED: aquaporin PIP2-1-like [Glycine max]
 gb|KHN00839.1| Putative aquaporin PIP2-5 [Glycine soja]
Length=284

 Score =   235 bits (600),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 113/128 (88%), Positives = 120/128 (94%), Gaps = 0/128 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGYS GTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  154  GANSLADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  213

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIP+TGTGINPARS GAAVIY +DK WDD WIFWVGPF+GAAIAA YHQ++LRAGAAK
Sbjct  214  LATIPVTGTGINPARSLGAAVIYNQDKPWDDHWIFWVGPFIGAAIAAFYHQFILRAGAAK  273

Query  319  ALGSYRSN  296
            ALGS+RSN
Sbjct  274  ALGSFRSN  281



>gb|ACZ06859.1| plasma membrane intrinsic protein [Glycine soja]
Length=284

 Score =   235 bits (600),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 113/128 (88%), Positives = 120/128 (94%), Gaps = 0/128 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGYS GTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  154  GANSLADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  213

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIP+TGTGINPARS GAAVIY +DK WDD WIFWVGPF+GAAIAA YHQ++LRAGAAK
Sbjct  214  LATIPVTGTGINPARSLGAAVIYNQDKPWDDHWIFWVGPFIGAAIAAFYHQFILRAGAAK  273

Query  319  ALGSYRSN  296
            ALGS+RSN
Sbjct  274  ALGSFRSN  281



>dbj|BAG06231.1| plasma membrane intrinsic protein [Hordeum vulgare]
 dbj|BAK01580.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK01902.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=290

 Score =   236 bits (601),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 115/129 (89%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L  GYSKGTGL AEIIGTFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVH
Sbjct  162  GANTLAAGYSKGTGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVH  221

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARS GAAVIY KDKAWDDQWIFWVGP +GAAIAA YHQY+LRAGA K
Sbjct  222  LATIPITGTGINPARSLGAAVIYNKDKAWDDQWIFWVGPMIGAAIAAFYHQYILRAGAIK  281

Query  319  ALGSYRSNA  293
            ALGS+RSNA
Sbjct  282  ALGSFRSNA  290



>gb|AFK33316.1| unknown [Medicago truncatula]
Length=287

 Score =   235 bits (600),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 115/127 (91%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L  GYSKGTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  157  GANMLSAGYSKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  216

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAVIY  +KAWDDQWIFWVGPF+GAAIAA+YHQ+VLRA AAK
Sbjct  217  LATIPITGTGINPARSFGAAVIYNNEKAWDDQWIFWVGPFIGAAIAAIYHQFVLRAQAAK  276

Query  319  ALGSYRS  299
            ALGS+RS
Sbjct  277  ALGSFRS  283



>gb|ABK60195.2| PIP2 protein [Gossypium hirsutum]
Length=285

 Score =   235 bits (600),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 112/129 (87%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGYS GTGL AEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  155  GANSLADGYSTGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  214

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAV++ +DK WDD WIFWVGPF+GAAIAA+YHQY+LRAGAAK
Sbjct  215  LATIPITGTGINPARSFGAAVMFNQDKPWDDHWIFWVGPFIGAAIAAIYHQYILRAGAAK  274

Query  319  ALGSYRSNA  293
            ALGS+RS++
Sbjct  275  ALGSFRSSS  283



>gb|KHG08488.1| putative aquaporin PIP2-2 [Gossypium arboreum]
Length=285

 Score =   235 bits (600),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 113/128 (88%), Positives = 120/128 (94%), Gaps = 0/128 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN LQ G++KGTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  158  GANELQSGFNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  217

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIP+TGTGINPARSFGAAVIY K+KAWDDQWIFWVGPF+GAAIAA YHQY+LRA A K
Sbjct  218  LATIPVTGTGINPARSFGAAVIYNKEKAWDDQWIFWVGPFIGAAIAAFYHQYILRAAAIK  277

Query  319  ALGSYRSN  296
            A GS RSN
Sbjct  278  AFGSSRSN  285



>gb|KJB21561.1| hypothetical protein B456_004G001400 [Gossypium raimondii]
Length=285

 Score =   235 bits (600),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 113/128 (88%), Positives = 120/128 (94%), Gaps = 0/128 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN LQ G++KGTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  158  GANELQSGFNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  217

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIP+TGTGINPARSFGAAVIY K+KAWDDQWIFWVGPF+GAAIAA YHQY+LRA A K
Sbjct  218  LATIPVTGTGINPARSFGAAVIYNKEKAWDDQWIFWVGPFIGAAIAAFYHQYILRAAAIK  277

Query  319  ALGSYRSN  296
            A GS RSN
Sbjct  278  AFGSSRSN  285



>ref|XP_007143702.1| hypothetical protein PHAVU_007G094600g [Phaseolus vulgaris]
 gb|AGV54658.1| aquaporin PIP2 [Phaseolus vulgaris]
 gb|ESW15696.1| hypothetical protein PHAVU_007G094600g [Phaseolus vulgaris]
Length=287

 Score =   235 bits (600),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 113/128 (88%), Positives = 119/128 (93%), Gaps = 0/128 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGYS GTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  157  GANSLADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  216

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIP+TGTGINPARS GAAVIY KDK WDD WIFWVGPF+GAAIAA YHQ++LRAGA K
Sbjct  217  LATIPVTGTGINPARSLGAAVIYNKDKPWDDHWIFWVGPFIGAAIAAFYHQFILRAGAVK  276

Query  319  ALGSYRSN  296
            ALGS+RSN
Sbjct  277  ALGSFRSN  284



>ref|XP_011044357.1| PREDICTED: probable aquaporin PIP2-4 [Populus euphratica]
Length=284

 Score =   235 bits (599),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 112/129 (87%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN LQ+GY+KGTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  156  GANELQEGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  215

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAVI+ + KAWDD W+FWVGPF+GAAIAA YHQ++LRA A K
Sbjct  216  LATIPITGTGINPARSFGAAVIFNQSKAWDDHWLFWVGPFIGAAIAAFYHQFILRAAAIK  275

Query  319  ALGSYRSNA  293
            ALGS+RSNA
Sbjct  276  ALGSFRSNA  284



>ref|XP_002313510.1| hypothetical protein POPTR_0009s01940g [Populus trichocarpa]
 gb|EEE87465.1| hypothetical protein POPTR_0009s01940g [Populus trichocarpa]
Length=284

 Score =   235 bits (599),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 112/129 (87%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN LQ+GY+KGTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  156  GANELQEGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  215

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAVI+ + KAWDD W+FWVGPF+GAAIAA YHQ++LRA A K
Sbjct  216  LATIPITGTGINPARSFGAAVIFNQSKAWDDHWLFWVGPFIGAAIAAFYHQFILRAAAIK  275

Query  319  ALGSYRSNA  293
            ALGS+RSNA
Sbjct  276  ALGSFRSNA  284



>ref|XP_010042277.1| PREDICTED: aquaporin PIP2-1-like [Eucalyptus grandis]
Length=257

 Score =   234 bits (597),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 113/129 (88%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGYSKG GLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  129  GANELSDGYSKGVGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  188

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIP+TGTGINPARS GAAV+Y KDKAWDDQW+FWVGPF+GAAIAA Y+QY+LRAGA K
Sbjct  189  LATIPVTGTGINPARSLGAAVMYNKDKAWDDQWMFWVGPFIGAAIAAFYYQYILRAGAVK  248

Query  319  ALGSYRSNA  293
            A GS RSNA
Sbjct  249  AFGSSRSNA  257



>ref|XP_006428786.1| hypothetical protein CICLE_v10012379mg [Citrus clementina]
 gb|ESR42026.1| hypothetical protein CICLE_v10012379mg [Citrus clementina]
Length=287

 Score =   235 bits (599),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 112/129 (87%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGYS GTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  157  GANELADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  216

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIP+TGTGINPARS GAAVIY KDKAWDDQWIFWVGPF+GAAIAA YHQ++LRA A+K
Sbjct  217  LATIPVTGTGINPARSLGAAVIYKKDKAWDDQWIFWVGPFIGAAIAAFYHQFILRASASK  276

Query  319  ALGSYRSNA  293
            ALGS++S++
Sbjct  277  ALGSFKSSS  285



>ref|XP_006381453.1| hypothetical protein POPTR_0006s12980g [Populus trichocarpa]
 gb|ABK96511.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|ERP59250.1| hypothetical protein POPTR_0006s12980g [Populus trichocarpa]
Length=285

 Score =   235 bits (599),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 113/129 (88%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            G N L  G+SKGTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  155  GVNELATGFSKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  214

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAVIY +DKAWDD WIFWVGPF+GAAIAA+YHQYVLRA A K
Sbjct  215  LATIPITGTGINPARSFGAAVIYNEDKAWDDHWIFWVGPFIGAAIAALYHQYVLRAAAVK  274

Query  319  ALGSYRSNA  293
            ALGS+RS++
Sbjct  275  ALGSFRSSS  283



>ref|XP_011089904.1| PREDICTED: LOW QUALITY PROTEIN: aquaporin PIP2-7-like [Sesamum 
indicum]
Length=278

 Score =   234 bits (598),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 114/129 (88%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L  GY+KG GLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  150  GANELAAGYNKGVGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  209

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAVIY  DKAWDD WIFWVGPF+GAAIAA YHQY+LRA A K
Sbjct  210  LATIPITGTGINPARSFGAAVIYNDDKAWDDHWIFWVGPFIGAAIAAFYHQYILRAAAIK  269

Query  319  ALGSYRSNA  293
            ALGS+RSNA
Sbjct  270  ALGSFRSNA  278



>ref|XP_010043747.1| PREDICTED: probable aquaporin PIP2-5 [Eucalyptus grandis]
 gb|KCW85738.1| hypothetical protein EUGRSUZ_B02500 [Eucalyptus grandis]
Length=284

 Score =   235 bits (599),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 113/129 (88%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGYSKG GLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  156  GANELSDGYSKGVGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  215

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIP+TGTGINPARS GAAV+Y KDKAWDDQW+FWVGPF+GAAIAA Y+QY+LRAGA K
Sbjct  216  LATIPVTGTGINPARSLGAAVMYNKDKAWDDQWMFWVGPFIGAAIAAFYYQYILRAGAVK  275

Query  319  ALGSYRSNA  293
            A GS RSNA
Sbjct  276  AFGSSRSNA  284



>gb|ABC70536.1| aquaporin protein [Vitis pseudoreticulata]
Length=159

 Score =   230 bits (587),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 111/128 (87%), Positives = 119/128 (93%), Gaps = 0/128 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L  GYSKGTGLGAEIIGTFVLVYTVF+ATDPKR+ARDSH+PVLAPLPIGFAVFMVH
Sbjct  29   GANELSAGYSKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHIPVLAPLPIGFAVFMVH  88

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARS GAAVIY  +KAWDDQWIFWVGPF+GAAIAA YHQ++LRAGA K
Sbjct  89   LATIPITGTGINPARSLGAAVIYNNEKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAIK  148

Query  319  ALGSYRSN  296
            ALGS+RS 
Sbjct  149  ALGSFRST  156



>ref|XP_008785285.1| PREDICTED: aquaporin PIP2-4 [Phoenix dactylifera]
Length=287

 Score =   235 bits (599),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 114/127 (90%), Positives = 119/127 (94%), Gaps = 0/127 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L  GYS+GTGL AEIIGTFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVH
Sbjct  160  GANELSSGYSRGTGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVH  219

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAVIY +DKAWDDQWIFWVGPF+GAAIAA YHQYVLRA A K
Sbjct  220  LATIPITGTGINPARSFGAAVIYNEDKAWDDQWIFWVGPFIGAAIAAAYHQYVLRASAGK  279

Query  319  ALGSYRS  299
            ALGSYRS
Sbjct  280  ALGSYRS  286



>ref|XP_010443868.1| PREDICTED: probable aquaporin PIP2-4 [Camelina sativa]
Length=286

 Score =   235 bits (599),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 113/129 (88%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGY+KGTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  158  GANELADGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  217

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAVIY K+KAWDDQWIFWVGP +GAA AA+YHQ++LRA A K
Sbjct  218  LATIPITGTGINPARSFGAAVIYNKEKAWDDQWIFWVGPMIGAAAAALYHQFILRAAAIK  277

Query  319  ALGSYRSNA  293
            ALGS+RS+A
Sbjct  278  ALGSFRSSA  286



>gb|AIA83106.1| putative aquaporin PIP2 [Citrus trifoliata]
Length=292

 Score =   235 bits (599),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/129 (88%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGY+KGTGLGAEIIGTFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVH
Sbjct  164  GANELADGYNKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVH  223

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAVIY K+KAWDDQWI WVGPF+GA +AA YHQY+LRA A K
Sbjct  224  LATIPITGTGINPARSFGAAVIYNKEKAWDDQWILWVGPFIGAFVAAFYHQYILRAAAIK  283

Query  319  ALGSYRSNA  293
            ALGS+RSNA
Sbjct  284  ALGSFRSNA  292



>ref|XP_009413714.1| PREDICTED: aquaporin PIP2-4-like isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=287

 Score =   234 bits (598),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 116/129 (90%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L  GYSKGTGL AEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  159  GANELSAGYSKGTGLAAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  218

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARS GAAVIY +DKAWDDQWIFWVGPFVGAAIAA YHQYVLRA  AK
Sbjct  219  LATIPITGTGINPARSLGAAVIYNQDKAWDDQWIFWVGPFVGAAIAAAYHQYVLRASGAK  278

Query  319  ALGSYRSNA  293
            A+GS+ SNA
Sbjct  279  AMGSFGSNA  287



>ref|XP_010521765.1| PREDICTED: aquaporin PIP2-7-like [Tarenaya hassleriana]
Length=286

 Score =   234 bits (598),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 115/129 (89%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L  GY+KGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  158  GANVLASGYNKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  217

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAVIY +DKAWDD W+FWVGPF+GA  AAVYHQYVLRA A K
Sbjct  218  LATIPITGTGINPARSFGAAVIYNQDKAWDDHWLFWVGPFIGALAAAVYHQYVLRAAAIK  277

Query  319  ALGSYRSNA  293
            ALGS+RSNA
Sbjct  278  ALGSFRSNA  286



>ref|NP_001105024.1| aquaporin PIP2-1 [Zea mays]
 sp|Q84RL7.2|PIP21_MAIZE RecName: Full=Aquaporin PIP2-1; AltName: Full=Plasma membrane 
intrinsic protein 2-1; AltName: Full=ZmPIP2-1; AltName: Full=ZmPIP2;1 
[Zea mays]
 gb|AAK26758.1| plasma membrane integral protein ZmPIP2-1 [Zea mays]
 gb|ACF78965.1| unknown [Zea mays]
 gb|ACF84592.1| unknown [Zea mays]
 gb|ACF86144.1| unknown [Zea mays]
 gb|ACG31774.1| aquaporin PIP2.1 [Zea mays]
 tpg|DAA60473.1| TPA: plasma membrane intrinsic protein2 [Zea mays]
Length=290

 Score =   234 bits (598),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 114/129 (88%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L  GYS+GTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  162  GANSLASGYSRGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  221

