BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF029E15

Length=751
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006341557.1|  PREDICTED: guanine nucleotide-binding protei...    357   1e-119   
ref|XP_009611065.1|  PREDICTED: guanine nucleotide-binding protei...    353   2e-118   Nicotiana tomentosiformis
gb|ABB86277.1|  ArcA2 protein-like                                      353   3e-118   Solanum tuberosum [potatoes]
gb|AJE63428.1|  transcription factor ArcA1                              353   4e-118   Capsicum annuum
ref|XP_009776114.1|  PREDICTED: guanine nucleotide-binding protei...    352   8e-118   Nicotiana sylvestris
emb|CAA96528.1|  G protein beta-subunit-like protein                    352   8e-118   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_009780116.1|  PREDICTED: guanine nucleotide-binding protei...    352   9e-118   Nicotiana sylvestris
ref|XP_009600162.1|  PREDICTED: guanine nucleotide-binding protei...    350   4e-117   Nicotiana tomentosiformis
ref|NP_001233881.1|  ArcA2 protein                                      350   6e-117   
ref|XP_004252270.1|  PREDICTED: guanine nucleotide-binding protei...    349   1e-116   Solanum lycopersicum
ref|XP_009624187.1|  PREDICTED: guanine nucleotide-binding protei...    349   1e-116   Nicotiana tomentosiformis
gb|ABB02625.1|  G protein beta subunit-like protein                     346   1e-116   Solanum tuberosum [potatoes]
ref|XP_006353816.1|  PREDICTED: guanine nucleotide-binding protei...    347   6e-116   Solanum tuberosum [potatoes]
gb|EYU40229.1|  hypothetical protein MIMGU_mgv1a008949mg                348   1e-115   Erythranthe guttata [common monkey flower]
ref|XP_009778426.1|  PREDICTED: guanine nucleotide-binding protei...    345   3e-115   Nicotiana sylvestris
ref|XP_011072970.1|  PREDICTED: guanine nucleotide-binding protei...    345   4e-115   Sesamum indicum [beniseed]
sp|P93340.1|GBLP_NICPL  RecName: Full=Guanine nucleotide-binding ...    344   9e-115   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
sp|P49026.1|GBLP_TOBAC  RecName: Full=Guanine nucleotide-binding ...    344   9e-115   Nicotiana tabacum [American tobacco]
ref|XP_003631071.1|  Guanine nucleotide-binding protein subunit b...    343   2e-114   Medicago truncatula
gb|EYU17645.1|  hypothetical protein MIMGU_mgv1a009858mg                343   2e-114   Erythranthe guttata [common monkey flower]
ref|XP_006365404.1|  PREDICTED: guanine nucleotide-binding protei...    342   6e-114   Solanum tuberosum [potatoes]
gb|KHN21658.1|  Guanine nucleotide-binding protein subunit beta-l...    338   7e-114   Glycine soja [wild soybean]
ref|NP_001233876.1|  ArcA1 protein                                      342   9e-114   
gb|AFK36580.1|  unknown                                                 341   2e-113   Medicago truncatula
gb|EPS70887.1|  hypothetical protein M569_03871                         341   2e-113   Genlisea aurea
sp|O24076.1|GBLP_MEDSA  RecName: Full=Guanine nucleotide-binding ...    340   3e-113   Medicago sativa [alfalfa]
gb|ACR77528.1|  heterotrimeric G protein beta 1 subunit                 340   3e-113   Nicotiana benthamiana
gb|KHN00175.1|  Guanine nucleotide-binding protein subunit beta-l...    336   4e-113   Glycine soja [wild soybean]
emb|CDO98381.1|  unnamed protein product                                365   6e-113   Coffea canephora [robusta coffee]
gb|KJB37175.1|  hypothetical protein B456_006G192600                    339   7e-113   Gossypium raimondii
gb|KHG00880.1|  Guanine nucleotide-binding protein subunit beta-l...    339   1e-112   Gossypium arboreum [tree cotton]
ref|XP_004299548.1|  PREDICTED: guanine nucleotide-binding protei...    338   2e-112   Fragaria vesca subsp. vesca
gb|KJB53022.1|  hypothetical protein B456_008G288800                    338   2e-112   Gossypium raimondii
ref|NP_001241455.1|  uncharacterized protein LOC100778205               338   2e-112   Glycine max [soybeans]
ref|XP_002529557.1|  receptor for activated protein kinase C, put...    337   5e-112   Ricinus communis
ref|NP_001235369.1|  guanine nucleotide-binding protein subunit b...    337   9e-112   Glycine max [soybeans]
gb|KHG17882.1|  Guanine nucleotide-binding protein subunit beta-l...    337   9e-112   Gossypium arboreum [tree cotton]
gb|ACJ24167.1|  Rack                                                    336   1e-111   Phaseolus vulgaris [French bean]
ref|XP_008453452.1|  PREDICTED: guanine nucleotide-binding protei...    336   1e-111   Cucumis melo [Oriental melon]
ref|XP_004137327.1|  PREDICTED: guanine nucleotide-binding protei...    336   1e-111   Cucumis sativus [cucumbers]
ref|XP_007160506.1|  hypothetical protein PHAVU_002G327500g             336   1e-111   Phaseolus vulgaris [French bean]
gb|KDO62873.1|  hypothetical protein CISIN_1g048118mg                   335   1e-111   Citrus sinensis [apfelsine]
ref|XP_006451669.1|  hypothetical protein CICLE_v10008909mg             336   1e-111   Citrus clementina [clementine]
ref|XP_007036696.1|  Transducin/WD40 repeat-like superfamily protein    334   6e-111   Theobroma cacao [chocolate]
gb|KFK43977.1|  guanine nucleotide-binding protein subunit beta-l...    333   3e-110   Arabis alpina [alpine rockcress]
ref|XP_010032559.1|  PREDICTED: guanine nucleotide-binding protei...    332   4e-110   Eucalyptus grandis [rose gum]
gb|KHG29145.1|  Guanine nucleotide-binding protein subunit beta-l...    332   6e-110   Gossypium arboreum [tree cotton]
ref|XP_009110365.1|  PREDICTED: guanine nucleotide-binding protei...    332   6e-110   Brassica rapa
ref|XP_006416642.1|  hypothetical protein EUTSA_v10008183mg             331   1e-109   Eutrema salsugineum [saltwater cress]
ref|XP_009117627.1|  PREDICTED: guanine nucleotide-binding protei...    331   1e-109   Brassica rapa
ref|XP_002894122.1|  hypothetical protein ARALYDRAFT_474002             331   1e-109   
gb|KJB08186.1|  hypothetical protein B456_001G069800                    331   2e-109   Gossypium raimondii
ref|XP_010678120.1|  PREDICTED: guanine nucleotide-binding protei...    330   2e-109   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009149259.1|  PREDICTED: guanine nucleotide-binding protei...    330   2e-109   Brassica rapa
gb|KDP37901.1|  hypothetical protein JCGZ_05340                         330   3e-109   Jatropha curcas
ref|XP_002890259.1|  hypothetical protein ARALYDRAFT_889221             330   3e-109   Arabidopsis lyrata subsp. lyrata
ref|XP_002281279.1|  PREDICTED: guanine nucleotide-binding protei...    329   7e-109   Vitis vinifera
emb|CAA06154.1|  arcA 3                                                 327   1e-108   Nicotiana tabacum [American tobacco]
ref|XP_010036939.1|  PREDICTED: guanine nucleotide-binding protei...    328   1e-108   Eucalyptus grandis [rose gum]
ref|NP_173248.1|  guanine nucleotide-binding protein subunit beta...    328   1e-108   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010540016.1|  PREDICTED: guanine nucleotide-binding protei...    328   1e-108   Tarenaya hassleriana [spider flower]
ref|XP_010537487.1|  PREDICTED: guanine nucleotide-binding protei...    328   1e-108   Tarenaya hassleriana [spider flower]
ref|XP_006305354.1|  hypothetical protein CARUB_v10009733mg             328   2e-108   Capsella rubella
ref|NP_188441.1|  receptor for activated C kinase 1C                    328   2e-108   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009360100.1|  PREDICTED: guanine nucleotide-binding protei...    328   2e-108   Pyrus x bretschneideri [bai li]
gb|AAB82647.1|  WD-40 repeat protein                                    327   3e-108   Arabidopsis thaliana [mouse-ear cress]
gb|AGV54321.1|  RACK1                                                   327   5e-108   Phaseolus vulgaris [French bean]
ref|XP_010097592.1|  Guanine nucleotide-binding protein subunit b...    327   6e-108   Morus notabilis
ref|XP_010506450.1|  PREDICTED: guanine nucleotide-binding protei...    327   7e-108   Camelina sativa [gold-of-pleasure]
ref|XP_008374821.1|  PREDICTED: LOW QUALITY PROTEIN: guanine nucl...    327   7e-108   Malus domestica [apple tree]
ref|XP_008393404.1|  PREDICTED: guanine nucleotide-binding protei...    327   7e-108   Malus domestica [apple tree]
ref|XP_010498185.1|  PREDICTED: guanine nucleotide-binding protei...    326   9e-108   Camelina sativa [gold-of-pleasure]
ref|XP_006305339.1|  hypothetical protein CARUB_v10009720mg             326   9e-108   Capsella rubella
ref|NP_175296.1|  receptor for activated C kinase 1B                    326   9e-108   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010476972.1|  PREDICTED: guanine nucleotide-binding protei...    326   1e-107   Camelina sativa [gold-of-pleasure]
ref|XP_002318528.1|  GTP-binding protein beta chain                     326   1e-107   Populus trichocarpa [western balsam poplar]
ref|XP_011039103.1|  PREDICTED: guanine nucleotide-binding protei...    326   1e-107   Populus euphratica
ref|XP_007209348.1|  hypothetical protein PRUPE_ppa008536mg             326   1e-107   Prunus persica
ref|XP_008240184.1|  PREDICTED: guanine nucleotide-binding protei...    326   1e-107   Prunus mume [ume]
ref|XP_011039104.1|  PREDICTED: guanine nucleotide-binding protei...    326   2e-107   Populus euphratica
ref|XP_010487724.1|  PREDICTED: guanine nucleotide-binding protei...    325   3e-107   Camelina sativa [gold-of-pleasure]
emb|CDY64888.1|  BnaC06g40840D                                          323   4e-107   Brassica napus [oilseed rape]
ref|XP_010500401.1|  PREDICTED: guanine nucleotide-binding protei...    324   7e-107   Camelina sativa [gold-of-pleasure]
ref|XP_006393380.1|  hypothetical protein EUTSA_v10011646mg             324   8e-107   Eutrema salsugineum [saltwater cress]
gb|AAM65407.1|  guanine nucleotide-binding protein, putative            324   9e-107   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010465892.1|  PREDICTED: guanine nucleotide-binding protei...    324   9e-107   Camelina sativa [gold-of-pleasure]
gb|KFK39137.1|  guanine nucleotide-binding protein subunit beta-l...    324   9e-107   Arabis alpina [alpine rockcress]
ref|XP_006297909.1|  hypothetical protein CARUB_v10013951mg             325   1e-106   
ref|XP_010479287.1|  PREDICTED: guanine nucleotide-binding protei...    323   2e-106   Camelina sativa [gold-of-pleasure]
sp|Q39336.1|GBLP_BRANA  RecName: Full=Guanine nucleotide-binding ...    323   2e-106   Brassica napus [oilseed rape]
ref|XP_010461692.1|  PREDICTED: guanine nucleotide-binding protei...    323   2e-106   Camelina sativa [gold-of-pleasure]
ref|XP_010549078.1|  PREDICTED: guanine nucleotide-binding protei...    322   5e-106   Tarenaya hassleriana [spider flower]
ref|XP_006406649.1|  hypothetical protein EUTSA_v10021128mg             322   7e-106   Eutrema salsugineum [saltwater cress]
ref|XP_009147950.1|  PREDICTED: LOW QUALITY PROTEIN: guanine nucl...    321   9e-106   Brassica rapa
ref|XP_010549077.1|  PREDICTED: guanine nucleotide-binding protei...    321   1e-105   Tarenaya hassleriana [spider flower]
ref|XP_004503304.1|  PREDICTED: guanine nucleotide-binding protei...    320   2e-105   Cicer arietinum [garbanzo]
ref|XP_002885240.1|  guanine nucleotide-binding family protein          320   2e-105   Arabidopsis lyrata subsp. lyrata
ref|XP_009145001.1|  PREDICTED: guanine nucleotide-binding protei...    320   2e-105   Brassica rapa
pdb|3DM0|A  Chain A, Maltose Binding Protein Fusion With Rack1 Fr...    331   3e-105   Escherichia coli K-12
emb|CDY18497.1|  BnaA01g26980D                                          319   4e-105   Brassica napus [oilseed rape]
ref|XP_009113515.1|  PREDICTED: guanine nucleotide-binding protei...    319   4e-105   Brassica rapa
ref|XP_010551145.1|  PREDICTED: guanine nucleotide-binding protei...    318   9e-105   Tarenaya hassleriana [spider flower]
ref|XP_011000479.1|  PREDICTED: guanine nucleotide-binding protei...    318   1e-104   Populus euphratica
emb|CDX95554.1|  BnaC01g34460D                                          318   1e-104   
emb|CDY44104.1|  BnaA01g13120D                                          317   2e-104   Brassica napus [oilseed rape]
ref|XP_009145932.1|  PREDICTED: guanine nucleotide-binding protei...    317   4e-104   Brassica rapa
emb|CDX92200.1|  BnaA05g22070D                                          317   5e-104   
emb|CDX95784.1|  BnaC05g35350D                                          316   1e-103   
ref|XP_002321505.1|  GTP-binding protein beta chain                     315   2e-103   Populus trichocarpa [western balsam poplar]
ref|XP_011084467.1|  PREDICTED: LOW QUALITY PROTEIN: guanine nucl...    314   4e-103   Sesamum indicum [beniseed]
ref|XP_010256121.1|  PREDICTED: guanine nucleotide-binding protei...    310   1e-101   Nelumbo nucifera [Indian lotus]
ref|XP_010243791.1|  PREDICTED: guanine nucleotide-binding protei...    308   7e-101   Nelumbo nucifera [Indian lotus]
ref|XP_010916329.1|  PREDICTED: guanine nucleotide-binding protei...    307   2e-100   Elaeis guineensis
ref|XP_006837182.1|  hypothetical protein AMTR_s00105p00058690          303   1e-98    Amborella trichopoda
ref|XP_010924141.1|  PREDICTED: guanine nucleotide-binding protei...    303   1e-98    Elaeis guineensis
ref|XP_010430893.1|  PREDICTED: guanine nucleotide-binding protei...    301   2e-98    
ref|XP_009405003.1|  PREDICTED: guanine nucleotide-binding protei...    302   3e-98    Musa acuminata subsp. malaccensis [pisang utan]
emb|CAC09579.1|  gbf1 protein                                           300   3e-98    Fagus sylvatica
ref|XP_010495439.1|  PREDICTED: guanine nucleotide-binding protei...    300   6e-98    
ref|XP_008803271.1|  PREDICTED: guanine nucleotide-binding protei...    298   1e-96    Phoenix dactylifera
ref|XP_009400497.1|  PREDICTED: guanine nucleotide-binding protei...    298   1e-96    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010923802.1|  PREDICTED: guanine nucleotide-binding protei...    297   2e-96    Elaeis guineensis
gb|AFV60006.1|  heterotrimeric guanine nucleotide-binding protein...    296   3e-96    Eschscholzia californica
ref|XP_009380503.1|  PREDICTED: guanine nucleotide-binding protei...    296   8e-96    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004252271.1|  PREDICTED: guanine nucleotide-binding protei...    293   4e-95    Solanum lycopersicum
gb|ABK25010.1|  unknown                                                 292   2e-94    Picea sitchensis
gb|ACN41093.1|  unknown                                                 292   2e-94    Picea sitchensis
ref|XP_008812615.1|  PREDICTED: guanine nucleotide-binding protei...    290   1e-93    
gb|ABK26798.1|  unknown                                                 286   3e-92    Picea sitchensis
ref|NP_001136800.1|  guanine nucleotide-binding protein beta subu...    284   4e-91    Zea mays [maize]
gb|ACL54313.1|  unknown                                                 283   7e-91    Zea mays [maize]
ref|NP_001146976.1|  LOC100280585                                       283   7e-91    Zea mays [maize]
ref|XP_002440202.1|  hypothetical protein SORBIDRAFT_09g027690          283   1e-90    Sorghum bicolor [broomcorn]
ref|XP_001780288.1|  predicted protein                                  280   7e-90    
ref|XP_002945887.1|  hypothetical protein VOLCADRAFT_78914              280   8e-90    Volvox carteri f. nagariensis
ref|XP_008811978.1|  PREDICTED: LOW QUALITY PROTEIN: guanine nucl...    280   1e-89    Phoenix dactylifera
ref|XP_001779496.1|  predicted protein                                  279   2e-89    
ref|XP_001754916.1|  predicted protein                                  278   3e-89    
ref|XP_001698065.1|  receptor of activated protein kinase C 1           278   3e-89    Chlamydomonas reinhardtii
ref|XP_004969582.1|  PREDICTED: guanine nucleotide-binding protei...    279   4e-89    Setaria italica
gb|ACJ85349.1|  unknown                                                 276   7e-89    Medicago truncatula
ref|XP_006644561.1|  PREDICTED: LOW QUALITY PROTEIN: guanine nucl...    276   3e-88    Oryza brachyantha
ref|XP_004961307.1|  PREDICTED: guanine nucleotide-binding protei...    276   5e-88    Setaria italica
ref|XP_005847990.1|  hypothetical protein CHLNCDRAFT_31033              275   6e-88    Chlorella variabilis
ref|NP_001043910.1|  Os01g0686800                                       276   7e-88    
emb|CEG00110.1|  G-protein beta WD-40 repeat                            275   9e-88    Ostreococcus tauri
gb|EMS52917.1|  Guanine nucleotide-binding protein subunit beta-l...    275   2e-87    Triticum urartu
dbj|BAJ90663.1|  predicted protein                                      274   2e-87    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003567944.1|  PREDICTED: guanine nucleotide-binding protei...    274   3e-87    Brachypodium distachyon [annual false brome]
ref|XP_001421096.1|  Receptor of activated protein kinase C 1A, c...    272   1e-86    Ostreococcus lucimarinus CCE9901
gb|AEF79971.1|  receptor of activated protein kinase C 1                272   1e-86    Dunaliella salina
ref|NP_001056254.1|  Os05g0552300                                       272   2e-86    
ref|XP_003082627.1|  GTP-binding regulatory protein beta chain ho...    277   2e-86    
ref|XP_006654750.1|  PREDICTED: guanine nucleotide-binding protei...    271   4e-86    Oryza brachyantha
gb|AEO44580.1|  receptor for activated C kinase 1                       270   6e-86    Dunaliella salina
ref|XP_002456166.1|  hypothetical protein SORBIDRAFT_03g031520          271   6e-86    Sorghum bicolor [broomcorn]
ref|XP_003060952.1|  predicted protein                                  270   1e-85    Micromonas pusilla CCMP1545
ref|XP_002502835.1|  predicted protein                                  269   2e-85    Micromonas commoda
gb|EMT00770.1|  hypothetical protein F775_19376                         277   2e-85    
ref|XP_010480509.1|  PREDICTED: guanine nucleotide-binding protei...    265   8e-85    
ref|XP_002967499.1|  hypothetical protein SELMODRAFT_144795             266   3e-84    Selaginella moellendorffii
ref|XP_005652002.1|  WD40 repeat-like protein                           265   8e-84    Coccomyxa subellipsoidea C-169
ref|XP_002960209.1|  hypothetical protein SELMODRAFT_266532             262   6e-83    
ref|XP_003569582.1|  PREDICTED: guanine nucleotide-binding protei...    262   1e-82    Brachypodium distachyon [annual false brome]
gb|KIY98327.1|  Guanine nucleotide-binding protein subunit beta-l...    261   4e-82    Monoraphidium neglectum
gb|KDD72035.1|  hypothetical protein H632_c3969p0                       257   1e-81    Helicosporidium sp. ATCC 50920
ref|XP_005711409.1|  receptor for activated protein kinase C            259   2e-81    Chondrus crispus [carageen]
dbj|BAF47116.1|  G protein beta-subunit-like protein                    253   2e-81    Nicotiana tabacum [American tobacco]
emb|CDY59680.1|  BnaA05g36460D                                          255   2e-81    Brassica napus [oilseed rape]
dbj|BAJ98167.1|  predicted protein                                      259   2e-81    Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDM83867.1|  unnamed protein product                                258   5e-81    Triticum aestivum [Canadian hard winter wheat]
ref|XP_007508318.1|  predicted protein                                  256   1e-80    Bathycoccus prasinos
emb|CDY71917.1|  BnaCnng75080D                                          253   3e-80    Brassica napus [oilseed rape]
dbj|BAF47119.1|  G protein beta-subunit-like protein                    249   3e-80    Nicotiana tabacum [American tobacco]
ref|XP_011397272.1|  Guanine nucleotide-binding protein subunit b...    252   8e-79    Auxenochlorella protothecoides
ref|XP_002903189.1|  guanine nucleotide-binding protein subunit b...    252   9e-79    Phytophthora infestans T30-4
ref|XP_009836542.1|  guanine nucleotide-binding protein subunit b...    252   1e-78    Aphanomyces astaci
ref|XP_010926201.1|  PREDICTED: guanine nucleotide-binding protei...    251   2e-78    Elaeis guineensis
gb|ETM44908.1|  guanine nucleotide-binding protein subunit beta-l...    252   2e-78    Phytophthora parasitica
ref|XP_009531042.1|  hypothetical protein PHYSODRAFT_355000             251   3e-78    Phytophthora sojae
gb|KDO19117.1|  guanine nucleotide-binding protein subunit beta-2...    250   4e-78    Saprolegnia parasitica CBS 223.65
ref|XP_008608530.1|  guanine nucleotide-binding protein subunit b...    250   5e-78    Saprolegnia diclina VS20
ref|XP_004343796.1|  guanine nucleotide-binding protein                 249   8e-78    Capsaspora owczarzaki ATCC 30864
gb|ACQ83470.1|  receptor of activated protein kinase C                  248   4e-77    Platynereis dumerilii
emb|CCI48432.1|  unnamed protein product                                247   5e-77    Albugo candida
emb|CCA26420.1|  guanine nucleotidebinding protein subunit beta2l...    247   5e-77    Albugo laibachii Nc14
ref|XP_009037831.1|  hypothetical protein AURANDRAFT_37768              247   7e-77    Aureococcus anophagefferens
gb|ETI45096.1|  guanine nucleotide-binding protein subunit beta-l...    250   9e-77    Phytophthora parasitica P1569
emb|CEG76293.1|  Putative Guanine nucleotide-binding protein subu...    245   1e-76    Rhizopus microsporus
ref|XP_002286095.1|  guanine nucleotide binding protein beta subu...    246   1e-76    Thalassiosira pseudonana CCMP1335
ref|XP_005795376.1|  PREDICTED: guanine nucleotide-binding protei...    246   2e-76    Xiphophorus maculatus
ref|XP_004696065.1|  PREDICTED: LOW QUALITY PROTEIN: guanine nucl...    243   4e-76    
ref|XP_004073369.1|  PREDICTED: guanine nucleotide-binding protei...    245   4e-76    Oryzias latipes [Japanese rice fish]
ref|XP_004540947.1|  PREDICTED: guanine nucleotide-binding protei...    245   5e-76    Maylandia zebra
ref|NP_001266445.1|  guanine nucleotide-binding protein subunit b...    245   5e-76    Oreochromis niloticus
gb|EDL33790.1|  guanine nucleotide binding protein (G protein), b...    241   6e-76    Mus musculus [mouse]
gb|KFM07186.1|  Guanine nucleotide-binding protein subunit beta-2...    241   6e-76    Aptenodytes forsteri
ref|XP_007527211.1|  PREDICTED: guanine nucleotide-binding protei...    243   7e-76    Erinaceus europaeus [common hedgehog]
gb|ERE68979.1|  guanine nucleotide-binding protein subunit beta-2...    241   7e-76    Cricetulus griseus [Chinese hamsters]
gb|EIE78732.1|  guanine nucleotide-binding protein subunit beta-2...    244   7e-76    Rhizopus delemar RA 99-880
ref|XP_009277073.1|  PREDICTED: guanine nucleotide-binding protei...    242   7e-76    
ref|XP_002181732.1|  predicted protein                                  244   8e-76    Phaeodactylum tricornutum CCAP 1055/1
gb|ABY75292.1|  putative guanine nucleotide binding protein beta ...    241   8e-76    Ovis aries [domestic sheep]
ref|XP_005891160.1|  PREDICTED: guanine nucleotide-binding protei...    243   8e-76    Bos mutus
ref|XP_005977784.1|  PREDICTED: guanine nucleotide-binding protei...    243   8e-76    Pantholops hodgsonii [Tibetan antelope]
ref|XP_009576203.1|  PREDICTED: guanine nucleotide-binding protei...    241   8e-76    Fulmarus glacialis
gb|AAR24619.1|  proliferation-inducing gene 21                          243   9e-76    Homo sapiens [man]
gb|ELK03178.1|  Guanine nucleotide-binding protein subunit beta-2...    242   9e-76    Pteropus alecto
ref|XP_006746631.1|  PREDICTED: guanine nucleotide-binding protei...    243   9e-76    Leptonychotes weddellii
gb|EPQ05298.1|  Guanine nucleotide-binding protein subunit beta-2...    242   9e-76    Myotis brandtii
gb|EAW53697.1|  guanine nucleotide binding protein (G protein), b...    241   9e-76    Homo sapiens [man]
ref|XP_004657524.1|  PREDICTED: guanine nucleotide-binding protei...    242   9e-76    Jaculus jaculus
dbj|BAE39095.1|  unnamed protein product                                241   1e-75    Mus musculus [mouse]
ref|XP_008063710.1|  PREDICTED: guanine nucleotide-binding protei...    242   1e-75    Carlito syrichta
ref|NP_571519.1|  guanine nucleotide-binding protein subunit beta...    244   1e-75    Danio rerio [leopard danio]
ref|XP_005703361.1|  hypothetical protein Gasu_55280                    244   1e-75    Galdieria sulphuraria
gb|ETP42980.1|  guanine nucleotide-binding protein subunit beta-l...    247   1e-75    Phytophthora parasitica P10297
gb|EWM27643.1|  guanine nucleotide binding protein                      244   1e-75    Nannochloropsis gaditana
emb|CEG67117.1|  Putative Guanine nucleotide-binding protein subu...    244   1e-75    Rhizopus microsporus
ref|XP_007548404.1|  PREDICTED: guanine nucleotide-binding protei...    244   1e-75    Poecilia formosa
dbj|BAG53102.1|  unnamed protein product                                242   1e-75    Homo sapiens [man]
gb|AAX94566.1|  Gpa1 interacting G protein subunit                      241   1e-75    Cryptococcus neoformans var. grubii
ref|XP_005989393.1|  PREDICTED: guanine nucleotide-binding protei...    243   2e-75    Latimeria chalumnae
gb|EJT47727.1|  G protein beta subunit-like protein Rkp1                243   2e-75    Trichosporon asahii var. asahii CBS 2479
ref|XP_002804718.1|  PREDICTED: guanine nucleotide-binding protei...    242   2e-75    