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIP+TGTGINPARS GAAVIY KDK WDD WIFWVGP VGAAIAA YHQY+LRAGA K
Sbjct  222  LATIPVTGTGINPARSLGAAVIYNKDKPWDDHWIFWVGPLVGAAIAAFYHQYILRAGAIK  281

Query  319  ALGSYRSNA  293
            ALGS+RSNA
Sbjct  282  ALGSFRSNA  290



>ref|XP_008791535.1| PREDICTED: aquaporin PIP2-4-like [Phoenix dactylifera]
Length=287

 Score =   234 bits (598),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 114/127 (90%), Positives = 119/127 (94%), Gaps = 0/127 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L  GYSKGTGL AEIIGTFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVH
Sbjct  160  GANELSSGYSKGTGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVH  219

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAVIY K+KAWDDQWIFWVGPF+GAAIA  YHQYVLRA AAK
Sbjct  220  LATIPITGTGINPARSFGAAVIYNKEKAWDDQWIFWVGPFIGAAIAEAYHQYVLRASAAK  279

Query  319  ALGSYRS  299
            ALGS+RS
Sbjct  280  ALGSFRS  286



>ref|XP_004956113.1| PREDICTED: aquaporin PIP2-1-like [Setaria italica]
Length=289

 Score =   234 bits (598),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 114/129 (88%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L  GYS+GTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  161  GANSLASGYSRGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  220

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIP+TGTGINPARS GAAVIY KDK WDD WIFWVGPF GAAIAA YHQY+LRAGA K
Sbjct  221  LATIPVTGTGINPARSLGAAVIYNKDKPWDDHWIFWVGPFAGAAIAAFYHQYILRAGAIK  280

Query  319  ALGSYRSNA  293
            ALGS+RSNA
Sbjct  281  ALGSFRSNA  289



>ref|XP_003563177.1| PREDICTED: probable aquaporin PIP2-1 [Brachypodium distachyon]
Length=290

 Score =   234 bits (598),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 115/129 (89%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L  GYSKGTGL AEIIGTFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVH
Sbjct  162  GANTLAAGYSKGTGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVH  221

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARS GAAVI+ KDKAWDDQWIFWVGP VGAAIAA YHQY+LRAGA K
Sbjct  222  LATIPITGTGINPARSLGAAVIFNKDKAWDDQWIFWVGPMVGAAIAAFYHQYILRAGAIK  281

Query  319  ALGSYRSNA  293
            ALGS+RSNA
Sbjct  282  ALGSFRSNA  290



>ref|XP_006648854.1| PREDICTED: probable aquaporin PIP2-2-like [Oryza brachyantha]
Length=262

 Score =   234 bits (596),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 116/129 (90%), Positives = 119/129 (92%), Gaps = 1/129 (1%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L  GYSKGTGLGAEIIGTFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVH
Sbjct  135  GANELSSGYSKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVH  194

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARS GAAVIY  DKAWDDQWIFWVGP +GAAIAA YHQYVLRA AAK
Sbjct  195  LATIPITGTGINPARSLGAAVIYNNDKAWDDQWIFWVGPLIGAAIAAAYHQYVLRASAAK  254

Query  319  ALGSYRSNA  293
             LGSYRSNA
Sbjct  255  -LGSYRSNA  262



>gb|ACG32567.1| aquaporin PIP2.1 [Zea mays]
Length=290

 Score =   234 bits (598),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 114/129 (88%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L  GYS+GTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  162  GANSLASGYSRGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  221

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIP+TGTGINPARS GAAVIY KDK WDD WIFWVGP VGAAIAA YHQY+LRAGA K
Sbjct  222  LATIPVTGTGINPARSLGAAVIYNKDKPWDDHWIFWVGPLVGAAIAAFYHQYILRAGAIK  281

Query  319  ALGSYRSNA  293
            ALGS+RSNA
Sbjct  282  ALGSFRSNA  290



>gb|AIG92831.1| aquaporin PIP2 [Chrysanthemum x morifolium]
Length=285

 Score =   234 bits (598),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/128 (88%), Positives = 122/128 (95%), Gaps = 0/128 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGY+KGTGLGAEIIGTFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVH
Sbjct  155  GANSLADGYNKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVH  214

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIP+TGTGINPARSFGAAVIY K+K WDDQWIFWVGPF+GAAIAA YHQ++LRAGA K
Sbjct  215  LATIPVTGTGINPARSFGAAVIYNKEKIWDDQWIFWVGPFIGAAIAAFYHQFILRAGAIK  274

Query  319  ALGSYRSN  296
            ALGS+RS+
Sbjct  275  ALGSFRSS  282



>gb|ABU94631.1| putative aquaporin PIP2;3 [Phaseolus vulgaris]
Length=287

 Score =   234 bits (598),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/128 (88%), Positives = 119/128 (93%), Gaps = 0/128 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGYS GTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  157  GANSLADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  216

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIP+TGTGINPARS GAAVIY KDK WDD WIFWVGPF+GAAIAA YHQ++LRAGA K
Sbjct  217  LATIPVTGTGINPARSLGAAVIYNKDKPWDDHWIFWVGPFIGAAIAAFYHQFILRAGAVK  276

Query  319  ALGSYRSN  296
            ALGS+RSN
Sbjct  277  ALGSFRSN  284



>gb|KHG30776.1| Aquaporin PIP2-2 -like protein [Gossypium arboreum]
Length=285

 Score =   234 bits (597),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 111/129 (86%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGYS GTGL AEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  155  GANSLADGYSTGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  214

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAV++ +DK WDD WIFWVGPF+GAAIAA+YH+Y+LRAGAAK
Sbjct  215  LATIPITGTGINPARSFGAAVMFNQDKPWDDHWIFWVGPFIGAAIAAIYHEYILRAGAAK  274

Query  319  ALGSYRSNA  293
            ALGS+RS++
Sbjct  275  ALGSFRSSS  283



>gb|AIA83104.1| putative aquaporin PIP2 [Citrus sinensis x Citrus trifoliata]
Length=290

 Score =   234 bits (598),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/129 (88%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGY+KGTGLGAEIIGTFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVH
Sbjct  162  GANELADGYNKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVH  221

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPI GTGINPARSFGAAVIY K+KAWDDQWIFWVGPF+GA +AA YHQY+LRA A K
Sbjct  222  LATIPIIGTGINPARSFGAAVIYNKEKAWDDQWIFWVGPFIGAFVAAFYHQYILRAAAIK  281

Query  319  ALGSYRSNA  293
            ALGS+RSNA
Sbjct  282  ALGSFRSNA  290



>ref|NP_001274308.1| aquaporin PIP2-1-like [Solanum lycopersicum]
 dbj|BAO18628.1| plasmamembrane intrinsic protein 2;5 [Solanum lycopersicum]
Length=281

 Score =   234 bits (597),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/129 (87%), Positives = 123/129 (95%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L  GY+  TGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  153  GANELAVGYNIATGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  212

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAVIYGK+K+WDDQWIFWVGPF+GAAIAA+YHQY+LRAGA+K
Sbjct  213  LATIPITGTGINPARSFGAAVIYGKNKSWDDQWIFWVGPFIGAAIAAIYHQYILRAGASK  272

Query  319  ALGSYRSNA  293
            ++ S+RSNA
Sbjct  273  SINSFRSNA  281



>ref|XP_006481455.1| PREDICTED: aquaporin PIP2-2-like [Citrus sinensis]
Length=287

 Score =   234 bits (597),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 111/129 (86%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGYS GTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  157  GANELADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  216

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIP+TGTGINPARS GAAVIY K+KAWDDQWIFWVGPF+GAAIAA YHQ++LRA A+K
Sbjct  217  LATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYHQFILRASASK  276

Query  319  ALGSYRSNA  293
            ALGS++S++
Sbjct  277  ALGSFKSSS  285



>ref|XP_009342858.1| PREDICTED: probable aquaporin PIP2-5 isoform X1 [Pyrus x bretschneideri]
Length=285

 Score =   234 bits (597),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/128 (88%), Positives = 121/128 (95%), Gaps = 0/128 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGYS GTGLGAEI+GTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVF+VH
Sbjct  155  GANELADGYSTGTGLGAEIVGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFIVH  214

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARS GAAVIY  DKAW+DQWIFWVGPF+GAAIAA+YHQY+LRAGA K
Sbjct  215  LATIPITGTGINPARSLGAAVIYNNDKAWNDQWIFWVGPFIGAAIAALYHQYILRAGAVK  274

Query  319  ALGSYRSN  296
            ALGS+RS+
Sbjct  275  ALGSFRSS  282



>gb|ABB13430.2| plasma membrane intrinsic protein [Olea europaea]
Length=287

 Score =   234 bits (597),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 114/129 (88%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L  GY+KG GLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  159  GANELAPGYNKGVGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  218

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAVIY +DK WDD WIFWVGPFVGA IAA+YHQY+LRAGA K
Sbjct  219  LATIPITGTGINPARSFGAAVIYNEDKPWDDHWIFWVGPFVGALIAAIYHQYILRAGAIK  278

Query  319  ALGSYRSNA  293
            ALGS+RSNA
Sbjct  279  ALGSFRSNA  287



>ref|XP_006339071.1| PREDICTED: aquaporin PIP2-1-like [Solanum tuberosum]
Length=281

 Score =   234 bits (597),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/129 (87%), Positives = 123/129 (95%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L  GY+  TGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  153  GANELAVGYNTATGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  212

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAVIYGK+K+WDDQWIFWVGPF+GAAIAA+YHQY+LRAGA+K
Sbjct  213  LATIPITGTGINPARSFGAAVIYGKNKSWDDQWIFWVGPFIGAAIAALYHQYILRAGASK  272

Query  319  ALGSYRSNA  293
            ++ S+RSNA
Sbjct  273  SINSFRSNA  281



>ref|XP_009342865.1| PREDICTED: probable aquaporin PIP2-5 isoform X2 [Pyrus x bretschneideri]
Length=285

 Score =   234 bits (597),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/128 (88%), Positives = 121/128 (95%), Gaps = 0/128 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGYS GTGLGAEI+GTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVF+VH
Sbjct  155  GANELADGYSTGTGLGAEIVGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFIVH  214

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARS GAAVIY  DKAW+DQWIFWVGPF+GAAIAA+YHQY+LRAGA K
Sbjct  215  LATIPITGTGINPARSLGAAVIYNNDKAWNDQWIFWVGPFIGAAIAALYHQYILRAGAVK  274

Query  319  ALGSYRSN  296
            ALGS+RS+
Sbjct  275  ALGSFRSS  282



>ref|XP_008387595.1| PREDICTED: probable aquaporin PIP2-5 [Malus domestica]
Length=285

 Score =   234 bits (597),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/128 (88%), Positives = 121/128 (95%), Gaps = 0/128 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGYS GTGLGAEI+GTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVF+VH
Sbjct  155  GANELADGYSTGTGLGAEIVGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFIVH  214

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARS GAAVIY  DKAW+DQWIFWVGPF+GAAIAA+YHQY+LRAGA K
Sbjct  215  LATIPITGTGINPARSLGAAVIYNNDKAWNDQWIFWVGPFIGAAIAALYHQYILRAGAVK  274

Query  319  ALGSYRSN  296
            ALGS+RS+
Sbjct  275  ALGSFRSS  282



>gb|AAV80229.1| aquaporin 2 [Aegiceras corniculatum]
Length=284

 Score =   234 bits (596),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 114/129 (88%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGY+KGTGLGAEIIGTFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVH
Sbjct  156  GANYLHDGYNKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVH  215

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARS GAAVIYGK K WDDQWIFW GPF+GA IAA YHQ++LRAGA K
Sbjct  216  LATIPITGTGINPARSLGAAVIYGKKKTWDDQWIFWGGPFIGAPIAAFYHQFILRAGAIK  275

Query  319  ALGSYRSNA  293
            ALGSYRSNA
Sbjct  276  ALGSYRSNA  284



>ref|XP_011031744.1| PREDICTED: probable aquaporin PIP2-5 [Populus euphratica]
Length=285

 Score =   234 bits (596),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/128 (88%), Positives = 120/128 (94%), Gaps = 0/128 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGYS GTGLGAEIIGTFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVH
Sbjct  155  GANILADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVH  214

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARS GAAVIY  +KAWDDQWIFWVGPF+GAAIAA YHQ++LRAGA K
Sbjct  215  LATIPITGTGINPARSLGAAVIYNNEKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAIK  274

Query  319  ALGSYRSN  296
            ALGS+RSN
Sbjct  275  ALGSFRSN  282



>gb|AAB18227.1| MipC [Mesembryanthemum crystallinum]
Length=287

 Score =   234 bits (596),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/129 (88%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN +  GY+KGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  159  GANEMASGYTKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  218

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAVIY + KAWDD WIFWVGPF+GAAIAA YHQY+LRA A K
Sbjct  219  LATIPITGTGINPARSFGAAVIYNQQKAWDDHWIFWVGPFIGAAIAAFYHQYILRAAAIK  278

Query  319  ALGSYRSNA  293
            ALGS+RS+A
Sbjct  279  ALGSFRSSA  287



>ref|XP_010483715.1| PREDICTED: probable aquaporin PIP2-4 [Camelina sativa]
Length=286

 Score =   234 bits (596),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/129 (87%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGY+KGTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  158  GANELADGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  217

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAVIY ++KAWDDQWIFWVGP +GAA AA+YHQ++LRA A K
Sbjct  218  LATIPITGTGINPARSFGAAVIYNQEKAWDDQWIFWVGPMIGAAAAALYHQFILRAAAIK  277

Query  319  ALGSYRSNA  293
            ALGS+RS+A
Sbjct  278  ALGSFRSSA  286



>ref|XP_010553324.1| PREDICTED: aquaporin PIP2-2 [Tarenaya hassleriana]
Length=198

 Score =   231 bits (588),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/129 (85%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGYS+GTGL AEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  68   GANSLADGYSEGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  127

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARS GAAVI+ KDK WDD WIFWVGPF+GAAIAA YHQYVLRA  +K
Sbjct  128  LATIPITGTGINPARSLGAAVIFNKDKPWDDHWIFWVGPFIGAAIAAFYHQYVLRASGSK  187

Query  319  ALGSYRSNA  293
            +LGS+RS++
Sbjct  188  SLGSFRSSS  196



>dbj|BAB40143.1| plasma membrane intrinsic protein 2-2 [Pyrus communis]
Length=287

 Score =   234 bits (596),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/128 (88%), Positives = 119/128 (93%), Gaps = 0/128 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGYS G GL AEIIGTFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVF+VH
Sbjct  157  GANSLSDGYSTGVGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFIVH  216

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARS GAAVIY KDKAWDDQWIFWVGPF+GAAIAA YHQ++LRAGA K
Sbjct  217  LATIPITGTGINPARSLGAAVIYNKDKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVK  276

Query  319  ALGSYRSN  296
            ALGS+RSN
Sbjct  277  ALGSFRSN  284



>gb|ACG39551.1| aquaporin PIP2.1 [Zea mays]
Length=290

 Score =   234 bits (596),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 114/129 (88%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L  GYS+GTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  162  GANSLASGYSRGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  221

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIP+TGTGINPARS GAAVIY KDK WDD WIFWVGP VGAAIAA YHQY+LRAGA K
Sbjct  222  LATIPVTGTGINPARSLGAAVIYNKDKPWDDHWIFWVGPLVGAAIAAFYHQYILRAGAIK  281

Query  319  ALGSYRSNA  293
            ALGS+RSNA
Sbjct  282  ALGSFRSNA  290



>gb|EYU36189.1| hypothetical protein MIMGU_mgv1a011437mg [Erythranthe guttata]
Length=282

 Score =   234 bits (596),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 113/129 (88%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L  GY+KGTGLGAEIIGTFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVH
Sbjct  154  GANTLALGYNKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVH  213

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAVI+  +KAWDD WIFWVGPF+GAAIAA+YHQ+VLRAGA K
Sbjct  214  LATIPITGTGINPARSFGAAVIFNNEKAWDDHWIFWVGPFIGAAIAAIYHQFVLRAGAIK  273

Query  319  ALGSYRSNA  293
            ALGS+RSNA
Sbjct  274  ALGSFRSNA  282



>ref|XP_009387242.1| PREDICTED: aquaporin PIP2-5 [Musa acuminata subsp. malaccensis]
Length=286

 Score =   234 bits (596),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 113/127 (89%), Positives = 118/127 (93%), Gaps = 0/127 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGYSKGTGL AEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  159  GANELSDGYSKGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  218

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAVIY KDKAWDDQW+FWVGPF+GAA+AA YHQY+LRA  AK
Sbjct  219  LATIPITGTGINPARSFGAAVIYNKDKAWDDQWMFWVGPFIGAAVAAAYHQYILRASGAK  278

Query  319  ALGSYRS  299
            ALGS  S
Sbjct  279  ALGSSSS  285



>gb|ACG33001.1| aquaporin PIP2.2 [Zea mays]
Length=288

 Score =   234 bits (596),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 116/129 (90%), Positives = 119/129 (92%), Gaps = 1/129 (1%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGYSKGTGL AEIIGTFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVH
Sbjct  161  GANELSDGYSKGTGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVH  220

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARS GAAVIY KDKAWDDQWIFWVGP +GAAIAA YHQYVLRA A K
Sbjct  221  LATIPITGTGINPARSLGAAVIYNKDKAWDDQWIFWVGPLIGAAIAAAYHQYVLRASATK  280

Query  319  ALGSYRSNA  293
             LGSYRSNA
Sbjct  281  -LGSYRSNA  288



>gb|AEY75242.1| plasma membrane intrinsic protein [Malus hupehensis]
Length=287

 Score =   234 bits (596),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 112/128 (88%), Positives = 119/128 (93%), Gaps = 0/128 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGYS G GL AEIIGTFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVF+VH
Sbjct  157  GANSLSDGYSTGVGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFIVH  216

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARS GAAVIY KDKAWDDQWIFWVGPF+GAAIAA YHQ++LRAGA K
Sbjct  217  LATIPITGTGINPARSLGAAVIYNKDKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVK  276

Query  319  ALGSYRSN  296
            ALGS+RSN
Sbjct  277  ALGSFRSN  284



>gb|ABH09326.1| putative aquaporin [Vitis vinifera]
Length=284

 Score =   234 bits (596),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 113/129 (88%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L  GYSKGTGLGAEIIGTFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVH
Sbjct  154  GANELSTGYSKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVH  213

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARS GAAVIY  +KAWDDQWIFWVGPF+GAAIAA YHQ++LRAGA K
Sbjct  214  LATIPITGTGINPARSLGAAVIYNNEKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVK  273

Query  319  ALGSYRSNA  293
            ALGS+RS A
Sbjct  274  ALGSFRSTA  282



>dbj|BAA22098.1| unnamed protein product [Arabidopsis thaliana]
Length=193

 Score =   230 bits (587),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 110/132 (83%), Positives = 120/132 (91%), Gaps = 0/132 (0%)
 Frame = -2

Query  688  MAAGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVF  509
            +  GAN + DGYSKGT LGAEIIGTFVLVYTVF+ATDPKR+ARDSH+PV+APLPIGFAVF
Sbjct  60   LGGGANTVADGYSKGTALGAEIIGTFVLVYTVFSATDPKRSARDSHIPVVAPLPIGFAVF  119

Query  508  MVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAG  329
            MVHLATIPITGTGINPARSFGAAVIY  +KAWDDQWIFWVGPF+GA  AA YHQY+LRA 
Sbjct  120  MVHLATIPITGTGINPARSFGAAVIYNNEKAWDDQWIFWVGPFLGALAAAAYHQYILRAS  179

Query  328  AAKALGSYRSNA  293
            A KALGS+RSNA
Sbjct  180  AIKALGSFRSNA  191



>ref|XP_008365039.1| PREDICTED: probable aquaporin PIP2-5 [Malus domestica]
Length=287

 Score =   234 bits (596),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 112/128 (88%), Positives = 119/128 (93%), Gaps = 0/128 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGYS G GL AEIIGTFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVF+VH
Sbjct  157  GANSLSDGYSTGVGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFIVH  216

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARS GAAVIY KDKAWDDQWIFWVGPF+GAAIAA YHQ++LRAGA K
Sbjct  217  LATIPITGTGINPARSLGAAVIYNKDKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVK  276

Query  319  ALGSYRSN  296
            ALGS+RSN
Sbjct  277  ALGSFRSN  284



>ref|XP_007218772.1| hypothetical protein PRUPE_ppa009540mg [Prunus persica]
 gb|EMJ19971.1| hypothetical protein PRUPE_ppa009540mg [Prunus persica]
Length=287

 Score =   234 bits (596),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 112/128 (88%), Positives = 120/128 (94%), Gaps = 0/128 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L  GYSKG GLGAEIIGTFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVF+VH
Sbjct  157  GANELSQGYSKGVGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFIVH  216

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARS GAAVIY K+KAWDDQWIFWVGPF+GAAIAA YHQ++LRAGA K
Sbjct  217  LATIPITGTGINPARSLGAAVIYNKEKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVK  276

Query  319  ALGSYRSN  296
            ALGS+RSN
Sbjct  277  ALGSFRSN  284



>ref|XP_004304426.1| PREDICTED: aquaporin PIP2-1-like [Fragaria vesca subsp. vesca]
Length=284

 Score =   233 bits (595),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 113/129 (88%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GANGL DGYS+GTGL AEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  154  GANGLADGYSEGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  213

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAVIY  +KAWDD WIFWVGPF+GAAIAA+YHQ +LRAGAAK
Sbjct  214  LATIPITGTGINPARSFGAAVIYNNEKAWDDHWIFWVGPFIGAAIAALYHQNILRAGAAK  273

Query  319  ALGSYRSNA  293
            A GS+RS++
Sbjct  274  ASGSFRSSS  282



>ref|XP_011015478.1| PREDICTED: aquaporin PIP2-2-like [Populus euphratica]
Length=285

 Score =   233 bits (595),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 112/128 (88%), Positives = 121/128 (95%), Gaps = 0/128 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GANGL  GYSKG GLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  155  GANGLAIGYSKGNGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  214

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAVIY K+KAWDD WIFWVGPF+GAAIAA+YHQ++LRA A K
Sbjct  215  LATIPITGTGINPARSFGAAVIYNKEKAWDDHWIFWVGPFIGAAIAALYHQFILRAAAVK  274

Query  319  ALGSYRSN  296
            +LGS+RS+
Sbjct  275  SLGSFRSS  282



>ref|NP_001105026.1| aquaporin PIP2-4 [Zea mays]
 sp|Q9ATM6.1|PIP24_MAIZE RecName: Full=Aquaporin PIP2-4; AltName: Full=Plasma membrane 
intrinsic protein 2-4; AltName: Full=ZmPIP2-4; AltName: Full=ZmPIP2;4 
[Zea mays]
 gb|AAK26761.1| plasma membrane integral protein ZmPIP2-4 [Zea mays]
 gb|ACN28082.1| unknown [Zea mays]
 gb|AFW72774.1| plasma membrane intrinsic protein2 [Zea mays]
Length=288

 Score =   234 bits (596),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 116/129 (90%), Positives = 119/129 (92%), Gaps = 1/129 (1%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGYSKGTGL AEIIGTFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVH
Sbjct  161  GANELSDGYSKGTGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVH  220

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARS GAAVIY KDKAWDDQWIFWVGP +GAAIAA YHQYVLRA A K
Sbjct  221  LATIPITGTGINPARSLGAAVIYNKDKAWDDQWIFWVGPLIGAAIAAAYHQYVLRASATK  280

Query  319  ALGSYRSNA  293
             LGSYRSNA
Sbjct  281  -LGSYRSNA  288



>ref|XP_009803627.1| PREDICTED: aquaporin PIP2-7-like [Nicotiana sylvestris]
 tpg|DAA64681.1| TPA_exp: aquaporin PIP2 6b [Nicotiana tabacum]
Length=283

 Score =   233 bits (595),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 113/128 (88%), Positives = 121/128 (95%), Gaps = 0/128 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN +Q GY+KGT LGAEIIGTFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVH
Sbjct  153  GANFVQPGYNKGTALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVH  212

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAVIY K+K WDDQWIFWVGPFVGA IAA+YHQ+VLRAGA K
Sbjct  213  LATIPITGTGINPARSFGAAVIYNKEKIWDDQWIFWVGPFVGALIAAIYHQFVLRAGAVK  272

Query  319  ALGSYRSN  296
            ALGS+RSN
Sbjct  273  ALGSFRSN  280



>ref|XP_010920405.1| PREDICTED: aquaporin PIP2-4 isoform X1 [Elaeis guineensis]
Length=285

 Score =   233 bits (595),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 113/129 (88%), Positives = 118/129 (91%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            G N L  GYSKGTGL AEIIGTFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVH
Sbjct  157  GVNELSSGYSKGTGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVH  216

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARS G AVIY  DKAWDDQWIFWVGPF+GAAIAA YHQY+LRAGA K
Sbjct  217  LATIPITGTGINPARSLGPAVIYNNDKAWDDQWIFWVGPFIGAAIAAAYHQYILRAGAIK  276

Query  319  ALGSYRSNA  293
            ALGS+RSNA
Sbjct  277  ALGSFRSNA  285



>ref|XP_002532756.1| Aquaporin PIP2.1, putative [Ricinus communis]
 gb|EEF29633.1| Aquaporin PIP2.1, putative [Ricinus communis]
Length=283

 Score =   233 bits (595),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 112/128 (88%), Positives = 119/128 (93%), Gaps = 0/128 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L D YS G GLGAEIIGTFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVH
Sbjct  153  GANTLDDNYSTGVGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVH  212

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARS GAAVIY +DKAWDDQWIFWVGPF+GAAIAA YHQ++LRAGA K
Sbjct  213  LATIPITGTGINPARSLGAAVIYNQDKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVK  272

Query  319  ALGSYRSN  296
            ALGS+RSN
Sbjct  273  ALGSFRSN  280



>ref|NP_001105025.1| aquaporin PIP2-3 [Zea mays]
 sp|Q9ATM7.1|PIP23_MAIZE RecName: Full=Aquaporin PIP2-3; AltName: Full=Plasma membrane 
intrinsic protein 2-3; AltName: Full=ZmPIP2-3; AltName: Full=ZmPIP2;3 
[Zea mays]
 gb|AAK26760.1| plasma membrane integral protein ZmPIP2-3 [Zea mays]
 gb|ACR38296.1| unknown [Zea mays]
 gb|AFW63074.1| plasma membrane intrinsic protein2 [Zea mays]
Length=289

 Score =   233 bits (595),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 116/129 (90%), Positives = 119/129 (92%), Gaps = 1/129 (1%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGYSKGTGL AEIIGTFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVH
Sbjct  162  GANELSDGYSKGTGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVH  221

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARS GAAVIY KDKAWDDQWIFWVGP +GAAIAA YHQYVLRA A K
Sbjct  222  LATIPITGTGINPARSLGAAVIYNKDKAWDDQWIFWVGPLIGAAIAAAYHQYVLRASATK  281

Query  319  ALGSYRSNA  293
             LGSYRSNA
Sbjct  282  -LGSYRSNA  289



>ref|XP_010684101.1| PREDICTED: aquaporin PIP2-1-like [Beta vulgaris subsp. vulgaris]
Length=284

 Score =   233 bits (595),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 110/129 (85%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN LQDGYSKGTGLGAEIIGTFVLVYTVF+ATDPKR+ARDSH+PVLAPLPIGFAVFMVH
Sbjct  154  GANTLQDGYSKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHIPVLAPLPIGFAVFMVH  213

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIP+TGTGINPARSFGAAVI+   +AWDD WIFWVGPF+GAAIAA+YHQY+LRAG  K
Sbjct  214  LATIPVTGTGINPARSFGAAVIFNSKQAWDDHWIFWVGPFIGAAIAAIYHQYILRAGFVK  273

Query  319  ALGSYRSNA  293
            ALGS+RS++
Sbjct  274  ALGSFRSSS  282



>gb|KHN38765.1| Aquaporin PIP2-7 [Glycine soja]
Length=286

 Score =   233 bits (595),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 113/129 (88%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN + DGY+ GT LGAEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  158  GANSVADGYNNGTALGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  217

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAVIY KDK WDDQWIFWVGP VGAA+AA YHQY+LRA A K
Sbjct  218  LATIPITGTGINPARSFGAAVIYNKDKIWDDQWIFWVGPIVGAAVAAFYHQYILRAAAIK  277

Query  319  ALGSYRSNA  293
            ALGS+RSNA
Sbjct  278  ALGSFRSNA  286



>gb|KDP44363.1| hypothetical protein JCGZ_20043 [Jatropha curcas]
Length=285

 Score =   233 bits (595),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 113/128 (88%), Positives = 119/128 (93%), Gaps = 0/128 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGYS G GLGAEIIGTFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVH
Sbjct  155  GANTLADGYSTGVGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVH  214

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARS GAAVIY  DKAWDDQWIFWVGPF+GAAIAA YHQ++LRAGA K
Sbjct  215  LATIPITGTGINPARSLGAAVIYNHDKAWDDQWIFWVGPFLGAAIAAFYHQFILRAGAVK  274

Query  319  ALGSYRSN  296
            ALGS+RSN
Sbjct  275  ALGSFRSN  282



>gb|KJB11821.1| hypothetical protein B456_002G2484001 [Gossypium raimondii]
Length=285

 Score =   233 bits (595),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 111/129 (86%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGYS GTGL AEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  155  GANSLADGYSTGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  214

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAV++ +DK WDD WIFWVGP +GAAIAA+YHQY+LRAGAAK
Sbjct  215  LATIPITGTGINPARSFGAAVMFNQDKPWDDHWIFWVGPLIGAAIAAIYHQYILRAGAAK  274

Query  319  ALGSYRSNA  293
            ALGS+RS++
Sbjct  275  ALGSFRSSS  283



>ref|XP_003538174.1| PREDICTED: aquaporin PIP2-7 [Glycine max]
Length=286

 Score =   233 bits (595),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 113/129 (88%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN + DGY+ GT LGAEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  158  GANSVADGYNNGTALGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  217

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAVIY KDK WDDQWIFWVGP VGAA+AA YHQY+LRA A K
Sbjct  218  LATIPITGTGINPARSFGAAVIYNKDKIWDDQWIFWVGPIVGAAVAAFYHQYILRAAAIK  277