gb|AAI50408.1|  Guanine nucleotide binding protein (G protein), b...    243   2e-75    Danio rerio [leopard danio]
ref|XP_007244608.1|  PREDICTED: guanine nucleotide-binding protei...    243   2e-75    Astyanax mexicanus [blind cave fish]
ref|XP_006147504.1|  PREDICTED: guanine nucleotide-binding protei...    241   3e-75    
gb|EPB90862.1|  guanine nucleotide-binding protein subunit beta-2...    243   3e-75    Mucor circinelloides f. circinelloides 1006PhL
emb|CCQ18636.1|  G protein beta subunit-like protein                    243   3e-75    Sycon ciliatum
ref|XP_009080129.1|  PREDICTED: guanine nucleotide-binding protei...    240   3e-75    Acanthisitta chloris
gb|ADO27998.1|  guanine nucleotide-binding protein subunit beta-2...    243   3e-75    Ictalurus furcatus
ref|NP_001187435.1|  guanine nucleotide-binding protein subunit b...    243   3e-75    Ictalurus punctatus
ref|XP_009922131.1|  PREDICTED: guanine nucleotide-binding protei...    242   3e-75    Haliaeetus albicilla
gb|KFP61115.1|  Guanine nucleotide-binding protein subunit beta-2...    242   4e-75    Cariama cristata
gb|KFP96911.1|  Guanine nucleotide-binding protein subunit beta-2...    241   4e-75    Haliaeetus albicilla
ref|XP_009489930.1|  PREDICTED: guanine nucleotide-binding protei...    241   4e-75    Pelecanus crispus
ref|XP_007070338.1|  PREDICTED: guanine nucleotide-binding protei...    241   4e-75    
gb|EDL33792.1|  guanine nucleotide binding protein (G protein), b...    241   4e-75    Mus musculus [mouse]
dbj|BAB28114.1|  unnamed protein product                                241   4e-75    Mus musculus [mouse]
ref|XP_009462428.1|  PREDICTED: guanine nucleotide-binding protei...    242   4e-75    Nipponia nippon
gb|KFQ96249.1|  Guanine nucleotide-binding protein subunit beta-2...    241   4e-75    Nipponia nippon
gb|AEW43729.1|  activated protein kinase C receptor                     242   4e-75    Epinephelus coioides [estuary cod]
ref|XP_010296751.1|  PREDICTED: guanine nucleotide-binding protei...    241   4e-75    Balearica regulorum gibbericeps
gb|KFQ99079.1|  Guanine nucleotide-binding protein subunit beta-2...    241   4e-75    Opisthocomus hoazin [hoatzin]
gb|KFQ66729.1|  Guanine nucleotide-binding protein subunit beta-2...    241   4e-75    Pelecanus crispus
gb|KFQ89059.1|  Guanine nucleotide-binding protein subunit beta-2...    241   4e-75    Phoenicopterus ruber ruber
ref|XP_006037851.1|  PREDICTED: guanine nucleotide-binding protei...    242   4e-75    
ref|XP_009701898.1|  PREDICTED: guanine nucleotide-binding protei...    242   4e-75    Cariama cristata
dbj|BAE40068.1|  unnamed protein product                                242   5e-75    Mus musculus [mouse]
gb|EHB05258.1|  Guanine nucleotide-binding protein subunit beta-2...    243   5e-75    Heterocephalus glaber [naked mole rat]
gb|KFP58388.1|  Guanine nucleotide-binding protein subunit beta-2...    241   5e-75    Cathartes aura
ref|XP_009448630.1|  PREDICTED: guanine nucleotide-binding protei...    241   5e-75    
gb|KFO20808.1|  Guanine nucleotide-binding protein subunit beta-2...    242   5e-75    Fukomys damarensis [Damara mole rat]
ref|XP_005234127.1|  PREDICTED: LOW QUALITY PROTEIN: guanine nucl...    242   5e-75    Falco peregrinus [peregrine]
dbj|BAE40059.1|  unnamed protein product                                242   5e-75    Mus musculus [mouse]
ref|XP_005435183.1|  PREDICTED: guanine nucleotide-binding protei...    242   5e-75    Falco cherrug
ref|XP_572317.1|  cytoplasm protein                                     242   5e-75    Cryptococcus neoformans var. neoformans JEC21
gb|AAI02287.2|  GNB2L1 protein                                          242   5e-75    Bos taurus [bovine]
ref|XP_009329421.1|  PREDICTED: guanine nucleotide-binding protei...    241   6e-75    Pygoscelis adeliae
ref|NP_006089.1|  guanine nucleotide-binding protein subunit beta...    242   6e-75    Homo sapiens [man]
ref|XP_004387229.1|  PREDICTED: guanine nucleotide-binding protei...    242   6e-75    Trichechus manatus latirostris
ref|XP_005658294.1|  PREDICTED: guanine nucleotide binding protei...    242   6e-75    
gb|AAW82329.1|  guanine nucleotide binding 12.3                         242   6e-75    Gallus gallus [bantam]
ref|XP_009995617.1|  PREDICTED: guanine nucleotide-binding protei...    241   6e-75    Chaetura pelagica
gb|KFO08948.1|  Guanine nucleotide-binding protein subunit beta-2...    241   6e-75    Balearica regulorum gibbericeps
ref|XP_007431363.1|  PREDICTED: guanine nucleotide-binding protei...    242   6e-75    Python bivittatus
ref|XP_010291551.1|  PREDICTED: guanine nucleotide-binding protei...    241   6e-75    Phaethon lepturus
gb|AAP36938.1|  Homo sapiens guanine nucleotide binding protein (...    242   7e-75    synthetic construct
ref|XP_006631768.1|  PREDICTED: guanine nucleotide-binding protei...    242   7e-75    Lepisosteus oculatus
gb|KFQ81036.1|  Guanine nucleotide-binding protein subunit beta-2...    241   7e-75    Phaethon lepturus
pdb|4AOW|A  Chain A, Crystal Structure Of The Human Rack1 Protein...    243   7e-75    Homo sapiens [man]
emb|CEP13972.1|  hypothetical protein                                   242   7e-75    Parasitella parasitica
gb|EAW53699.1|  guanine nucleotide binding protein (G protein), b...    243   7e-75    Homo sapiens [man]
ref|XP_010391434.1|  PREDICTED: guanine nucleotide-binding protei...    240   7e-75    
gb|KFW72146.1|  Guanine nucleotide-binding protein subunit beta-2...    241   8e-75    Pygoscelis adeliae
ref|XP_008325350.1|  PREDICTED: guanine nucleotide-binding protei...    242   8e-75    Cynoglossus semilaevis [half-smooth tongue sole]
gb|KFO58265.1|  Guanine nucleotide-binding protein subunit beta-2...    240   8e-75    Corvus brachyrhynchos
gb|EPY85923.1|  guanine nucleotide binding protein, beta polypept...    242   8e-75    Camelus ferus
ref|XP_008630825.1|  PREDICTED: guanine nucleotide-binding protei...    241   9e-75    
emb|CEP08121.1|  hypothetical protein                                   241   9e-75    
gb|KFO76552.1|  Guanine nucleotide-binding protein subunit beta-2...    241   9e-75    
ref|XP_003197003.1|  G protein beta subunit-like protein Rkp1           241   9e-75    
gb|AAA18951.1|  protein kinase C receptor                               241   9e-75    
ref|XP_005018374.1|  PREDICTED: guanine nucleotide-binding protei...    243   1e-74    
ref|XP_009931788.1|  PREDICTED: LOW QUALITY PROTEIN: guanine nucl...    241   1e-74    
ref|XP_005758143.1|  receptor of activated protein kinase C             241   1e-74    
ref|XP_005534099.1|  PREDICTED: guanine nucleotide-binding protei...    241   1e-74    
ref|XP_005862397.1|  PREDICTED: guanine nucleotide-binding protei...    243   1e-74    
gb|AAO21313.1|  lung cancer oncogene 7                                  242   1e-74    
gb|ACV53651.1|  guanine nucleotide-binding protein beta polypepti...    241   1e-74    
ref|XP_008873892.1|  guanine nucleotide-binding protein subunit b...    241   1e-74    
gb|EAW53696.1|  guanine nucleotide binding protein (G protein), b...    242   1e-74    
ref|XP_004468645.1|  PREDICTED: guanine nucleotide-binding protei...    242   1e-74    
ref|XP_008681951.1|  PREDICTED: guanine nucleotide-binding protei...    243   1e-74    
ref|XP_007229955.1|  PREDICTED: guanine nucleotide-binding protei...    241   1e-74    
ref|XP_006105825.1|  PREDICTED: LOW QUALITY PROTEIN: guanine nucl...    243   1e-74    
ref|XP_006766909.1|  PREDICTED: guanine nucleotide-binding protei...    243   2e-74    
gb|EPB88453.1|  guanine nucleotide-binding protein subunit beta-2...    241   2e-74    
gb|ABI26262.1|  receptor for activated protein kinase c                 241   2e-74    
ref|XP_008156879.1|  PREDICTED: guanine nucleotide-binding protei...    243   2e-74    
ref|XP_009884754.1|  PREDICTED: guanine nucleotide-binding protei...    239   2e-74    
gb|KIR44237.1|  guanine nucleotide-binding protein subunit beta-l...    241   2e-74    
dbj|BAD96208.1|  guanine nucleotide binding protein (G protein), ...    241   2e-74    
dbj|BAE93065.1|  guanine nucleotide binding protein beta polypept...    241   2e-74    
gb|AHG98118.1|  guanine nucleotide-binding protein subunit beta-2...    240   2e-74    
ref|NP_001118140.1|  RACK1                                              241   2e-74    
gb|AHG98116.1|  guanine nucleotide-binding protein subunit beta-2...    240   2e-74    
gb|ACH70647.1|  guanine nucleotide binding protein (G protein) be...    240   2e-74    
gb|AHG98119.1|  guanine nucleotide-binding protein subunit beta-2...    240   2e-74    
gb|AAM88904.1|  guanine nucleotide-binding protein                      240   3e-74    
ref|XP_006679085.1|  hypothetical protein BATDEDRAFT_33248              240   3e-74    
gb|AAS49532.1|  guanine nucleotide binding protein beta polypepti...    239   3e-74    
gb|AAP04406.1|  G-protein beta subunit like-protein                     240   3e-74    
gb|ABX90099.1|  receptor for activated C kinase 1                       240   3e-74    
ref|XP_008013783.1|  PREDICTED: guanine nucleotide-binding protei...    243   3e-74    
gb|ESA03866.1|  hypothetical protein GLOINDRAFT_336518                  240   3e-74    
ref|XP_008955153.1|  PREDICTED: guanine nucleotide-binding protei...    243   4e-74    
gb|AAT35603.1|  receptor for activated protein kinase C                 240   4e-74    
ref|XP_006270088.1|  PREDICTED: guanine nucleotide-binding protei...    240   4e-74    
ref|XP_006898235.1|  PREDICTED: guanine nucleotide-binding protei...    237   4e-74    
gb|EAW53694.1|  guanine nucleotide binding protein (G protein), b...    242   4e-74    
gb|AAF22119.1|AF124742_1  guanine nucleotide-binding protein            239   4e-74    
ref|NP_001279416.1|  guanine nucleotide-binding protein subunit b...    240   4e-74    
dbj|BAA06185.1|  G protein beta subuit like                             239   5e-74    
gb|ACQ58047.1|  Guanine nucleotide-binding protein subunit beta-2...    239   5e-74    
ref|XP_007899557.1|  PREDICTED: guanine nucleotide-binding protei...    239   5e-74    
ref|XP_001105066.1|  PREDICTED: guanine nucleotide-binding protei...    242   5e-74    
ref|XP_003900707.2|  PREDICTED: guanine nucleotide-binding protei...    242   6e-74    
gb|ACJ06767.1|  receptor for activated C-kinase                         239   6e-74    
ref|NP_001274728.1|  guanine nucleotide-binding protein subunit b...    239   6e-74    
ref|XP_010780163.1|  PREDICTED: guanine nucleotide-binding protei...    239   6e-74    
dbj|BAE35378.1|  unnamed protein product                                239   6e-74    
gb|AAD42045.1|AF105259_1  activated protein kinase C receptor           239   6e-74    
gb|ETE60795.1|  Guanine nucleotide-binding protein subunit beta-2...    242   7e-74    
ref|XP_002735015.1|  PREDICTED: guanine nucleotide-binding protei...    239   8e-74    
ref|XP_010124278.1|  PREDICTED: LOW QUALITY PROTEIN: guanine nucl...    236   8e-74    
gb|AHG98209.1|  guanine nucleotide-binding protein subunit beta-2...    239   8e-74    
gb|AAS59422.1|  G-protein beta subunit like-protein                     234   9e-74    
ref|XP_008282647.1|  PREDICTED: guanine nucleotide-binding protei...    239   9e-74    
ref|NP_001004946.1|  guanine nucleotide binding protein (G protei...    239   9e-74    
ref|XP_004341795.1|  guanine nucleotide-binding protein beta subu...    239   9e-74    
ref|XP_010223334.1|  PREDICTED: guanine nucleotide-binding protei...    238   1e-73    
ref|NP_001086465.1|  uncharacterized protein LOC446289                  239   1e-73    
gb|EGV96576.1|  Guanine nucleotide-binding protein subunit beta-2...    237   1e-73    
emb|CAL48986.1|  Receptor of Activated Kinase C 1                       239   1e-73    
ref|XP_007083117.1|  PREDICTED: guanine nucleotide-binding protei...    241   1e-73    
ref|XP_007642752.1|  PREDICTED: guanine nucleotide-binding protei...    238   1e-73    
ref|XP_002834824.3|  PREDICTED: guanine nucleotide-binding protei...    241   1e-73    
ref|XP_007408997.1|  hypothetical protein MELLADRAFT_116221             238   1e-73    
gb|AFK73701.1|  receptor of activated kinase C                          238   2e-73    
gb|EAW53700.1|  guanine nucleotide binding protein (G protein), b...    242   2e-73    
ref|NP_001279371.1|  uncharacterized protein LOC103175775               238   2e-73    
gb|ACO09909.1|  Guanine nucleotide-binding protein subunit beta 2...    238   2e-73    
emb|CDH49812.1|  guanine nucleotide binding protein beta subunit        238   3e-73    
ref|XP_003970442.1|  PREDICTED: guanine nucleotide-binding protei...    238   3e-73    