Query  319  ALGSYRSNA  293
            ALGS+RSNA
Sbjct  278  ALGSFRSNA  286



>ref|XP_007132257.1| hypothetical protein PHAVU_011G079300g [Phaseolus vulgaris]
 gb|ESW04251.1| hypothetical protein PHAVU_011G079300g [Phaseolus vulgaris]
Length=285

 Score =   233 bits (594),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 111/129 (86%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN + DGY+KGT LGAEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  157  GANSVADGYNKGTALGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  216

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIP+TGTGINPARSFGAAVIY K+K WDDQWIFWVGP +GAA+AA YHQY+LRA A K
Sbjct  217  LATIPVTGTGINPARSFGAAVIYNKEKIWDDQWIFWVGPIIGAAVAAFYHQYILRAAAIK  276

Query  319  ALGSYRSNA  293
            ALGS+RSNA
Sbjct  277  ALGSFRSNA  285



>ref|NP_001268056.1| aquaporin PIP2 [Vitis vinifera]
 gb|ABC84558.1| aquaporin PIP2 [Vitis vinifera]
Length=280

 Score =   233 bits (594),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 113/129 (88%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L  GY+KG GLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  152  GANELAGGYNKGVGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  211

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAVIY  DKAWDD W+FWVGPF+GAAIAA YHQY+LRA A K
Sbjct  212  LATIPITGTGINPARSFGAAVIYNNDKAWDDHWMFWVGPFIGAAIAAFYHQYILRAAAIK  271

Query  319  ALGSYRSNA  293
            ALGS+RSNA
Sbjct  272  ALGSFRSNA  280



>ref|XP_006481459.1| PREDICTED: aquaporin PIP2-2-like [Citrus sinensis]
Length=287

 Score =   233 bits (594),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 111/129 (86%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGYS G GLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  157  GANELADGYSTGAGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  216

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIP+TGTGINPARS GAAVIY KDKAWDDQWIFWVGPF+GAAIAA YHQ++LRA A+K
Sbjct  217  LATIPVTGTGINPARSLGAAVIYKKDKAWDDQWIFWVGPFIGAAIAAFYHQFILRASASK  276

Query  319  ALGSYRSNA  293
            ALGS++S++
Sbjct  277  ALGSFKSSS  285



>gb|AAO86707.1| aquaporin [Zea mays]
Length=290

 Score =   233 bits (594),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 113/129 (88%), Positives = 118/129 (91%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L  GYS+GTG GAEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  162  GANSLASGYSRGTGFGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  221

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIP+TGTGINPARS GAAVIY KDK WDD WIFWVGP VGAAIAA YHQY+LRAGA K
Sbjct  222  LATIPVTGTGINPARSLGAAVIYNKDKPWDDHWIFWVGPLVGAAIAAFYHQYILRAGAIK  281

Query  319  ALGSYRSNA  293
            ALGS+RSNA
Sbjct  282  ALGSFRSNA  290



>ref|XP_010037961.1| PREDICTED: probable aquaporin PIP2-2 [Eucalyptus grandis]
 gb|KCW49750.1| hypothetical protein EUGRSUZ_K03244 [Eucalyptus grandis]
Length=289

 Score =   233 bits (594),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 113/129 (88%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN LQ GYSKGTGLGAEIIGTFVLVYTV +ATDPKR+ARDSHVPVLAPLPIGFAVFMVH
Sbjct  159  GANMLQAGYSKGTGLGAEIIGTFVLVYTVLSATDPKRSARDSHVPVLAPLPIGFAVFMVH  218

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAV+Y K+KAWDDQWIFWVGPF+GAAIAA YHQ+VLRA A K
Sbjct  219  LATIPITGTGINPARSFGAAVMYNKEKAWDDQWIFWVGPFIGAAIAAFYHQHVLRAAAIK  278

Query  319  ALGSYRSNA  293
            ALGS+RS++
Sbjct  279  ALGSFRSSS  287



>ref|XP_002452483.1| hypothetical protein SORBIDRAFT_04g026650 [Sorghum bicolor]
 gb|EES05459.1| hypothetical protein SORBIDRAFT_04g026650 [Sorghum bicolor]
Length=289

 Score =   233 bits (594),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 114/129 (88%), Positives = 117/129 (91%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGYSKGTGL AEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  161  GANELSDGYSKGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  220

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARS GAAVIY  DKAWDDQWIFWVGP +GAAIAA YHQYVLRA A+K
Sbjct  221  LATIPITGTGINPARSLGAAVIYNNDKAWDDQWIFWVGPLIGAAIAAAYHQYVLRASASK  280

Query  319  ALGSYRSNA  293
               SYRSNA
Sbjct  281  LGSSYRSNA  289



>gb|ADJ67992.1| aquaporin [Fragaria x ananassa]
Length=285

 Score =   233 bits (593),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 113/129 (88%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGYS G GL AEIIGTFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVH
Sbjct  157  GANELADGYSTGVGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVH  216

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARS GAAVIY K KAWDDQWIFWVGPF+GAAIAA YHQ++LRAGA K
Sbjct  217  LATIPITGTGINPARSLGAAVIYDKKKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVK  276

Query  319  ALGSYRSNA  293
            ALGS+RSNA
Sbjct  277  ALGSFRSNA  285



>ref|XP_007150204.1| hypothetical protein PHAVU_005G135300g [Phaseolus vulgaris]
 gb|ESW22198.1| hypothetical protein PHAVU_005G135300g [Phaseolus vulgaris]
Length=287

 Score =   233 bits (593),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 111/129 (86%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN + DGY+KGT LGAEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  159  GANTVSDGYNKGTALGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  218

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFG AVI+  DKAWDDQWI+WVGPF+GAA+AA YHQY+LRA A K
Sbjct  219  LATIPITGTGINPARSFGPAVIFNNDKAWDDQWIYWVGPFIGAAVAAFYHQYILRAAAIK  278

Query  319  ALGSYRSNA  293
            ALGS+RSNA
Sbjct  279  ALGSFRSNA  287



>ref|XP_003536353.1| PREDICTED: aquaporin PIP2-1-like isoform 1 [Glycine max]
 gb|KHN17135.1| Aquaporin PIP2-2 [Glycine soja]
Length=287

 Score =   233 bits (593),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 112/128 (88%), Positives = 119/128 (93%), Gaps = 0/128 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L  GYS GTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  157  GANSLAAGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  216

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIP+TGTGINPARS GAAVIY +DK WDD WIFWVGPF+GAAIAA YHQ++LRAGAAK
Sbjct  217  LATIPVTGTGINPARSLGAAVIYNQDKPWDDHWIFWVGPFIGAAIAAFYHQFILRAGAAK  276

Query  319  ALGSYRSN  296
            ALGS+RSN
Sbjct  277  ALGSFRSN  284



>ref|XP_010107541.1| Aquaporin PIP2-2 [Morus notabilis]
 gb|EXC16223.1| Aquaporin PIP2-2 [Morus notabilis]
Length=286

 Score =   233 bits (593),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 112/129 (87%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGYS GTGL AEIIGTFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVH
Sbjct  156  GANSLADGYSNGTGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVH  215

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAVIY KDK WDD WIFWVGPF+GAAIAA+YHQY+LRA A K
Sbjct  216  LATIPITGTGINPARSFGAAVIYNKDKPWDDHWIFWVGPFIGAAIAALYHQYILRAAAVK  275

Query  319  ALGSYRSNA  293
            ALGS+RS++
Sbjct  276  ALGSFRSSS  284



>ref|NP_001274386.1| aquaporin PIP2-1-like [Cucumis sativus]
 gb|AHB33477.1| plasma intrinsic protein 2-1 [Cucumis sativus]
 gb|KGN48148.1| hypothetical protein Csa_6G445130 [Cucumis sativus]
Length=284

 Score =   233 bits (593),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 111/132 (84%), Positives = 121/132 (92%), Gaps = 0/132 (0%)
 Frame = -2

Query  691  DMAAGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAV  512
            +   GAN L DGYS GTGL AEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAV
Sbjct  153  EYGGGANSLADGYSTGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAV  212

Query  511  FMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRA  332
            FMVHLATIPITGTGINPARSFGAAV++ K K WDDQWIFWVGPF+GAAIAA+YHQ++LRA
Sbjct  213  FMVHLATIPITGTGINPARSFGAAVVFNKSKPWDDQWIFWVGPFIGAAIAAIYHQFILRA  272

Query  331  GAAKALGSYRSN  296
            GAAKALGS+ S+
Sbjct  273  GAAKALGSFSSS  284



>ref|XP_010264685.1| PREDICTED: aquaporin PIP2-1-like [Nelumbo nucifera]
Length=287

 Score =   233 bits (593),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 113/128 (88%), Positives = 118/128 (92%), Gaps = 0/128 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L  GYSKG GLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  157  GANSLALGYSKGVGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  216

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARS GAAVIY KDKAWDD WIFWVGPF GAA+AA+YHQY+LRA A K
Sbjct  217  LATIPITGTGINPARSLGAAVIYNKDKAWDDHWIFWVGPFTGAALAALYHQYILRAAAIK  276

Query  319  ALGSYRSN  296
            ALGS+RSN
Sbjct  277  ALGSFRSN  284



>emb|CAN75442.1| hypothetical protein VITISV_019657 [Vitis vinifera]
Length=284

 Score =   232 bits (592),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 112/128 (88%), Positives = 119/128 (93%), Gaps = 0/128 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L  GYSKGTGLGAEIIGTFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVH
Sbjct  154  GANELSTGYSKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVH  213

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARS GAAVIY  +KAWDDQWIFWVGPF+GAAIAA YHQ++LRAGA K
Sbjct  214  LATIPITGTGINPARSLGAAVIYNNEKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVK  273

Query  319  ALGSYRSN  296
            ALGS+RS 
Sbjct  274  ALGSFRST  281



>gb|KHG10662.1| Aquaporin PIP2-1 -like protein [Gossypium arboreum]
 gb|KJB36605.1| hypothetical protein B456_006G166800 [Gossypium raimondii]
 gb|KJB36607.1| hypothetical protein B456_006G166800 [Gossypium raimondii]
Length=285

 Score =   232 bits (592),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 110/129 (85%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGYS GTGL AEIIGTFVLVYTVF+ATDPKRNARDSH+PVLAPLPIGFAVFMVH
Sbjct  155  GANSLADGYSTGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHIPVLAPLPIGFAVFMVH  214

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAVIY +DK WDD WIFWVGPF+GAAIAA+YHQ++LRA A K
Sbjct  215  LATIPITGTGINPARSFGAAVIYNQDKPWDDHWIFWVGPFIGAAIAAIYHQFILRAAAVK  274

Query  319  ALGSYRSNA  293
            ALGS+RS++
Sbjct  275  ALGSFRSSS  283



>ref|NP_001267922.1| aquaporin-like [Vitis vinifera]
 gb|ABN14353.1| aquaporin PIP2;4 [Vitis vinifera]
Length=284

 Score =   232 bits (592),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 112/129 (87%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L  GYSKGTGLGAEIIGTFVLVYTVF+ATDPK++ARDSHVPVLAPLPIGFAVFMVH
Sbjct  154  GANELSTGYSKGTGLGAEIIGTFVLVYTVFSATDPKKSARDSHVPVLAPLPIGFAVFMVH  213

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARS GAAVIY  +KAWDDQWIFWVGPF+GAAIAA YHQ++LRAGA K
Sbjct  214  LATIPITGTGINPARSLGAAVIYNNEKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVK  273

Query  319  ALGSYRSNA  293
            ALGS+RS A
Sbjct  274  ALGSFRSTA  282



>gb|AAV69744.1| aquaporin [Vitis vinifera]
Length=284

 Score =   232 bits (592),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 112/128 (88%), Positives = 119/128 (93%), Gaps = 0/128 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L  GYSKGTGLGAEIIGTFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVH
Sbjct  154  GANELSTGYSKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVH  213

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARS GAAVIY  +KAWDDQWIFWVGPF+GAAIAA YHQ++LRAGA K
Sbjct  214  LATIPITGTGINPARSLGAAVIYNNEKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVK  273

Query  319  ALGSYRSN  296
            ALGS+RS 
Sbjct  274  ALGSFRST  281



>gb|AEO13898.1| aquaporin 7 [Triticum aestivum]
Length=286

 Score =   232 bits (592),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 115/128 (90%), Positives = 118/128 (92%), Gaps = 1/128 (1%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L  GYSKGTGL AEIIGTFVLVYTVF+ATDPKRNARDSH+PVLAPLPIGFAVFMVH
Sbjct  160  GANELSAGYSKGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHIPVLAPLPIGFAVFMVH  219

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARS GAAVIY KDKAWDDQWIFWVGP +GAAIAA YHQYVLRA AAK
Sbjct  220  LATIPITGTGINPARSLGAAVIYNKDKAWDDQWIFWVGPLIGAAIAAAYHQYVLRASAAK  279

Query  319  ALGSYRSN  296
             LGSYRSN
Sbjct  280  -LGSYRSN  286



>emb|CDQ12456.1| plasma membrane intrinsic protein 2;1, partial [Vicia faba var. 
minor]
Length=182

 Score =   229 bits (583),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 108/129 (84%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN + DGYSKGT LGAEIIGTFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVH
Sbjct  54   GANTVSDGYSKGTALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVH  113

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LA IP+TGTGINPARSFG AVI+  DKAWDDQWI+WVGPF+GAA+AA+YHQY+LR  A K
Sbjct  114  LAAIPVTGTGINPARSFGPAVIFNNDKAWDDQWIYWVGPFIGAAVAAIYHQYILRGSAIK  173

Query  319  ALGSYRSNA  293
            ALGS+RSNA
Sbjct  174  ALGSFRSNA  182



>ref|XP_006400824.1| hypothetical protein EUTSA_v10014299mg [Eutrema salsugineum]
 gb|ESQ42277.1| hypothetical protein EUTSA_v10014299mg [Eutrema salsugineum]
Length=285

 Score =   232 bits (592),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 111/129 (86%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGY+KGTGLGAEIIGTFVLVYTVF+ATDPKR+ARDSH+PVLAPLPIGFAVFMVH
Sbjct  157  GANELADGYNKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHIPVLAPLPIGFAVFMVH  216

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAVIY ++KAWDDQWIFWVGP +GAA AA+YHQ+VLRA A K
Sbjct  217  LATIPITGTGINPARSFGAAVIYNQEKAWDDQWIFWVGPMIGAAAAALYHQFVLRAAAIK  276

Query  319  ALGSYRSNA  293
            ALGS+RS+A
Sbjct  277  ALGSFRSSA  285



>ref|XP_010920407.1| PREDICTED: probable aquaporin PIP2-2 [Elaeis guineensis]
Length=287

 Score =   232 bits (592),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 113/127 (89%), Positives = 117/127 (92%), Gaps = 0/127 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L  GYSKGTGL AEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  160  GANELSSGYSKGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  219

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARS GAAVIY  +KAWDDQWIFWVGPF+GAAIAA YHQYVLRA A K
Sbjct  220  LATIPITGTGINPARSLGAAVIYNNEKAWDDQWIFWVGPFIGAAIAAAYHQYVLRASAGK  279

Query  319  ALGSYRS  299
            ALGS+RS
Sbjct  280  ALGSFRS  286



>gb|AAC17529.1| aquaporin 2 [Samanea saman]
Length=287

 Score =   232 bits (592),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 111/128 (87%), Positives = 120/128 (94%), Gaps = 0/128 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGYS GTGLGAEIIGTFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVH
Sbjct  157  GANTLSDGYSTGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVH  216

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIP+TGTGINPARS GAAVI+ + KAWDD WIFWVGPF+GAAIAA YHQ++LRAGAAK
Sbjct  217  LATIPVTGTGINPARSLGAAVIFNQQKAWDDHWIFWVGPFIGAAIAAFYHQFILRAGAAK  276

Query  319  ALGSYRSN  296
            ALGS+RSN
Sbjct  277  ALGSFRSN  284



>dbj|BAD90699.1| plasma membrane intrinsic protein 2;3 [Mimosa pudica]
Length=288

 Score =   232 bits (592),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/128 (88%), Positives = 120/128 (94%), Gaps = 0/128 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGYS GTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  158  GANTLGDGYSVGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  217

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIP+TGTGINPARSFGAAVI+ + KAWD  WIFWVGPF+GAAIAA YHQ++LRAGAAK
Sbjct  218  LATIPVTGTGINPARSFGAAVIFNQQKAWDKHWIFWVGPFIGAAIAAFYHQFILRAGAAK  277

Query  319  ALGSYRSN  296
            ALGS+RSN
Sbjct  278  ALGSFRSN  285



>gb|KHN05685.1| Aquaporin PIP2-7 [Glycine soja]
Length=286

 Score =   232 bits (592),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/129 (87%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN + DGY+ GT LGAEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  158  GANSVADGYNNGTALGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  217

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAVIY +DK WDDQWIFWVGP VGAA+AA YHQY+LRA A K
Sbjct  218  LATIPITGTGINPARSFGAAVIYNEDKIWDDQWIFWVGPIVGAAVAAFYHQYILRAAAIK  277

Query  319  ALGSYRSNA  293
            ALGS+RSNA
Sbjct  278  ALGSFRSNA  286



>gb|AFH36337.1| aquaporin PIP2;2 [Quercus petraea]
Length=285

 Score =   232 bits (592),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 113/129 (88%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L  GY+KGTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  157  GANELAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  216

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAVI+ + KAWDD WIFWVGPFVGAAIAA YHQ++LRA A K
Sbjct  217  LATIPITGTGINPARSFGAAVIFNQSKAWDDHWIFWVGPFVGAAIAAFYHQFILRAAAIK  276

Query  319  ALGSYRSNA  293
            ALGS+RSNA
Sbjct  277  ALGSFRSNA  285



>gb|AFB83068.1| plasma intrinsic protein PIP2.2 [Helianthemum almeriense]
Length=281

 Score =   232 bits (591),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/129 (87%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L  GYSKGTGLGAEIIGTFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVH
Sbjct  151  GANELSGGYSKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVH  210

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAVIY  +KAWDDQWIFWVGPF+GAAIAA Y+QY+LRAGA K
Sbjct  211  LATIPITGTGINPARSFGAAVIYNTEKAWDDQWIFWVGPFIGAAIAAFYYQYILRAGAVK  270

Query  319  ALGSYRSNA  293
            AL S+RS++
Sbjct  271  ALASFRSSS  279



>ref|XP_003591907.1| Aquaporin PIP [Medicago truncatula]
 gb|AES62158.1| major intrinsic protein (MIP) family transporter [Medicago truncatula]
Length=221

 Score =   230 bits (586),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 109/128 (85%), Positives = 118/128 (92%), Gaps = 0/128 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGYS G GLGAEI+GTFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVH
Sbjct  91   GANFLHDGYSTGVGLGAEIVGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVH  150

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIP+TGTGINPARS G+AVIY KDK WDD WIFWVGPF+GAAIAA YHQ++LRAGA K
Sbjct  151  LATIPVTGTGINPARSLGSAVIYNKDKPWDDHWIFWVGPFIGAAIAAFYHQFILRAGAVK  210

Query  319  ALGSYRSN  296
            ALGS+RSN
Sbjct  211  ALGSFRSN  218



>gb|AHK05706.1| plasma membrane intrinsic protein PIP2;3 [Hevea brasiliensis]
Length=285

 Score =   232 bits (591),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/128 (88%), Positives = 118/128 (92%), Gaps = 0/128 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L  GYSKG GLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  155  GANSLAAGYSKGVGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  214

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARS GAAVIY +DK WDD WIFWVGPF+GAAIAA YHQ++LRAGA K
Sbjct  215  LATIPITGTGINPARSLGAAVIYNQDKPWDDHWIFWVGPFIGAAIAAFYHQFILRAGAVK  274

Query  319  ALGSYRSN  296
            ALGS+RSN
Sbjct  275  ALGSFRSN  282



>ref|XP_003518297.1| PREDICTED: aquaporin PIP2-2-like [Glycine max]
Length=285

 Score =   232 bits (591),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 110/128 (86%), Positives = 120/128 (94%), Gaps = 0/128 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L +GYS G GLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  155  GANELSEGYSTGVGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  214

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIP+TGTGINPARSFGAAV+Y + KAWDDQWIFWVGPF+GAAIAA YHQ++LRA AAK
Sbjct  215  LATIPVTGTGINPARSFGAAVMYNQKKAWDDQWIFWVGPFIGAAIAAFYHQFILRASAAK  274

Query  319  ALGSYRSN  296
            A+GS+RSN
Sbjct  275  AVGSFRSN  282



>gb|AAB36949.1| plasma membrane intrinsic protein PIP3 [Arabidopsis thaliana]
Length=280

 Score =   232 bits (591),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 111/132 (84%), Positives = 120/132 (91%), Gaps = 0/132 (0%)
 Frame = -2

Query  688  MAAGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVF  509
            +  GAN + DGYSKGT LGAEIIGTFVLVYTVF+ATDPKR+ARDSH+PVLAPLPIGFAVF
Sbjct  147  LGGGANTVADGYSKGTALGAEIIGTFVLVYTVFSATDPKRSARDSHIPVLAPLPIGFAVF  206

Query  508  MVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAG  329
            MVHLATIPITGTGINPARSFGAAVIY  +KAWDDQWIFWVGPF+GA  AA YHQY+LRA 
Sbjct  207  MVHLATIPITGTGINPARSFGAAVIYNNEKAWDDQWIFWVGPFLGALAAAAYHQYILRAS  266

Query  328  AAKALGSYRSNA  293
            A KALGS+RSNA
Sbjct  267  AIKALGSFRSNA  278



>ref|XP_009345759.1| PREDICTED: probable aquaporin PIP2-5 [Pyrus x bretschneideri]
 ref|XP_009345763.1| PREDICTED: probable aquaporin PIP2-5 [Pyrus x bretschneideri]
Length=285

 Score =   232 bits (591),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 111/128 (87%), Positives = 120/128 (94%), Gaps = 0/128 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGYS  TGLGAEI+GTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVF+VH
Sbjct  155  GANELADGYSTSTGLGAEIVGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFIVH  214

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARS GAAVIY  DKAW+DQWIFWVGPF+GAAIAA+YHQY+LRAGA K
Sbjct  215  LATIPITGTGINPARSLGAAVIYNNDKAWNDQWIFWVGPFIGAAIAALYHQYILRAGAVK  274

Query  319  ALGSYRSN  296
            ALGS+RS+
Sbjct  275  ALGSFRSS  282



>emb|CDP06739.1| unnamed protein product [Coffea canephora]
Length=287

 Score =   232 bits (591),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 114/128 (89%), Positives = 121/128 (95%), Gaps = 2/128 (2%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GANGL DGYS GTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  159  GANGLSDGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  218

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIP+TGTGINPARSFGAAVIYG  KAWDD WIFWVGPF+GAAIAA YHQY+LRAGA K
Sbjct  219  LATIPVTGTGINPARSFGAAVIYG--KAWDDHWIFWVGPFIGAAIAAFYHQYILRAGAVK  276

Query  319  ALGSYRSN  296
            ALGS++S+
Sbjct  277  ALGSFKSS  284



>gb|AAB65787.1| plasma membrane intrinsic protein [Arabidopsis thaliana]
Length=280

 Score =   231 bits (590),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 111/132 (84%), Positives = 120/132 (91%), Gaps = 0/132 (0%)
 Frame = -2

Query  688  MAAGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVF  509
            +  GAN + DGYSKGT LGAEIIGTFVLVYTVF+ATDPKR+ARDSH+PVLAPLPIGFAVF
Sbjct  147  LGGGANTVADGYSKGTALGAEIIGTFVLVYTVFSATDPKRSARDSHIPVLAPLPIGFAVF  206

Query  508  MVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAG  329
            MVHLATIPITGTGINPARSFGAAVIY  +KAWDDQWIFWVGPF+GA  AA YHQY+LRA 
Sbjct  207  MVHLATIPITGTGINPARSFGAAVIYNNEKAWDDQWIFWVGPFLGALAAAAYHQYILRAS  266

Query  328  AAKALGSYRSNA  293
            A KALGS+RSNA
Sbjct  267  AIKALGSFRSNA  278



>ref|NP_195236.1| plasma membrane intrinsic protein 3 [Arabidopsis thaliana]
 ref|NP_001190920.1| plasma membrane intrinsic protein 3 [Arabidopsis thaliana]
 sp|P93004.2|PIP27_ARATH RecName: Full=Aquaporin PIP2-7; AltName: Full=Plasma membrane 
intrinsic protein 2-7; Short=AtPIP2;7; AltName: Full=Plasma 
membrane intrinsic protein 3; AltName: Full=Salt stress-induced 
major intrinsic protein; Contains: RecName: Full=Aquaporin 
PIP2-7, N-terminally processed [Arabidopsis thaliana]
 gb|AAL06563.1|AF412110_1 AT4g35100/M4E13_150 [Arabidopsis thaliana]
 emb|CAA17774.1| plasma membrane intrinsic protein (SIMIP) [Arabidopsis thaliana]
 emb|CAB80227.1| plasma membrane intrinsic protein (SIMIP) [Arabidopsis thaliana]
 gb|AAL32881.1| plasma membrane intrinsic protein (SIMIP) [Arabidopsis thaliana]
 gb|AAM10142.1| plasma membrane intrinsic protein (SIMIP) [Arabidopsis thaliana]
 gb|AAM66021.1| plasma membrane intrinsic protein SIMIP [Arabidopsis thaliana]
 dbj|BAH30556.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE86464.1| plasma membrane intrinsic protein 3 [Arabidopsis thaliana]
 gb|AEE86465.1| plasma membrane intrinsic protein 3 [Arabidopsis thaliana]
Length=280

 Score =   231 bits (590),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 111/132 (84%), Positives = 120/132 (91%), Gaps = 0/132 (0%)
 Frame = -2

Query  688  MAAGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVF  509
            +  GAN + DGYSKGT LGAEIIGTFVLVYTVF+ATDPKR+ARDSH+PVLAPLPIGFAVF
Sbjct  147  LGGGANTVADGYSKGTALGAEIIGTFVLVYTVFSATDPKRSARDSHIPVLAPLPIGFAVF  206

Query  508  MVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAG  329
            MVHLATIPITGTGINPARSFGAAVIY  +KAWDDQWIFWVGPF+GA  AA YHQY+LRA 
Sbjct  207  MVHLATIPITGTGINPARSFGAAVIYNNEKAWDDQWIFWVGPFLGALAAAAYHQYILRAS  266

Query  328  AAKALGSYRSNA  293
            A KALGS+RSNA
Sbjct  267  AIKALGSFRSNA  278



>ref|XP_002869108.1| hypothetical protein ARALYDRAFT_491143 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45367.1| hypothetical protein ARALYDRAFT_491143 [Arabidopsis lyrata subsp. 
lyrata]
Length=280

 Score =   231 bits (590),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 111/132 (84%), Positives = 120/132 (91%), Gaps = 0/132 (0%)
 Frame = -2

Query  688  MAAGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVF  509
            +  GAN + DGYSKGT LGAEIIGTFVLVYTVF+ATDPKR+ARDSH+PVLAPLPIGFAVF
Sbjct  147  LGGGANTVADGYSKGTALGAEIIGTFVLVYTVFSATDPKRSARDSHIPVLAPLPIGFAVF  206

Query  508  MVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAG  329
            MVHLATIPITGTGINPARSFGAAVIY  +KAWDDQWIFWVGPF+GA  AA YHQY+LRA 
Sbjct  207  MVHLATIPITGTGINPARSFGAAVIYNNEKAWDDQWIFWVGPFLGALAAAAYHQYILRAS  266

Query  328  AAKALGSYRSNA  293
            A KALGS+RSNA
Sbjct  267  AIKALGSFRSNA  278



>ref|NP_001240223.1| prolactin-inducible protein [Glycine max]
 gb|ACU20043.1| unknown [Glycine max]
Length=286

 Score =   232 bits (591),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/129 (87%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN + DGY+ GT LGAEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  158  GANSVADGYNNGTALGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  217

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAVIY +DK WDDQWIFWVGP VGAA+AA YHQY+LRA A K
Sbjct  218  LATIPITGTGINPARSFGAAVIYNEDKIWDDQWIFWVGPIVGAAVAAFYHQYILRAAAIK  277

Query  319  ALGSYRSNA  293
            ALGS+RSNA
Sbjct  278  ALGSFRSNA  286



>gb|AHA84284.1| prolactin-inducible protein [Phaseolus vulgaris]
Length=285

 Score =   232 bits (591),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 110/129 (85%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN + DGY+KGT LGAEIIGTFVLVYTVF+ATDPK+NARDSHVPVLAPLPIGFAVFMVH
Sbjct  157  GANSVADGYNKGTALGAEIIGTFVLVYTVFSATDPKKNARDSHVPVLAPLPIGFAVFMVH  216

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIP+TGTGINPARSFGAAVIY K+K WDDQWIFWVGP +GAA+AA YHQY+LRA A K
Sbjct  217  LATIPVTGTGINPARSFGAAVIYNKEKIWDDQWIFWVGPIIGAAVAAFYHQYILRAAAIK  276

Query  319  ALGSYRSNA  293
            ALGS+RSNA
Sbjct  277  ALGSFRSNA  285



>ref|XP_006436425.1| hypothetical protein CICLE_v10032302mg [Citrus clementina]
 ref|XP_006485687.1| PREDICTED: probable aquaporin PIP2-5-like [Citrus sinensis]
 gb|ESR49665.1| hypothetical protein CICLE_v10032302mg [Citrus clementina]
Length=287

 Score =   232 bits (591),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/129 (86%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGYS G GL AEIIGTFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVH
Sbjct  157  GANELADGYSTGVGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVH  216

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARS GAAVIY KDKAWDDQW+FWVGPF+GAAIAA YHQ++LRAGA K
Sbjct  217  LATIPITGTGINPARSLGAAVIYNKDKAWDDQWLFWVGPFIGAAIAAFYHQFILRAGAVK  276

Query  319  ALGSYRSNA  293
            ALGS+RS +
Sbjct  277  ALGSFRSQS  285



>ref|XP_008449252.1| PREDICTED: aquaporin PIP2-1-like isoform X2 [Cucumis melo]
Length=284