gb|KDQ57687.1|  hypothetical protein JAAARDRAFT_35372                   237   4e-73    
dbj|BAC56715.1|  receptor for activated protein kinase C homolog        237   4e-73    
gb|EIE91439.1|  guanine nucleotide-binding protein subunit beta-l...    236   5e-73    
ref|XP_010733915.1|  PREDICTED: guanine nucleotide-binding protei...    237   5e-73    
ref|NP_001291025.1|  guanine nucleotide binding protein (G protei...    237   5e-73    
ref|XP_011445926.1|  PREDICTED: guanine nucleotide-binding protei...    237   6e-73    
gb|EIE76651.1|  guanine nucleotide-binding protein subunit beta-2...    237   7e-73    
gb|AGN75114.1|  receptor for activated C kinase 1                       236   8e-73    
gb|ACU33969.1|  receptor of activated kinase C                          236   8e-73    
emb|CAG01204.1|  unnamed protein product                                236   1e-72    
gb|AAZ29606.1|  activated C kinase 1 receptor                           236   1e-72    
gb|AAZ29605.1|  activated C kinase 1 receptor                           236   1e-72    
gb|KIJ49590.1|  hypothetical protein M422DRAFT_205027                   236   1e-72    
ref|XP_010020213.1|  PREDICTED: guanine nucleotide-binding protei...    233   1e-72    
gb|KDO24030.1|  guanine nucleotide-binding protein subunit beta-2...    233   1e-72    
emb|CCA74715.1|  probable CPC2 protein, guanine nucleotide-bindin...    236   1e-72    
ref|XP_006958593.1|  WD40 repeat-like protein                           236   2e-72    
ref|XP_009983622.1|  PREDICTED: guanine nucleotide-binding protei...    234   2e-72    
dbj|BAD52259.1|  receptor for activated protein kinase C homolog        236   2e-72    
ref|XP_009267143.1|  Guanine nucleotide-binding protein subunit b...    234   2e-72    
dbj|GAN10996.1|  guanine nucleotide-binding protein                     233   3e-72    
gb|KFH73669.1|  guanine nucleotide-binding protein subunit beta-l...    235   3e-72    
emb|CDH49357.1|  guanine nucleotide binding protein beta subunit        235   3e-72    
gb|AFV81452.1|  receptor for activated protein kinase C                 235   3e-72    
gb|AAM88905.1|  guanine nucleotide-binding protein                      234   4e-72    
emb|CDS03837.1|  Putative Guanine nucleotide-binding proteinFT su...    234   4e-72    
dbj|BAM17717.1|  receptor of activated protein kinase C 1               235   4e-72    
gb|ABA01128.1|  G protein beta subunit-like polypeptide                 233   4e-72    
ref|XP_007864562.1|  WD40 repeat-like protein                           234   5e-72    
gb|AEB26318.1|  receptor for activated protein kinase C                 234   6e-72    
gb|ADO33039.1|  receptor for activated protein kinase C RACK isof...    234   6e-72    
gb|KFU89350.1|  Guanine nucleotide-binding protein subunit beta-2...    233   9e-72    
gb|KHJ35931.1|  putative guanine nucleotide-binding protein subun...    234   9e-72    
gb|ELW66848.1|  Guanine nucleotide-binding protein subunit beta-2...    242   1e-71    
gb|EMP25897.1|  Guanine nucleotide-binding protein subunit beta-2...    244   1e-71    
ref|XP_008494697.1|  PREDICTED: guanine nucleotide-binding protei...    232   2e-71    
ref|XP_008034536.1|  guanine nucleotide binding protein beta subunit    233   2e-71    
gb|AAU84924.1|  putative activated protein kinase C receptor            233   2e-71    
emb|CCF48119.1|  probable CPC2 protein, guanine nucleotide-bindin...    233   2e-71    
ref|XP_973579.1|  PREDICTED: guanine nucleotide-binding protein s...    233   2e-71    
gb|ACR19030.1|  receptor for activated protein kinase C                 233   2e-71    
ref|NP_001041703.1|  receptor for activated protein kinase C RACK...    233   2e-71    
dbj|BAK78892.1|  receptor of activated protein kinase C1                229   2e-71    
gb|EMS22902.1|  G-protein complex beta subunit                          233   3e-71    
gb|ABX55886.1|  activated C kinase 1 receptor                           233   3e-71    
emb|CEG70024.1|  Putative Guanine nucleotide-binding protein subu...    231   3e-71    
emb|CEJ02996.1|  Putative Guanine nucleotide-binding protein subu...    231   3e-71    
ref|XP_009547379.1|  hypothetical protein HETIRDRAFT_418643             232   3e-71    
gb|KIO09923.1|  hypothetical protein M404DRAFT_995909                   232   4e-71    
ref|XP_007362000.1|  guanine nucleotide binding protein beta subunit    232   4e-71    
ref|NP_001280259.1|  guanine nucleotide-binding protein subunit b...    232   4e-71    
ref|XP_007877264.1|  hypothetical protein PFL1_01563                    233   4e-71    
gb|AEE62785.1|  unknown                                                 232   5e-71    
gb|KIM24190.1|  hypothetical protein M408DRAFT_331939                   232   5e-71    
ref|XP_007007889.1|  hypothetical protein TREMEDRAFT_45853              232   5e-71    
emb|CEG70023.1|  Putative Guanine nucleotide-binding protein subu...    232   5e-71    
emb|CCX15458.1|  Similar to Guanine nucleotide-binding protein su...    233   5e-71    
emb|CBQ71151.1|  probable CPC2 protein, guanine nucleotide-bindin...    231   7e-71    
gb|ENN71239.1|  hypothetical protein YQE_12166                          233   7e-71    
gb|KII92153.1|  hypothetical protein PLICRDRAFT_104409                  231   8e-71    
ref|XP_011388829.1|  putative guanine nucleotide-binding protein ...    231   8e-71    
gb|ACO15464.1|  Guanine nucleotide-binding protein subunit beta-2...    231   8e-71    
ref|XP_005062497.1|  PREDICTED: guanine nucleotide-binding protei...    230   9e-71    
gb|KEI37942.1|  hypothetical protein L969DRAFT_89179                    231   1e-70    
emb|CCM01124.1|  predicted protein                                      231   1e-70    
ref|XP_007308233.1|  guanine nucleotide binding protein beta subunit    231   1e-70    
ref|XP_001631784.1|  predicted protein                                  231   1e-70    
ref|XP_003664641.1|  hypothetical protein MYCTH_2307651                 231   1e-70    
gb|ETS62557.1|  hypothetical protein PaG_03192                          232   1e-70    
gb|KDQ21830.1|  hypothetical protein BOTBODRAFT_123721                  231   1e-70    
ref|XP_006665983.1|  guanine nucleotide-binding protein beta subu...    231   2e-70    
ref|XP_006695086.1|  putative guanine nucleotide-binding protein        231   2e-70    
dbj|GAC98631.1|  hypothetical protein PHSY_006225                       233   2e-70    
ref|XP_007799385.1|  putative guanine nucleotide-binding protein ...    231   2e-70    
gb|ABU41071.1|  receptor for activated protein kinase C-like protein    230   2e-70    
gb|KDR18184.1|  Guanine nucleotide-binding protein subunit beta-l...    231   2e-70    
gb|KGL84405.1|  Guanine nucleotide-binding protein subunit beta-2...    229   2e-70    
gb|KGB35723.1|  Guanine nucleotide-binding protein subunit beta-2...    230   2e-70    
emb|CDI55376.1|  probable CPC2 protein, guanine nucleotide-bindin...    230   2e-70    
ref|XP_007397219.1|  hypothetical protein PHACADRAFT_258442             230   2e-70    
ref|XP_008600266.1|  WD domain-containing protein                       230   2e-70    
gb|AAP13580.2|AF407335_1  guanine nucleotide binding protein beta...    230   2e-70    
gb|ABR23464.1|  G protein beta subunit-like protein                     230   2e-70    
gb|KIH90457.1|  guanine nucleotide-binding protein subunit beta-2...    229   2e-70    
gb|AAM88903.1|  guanine nucleotide-binding protein                      229   2e-70    
ref|XP_002850965.1|  G-protein complex beta subunit CpcB                230   2e-70    
gb|KFP02898.1|  Guanine nucleotide-binding protein subunit beta-2...    229   3e-70    
gb|EMD37863.1|  guanine nucleotide binding protein beta subunit         230   3e-70    
gb|ACN10148.1|  Guanine nucleotide-binding protein subunit beta-2...    230   3e-70    
ref|XP_004780256.1|  PREDICTED: guanine nucleotide-binding protei...    230   3e-70    
gb|ERS97367.1|  guanine nucleotide-binding protein subunit beta-l...    230   3e-70    
ref|XP_001226350.1|  guanine nucleotide-binding protein beta subu...    230   3e-70    
ref|XP_661767.1|  GBLP_NEUCR Guanine nucleotide-binding protein b...    229   3e-70    
ref|XP_002613759.1|  hypothetical protein BRAFLDRAFT_84515              229   4e-70    
gb|KIY65838.1|  guanine nucleotide binding protein beta subunit         228   4e-70    
sp|Q93134.1|GBLP_BIOGL  RecName: Full=Guanine nucleotide-binding ...    229   4e-70    
gb|KIK68892.1|  hypothetical protein GYMLUDRAFT_236781                  229   4e-70    
gb|ABI63548.1|  receptor for activated protein kinase C-like            229   5e-70    
gb|EST05924.1|  putative CPC2 protein, guanine nucleotide-binding...    230   5e-70    
gb|KIJ67868.1|  hypothetical protein HYDPIDRAFT_25333                   229   6e-70    
gb|KIV82161.1|  guanine nucleotide-binding protein subunit beta-l...    229   6e-70    
gb|EHK21487.1|  cross-pathway control WD-repeat protein cpc2            229   6e-70    
gb|KDE05309.1|  guanine nucleotide-binding protein subunit beta-l...    229   7e-70    
ref|XP_007849688.1|  g-protein comlpex beta subunit                     229   7e-70    
gb|KIK28004.1|  hypothetical protein PISMIDRAFT_148977                  229   7e-70    
gb|AHW80379.1|  guanine nucleotide-binding protein                      229   7e-70    
ref|XP_007287787.1|  g-protein beta subunit                             228   8e-70    
ref|XP_009160336.1|  guanine nucleotide-binding protein subunit b...    231   8e-70    
ref|XP_008052288.1|  PREDICTED: LOW QUALITY PROTEIN: guanine nucl...    229   8e-70    
gb|KIW62858.1|  guanine nucleotide-binding protein subunit beta-l...    229   8e-70    
ref|XP_005094913.1|  PREDICTED: LOW QUALITY PROTEIN: guanine nucl...    229   8e-70    
gb|EAW53698.1|  guanine nucleotide binding protein (G protein), b...    232   9e-70    
ref|XP_001830441.1|  guanine nucleotide binding protein beta subunit    229   9e-70    
ref|XP_011049912.1|  PREDICTED: guanine nucleotide-binding protei...    229   9e-70    
gb|KIX03579.1|  guanine nucleotide-binding protein subunit beta-l...    229   1e-69    
ref|XP_001903663.1|  hypothetical protein                               229   1e-69    
ref|XP_003176836.1|  G-protein comlpex beta subunit CpcB                228   1e-69    
dbj|GAE00026.1|  hypothetical protein PVAR5_8757                        228   1e-69    
gb|EQB48545.1|  hypothetical protein CGLO_12231                         228   1e-69    
gb|EGI68372.1|  Guanine nucleotide-binding protein subunit beta-l...    228   1e-69    
ref|XP_003051079.1|  predicted protein                                  228   1e-69    
emb|CEJ92213.1|  Putative Pc22g03140 protein                            228   1e-69    
ref|XP_007723621.1|  guanine nucleotide-binding protein subunit b...    228   1e-69    
gb|EXX68230.1|  Asc1p                                                   228   1e-69    
gb|KIW10778.1|  guanine nucleotide-binding protein subunit beta-l...    228   1e-69    
gb|KIM69177.1|  hypothetical protein SCLCIDRAFT_1208600                 228   1e-69    
gb|KIP05099.1|  hypothetical protein PHLGIDRAFT_74762                   228   1e-69    
gb|KDN52294.1|  putative CPC2 protein                                   228   1e-69    
ref|XP_007761319.1|  guanine nucleotide-binding protein subunit b...    228   1e-69    
gb|EPT05016.1|  hypothetical protein FOMPIDRAFT_1045684                 228   1e-69    
gb|KFH46842.1|  Guanine nucleotide-binding protein subunit beta-l...    228   1e-69    
ref|XP_006962578.1|  cross-pathway control WD-repeat-containing p...    228   1e-69    
ref|XP_003651077.1|  hypothetical protein THITE_2169762                 228   1e-69    
gb|AAT01086.1|  putative activated protein kinase C receptor            228   2e-69    
ref|NP_001291517.1|  guanine nucleotide-binding protein subunit b...    228   2e-69    
ref|XP_007339269.1|  guanine nucleotide binding protein beta subunit    228   2e-69    
gb|KIK47181.1|  hypothetical protein CY34DRAFT_799718                   228   2e-69    
ref|XP_001537609.1|  hypothetical protein HCAG_07031                    228   2e-69    
gb|KIW40911.1|  guanine nucleotide-binding protein subunit beta-l...    228   2e-69    
emb|CCO34704.1|  Guanine nucleotide-binding protein subunit beta-...    228   2e-69    
ref|XP_005818516.1|  small subunit ribosomal protein RACK1, cytop...    228   2e-69    
ref|XP_009261603.1|  FGB1                                               228   2e-69    
ref|XP_001212378.1|  hypothetical protein ATEG_03200                    226   3e-69    
gb|ABU49887.1|  receptor for activated protein kinase c1                228   3e-69    



>ref|XP_006341557.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein-like [Solanum tuberosum]
Length=327

 Score =   357 bits (915),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 168/190 (88%), Positives = 182/190 (96%), Gaps = 0/190 (0%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTIQDGD H++WVSCVRFSP+TLQPTIVSGSWDRTVK+WNL+NCKLRSTLAGH+GYV
Sbjct  138  ECKYTIQDGDSHSDWVSCVRFSPNTLQPTIVSGSWDRTVKIWNLTNCKLRSTLAGHSGYV  197

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDA SIIH LCFSPNRYWLCAATE+S
Sbjct  198  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDASSIIHTLCFSPNRYWLCAATESS  257

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            IKIWDLESK+IVVDLRVDLK ESEM+A  + TA KNK+I+CTSLSW+ADGSTLFSGYTDG
Sbjct  258  IKIWDLESKTIVVDLRVDLKHESEMAANESGTAPKNKVIYCTSLSWSADGSTLFSGYTDG  317

Query  211  VIRVWGIGRY  182
            +IRVWGIGRY
Sbjct  318  LIRVWGIGRY  327


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 50/186 (27%), Positives = 82/186 (44%), Gaps = 27/186 (15%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  557
             H +WV+ +  +P      IV+ S D+++ VW+L+         R  L GH  +V  V +
Sbjct  14   AHTDWVTAIA-TPIDNSDMIVTSSRDKSIIVWSLTKDGAQYGVPRRRLTGHGHFVQDVVL  72

Query  556  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  383
            S DG    SG  DG + LWDL  G         +  + ++ FS  NR  + A+ + SIK+
Sbjct  73   SSDGMFALSGSWDGELRLWDLQAGTTARRFVGHTKDVLSVAFSVDNRQIVSASRDKSIKL  132

Query  382  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            W+   E K  + D              G+   + +  + C   S N    T+ SG  D  
Sbjct  133  WNTLGECKYTIQD--------------GD---SHSDWVSCVRFSPNTLQPTIVSGSWDRT  175

Query  208  IRVWGI  191
            +++W +
Sbjct  176  VKIWNL  181



>ref|XP_009611065.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Nicotiana tomentosiformis]
Length=325

 Score =   353 bits (906),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 171/190 (90%), Positives = 180/190 (95%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTI DGD H+ WVSCVRFSP+ LQPTIVSGSWDRTVK+WNL+NCKLRSTLAGH+GYV
Sbjct  137  ECKYTITDGDSHSNWVSCVRFSPNNLQPTIVSGSWDRTVKIWNLTNCKLRSTLAGHSGYV  196

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIH LCFSPNRYWLCAATE+S
Sbjct  197  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHTLCFSPNRYWLCAATESS  256

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            IKIWDLESKSIVVDLRVDLKQESEMSAEG   AAKNKII+CT LSW+ADGSTLF GYTDG
Sbjct  257  IKIWDLESKSIVVDLRVDLKQESEMSAEG-TAAAKNKIIYCTCLSWSADGSTLFGGYTDG  315

Query  211  VIRVWGIGRY  182
            +IRVWGIGRY
Sbjct  316  LIRVWGIGRY  325


 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 46/186 (25%), Positives = 78/186 (42%), Gaps = 27/186 (15%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSN-----CKLRSTLAGHTGYVNTVAV  557
             H +WV+ +  +P      IV+ S D+++ VW+L+         R  L GH  +V  V +
Sbjct  13   AHTDWVTAIA-TPIDNSDMIVTSSRDKSIIVWSLTKDGPQYGVPRRRLTGHGHFVQDVVL  71

Query  556  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  383
            S DG    SG  DG + LWDL  G   + +      ++       NR  + A+ + +IK+
Sbjct  72   SSDGMFALSGSWDGELRLWDLQAGTTARRFVGHTKDVLSVAFSVDNRQIVSASRDKTIKL  131

Query  382  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            W+   E K  + D                   + +  + C   S N    T+ SG  D  
Sbjct  132  WNTLGECKYTITD-----------------GDSHSNWVSCVRFSPNNLQPTIVSGSWDRT  174

Query  208  IRVWGI  191
            +++W +
Sbjct  175  VKIWNL  180



>gb|ABB86277.1| ArcA2 protein-like [Solanum tuberosum]
Length=327

 Score =   353 bits (906),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 167/190 (88%), Positives = 181/190 (95%), Gaps = 0/190 (0%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTIQDGD H++WVSCVRFSP+TLQPTIVSGSWDRTVK+WNL+NCKLRSTLAGH+GYV
Sbjct  138  ECKYTIQDGDSHSDWVSCVRFSPNTLQPTIVSGSWDRTVKIWNLTNCKLRSTLAGHSGYV  197

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDA SIIH LCFSPNRYWLCAATE+S
Sbjct  198  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDASSIIHTLCFSPNRYWLCAATESS  257

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            IKIWDLESK+IVVDLRVDLKQESEM+A  + T  KNK+I+CTSLSW+ADGSTL SGYTDG
Sbjct  258  IKIWDLESKTIVVDLRVDLKQESEMAATESGTGPKNKVIYCTSLSWSADGSTLSSGYTDG  317

Query  211  VIRVWGIGRY  182
            +IRVWGIGRY
Sbjct  318  LIRVWGIGRY  327


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 50/186 (27%), Positives = 82/186 (44%), Gaps = 27/186 (15%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  557
             H +WV+ +  +P      IV+ S D+++ VW+L+         R  L GH  +V  V +
Sbjct  14   AHTDWVTAIA-TPIDNSDMIVTSSRDKSIIVWSLTKDGAQYGVPRRRLTGHGHFVQDVVL  72