 Score =   232 bits (591),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/132 (84%), Positives = 121/132 (92%), Gaps = 0/132 (0%)
 Frame = -2

Query  691  DMAAGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAV  512
            +   GAN L DGYS GTGL AEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAV
Sbjct  153  EYGGGANSLADGYSTGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAV  212

Query  511  FMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRA  332
            FMVHLATIPITGTGINPARSFGAAV++ + K WDDQWIFWVGPF+GAAIAA+YHQ+VLRA
Sbjct  213  FMVHLATIPITGTGINPARSFGAAVVFNRSKPWDDQWIFWVGPFIGAAIAAIYHQFVLRA  272

Query  331  GAAKALGSYRSN  296
            GAAKALGS+ S+
Sbjct  273  GAAKALGSFSSS  284



>gb|AAF71816.1|AF141642_1 putative aquaporin PIP2-1 [Vitis cinerea var. helleri x Vitis 
rupestris]
Length=284

 Score =   231 bits (590),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/128 (88%), Positives = 119/128 (93%), Gaps = 0/128 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L  GYSKGTGLGAEIIGTFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVH
Sbjct  154  GANELSTGYSKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVH  213

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARS GAAVIY  +KAWDDQWIFWVGPF+GAAIAA YHQ++LRAGA K
Sbjct  214  LATIPITGTGINPARSLGAAVIYNNEKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAIK  273

Query  319  ALGSYRSN  296
            ALGS+RS 
Sbjct  274  ALGSFRST  281



>gb|ACU20229.1| unknown [Glycine max]
Length=285

 Score =   231 bits (590),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 110/128 (86%), Positives = 119/128 (93%), Gaps = 0/128 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L +GYS G GLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  155  GANELSEGYSTGVGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  214

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIP+TGTGINPARS GAAV+Y + KAWDD WIFWVGPF+GAAIAA YHQ++LRAGAAK
Sbjct  215  LATIPVTGTGINPARSLGAAVVYNQQKAWDDHWIFWVGPFIGAAIAAFYHQFILRAGAAK  274

Query  319  ALGSYRSN  296
            ALGS+RSN
Sbjct  275  ALGSFRSN  282



>emb|CDY70391.1| BnaC03g72010D [Brassica napus]
Length=159

 Score =   227 bits (579),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 110/129 (85%), Positives = 117/129 (91%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGYS GTGL AEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  29   GANSLADGYSTGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  88

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAVIY + K WDD WIFWVGPF+GAAIAA YHQ+VLRA  +K
Sbjct  89   LATIPITGTGINPARSFGAAVIYNESKPWDDHWIFWVGPFIGAAIAAFYHQFVLRASGSK  148

Query  319  ALGSYRSNA  293
            +LGS+RS A
Sbjct  149  SLGSFRSAA  157



>gb|KDO44716.1| hypothetical protein CISIN_1g0196812mg [Citrus sinensis]
Length=337

 Score =   233 bits (594),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/129 (86%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGYS G GL AEIIGTFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVH
Sbjct  207  GANELADGYSTGVGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVH  266

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARS GAAVIY KDKAWDDQW+FWVGPF+GAAIAA YHQ++LRAGA K
Sbjct  267  LATIPITGTGINPARSLGAAVIYNKDKAWDDQWLFWVGPFIGAAIAAFYHQFILRAGAVK  326

Query  319  ALGSYRSNA  293
            ALGS+RS +
Sbjct  327  ALGSFRSQS  335



>gb|KHN32779.1| Aquaporin PIP2-2 [Glycine soja]
Length=239

 Score =   230 bits (586),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 109/128 (85%), Positives = 118/128 (92%), Gaps = 0/128 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L +GYS G GLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  109  GANELSEGYSTGVGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  168

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIP+TGTGINPARS GAAV+Y + KAWDD WIFWVGPF+GAAIAA YHQ++LRA AAK
Sbjct  169  LATIPVTGTGINPARSLGAAVMYNQQKAWDDHWIFWVGPFIGAAIAAFYHQFILRASAAK  228

Query  319  ALGSYRSN  296
            ALGS+RSN
Sbjct  229  ALGSFRSN  236



>gb|ABU94630.1| putative aquaporin PIP2;2 [Phaseolus vulgaris]
Length=287

 Score =   231 bits (590),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 110/129 (85%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN + DGY+KGT LGAEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  159  GANTVSDGYNKGTALGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  218

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFG AVI+  DKAWDDQWI+WVGPF+GAA+AA YHQY+LRA A K
Sbjct  219  LATIPITGTGINPARSFGPAVIFNNDKAWDDQWIYWVGPFIGAAVAAFYHQYILRAAAIK  278

Query  319  ALGSYRSNA  293
             LGS+RSNA
Sbjct  279  VLGSFRSNA  287



>gb|AHG32323.1| PIP2-2 [Pisum sativum]
Length=287

 Score =   231 bits (590),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 109/129 (84%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN + DGYSKGT LGAEIIGTFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVH
Sbjct  159  GANTVSDGYSKGTALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVH  218

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIP+TGTGINPARSFG AVI+  DKAWDDQWI+WVGPF+GAA+AA+YHQY+LR  A K
Sbjct  219  LATIPVTGTGINPARSFGPAVIFNNDKAWDDQWIYWVGPFIGAAVAAIYHQYILRGSAIK  278

Query  319  ALGSYRSNA  293
            ALGS+RSNA
Sbjct  279  ALGSFRSNA  287



>ref|XP_008449251.1| PREDICTED: aquaporin PIP2-1-like isoform X1 [Cucumis melo]
Length=287

 Score =   231 bits (590),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/132 (84%), Positives = 120/132 (91%), Gaps = 0/132 (0%)
 Frame = -2

Query  691  DMAAGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAV  512
            +   GAN L DGYS GTGL AEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAV
Sbjct  153  EYGGGANSLADGYSTGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAV  212

Query  511  FMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRA  332
            FMVHLATIPITGTGINPARSFGAAV++ + K WDDQWIFWVGPF+GAAIAA+YHQ VLRA
Sbjct  213  FMVHLATIPITGTGINPARSFGAAVVFNRSKPWDDQWIFWVGPFIGAAIAAIYHQIVLRA  272

Query  331  GAAKALGSYRSN  296
            GA KALGS+RS+
Sbjct  273  GAVKALGSFRSS  284



>gb|AIK66515.1| putative aquaporin [Vitis vinifera]
Length=284

 Score =   231 bits (589),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 111/128 (87%), Positives = 119/128 (93%), Gaps = 0/128 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L  GYSKGTGLGAEIIGTFVLVYTVF+ATDPKR+ARDSH+PVLAPLPIGFAVFMVH
Sbjct  154  GANELATGYSKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHIPVLAPLPIGFAVFMVH  213

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARS GAAVIY  +KAWDDQWIFWVGPF+GAAIAA YHQ++LRAGA K
Sbjct  214  LATIPITGTGINPARSLGAAVIYNNEKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAIK  273

Query  319  ALGSYRSN  296
            ALGS+RS 
Sbjct  274  ALGSFRST  281



>ref|XP_009600501.1| PREDICTED: aquaporin PIP2-7-like [Nicotiana tomentosiformis]
 tpg|DAA64680.1| TPA_exp: aquaporin PIP2 6a [Nicotiana tabacum]
Length=283

 Score =   231 bits (589),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 112/128 (88%), Positives = 121/128 (95%), Gaps = 0/128 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN +Q GY+KGT LGAEIIGTFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVH
Sbjct  153  GANFVQPGYNKGTALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVH  212

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAVIY K+K WDDQWIFWVGPFVGA IAA+Y+Q+VLRAGA K
Sbjct  213  LATIPITGTGINPARSFGAAVIYNKEKIWDDQWIFWVGPFVGALIAAIYYQFVLRAGAVK  272

Query  319  ALGSYRSN  296
            ALGS+RSN
Sbjct  273  ALGSFRSN  280



>gb|KHN00691.1| Aquaporin PIP2-2 [Glycine soja]
Length=285

 Score =   231 bits (589),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 110/128 (86%), Positives = 119/128 (93%), Gaps = 0/128 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L +GYS G GLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  155  GANELSEGYSTGVGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  214

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIP+TGTGINPARS GAAV+Y + KAWDD WIFWVGPF+GAAIAA YHQ++LRAGAAK
Sbjct  215  LATIPVTGTGINPARSLGAAVMYNQQKAWDDHWIFWVGPFIGAAIAAFYHQFILRAGAAK  274

Query  319  ALGSYRSN  296
            ALGS+RSN
Sbjct  275  ALGSFRSN  282



>gb|ACR56613.1| plasma intrinsic protein 2;3 [Juglans regia]
Length=284

 Score =   231 bits (589),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 112/129 (87%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L  GY+KG GLGAEIIGTFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVH
Sbjct  156  GANELAPGYNKGVGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVH  215

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAVIY +DKAWDDQWIFWVGPF+GAAIAA YHQ++LRA   K
Sbjct  216  LATIPITGTGINPARSFGAAVIYNQDKAWDDQWIFWVGPFIGAAIAAFYHQFILRAEPLK  275

Query  319  ALGSYRSNA  293
            ALGS+RSNA
Sbjct  276  ALGSFRSNA  284



>ref|NP_001240039.1| uncharacterized protein LOC100782155 [Glycine max]
 gb|ACU23140.1| unknown [Glycine max]
 gb|KHN32778.1| Aquaporin PIP2-2 [Glycine soja]
Length=285

 Score =   231 bits (589),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 110/128 (86%), Positives = 119/128 (93%), Gaps = 0/128 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L +GYS G GLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  155  GANELSEGYSTGVGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  214

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIP+TGTGINPARS GAAV+Y + KAWDD WIFWVGPF+GAAIAA YHQ++LRAGAAK
Sbjct  215  LATIPVTGTGINPARSLGAAVMYNQQKAWDDHWIFWVGPFIGAAIAAFYHQFILRAGAAK  274

Query  319  ALGSYRSN  296
            ALGS+RSN
Sbjct  275  ALGSFRSN  282



>ref|NP_001105639.1| aquaporin PIP2-7 [Zea mays]
 sp|Q9ATM4.1|PIP27_MAIZE RecName: Full=Aquaporin PIP2-7; AltName: Full=Plasma membrane 
intrinsic protein 2-7; AltName: Full=ZmPIP2-7; AltName: Full=ZmPIP2;7 
[Zea mays]
 gb|AAK26763.1| plasma membrane integral protein ZmPIP2-7 [Zea mays]
 gb|ACU23788.1| unknown [Glycine max]
 gb|KHN21518.1| Aquaporin PIP2-7 [Glycine soja]
Length=287

 Score =   231 bits (589),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 109/129 (84%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            G N + DGY+KGT LGAEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  159  GVNTVSDGYNKGTALGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  218

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIP+TGTGINPARSFG AVI+  DKAWDDQWI+WVGPFVGAA+AA+YHQY+LR  A K
Sbjct  219  LATIPVTGTGINPARSFGPAVIFNNDKAWDDQWIYWVGPFVGAAVAAIYHQYILRGSAIK  278

Query  319  ALGSYRSNA  293
            ALGS+RSNA
Sbjct  279  ALGSFRSNA  287



>gb|KDO68093.1| hypothetical protein CISIN_1g023370mg [Citrus sinensis]
Length=212

 Score =   228 bits (582),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 109/132 (83%), Positives = 117/132 (89%), Gaps = 0/132 (0%)
 Frame = -2

Query  691  DMAAGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAV  512
             +  GAN +  GY+KG+ LGAEIIGTFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAV
Sbjct  78   SLGGGANTVASGYNKGSALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAV  137

Query  511  FMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRA  332
            FMVHLATIPITGTGINPARSFGAAVIY  DKAWDD WIFWVGPFVGA  AA YHQY+LRA
Sbjct  138  FMVHLATIPITGTGINPARSFGAAVIYNNDKAWDDHWIFWVGPFVGALAAAAYHQYILRA  197

Query  331  GAAKALGSYRSN  296
             A KALGS+RSN
Sbjct  198  AAIKALGSFRSN  209



>ref|XP_010253676.1| PREDICTED: aquaporin PIP2-4-like [Nelumbo nucifera]
Length=287

 Score =   231 bits (589),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 112/128 (88%), Positives = 117/128 (91%), Gaps = 0/128 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGYSKG GL AEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  157  GANELADGYSKGVGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  216

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARS GAAVI+ KDKAW D WIFWVGPF+GAAIAA YHQY+LRA A K
Sbjct  217  LATIPITGTGINPARSLGAAVIFNKDKAWHDHWIFWVGPFIGAAIAAFYHQYILRAAAIK  276

Query  319  ALGSYRSN  296
            ALGS+RSN
Sbjct  277  ALGSFRSN  284



>ref|XP_006280883.1| hypothetical protein CARUB_v10026881mg, partial [Capsella rubella]
 gb|EOA13781.1| hypothetical protein CARUB_v10026881mg, partial [Capsella rubella]
Length=297

 Score =   231 bits (589),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 111/129 (86%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGY+KGTGLGAEIIGTFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVH
Sbjct  169  GANELADGYNKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVH  228

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAVIY K+KAWDDQWIFWVGP +GAA AA+YHQ++LRA A K
Sbjct  229  LATIPITGTGINPARSFGAAVIYNKEKAWDDQWIFWVGPMIGAAAAALYHQFILRAAAIK  288

Query  319  ALGSYRSNA  293
            AL S+RS+A
Sbjct  289  ALNSFRSSA  297



>gb|AAG02208.1|AF290201_1 plasma membrane intrinsic protein PIP2 [Solanum chacoense]
Length=283

 Score =   231 bits (588),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 112/128 (88%), Positives = 119/128 (93%), Gaps = 0/128 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN +Q GYSKGT LGAEIIGTFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVH
Sbjct  153  GANFVQPGYSKGTALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVH  212

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAVIYG +K WDDQWIFWVGP VGA  AA+YHQ+VLRAGA K
Sbjct  213  LATIPITGTGINPARSFGAAVIYGHEKIWDDQWIFWVGPMVGAMAAAIYHQFVLRAGAVK  272

Query  319  ALGSYRSN  296
            ALGS+RSN
Sbjct  273  ALGSFRSN  280



>emb|CBI37861.3| unnamed protein product [Vitis vinifera]
Length=198

 Score =   228 bits (580),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 109/132 (83%), Positives = 117/132 (89%), Gaps = 0/132 (0%)
 Frame = -2

Query  691  DMAAGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAV  512
             +  GAN +  GY+KGT LGAEIIGTFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAV
Sbjct  64   SLGGGANSVAAGYNKGTALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAV  123

Query  511  FMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRA  332
            FMVHLATIPITGTGINPARSFGAAVIY  +K WDDQWIFWVGPFVGA  AA YHQY+LRA
Sbjct  124  FMVHLATIPITGTGINPARSFGAAVIYNNEKVWDDQWIFWVGPFVGALAAAAYHQYILRA  183

Query  331  GAAKALGSYRSN  296
             A KALGS+RSN
Sbjct  184  AAIKALGSFRSN  195



>gb|ADK25057.1| plasma membrane intrinsic protein [Glycine max]
Length=286

 Score =   231 bits (588),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 111/129 (86%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN + DGY+ GT LGAEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  158  GANSVADGYNNGTALGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  217