Query  556  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  383
            S DG    SG  DG + LWDL  G         +  + ++ FS  NR  + A+ + SIK+
Sbjct  73   SSDGMFALSGSWDGELRLWDLQAGTTARRFVGHTKDVLSVAFSVDNRQIVSASRDKSIKL  132

Query  382  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            W+   E K  + D              G+   + +  + C   S N    T+ SG  D  
Sbjct  133  WNTLGECKYTIQD--------------GD---SHSDWVSCVRFSPNTLQPTIVSGSWDRT  175

Query  208  IRVWGI  191
            +++W +
Sbjct  176  VKIWNL  181



>gb|AJE63428.1| transcription factor ArcA1 [Capsicum annuum]
Length=330

 Score =   353 bits (905),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 170/193 (88%), Positives = 181/193 (94%), Gaps = 3/193 (2%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTIQDGD H++WVSCVRFSP+TLQPTIVSGSWDRTVK+WNL+NCKLRSTLAGHTGYV
Sbjct  138  ECKYTIQDGDSHSDWVSCVRFSPNTLQPTIVSGSWDRTVKIWNLTNCKLRSTLAGHTGYV  197

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIH LCFSPNRYWLCAATE+S
Sbjct  198  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHTLCFSPNRYWLCAATESS  257

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSA---EGNNTAAKNKIIFCTSLSWNADGSTLFSGY  221
            IKIWDLESKSIVVDLRVDLKQESEM A   +G     KNKII+CTSLSW+ADGSTL+ GY
Sbjct  258  IKIWDLESKSIVVDLRVDLKQESEMLAATPDGGAAPVKNKIIYCTSLSWSADGSTLYRGY  317

Query  220  TDGVIRVWGIGRY  182
            TDG+IRVWGIGRY
Sbjct  318  TDGLIRVWGIGRY  330


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 51/186 (27%), Positives = 83/186 (45%), Gaps = 27/186 (15%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSN-----CKLRSTLAGHTGYVNTVAV  557
             H +WV+ +  +P      IV+ S D+++ VW+L+         R  L GH  +V  V +
Sbjct  14   AHTDWVTAIA-TPIDNSDMIVTSSRDKSIIVWSLTKDGPTYGVPRRRLTGHGHFVQDVVL  72

Query  556  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  383
            S DG    SG  DG + LWDL  G    S    +  + ++ FS  NR  + A+ + SIK+
Sbjct  73   SSDGMFALSGSWDGELRLWDLQAGTTARSFVGHTKDVLSVAFSVDNRQIVSASRDKSIKL  132

Query  382  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            W+   E K  + D              G+   + +  + C   S N    T+ SG  D  
Sbjct  133  WNTLGECKYTIQD--------------GD---SHSDWVSCVRFSPNTLQPTIVSGSWDRT  175

Query  208  IRVWGI  191
            +++W +
Sbjct  176  VKIWNL  181



>ref|XP_009776114.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Nicotiana sylvestris]
Length=328

 Score =   352 bits (903),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 168/191 (88%), Positives = 181/191 (95%), Gaps = 1/191 (1%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTIQ+GD H++WVSCVRFSP+TLQPTIVSGSWDRTVK+WNL+NCKLRSTLAGH GYV
Sbjct  138  ECKYTIQEGDSHSDWVSCVRFSPNTLQPTIVSGSWDRTVKIWNLTNCKLRSTLAGHAGYV  197

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTVAVSPDGSLCASGGKDG ILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATE S
Sbjct  198  NTVAVSPDGSLCASGGKDGTILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATETS  257

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNN-TAAKNKIIFCTSLSWNADGSTLFSGYTD  215
            IKIWDLESKSIVVDL+VDLKQESEM+ EG   +A KNKI++CT LSW+ADGSTLFSGYTD
Sbjct  258  IKIWDLESKSIVVDLKVDLKQESEMATEGTTGSACKNKIMYCTCLSWSADGSTLFSGYTD  317

Query  214  GVIRVWGIGRY  182
            G+IRVWGIGRY
Sbjct  318  GLIRVWGIGRY  328


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 46/184 (25%), Positives = 79/184 (43%), Gaps = 23/184 (13%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSN-----CKLRSTLAGHTGYVNTVAV  557
             H +WV+ +  +P      IV+ S D+++ VW+L+         R  L GH  +V  V +
Sbjct  14   AHTDWVTAIA-TPIDNSDMIVTSSRDKSLIVWSLTKDGPQYGVPRRRLTGHGHFVQDVVL  72

Query  556  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  383
            S DG    SG  DG + LWDL  G   + +      ++       NR  + A+ + +IK+
Sbjct  73   SSDGMFALSGSWDGELRLWDLQAGTTARRFVGHTKDVLSVAFSVDNRQIVSASRDKTIKL  132

Query  382  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  203
            W+             L +      EG+   + +  + C   S N    T+ SG  D  ++
Sbjct  133  WNT------------LGECKYTIQEGD---SHSDWVSCVRFSPNTLQPTIVSGSWDRTVK  177

Query  202  VWGI  191
            +W +
Sbjct  178  IWNL  181



>emb|CAA96528.1| G protein beta-subunit-like protein [Nicotiana plumbaginifolia]
Length=328

 Score =   352 bits (903),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 168/191 (88%), Positives = 181/191 (95%), Gaps = 1/191 (1%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTIQ+GD H++WVSCVRFSP+TLQPTIVSGSWDRTVK+WNL+NCKLRSTLAGH GYV
Sbjct  138  ECKYTIQEGDSHSDWVSCVRFSPNTLQPTIVSGSWDRTVKIWNLTNCKLRSTLAGHAGYV  197

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTVAVSPDGSLCASGGKDG ILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATE S
Sbjct  198  NTVAVSPDGSLCASGGKDGTILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATETS  257

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNN-TAAKNKIIFCTSLSWNADGSTLFSGYTD  215
            IKIWDLESKSIVVDL+VDLKQESEM+ EG   +A KNKI++CT LSW+ADGSTLFSGYTD
Sbjct  258  IKIWDLESKSIVVDLKVDLKQESEMATEGTTGSACKNKIMYCTCLSWSADGSTLFSGYTD  317

Query  214  GVIRVWGIGRY  182
            G+IRVWGIGRY
Sbjct  318  GLIRVWGIGRY  328


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 49/184 (27%), Positives = 81/184 (44%), Gaps = 23/184 (13%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSN-----CKLRSTLAGHTGYVNTVAV  557
             H +WV+ +  +P      IV+ S D+++ VW+L+         R  L GH  +V  V +
Sbjct  14   AHTDWVTAIA-TPIDNSDMIVTSSRDKSLIVWSLTKDGPQYGVPRRRLTGHGHFVQDVVL  72

Query  556  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  383
            S DG    SG  DG + LWDL  G         +  + ++ FS  NR  + A+ + SIK+
Sbjct  73   SSDGMFALSGSWDGELRLWDLQAGTTARRFVGHTKDVLSVAFSVDNRQIVSASRDKSIKL  132

Query  382  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  203
            W+             L +      EG+   + +  + C   S N    T+ SG  D  ++
Sbjct  133  WNT------------LGECKYTIQEGD---SHSDWVSCVRFSPNTLQPTIVSGSWDRTVK  177

Query  202  VWGI  191
            +W +
Sbjct  178  IWNL  181



>ref|XP_009780116.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Nicotiana sylvestris]
Length=325

 Score =   352 bits (902),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 169/190 (89%), Positives = 182/190 (96%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTI DGD H++WVSCVRFSP+ LQPTIVSGSWDRTVK+WNL+NCKLRSTLAGH+GYV
Sbjct  137  ECKYTITDGDSHSDWVSCVRFSPNNLQPTIVSGSWDRTVKIWNLTNCKLRSTLAGHSGYV  196

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+AGSIIH+LCFSPNRYWLCAATE+S
Sbjct  197  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAGSIIHSLCFSPNRYWLCAATESS  256

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            IKIWDLESKSIVVDL+VDLKQESEMSAEG   AAKNKII+CT LSW+ADGSTLF GYTDG
Sbjct  257  IKIWDLESKSIVVDLKVDLKQESEMSAEG-TAAAKNKIIYCTCLSWSADGSTLFGGYTDG  315

Query  211  VIRVWGIGRY  182
            +IRVWGIGRY
Sbjct  316  LIRVWGIGRY  325


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 48/186 (26%), Positives = 80/186 (43%), Gaps = 27/186 (15%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSN-----CKLRSTLAGHTGYVNTVAV  557
             H +WV+ +  +P      IV+ S D+++ VW+L+         R  L GH  +V  V +
Sbjct  13   AHTDWVTAIA-TPIDNSDMIVTSSRDKSIIVWSLTKDGPQYGVPRRRLTGHGHFVQDVVL  71

Query  556  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  383
            S DG    SG  DG + LWDL  G         +  + ++ FS  NR  + A+ + +IK+
Sbjct  72   SSDGMFALSGSWDGELRLWDLQAGTTARRFVGHTKDVLSVAFSIDNRQIVSASRDKTIKL  131

Query  382  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            W+   E K  + D                   + +  + C   S N    T+ SG  D  
Sbjct  132  WNTLGECKYTITD-----------------GDSHSDWVSCVRFSPNNLQPTIVSGSWDRT  174

Query  208  IRVWGI  191
            +++W +
Sbjct  175  VKIWNL  180



>ref|XP_009600162.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Nicotiana tomentosiformis]
Length=328

 Score =   350 bits (899),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 167/191 (87%), Positives = 181/191 (95%), Gaps = 1/191 (1%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTIQ+GD H++WVSCVRFSP+TLQPTIVSGSWDRTVK+WNL+NCKLRSTLAGH GYV
Sbjct  138  ECKYTIQEGDSHSDWVSCVRFSPNTLQPTIVSGSWDRTVKIWNLTNCKLRSTLAGHGGYV  197

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTVAVSPDGSLCASGGKDG ILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATE S
Sbjct  198  NTVAVSPDGSLCASGGKDGTILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATETS  257

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNN-TAAKNKIIFCTSLSWNADGSTLFSGYTD  215
            IKIWDLESKS+VVDL+VDLKQESEM+ EG   +A KNKI++CT LSW+ADGSTLFSGYTD
Sbjct  258  IKIWDLESKSVVVDLKVDLKQESEMATEGTTGSACKNKIMYCTCLSWSADGSTLFSGYTD  317

Query  214  GVIRVWGIGRY  182
            G+IRVWGIGRY
Sbjct  318  GLIRVWGIGRY  328


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 49/184 (27%), Positives = 80/184 (43%), Gaps = 23/184 (13%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSN-----CKLRSTLAGHTGYVNTVAV  557
             H +WV+ +  +P      IV+ S D+++ VW L+         R  L GH  +V  V +
Sbjct  14   AHTDWVTAIA-TPIDNSDMIVTSSRDKSLIVWALTKDGPQYGVPRRRLTGHGHFVQDVVL  72

Query  556  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  383
            S DG    SG  DG + LWDL  G         +  + ++ FS  NR  + A+ + SIK+
Sbjct  73   SSDGMFALSGSWDGELRLWDLQAGTTARRFVGHTKDVLSVAFSVDNRQIVSASRDKSIKL  132

Query  382  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  203
            W+             L +      EG+   + +  + C   S N    T+ SG  D  ++
Sbjct  133  WNT------------LGECKYTIQEGD---SHSDWVSCVRFSPNTLQPTIVSGSWDRTVK  177

Query  202  VWGI  191
            +W +
Sbjct  178  IWNL  181


 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 50/187 (27%), Positives = 80/187 (43%), Gaps = 31/187 (17%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  542
            GH  +V  V  S   +    +SGSWD  +++W+L          GHT  V +VA S D  
Sbjct  62   GHGHFVQDVVLSSDGMFA--LSGSWDGELRLWDLQAGTTARRFVGHTKDVLSVAFSVDNR  119

Query  541  LCASGGKDGVILLWD-LAEGKKLYSLDAGSI----IHALCFSPNRYW---LCAATEASIK  386
               S  +D  I LW+ L E K  Y++  G      +  + FSPN      +  + + ++K
Sbjct  120  QIVSASRDKSIKLWNTLGECK--YTIQEGDSHSDWVSCVRFSPNTLQPTIVSGSWDRTVK  177

Query  385  IWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVI  206
            IW+L           + K  S ++  G          +  +++ + DGS   SG  DG I
Sbjct  178  IWNL----------TNCKLRSTLAGHGG---------YVNTVAVSPDGSLCASGGKDGTI  218

Query  205  RVWGIGR  185
             +W +  
Sbjct  219  LLWDLAE  225



>ref|NP_001233881.1| ArcA2 protein [Solanum lycopersicum]
 dbj|BAA76896.1| LeArcA2 protein [Solanum lycopersicum]
Length=326

 Score =   350 bits (897),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 167/190 (88%), Positives = 181/190 (95%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTIQDG  H++WVSCVRFSP+TLQPTIVSGSWDRTVK+WNL+NCKLRSTLAGH+GYV
Sbjct  138  ECKYTIQDGHSHSDWVSCVRFSPNTLQPTIVSGSWDRTVKIWNLTNCKLRSTLAGHSGYV  197

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIH LCFSPNRYWLCAATE+S
Sbjct  198  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHTLCFSPNRYWLCAATESS  257

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            IKIWDLESKSIVVDL+VDLK ESEM+ E + TA K K+I+CTSLSW+ADGSTLFSGYTDG
Sbjct  258  IKIWDLESKSIVVDLKVDLKHESEMANE-SGTAPKTKVIYCTSLSWSADGSTLFSGYTDG  316

Query  211  VIRVWGIGRY  182
            +IRVWGIGRY
Sbjct  317  LIRVWGIGRY  326


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 47/186 (25%), Positives = 78/186 (42%), Gaps = 27/186 (15%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  557
             H +WV+ +  +P      IV+ S D+++ VW+L+         R  L GH  +V  V +
Sbjct  14   AHTDWVTAIA-TPIDNSDMIVTSSRDKSIIVWSLTKDGAQYGVPRRRLTGHGHFVQDVVL  72

Query  556  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  383
            S DG    SG  DG + LWDL  G   + +      ++       NR  + A+ + SIK+
Sbjct  73   SSDGMFALSGSWDGELRLWDLQAGTTARRFVGHTKDVLSVAFSVDNRQIVSASRDKSIKL  132

Query  382  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            W+   E K  + D                   + +  + C   S N    T+ SG  D  
Sbjct  133  WNTLGECKYTIQD-----------------GHSHSDWVSCVRFSPNTLQPTIVSGSWDRT  175

Query  208  IRVWGI  191
            +++W +
Sbjct  176  VKIWNL  181



>ref|XP_004252270.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein isoform X1 [Solanum lycopersicum]
Length=329

 Score =   349 bits (895),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 166/192 (86%), Positives = 181/192 (94%), Gaps = 2/192 (1%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTIQD D H++WVSCVRFSP+ LQPTIVSGSWDRTVK+WNLSNCKLR+TLAGHTGYV
Sbjct  138  ECKYTIQDQDSHSDWVSCVRFSPNNLQPTIVSGSWDRTVKIWNLSNCKLRATLAGHTGYV  197

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NT AVSPDGSLCASGGKDGVILLWDLAEGKKLYSLD+GSIIHALCFSPNRYWLCAATE+S
Sbjct  198  NTAAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDSGSIIHALCFSPNRYWLCAATESS  257

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTA--AKNKIIFCTSLSWNADGSTLFSGYT  218
            IKIWDLESKSIVVDLRVDLKQE+EMS    +T+  +K K+I+CTSLSW+ADGSTLFSGYT
Sbjct  258  IKIWDLESKSIVVDLRVDLKQETEMSGNATSTSGNSKTKVIYCTSLSWSADGSTLFSGYT  317

Query  217  DGVIRVWGIGRY  182
            DG+IRVWGIGRY
Sbjct  318  DGLIRVWGIGRY  329


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 51/186 (27%), Positives = 82/186 (44%), Gaps = 27/186 (15%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSN-----CKLRSTLAGHTGYVNTVAV  557
             H +WV+ +  +P      IV+ S D+++ VW+L+         R  L GH  +V  V +
Sbjct  14   AHTDWVTAIA-TPIDNSDMIVTSSRDKSIIVWSLTKEGSQYGVPRRRLTGHGHFVQDVVL  72

Query  556  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  383
            S DG    SG  DG + LWDL  G         +  + ++ FS  NR  + A+ + SIK+
Sbjct  73   SSDGMFALSGSWDGELRLWDLQAGTTARRFVGHTKDVLSVAFSVDNRQIVSASRDKSIKL  132

Query  382  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            W+   E K  + D      Q+S            +  + C   S N    T+ SG  D  
Sbjct  133  WNTLGECKYTIQD------QDSH-----------SDWVSCVRFSPNNLQPTIVSGSWDRT  175

Query  208  IRVWGI  191
            +++W +
Sbjct  176  VKIWNL  181



>ref|XP_009624187.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Nicotiana tomentosiformis]
Length=326

 Score =   349 bits (895),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 165/190 (87%), Positives = 182/190 (96%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTIQDGD H++WVSCVRFSP+ LQPTIVSGSWDRTVK+WNL+NCKLR+TLAGHTGYV
Sbjct  138  ECKYTIQDGDSHSDWVSCVRFSPNNLQPTIVSGSWDRTVKIWNLTNCKLRATLAGHTGYV  197

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NT AVSPDGSLCASGGKDGVILLWDLAEGKKLYSL++GSIIH+LCFSPNRYWLCAATE+S
Sbjct  198  NTAAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLESGSIIHSLCFSPNRYWLCAATESS  257

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            IKIWDLESKSIV DL+VDLKQESEMS+EG   + KNK+I+CTSLSW+ADGSTLFSGYTDG
Sbjct  258  IKIWDLESKSIVDDLKVDLKQESEMSSEG-TASGKNKVIYCTSLSWSADGSTLFSGYTDG  316

Query  211  VIRVWGIGRY  182
            +IRVWGIGRY
Sbjct  317  LIRVWGIGRY  326


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 45/186 (24%), Positives = 78/186 (42%), Gaps = 27/186 (15%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSN-----CKLRSTLAGHTGYVNTVAV  557
             H +WV+ +  +P      IV+ S D+++ VW+++         R  L GH  +V  V +
Sbjct  14   AHTDWVTAIA-TPVDNSDMIVTSSRDKSIIVWSITKDGPQYGVPRRRLTGHGHFVQDVVL  72

Query  556  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  383
            S DG    SG  DG + LWDL  G   + +      ++       NR  + A+ + SI++
Sbjct  73   SSDGMFALSGSWDGELRLWDLQAGTTARRFVGHTKDVLSVAFSVDNRQIVSASRDKSIRL  132

Query  382  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            W+   E K  + D                   + +  + C   S N    T+ SG  D  
Sbjct  133  WNTLGECKYTIQD-----------------GDSHSDWVSCVRFSPNNLQPTIVSGSWDRT  175

Query  208  IRVWGI  191
            +++W +
Sbjct  176  VKIWNL  181


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 59/205 (29%), Positives = 86/205 (42%), Gaps = 31/205 (15%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  542
            GH  +V  V  S   +    +SGSWD  +++W+L          GHT  V +VA S D  
Sbjct  62   GHGHFVQDVVLSSDGMFA--LSGSWDGELRLWDLQAGTTARRFVGHTKDVLSVAFSVDNR  119

Query  541  LCASGGKDGVILLWD-LAEGKKLYSLDAGSI----IHALCFSPNRYW---LCAATEASIK  386
               S  +D  I LW+ L E K  Y++  G      +  + FSPN      +  + + ++K
Sbjct  120  QIVSASRDKSIRLWNTLGECK--YTIQDGDSHSDWVSCVRFSPNNLQPTIVSGSWDRTVK  177

Query  385  IWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVI  206
            IW+L +      LR  L   +       NTAA            + DGS   SG  DGVI
Sbjct  178  IWNLTN----CKLRATLAGHTGYV----NTAAV-----------SPDGSLCASGGKDGVI  218

Query  205  RVWGIGRY*MEEFRRSHMIIGHVCY  131
             +W +          S  II  +C+
Sbjct  219  LLWDLAEGKKLYSLESGSIIHSLCF  243



>gb|ABB02625.1| G protein beta subunit-like protein [Solanum tuberosum]
Length=261

 Score =   346 bits (888),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 166/192 (86%), Positives = 180/192 (94%), Gaps = 2/192 (1%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTIQD D H++WVSCVRFSP+ LQPTIVSGSWDRTVK+WNLSNCKLR+TLAGHTGYV
Sbjct  70   ECKYTIQDQDSHSDWVSCVRFSPNNLQPTIVSGSWDRTVKIWNLSNCKLRATLAGHTGYV  129

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NT AVSPDGSLCASGGKDGVILLWDLAEGKKLYSLD+GSIIHALCFSPNRYWLCAATE+S
Sbjct  130  NTAAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDSGSIIHALCFSPNRYWLCAATESS  189

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTA--AKNKIIFCTSLSWNADGSTLFSGYT  218
            IKIWDLESKSIVVDLRVDLKQE+EM     +T+  AK K+I+CTSLSW+ADGSTLFSGYT
Sbjct  190  IKIWDLESKSIVVDLRVDLKQETEMFGNATSTSGNAKTKVIYCTSLSWSADGSTLFSGYT  249

Query  217  DGVIRVWGIGRY  182
            DG+IRVWGIGRY
Sbjct  250  DGLIRVWGIGRY  261



>ref|XP_006353816.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein-like [Solanum tuberosum]
Length=329

 Score =   347 bits (891),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 165/192 (86%), Positives = 180/192 (94%), Gaps = 2/192 (1%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTIQD D H++WVSCVRFSP+ LQPTIVSGSWDRTVK+WNLSNCKLR+TLAGH GYV
Sbjct  138  ECKYTIQDQDSHSDWVSCVRFSPNNLQPTIVSGSWDRTVKIWNLSNCKLRATLAGHAGYV  197

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NT AVSPDGSLCASGGKDGVILLWDLAEGKKLYSLD+GSIIHALCFSPNRYWLCAATE+S
Sbjct  198  NTAAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDSGSIIHALCFSPNRYWLCAATESS  257

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTA--AKNKIIFCTSLSWNADGSTLFSGYT  218
            IKIWDLESKSIVVDLRVDLKQE+EMS    +T+  +K K+I+CTSLSW+ADGSTLFSGYT
Sbjct  258  IKIWDLESKSIVVDLRVDLKQETEMSGNATSTSGNSKTKVIYCTSLSWSADGSTLFSGYT  317

Query  217  DGVIRVWGIGRY  182
            DG+IRVWGIGRY
Sbjct  318  DGLIRVWGIGRY  329


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 51/186 (27%), Positives = 82/186 (44%), Gaps = 27/186 (15%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSN-----CKLRSTLAGHTGYVNTVAV  557
             H +WV+ +  +P      IV+ S D+++ VW+L+         R  L GH  +V  V +
Sbjct  14   AHTDWVTAIA-TPIDNSDMIVTSSRDKSIIVWSLTKEGSQYGVPRRRLTGHGHFVQDVVL  72

Query  556  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  383
            S DG    SG  DG + LWDL  G         +  + ++ FS  NR  + A+ + SIK+
Sbjct  73   SSDGMFALSGSWDGELRLWDLQAGTTARRFVGHTKDVLSVAFSVDNRQIVSASRDKSIKL  132

Query  382  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            W+   E K  + D      Q+S            +  + C   S N    T+ SG  D  
Sbjct  133  WNTLGECKYTIQD------QDSH-----------SDWVSCVRFSPNNLQPTIVSGSWDRT  175

Query  208  IRVWGI  191
            +++W +
Sbjct  176  VKIWNL  181



>gb|EYU40229.1| hypothetical protein MIMGU_mgv1a008949mg [Erythranthe guttata]
Length=357

 Score =   348 bits (892),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 164/192 (85%), Positives = 182/192 (95%), Gaps = 2/192 (1%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTIQD D H++WVSCVRFSP+TLQPTIVS SWD+TVK+WNL+NCKLRSTLAGH+GYV
Sbjct  166  ECKYTIQDQDAHSDWVSCVRFSPNTLQPTIVSASWDKTVKIWNLTNCKLRSTLAGHSGYV  225

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NT AVSPDGSLCASGGKDGVILLWDLAEGK+LYSLDAGSII+ALCFSPNRYWLCAATEAS
Sbjct  226  NTSAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDAGSIINALCFSPNRYWLCAATEAS  285