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAVIY +DK WDDQWIFWVGP VGAA+AA YHQY+LRA A K
Sbjct  218  LATIPITGTGINPARSFGAAVIYNEDKIWDDQWIFWVGPIVGAAVAAFYHQYILRAAAIK  277

Query  319  ALGSYRSNA  293
            ALGS++SNA
Sbjct  278  ALGSFKSNA  286



>dbj|BAF32141.1| putative aquaporin [Taxodium distichum]
Length=274

 Score =   230 bits (586),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 112/128 (88%), Positives = 118/128 (92%), Gaps = 0/128 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN +  GYSKGTGLGAEIIGTFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVH
Sbjct  144  GANSVAQGYSKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVH  203

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAVIYG DK WDDQWIFWVGPF+GA  AA YHQY+LRA A K
Sbjct  204  LATIPITGTGINPARSFGAAVIYGHDKIWDDQWIFWVGPFLGAFAAAFYHQYILRAAAIK  263

Query  319  ALGSYRSN  296
            ALGS+RSN
Sbjct  264  ALGSFRSN  271



>dbj|BAA23744.1| HvPIP2;1 [Hordeum vulgare subsp. vulgare]
Length=286

 Score =   231 bits (588),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 114/128 (89%), Positives = 117/128 (91%), Gaps = 1/128 (1%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L  GYSKGTGL AEIIGTFVLVYTVF+ATDPKRNARDSH+PVLAPLPIGFAVFMVH
Sbjct  160  GANELSAGYSKGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHIPVLAPLPIGFAVFMVH  219

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARS GAAVIY  DKAWDDQWIFWVGP +GAAIAA YHQYVLRA AAK
Sbjct  220  LATIPITGTGINPARSLGAAVIYNTDKAWDDQWIFWVGPLIGAAIAAAYHQYVLRASAAK  279

Query  319  ALGSYRSN  296
             LGSYRSN
Sbjct  280  -LGSYRSN  286



>ref|NP_001105638.1| aquaporin PIP2-2 [Zea mays]
 sp|Q9ATM8.1|PIP22_MAIZE RecName: Full=Aquaporin PIP2-2; AltName: Full=Plasma membrane 
intrinsic protein 2-2; AltName: Full=ZmPIP2-2; AltName: Full=ZmPIP2;2 
[Zea mays]
 gb|AAK26759.1| plasma membrane integral protein ZmPIP2-2 [Zea mays]
 gb|ACG39966.1| aquaporin PIP2.1 [Zea mays]
 gb|ACN31255.1| unknown [Zea mays]
 tpg|DAA39706.1| TPA: plasma membrane intrinsic protein2 [Zea mays]
Length=292

 Score =   231 bits (588),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 110/129 (85%), Positives = 118/129 (91%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L  GYS+G GLGAEI+GTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  164  GANSLASGYSRGAGLGAEIVGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  223

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIP+TGTGINPARS GAAV+Y KDK WDD WIFWVGP +GAAIAA YHQY+LRAGA K
Sbjct  224  LATIPVTGTGINPARSLGAAVVYNKDKPWDDHWIFWVGPLLGAAIAAFYHQYILRAGAIK  283

Query  319  ALGSYRSNA  293
            ALGS+RSNA
Sbjct  284  ALGSFRSNA  292



>ref|XP_007009830.1| Plasma membrane intrinsic protein 2A [Theobroma cacao]
 gb|EOY18640.1| Plasma membrane intrinsic protein 2A [Theobroma cacao]
Length=281

 Score =   230 bits (587),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 111/128 (87%), Positives = 117/128 (91%), Gaps = 0/128 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGYS GTGLGAEIIGTFVLVYTVF+ATDPKR ARDSHVPVLAPLPIGFAVFMVH
Sbjct  151  GANTLSDGYSTGTGLGAEIIGTFVLVYTVFSATDPKRKARDSHVPVLAPLPIGFAVFMVH  210

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIP+TGTGINPARSFGAAVIY   KAWDD WIFWVGP +GAAIAA YHQ++LRAGAAK
Sbjct  211  LATIPVTGTGINPARSFGAAVIYNNKKAWDDHWIFWVGPMIGAAIAAFYHQFILRAGAAK  270

Query  319  ALGSYRSN  296
            ALGS+RS 
Sbjct  271  ALGSFRSQ  278



>gb|ACF79873.1| unknown [Zea mays]
Length=294

 Score =   231 bits (588),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 110/129 (85%), Positives = 118/129 (91%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L  GYS+G GLGAEI+GTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  166  GANSLASGYSRGAGLGAEIVGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  225

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIP+TGTGINPARS GAAV+Y KDK WDD WIFWVGP +GAAIAA YHQY+LRAGA K
Sbjct  226  LATIPVTGTGINPARSLGAAVVYNKDKPWDDHWIFWVGPLLGAAIAAFYHQYILRAGAIK  285

Query  319  ALGSYRSNA  293
            ALGS+RSNA
Sbjct  286  ALGSFRSNA  294



>ref|XP_002311092.1| plasma membrane intrinsic protein 1-1 [Populus trichocarpa]
 gb|ABK95655.1| unknown [Populus trichocarpa]
 gb|EEE88459.1| plasma membrane intrinsic protein 1-1 [Populus trichocarpa]
Length=285

 Score =   230 bits (587),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 112/128 (88%), Positives = 118/128 (92%), Gaps = 0/128 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGYS GTGLGAEIIGTFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVH
Sbjct  155  GANVLADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVH  214

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAVIY   KAW DQWIFW GPF+GAAIAA YHQ++LRAGA K
Sbjct  215  LATIPITGTGINPARSFGAAVIYNNKKAWHDQWIFWAGPFIGAAIAAFYHQFILRAGAIK  274

Query  319  ALGSYRSN  296
            ALGS+RSN
Sbjct  275  ALGSFRSN  282



>dbj|BAE02729.1| PIP aquaporin [Hordeum vulgare]
Length=286

 Score =   230 bits (587),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 114/128 (89%), Positives = 117/128 (91%), Gaps = 1/128 (1%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L  GYSKGTGL AEIIGTFVLVYTVF+ATDPKRNARDSH+PVLAPLPIGFAVFMVH
Sbjct  160  GANELSAGYSKGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHIPVLAPLPIGFAVFMVH  219

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARS GAAVIY  DKAWDDQWIFWVGP +GAAIAA YHQYVLRA AAK
Sbjct  220  LATIPITGTGINPARSLGAAVIYNTDKAWDDQWIFWVGPLIGAAIAAAYHQYVLRASAAK  279

Query  319  ALGSYRSN  296
             LGSYRSN
Sbjct  280  -LGSYRSN  286



>gb|KFK30134.1| hypothetical protein AALP_AA7G221400 [Arabis alpina]
Length=282

 Score =   230 bits (587),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 110/132 (83%), Positives = 120/132 (91%), Gaps = 0/132 (0%)
 Frame = -2

Query  688  MAAGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVF  509
            +  GAN + DGY+KGT LGAEIIGTFVLVYTVF+ATDPKR+ARDSH+PVLAPLPIGFAVF
Sbjct  149  LGGGANMVADGYNKGTALGAEIIGTFVLVYTVFSATDPKRSARDSHIPVLAPLPIGFAVF  208

Query  508  MVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAG  329
            MVHLATIPITGTGINPARSFGAAVIY  +KAWDDQWIFWVGPF+GA  AA YHQY+LRA 
Sbjct  209  MVHLATIPITGTGINPARSFGAAVIYNNEKAWDDQWIFWVGPFLGALAAAAYHQYILRAA  268

Query  328  AAKALGSYRSNA  293
            A KALGS+RSNA
Sbjct  269  AVKALGSFRSNA  280



>ref|XP_008233329.1| PREDICTED: probable aquaporin PIP2-5 [Prunus mume]
Length=287

 Score =   230 bits (587),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 111/128 (87%), Positives = 118/128 (92%), Gaps = 0/128 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L  GYS G GLGAEIIGTFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVF+VH
Sbjct  157  GANELSQGYSTGVGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFIVH  216

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARS GAAVIY K KAWDDQWIFWVGPF+GAAIAA YHQ++LRAGA K
Sbjct  217  LATIPITGTGINPARSLGAAVIYNKKKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVK  276

Query  319  ALGSYRSN  296
            ALGS+RSN
Sbjct  277  ALGSFRSN  284



>ref|NP_001289999.1| aquaporin PIP2-1 [Beta vulgaris subsp. vulgaris]
 gb|ACT22630.1| plasma membrane intrinsic protein PIP2;2 [Beta vulgaris subsp. 
vulgaris]
Length=288

 Score =   230 bits (587),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 110/129 (85%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN +  GY+KGTGLGAEIIGTFVLVYTVFAATDPKR+ARDSHVPVLAPLPIGFAVFMVH
Sbjct  160  GANQMSHGYNKGTGLGAEIIGTFVLVYTVFAATDPKRSARDSHVPVLAPLPIGFAVFMVH  219

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAVI+ ++K+W++ WIFWVGPFVGAAIAA YHQY+LRAGA K
Sbjct  220  LATIPITGTGINPARSFGAAVIFNEEKSWNEHWIFWVGPFVGAAIAAFYHQYILRAGAIK  279

Query  319  ALGSYRSNA  293
            ALGS+RS+A
Sbjct  280  ALGSFRSSA  288



>ref|XP_006846771.1| hypothetical protein AMTR_s00148p00023270 [Amborella trichopoda]
 gb|ERN08352.1| hypothetical protein AMTR_s00148p00023270 [Amborella trichopoda]
Length=283

 Score =   230 bits (586),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 110/128 (86%), Positives = 117/128 (91%), Gaps = 0/128 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L +GY KG GLGAEIIGTFVLVYTVF+ATDPKR+ARDSH+PVLAPLPIGFAVFMVH
Sbjct  153  GANTLSNGYDKGVGLGAEIIGTFVLVYTVFSATDPKRSARDSHIPVLAPLPIGFAVFMVH  212

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARS GAAVIY   KAWDDQWIFWVGPF+GAAIAA YHQY+LRA A K
Sbjct  213  LATIPITGTGINPARSLGAAVIYNNKKAWDDQWIFWVGPFIGAAIAAAYHQYILRAAAIK  272

Query  319  ALGSYRSN  296
            ALGS+RSN
Sbjct  273  ALGSFRSN  280



>dbj|BAF32042.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32043.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32044.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32045.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32046.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32047.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32048.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32049.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32050.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32051.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32052.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32053.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32054.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32055.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32056.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32057.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32058.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32059.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32060.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32061.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32062.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32063.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32064.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32065.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32066.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32067.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32068.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32069.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32070.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32071.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32072.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32073.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32074.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32075.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32076.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32077.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32078.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32079.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32080.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32081.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32082.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32083.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32084.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32085.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32086.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32087.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32088.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32089.1| putative aquaporin [Cryptomeria japonica]
Length=275

 Score =   229 bits (585),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 112/128 (88%), Positives = 118/128 (92%), Gaps = 0/128 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN +  GYSKGTGLGAEIIGTFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVH
Sbjct  145  GANSVAPGYSKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVH  204

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAVIYG DK WDDQWIFWVGPF+GA  AA YHQY+LRA A K
Sbjct  205  LATIPITGTGINPARSFGAAVIYGHDKIWDDQWIFWVGPFLGAFAAAFYHQYILRAAAIK  264

Query  319  ALGSYRSN  296
            ALGS+RSN
Sbjct  265  ALGSFRSN  272



>gb|KJB15837.1| hypothetical protein B456_002G198900 [Gossypium raimondii]
Length=211

 Score =   228 bits (580),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 109/132 (83%), Positives = 118/132 (89%), Gaps = 0/132 (0%)
 Frame = -2

Query  691  DMAAGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAV  512
             +  GAN +  GY+KGT LGAEIIGTFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAV
Sbjct  77   SLGGGANTVASGYNKGTALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAV  136

Query  511  FMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRA  332
            FMVHLATIPITGTGINPARSFGAAVIY  DKAWD+ WIFWVGPFVGA  AA+YHQY+LRA
Sbjct  137  FMVHLATIPITGTGINPARSFGAAVIYNNDKAWDEHWIFWVGPFVGALAAAIYHQYILRA  196

Query  331  GAAKALGSYRSN  296
             A KALGS+RSN
Sbjct  197  AAIKALGSFRSN  208



>ref|XP_010529747.1| PREDICTED: aquaporin PIP2-2-like [Tarenaya hassleriana]
Length=288

 Score =   230 bits (586),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 111/127 (87%), Positives = 117/127 (92%), Gaps = 0/127 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGYSKGTGL AEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  158  GANSLADGYSKGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  217

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARS GAAVIY KDK WDD WIFWVGPF+GAAIAA YHQ+VLRA  +K
Sbjct  218  LATIPITGTGINPARSLGAAVIYNKDKPWDDHWIFWVGPFIGAAIAAFYHQFVLRASGSK  277

Query  319  ALGSYRS  299
            +LGS+RS
Sbjct  278  SLGSFRS  284



>ref|XP_004307390.1| PREDICTED: aquaporin PIP2-1 [Fragaria vesca subsp. vesca]
Length=285

 Score =   230 bits (586),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 111/128 (87%), Positives = 118/128 (92%), Gaps = 0/128 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L +GYS G GL AEIIGTFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVH
Sbjct  155  GANELAEGYSTGVGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVH  214

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARS GAAVIY K KAWDDQWIFWVGPF+GAAIAA YHQ++LRAGA K
Sbjct  215  LATIPITGTGINPARSLGAAVIYDKKKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVK  274

Query  319  ALGSYRSN  296
            ALGS+RSN
Sbjct  275  ALGSFRSN  282



>ref|XP_003606383.1| Aquaporin PIP2-7 [Medicago truncatula]
 gb|AES88580.1| major intrinsic protein (MIP) family transporter [Medicago truncatula]
 gb|AFK45158.1| unknown [Medicago truncatula]
Length=285

 Score =   230 bits (586),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 109/129 (84%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN + DGY+KGT LGAEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  157  GANFVHDGYNKGTALGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  216

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIP+TGTGINPARSFG+AVIY   K WDDQWIFWVGPF+GAA+AA+YHQY+LR  A K
Sbjct  217  LATIPVTGTGINPARSFGSAVIYNDGKIWDDQWIFWVGPFIGAAVAAIYHQYILRGSAIK  276

Query  319  ALGSYRSNA  293
            ALGS+RSNA
Sbjct  277  ALGSFRSNA  285



>ref|XP_010032196.1| PREDICTED: aquaporin PIP2-1 [Eucalyptus grandis]
Length=284

 Score =   229 bits (585),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/128 (87%), Positives = 118/128 (92%), Gaps = 0/128 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L +GY    GLGAEIIGTFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVH
Sbjct  156  GANMLAEGYKTRVGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVH  215

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARS GAAVIY KDKAWDDQWIFWVGPF+GAAIAA YHQ++LRAGA K
Sbjct  216  LATIPITGTGINPARSLGAAVIYNKDKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVK  275

Query  319  ALGSYRSN  296
            ALGS+RSN
Sbjct  276  ALGSFRSN  283



>ref|XP_006360898.1| PREDICTED: aquaporin PIP2-7-like [Solanum tuberosum]
Length=283

 Score =   229 bits (585),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/128 (87%), Positives = 119/128 (93%), Gaps = 0/128 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN +Q GY+KGT LGAEIIGTFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVH
Sbjct  153  GANFVQPGYNKGTALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVH  212

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAVIYG +K WDDQWIFWVGP VGA  AA+YHQ+VLRAGA K
Sbjct  213  LATIPITGTGINPARSFGAAVIYGNEKIWDDQWIFWVGPMVGAMAAAIYHQFVLRAGAVK  272

Query  319  ALGSYRSN  296
            ALGS+RSN
Sbjct  273  ALGSFRSN  280



>gb|AFK47442.1| unknown [Medicago truncatula]
Length=287

 Score =   229 bits (585),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/128 (85%), Positives = 118/128 (92%), Gaps = 0/128 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGYS G GLGAEI+GTFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVH
Sbjct  157  GANFLHDGYSTGVGLGAEIVGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVH  216

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIP+TGTGINPARS G+AVIY KDK WDD WIFWVGPF+GAAIAA YHQ++LRAGA K
Sbjct  217  LATIPVTGTGINPARSLGSAVIYNKDKPWDDHWIFWVGPFIGAAIAAFYHQFILRAGAVK  276

Query  319  ALGSYRSN  296
            ALGS+RSN
Sbjct  277  ALGSFRSN  284



>ref|XP_011041003.1| PREDICTED: probable aquaporin PIP2-5 [Populus euphratica]
Length=285

 Score =   229 bits (585),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/127 (87%), Positives = 118/127 (93%), Gaps = 0/127 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DG+S GTGLGAEIIGTFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVH
Sbjct  155  GANTLADGFSTGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVH  214

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARS GAAVIY +DKAWDD WIFWVGPF GAAIAA YHQ++LRAGA K
Sbjct  215  LATIPITGTGINPARSLGAAVIYNQDKAWDDHWIFWVGPFAGAAIAAFYHQFILRAGAVK  274

Query  319  ALGSYRS  299
            ALGS+RS
Sbjct  275  ALGSFRS  281



>ref|XP_010920097.1| PREDICTED: probable aquaporin PIP2-6 [Elaeis guineensis]
Length=282

 Score =   229 bits (584),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/132 (84%), Positives = 118/132 (89%), Gaps = 0/132 (0%)
 Frame = -2

Query  691  DMAAGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAV  512
             +  GAN +  GYSKGT LGAEIIGTFVLVYTVF+ATDPKRNARDSH+PVLAPLPIGFAV
Sbjct  148  SLGGGANEVAPGYSKGTALGAEIIGTFVLVYTVFSATDPKRNARDSHIPVLAPLPIGFAV  207

Query  511  FMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRA  332
            FMVHLATIPITGTGINPARSFGAAVIY + KAWDDQWIFWVGPFVGA  AA YHQY+LRA
Sbjct  208  FMVHLATIPITGTGINPARSFGAAVIYNQGKAWDDQWIFWVGPFVGALAAAAYHQYILRA  267

Query  331  GAAKALGSYRSN  296
             A KALGS+RSN
Sbjct  268  AAIKALGSFRSN  279



>dbj|BAD90698.1| plasma membrane intrinsic protein 2;2 [Mimosa pudica]
Length=286

 Score =   229 bits (584),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 110/129 (85%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN +QDGYS GT LGAEIIGTFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVH
Sbjct  158  GANFVQDGYSTGTALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVH  217

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIP+TGTGINPARSFGAAVIY KDK WDD WIFWVGP +GAA+AA+YHQ++LRA A K
Sbjct  218  LATIPVTGTGINPARSFGAAVIYNKDKIWDDHWIFWVGPAIGAAVAAIYHQHILRATAIK  277

Query  319  ALGSYRSNA  293
            ALGS+RSNA
Sbjct  278  ALGSFRSNA  286



>ref|XP_009131906.1| PREDICTED: probable aquaporin PIP2-4 [Brassica rapa]
Length=285

 Score =   229 bits (584),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/129 (84%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGY+KGTGLGAEIIGTFVLVYTVF+ATDPKR+ARDSH+PVLAPLPIGFAVFMVH
Sbjct  157  GANQLADGYNKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHIPVLAPLPIGFAVFMVH  216

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAVIY ++KAWDDQWIFWVGP +GAA AA+YHQ+VLRA   K
Sbjct  217  LATIPITGTGINPARSFGAAVIYNQEKAWDDQWIFWVGPMIGAAAAALYHQFVLRAAGIK  276

Query  319  ALGSYRSNA  293
            +LGS+RS+A
Sbjct  277  SLGSFRSSA  285



>ref|XP_009782764.1| PREDICTED: aquaporin PIP2-7 [Nicotiana sylvestris]
 tpg|DAA64682.1| TPA_exp: aquaporin PIP2 7a [Nicotiana tabacum]
Length=284

 Score =   229 bits (584),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 110/131 (84%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = -2

Query  688  MAAGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVF  509
            +  GAN +Q GY+KGT LGAEIIGTFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVF
Sbjct  151  LGGGANFVQPGYNKGTALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVF  210

Query  508  MVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAG  329
            MVHLATIPITGTGINPARSFGAAVIY  +K WDDQWIFWVGPFVGA +AAVYHQY+LR  
Sbjct  211  MVHLATIPITGTGINPARSFGAAVIYNTEKVWDDQWIFWVGPFVGALVAAVYHQYILRGS  270

Query  328  AAKALGSYRSN  296
            A KALGS+RSN
Sbjct  271  AIKALGSFRSN  281



>gb|AAB67868.1| plasma membrane major intrinsic protein 1 [Beta vulgaris]
Length=288

 Score =   229 bits (585),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 110/129 (85%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN +  GY+KGTGLGAEIIGTFVLVYTVFAATDPKR+ARDSHVPVLAPLPIGFAVFMVH
Sbjct  160  GANQMAHGYNKGTGLGAEIIGTFVLVYTVFAATDPKRSARDSHVPVLAPLPIGFAVFMVH  219

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAVI+ ++K+W++ WIFWVGPFVGAAIAA YHQY+LRAGA K
Sbjct  220  LATIPITGTGINPARSFGAAVIFNEEKSWNEHWIFWVGPFVGAAIAAFYHQYILRAGAIK  279

Query  319  ALGSYRSNA  293
            ALGS+RS+A
Sbjct  280  ALGSFRSSA  288



>emb|CDY31523.1| BnaA10g13480D [Brassica napus]
Length=260

 Score =   228 bits (582),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/129 (84%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGY+KGTGLGAEIIGTFVLVYTVF+ATDPKR+ARDSH+PVLAPLPIGFAVFMVH
Sbjct  132  GANELADGYNKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHIPVLAPLPIGFAVFMVH  191

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAVIY ++KAWDDQWIFWVGP +GAA AA+YHQ+VLRA   K
Sbjct  192  LATIPITGTGINPARSFGAAVIYNQEKAWDDQWIFWVGPMIGAAAAALYHQFVLRAAGIK  251

Query  319  ALGSYRSNA  293
            +LGS+RS+A
Sbjct  252  SLGSFRSSA  260



>emb|CDX88767.1| BnaA03g08820D [Brassica napus]
Length=260

 Score =   228 bits (582),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/129 (84%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGY+KGTGLGAEIIGTFVLVYTVF+ATDPKR+ARDSH+PVLAPLPIGFAVFMVH
Sbjct  132  GANQLADGYNKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHIPVLAPLPIGFAVFMVH  191

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAVIY ++KAWDDQWIFWVGP +GAA AA+YHQ+VLRA   K
Sbjct  192  LATIPITGTGINPARSFGAAVIYNQEKAWDDQWIFWVGPMIGAAAAALYHQFVLRAAGIK  251

Query  319  ALGSYRSNA  293
            +LGS+RS+A
Sbjct  252  SLGSFRSSA  260



>ref|NP_001237286.1| PIP2,2 [Glycine max]
 gb|AAX86046.1| PIP2,2 [Glycine max]
Length=287

 Score =   229 bits (584),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 108/129 (84%), Positives = 118/129 (91%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            G N + DGY+KGT LGAEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFM H
Sbjct  159  GVNTVSDGYNKGTALGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMAH  218

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIP+TGTGINPARSFG AVI+  DKAWDDQWI+WVGPFVGAA+AA+YHQY+LR  A K
Sbjct  219  LATIPVTGTGINPARSFGPAVIFNNDKAWDDQWIYWVGPFVGAAVAAIYHQYILRGSAIK  278

Query  319  ALGSYRSNA  293
            ALGS+RSNA
Sbjct  279  ALGSFRSNA  287



>ref|XP_003591905.1| Aquaporin PIP [Medicago truncatula]
Length=283

 Score =   229 bits (584),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/128 (85%), Positives = 118/128 (92%), Gaps = 0/128 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGYS G GLGAEI+GTFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVH
Sbjct  153  GANFLHDGYSTGVGLGAEIVGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVH  212

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIP+TGTGINPARS G+AVIY KDK WDD WIFWVGPF+GAAIAA YHQ++LRAGA K
Sbjct  213  LATIPVTGTGINPARSLGSAVIYNKDKPWDDHWIFWVGPFIGAAIAAFYHQFILRAGAVK  272

Query  319  ALGSYRSN  296
            ALGS+RSN
Sbjct  273  ALGSFRSN  280



>gb|AAD31846.1|AF133530_1 water channel protein MipH [Mesembryanthemum crystallinum]
Length=291

 Score =   229 bits (585),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 111/128 (87%), Positives = 119/128 (93%), Gaps = 0/128 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L  GYSKGTGL AEIIGTFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVH
Sbjct  160  GANELSVGYSKGTGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVH  219

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARS GAAVIY  +KAWDDQWIFWVGPF+GAAIAA+YHQY+LRAG  K
Sbjct  220  LATIPITGTGINPARSLGAAVIYNNNKAWDDQWIFWVGPFIGAAIAAIYHQYILRAGFIK  279

Query  319  ALGSYRSN  296
            ALGS+RS+
Sbjct  280  ALGSFRSS  287



>ref|XP_003548071.1| PREDICTED: aquaporin PIP2-2-like [Glycine max]
Length=285

 Score =   229 bits (584),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/128 (85%), Positives = 118/128 (92%), Gaps = 0/128 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L +GYS G GLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  155  GANELSEGYSTGVGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  214

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIP+TGTGINPARS GAAV+Y + KAWDD WIFWVGPF+GAAIAA YHQ++LRA AAK
Sbjct  215  LATIPVTGTGINPARSLGAAVMYNQQKAWDDHWIFWVGPFIGAAIAAFYHQFILRASAAK  274

Query  319  ALGSYRSN  296
            ALGS+RSN
Sbjct  275  ALGSFRSN  282



>gb|KHN02341.1| Putative aquaporin PIP2-1 [Glycine soja]
Length=194

 Score =   226 bits (576),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/129 (84%), Positives = 118/129 (91%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            G N L DGYSKGTGLGAEIIGTF+LVYTVF+ATDPKR ARDSHVPVLAPLPIGFAVFMVH
Sbjct  64   GVNMLADGYSKGTGLGAEIIGTFILVYTVFSATDPKRVARDSHVPVLAPLPIGFAVFMVH  123

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARS G AVI+  +KAWDDQWIFWVGPF+GAA+AA YHQ VLRA AAK
Sbjct  124  LATIPITGTGINPARSLGPAVIFNNEKAWDDQWIFWVGPFIGAALAAFYHQSVLRAQAAK  183

Query  319  ALGSYRSNA  293
            ALGS+RS++
Sbjct  184  ALGSFRSSS  192



>gb|KFK36804.1| hypothetical protein AALP_AA4G173500 [Arabis alpina]
Length=295

 Score =   229 bits (585),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 111/128 (87%), Positives = 117/128 (91%), Gaps = 0/128 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGY+ G G+GAEIIGTFVLVYTVF+ATDPKRNARDSH+PVLAPLPIGF+VFMVH
Sbjct  162  GANVLADGYNVGVGVGAEIIGTFVLVYTVFSATDPKRNARDSHIPVLAPLPIGFSVFMVH  221

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAVIY K KAWDDQWIFWVGPFVGAAIAA YHQ+VLRAGA K
Sbjct  222  LATIPITGTGINPARSFGAAVIYNKQKAWDDQWIFWVGPFVGAAIAAFYHQFVLRAGAMK  281

Query  319  ALGSYRSN  296
            A GS RS 
Sbjct  282  AYGSVRSQ  289



>gb|AAL49752.1|AF452014_1 aquaporin-like protein [Petunia x hybrida]
Length=286

 Score =   229 bits (584),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 110/128 (86%), Positives = 118/128 (92%), Gaps = 0/128 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L DGYSK  GL AEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  155  GANMLSDGYSKSVGLSAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  214

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARS GAAVI+ +DKAW D WIFWVGPF+GAAIAA YHQ++LRAGAAK
Sbjct  215  LATIPITGTGINPARSLGAAVIFNQDKAWKDHWIFWVGPFIGAAIAAFYHQFILRAGAAK  274

Query  319  ALGSYRSN  296
            ALGS+RS+
Sbjct  275  ALGSFRSS  282



>gb|ACU21481.1| unknown [Glycine max]
Length=287

 Score =   229 bits (584),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 108/129 (84%), Positives = 118/129 (91%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            G N + DGY+K T LGAEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  159  GVNTVSDGYNKSTALGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  218

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIP+TGTGINPARSFG AVI+  DKAWDDQWI+WVGPFVGAA+AA+YHQY+LR  A K
Sbjct  219  LATIPVTGTGINPARSFGPAVIFNNDKAWDDQWIYWVGPFVGAAVAAIYHQYILRGSAIK  278

Query  319  ALGSYRSNA  293
            ALGS+RSNA
Sbjct  279  ALGSFRSNA  287



>gb|EYU42155.1| hypothetical protein MIMGU_mgv1a011301mg [Erythranthe guttata]
Length=286

 Score =   229 bits (584),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 112/129 (87%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN L  GY+ G GLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  158  GANTLAHGYNTGVGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  217

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFGAAVI+  DKAWDDQWIFWVGPFVGAAIAA YHQ++LRA A K
Sbjct  218  LATIPITGTGINPARSFGAAVIFNNDKAWDDQWIFWVGPFVGAAIAAFYHQFILRAAAIK  277

Query  319  ALGSYRSNA  293
            ALGS+RS+A
Sbjct  278  ALGSFRSHA  286



>emb|CAB61749.1| putative water channel protein [Cicer arietinum]
Length=237

 Score =   227 bits (579),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 108/129 (84%), Positives = 118/129 (91%), Gaps = 0/129 (0%)
 Frame = -2

Query  679  GANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVH  500
            GAN + DGY+KGT LGAEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVH
Sbjct  109  GANFVHDGYNKGTALGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVH  168

Query  499  LATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAK  320
            LATIPITGTGINPARSFG+AVIY + K WDDQWIFWVGP +GA +AA+YHQY+LR  A K
Sbjct  169  LATIPITGTGINPARSFGSAVIYNEGKIWDDQWIFWVGPIIGATVAAIYHQYILRGSAIK  228

Query  319  ALGSYRSNA  293
            ALGS+RSNA
Sbjct  229  ALGSFRSNA  237



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1246782646395