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEG--NNTAAKNKIIFCTSLSWNADGSTLFSGYT  218
            IKIWDLESKS+VVDL+VDLK ESE++ EG   + AAKNK+I+CTSLSW+ADGSTLFSGYT
Sbjct  286  IKIWDLESKSVVVDLKVDLKHESEIAPEGATQSAAAKNKVIYCTSLSWSADGSTLFSGYT  345

Query  217  DGVIRVWGIGRY  182
            DGV+RVWGIGRY
Sbjct  346  DGVVRVWGIGRY  357


 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 47/186 (25%), Positives = 80/186 (43%), Gaps = 27/186 (15%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  557
             H +WV+ +  +P      IV+ S D+++ +W+L+         R  L GH+ +V  V +
Sbjct  42   AHTDWVTAIA-TPIDNSDMIVTASRDKSIILWSLTKEDRTYGVARRRLTGHSHFVEDVVL  100

Query  556  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  383
            S DG    SG  DG + LWDL  G         +  + ++ FS  NR  + A+ + +IK+
Sbjct  101  SSDGQFALSGSWDGELRLWDLQTGNTARRFVGHTKDVLSVAFSIDNRQIVSASRDKTIKL  160

Query  382  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            W+   E K  + D                   A +  + C   S N    T+ S   D  
Sbjct  161  WNTLGECKYTIQD-----------------QDAHSDWVSCVRFSPNTLQPTIVSASWDKT  203

Query  208  IRVWGI  191
            +++W +
Sbjct  204  VKIWNL  209


 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 57/185 (31%), Positives = 81/185 (44%), Gaps = 27/185 (15%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  542
            GH+ +V  V  S        +SGSWD  +++W+L          GHT  V +VA S D  
Sbjct  90   GHSHFVEDVVLSSD--GQFALSGSWDGELRLWDLQTGNTARRFVGHTKDVLSVAFSIDNR  147

Query  541  LCASGGKDGVILLWD-LAEGK-KLYSLDAGSI-IHALCFSPNRYW---LCAATEASIKIW  380
               S  +D  I LW+ L E K  +   DA S  +  + FSPN      + A+ + ++KIW
Sbjct  148  QIVSASRDKTIKLWNTLGECKYTIQDQDAHSDWVSCVRFSPNTLQPTIVSASWDKTVKIW  207

Query  379  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRV  200
            +L +      LR  L   S       NT+A +            DGS   SG  DGVI +
Sbjct  208  NLTN----CKLRSTLAGHSGYV----NTSAVSP-----------DGSLCASGGKDGVILL  248

Query  199  WGIGR  185
            W +  
Sbjct  249  WDLAE  253



>ref|XP_009778426.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Nicotiana sylvestris]
Length=326

 Score =   345 bits (886),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 163/190 (86%), Positives = 180/190 (95%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKY IQDGD H++WVSCVRFSP+ LQPTIVSGSWDRTVK+WNL+NCKLR+TLAGHTGYV
Sbjct  138  ECKYIIQDGDSHSDWVSCVRFSPNNLQPTIVSGSWDRTVKIWNLTNCKLRATLAGHTGYV  197

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NT AVSPDGSLCASGGKDGVILLWDLAEGKKLYSL++GSIIH+LCFSPNRYWLCAATE+S
Sbjct  198  NTTAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLESGSIIHSLCFSPNRYWLCAATESS  257

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            IKIWDLESK+IV DL+VDLKQESEMSAEG   + KNK+I+CTSL W+ADGSTLFSGYTDG
Sbjct  258  IKIWDLESKTIVDDLKVDLKQESEMSAEG-TASGKNKVIYCTSLGWSADGSTLFSGYTDG  316

Query  211  VIRVWGIGRY  182
            +IRVWGIGRY
Sbjct  317  LIRVWGIGRY  326


 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 47/185 (25%), Positives = 80/185 (43%), Gaps = 27/185 (15%)
 Frame = -1

Query  718  HNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSN-----CKLRSTLAGHTGYVNTVAVS  554
            H +WV+ +  +P      IV+ S D+++ VW+L+         R  L GH  +V  V +S
Sbjct  15   HTDWVTAIA-TPVDNSDMIVTSSRDKSIIVWSLTKDGPQYGVPRRRLTGHGHFVQDVVLS  73

Query  553  PDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIW  380
             DG    SG  DG + LWDL  G   + +      ++     + NR  + A+ + SI++W
Sbjct  74   SDGMFALSGSWDGELRLWDLQAGTTARRFVGHTKDVLSVAFSADNRQIVSASRDKSIRLW  133

Query  379  DL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVI  206
            +   E K I+ D                   + +  + C   S N    T+ SG  D  +
Sbjct  134  NTLGECKYIIQD-----------------GDSHSDWVSCVRFSPNNLQPTIVSGSWDRTV  176

Query  205  RVWGI  191
            ++W +
Sbjct  177  KIWNL  181


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 56/203 (28%), Positives = 82/203 (40%), Gaps = 27/203 (13%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  542
            GH  +V  V  S   +    +SGSWD  +++W+L          GHT  V +VA S D  
Sbjct  62   GHGHFVQDVVLSSDGMFA--LSGSWDGELRLWDLQAGTTARRFVGHTKDVLSVAFSADNR  119

Query  541  LCASGGKDGVILLWDLAEGKKLYSLDAGSI---IHALCFSPNRYW---LCAATEASIKIW  380
               S  +D  I LW+     K    D  S    +  + FSPN      +  + + ++KIW
Sbjct  120  QIVSASRDKSIRLWNTLGECKYIIQDGDSHSDWVSCVRFSPNNLQPTIVSGSWDRTVKIW  179

Query  379  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRV  200
            +L +      LR  L             A     +  T++S   DGS   SG  DGVI +
Sbjct  180  NLTN----CKLRATL-------------AGHTGYVNTTAVS--PDGSLCASGGKDGVILL  220

Query  199  WGIGRY*MEEFRRSHMIIGHVCY  131
            W +          S  II  +C+
Sbjct  221  WDLAEGKKLYSLESGSIIHSLCF  243



>ref|XP_011072970.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Sesamum indicum]
Length=329

 Score =   345 bits (885),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 162/192 (84%), Positives = 182/192 (95%), Gaps = 2/192 (1%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTIQD D H++WVSCVRFSP+TLQPTIVSGSWD+TVKVWNL+NCKLRSTL+GH+GYV
Sbjct  138  ECKYTIQDQDAHSDWVSCVRFSPNTLQPTIVSGSWDKTVKVWNLTNCKLRSTLSGHSGYV  197

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTVAVSPDGSLCASGGKDGVILLWDLAEGK+LYSLDAGSIIHALCFSPNRYWLCAATEAS
Sbjct  198  NTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDAGSIIHALCFSPNRYWLCAATEAS  257

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNN--TAAKNKIIFCTSLSWNADGSTLFSGYT  218
            IKIWDLESKS+VVDL+VDLKQES+++ +G +   A K K+I+CT L+W+ADGSTLFSGYT
Sbjct  258  IKIWDLESKSVVVDLKVDLKQESDLAKDGTDQTAAVKTKVIYCTCLNWSADGSTLFSGYT  317

Query  217  DGVIRVWGIGRY  182
            DGV+RVWGIGRY
Sbjct  318  DGVVRVWGIGRY  329


 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 48/186 (26%), Positives = 78/186 (42%), Gaps = 27/186 (15%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  557
             H +WV+ +  +P      IV+ S D+++ +W L+  +      R  L GH  +V  V +
Sbjct  14   AHTDWVTAIA-TPIDNSDMIVTSSRDKSIILWALTKEEKSYGVARRRLTGHGHFVQDVVL  72

Query  556  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  383
            S DG    SG  DG + LWDL  G   + +      +I       NR  + A+ + +IK+
Sbjct  73   SSDGQFALSGSWDGELRLWDLQTGVTARRFVGHTKDVISVAFSVDNRQIVSASRDKTIKL  132

Query  382  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            W+   E K  + D                   A +  + C   S N    T+ SG  D  
Sbjct  133  WNTLGECKYTIQD-----------------QDAHSDWVSCVRFSPNTLQPTIVSGSWDKT  175

Query  208  IRVWGI  191
            ++VW +
Sbjct  176  VKVWNL  181


 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 51/185 (28%), Positives = 79/185 (43%), Gaps = 27/185 (15%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  542
            GH  +V  V  S        +SGSWD  +++W+L          GHT  V +VA S D  
Sbjct  62   GHGHFVQDVVLSSD--GQFALSGSWDGELRLWDLQTGVTARRFVGHTKDVISVAFSVDNR  119

Query  541  LCASGGKDGVILLWD-LAEGK-KLYSLDAGSI-IHALCFSPNRYW---LCAATEASIKIW  380
               S  +D  I LW+ L E K  +   DA S  +  + FSPN      +  + + ++K+W
Sbjct  120  QIVSASRDKTIKLWNTLGECKYTIQDQDAHSDWVSCVRFSPNTLQPTIVSGSWDKTVKVW  179

Query  379  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRV  200
            +L           + K  S +S             +  +++ + DGS   SG  DGVI +
Sbjct  180  NL----------TNCKLRSTLSGHSG---------YVNTVAVSPDGSLCASGGKDGVILL  220

Query  199  WGIGR  185
            W +  
Sbjct  221  WDLAE  225



>sp|P93340.1|GBLP_NICPL RecName: Full=Guanine nucleotide-binding protein subunit beta-like 
protein [Nicotiana plumbaginifolia]
 emb|CAA70705.1| G protein beta subunit [Nicotiana plumbaginifolia]
Length=326

 Score =   344 bits (882),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 162/190 (85%), Positives = 180/190 (95%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKY IQDGD H++WVSCVRFSP+ LQPTIVSGSWDRTVK+WNL+NCKLR+TLAGHTGYV
Sbjct  138  ECKYIIQDGDSHSDWVSCVRFSPNNLQPTIVSGSWDRTVKIWNLTNCKLRATLAGHTGYV  197

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NT AVSPDGSLCASGGKDGVILLWDLAEGKKLYSL++GSIIH+LCFSPNRYWLCAATE+S
Sbjct  198  NTTAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLESGSIIHSLCFSPNRYWLCAATESS  257

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            IKIWDLESK+IV DL+VDLKQESEMSAEG   + KNK+I+CTSL W+ADGSTLFSGYTDG
Sbjct  258  IKIWDLESKTIVDDLKVDLKQESEMSAEG-TASGKNKVIYCTSLGWSADGSTLFSGYTDG  316

Query  211  VIRVWGIGRY  182
            +IRVWGIGR+
Sbjct  317  LIRVWGIGRF  326


 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 47/185 (25%), Positives = 80/185 (43%), Gaps = 27/185 (15%)
 Frame = -1

Query  718  HNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSN-----CKLRSTLAGHTGYVNTVAVS  554
            H +WV+ +  +P      IV+ S D+++ VW+L+         R  L GH  +V  V +S
Sbjct  15   HTDWVTAIA-TPVDNSDMIVTSSRDKSIIVWSLTKDGPQYGVPRRRLTGHGHFVQDVVLS  73

Query  553  PDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIW  380
             DG    SG  DG + LWDL  G   + +      ++     + NR  + A+ + SI++W
Sbjct  74   SDGMFALSGSWDGELRLWDLQAGTTARRFVGHTKDVLSVAFSADNRQIVSASRDKSIRLW  133

Query  379  DL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVI  206
            +   E K I+ D                   + +  + C   S N    T+ SG  D  +
Sbjct  134  NTLGECKYIIQD-----------------GDSHSDWVSCVRFSPNNLQPTIVSGSWDRTV  176

Query  205  RVWGI  191
            ++W +
Sbjct  177  KIWNL  181


 Score = 50.1 bits (118),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 56/203 (28%), Positives = 82/203 (40%), Gaps = 27/203 (13%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  542
            GH  +V  V  S   +    +SGSWD  +++W+L          GHT  V +VA S D  
Sbjct  62   GHGHFVQDVVLSSDGMFA--LSGSWDGELRLWDLQAGTTARRFVGHTKDVLSVAFSADNR  119

Query  541  LCASGGKDGVILLWDLAEGKKLYSLDAGSI---IHALCFSPNRYW---LCAATEASIKIW  380
               S  +D  I LW+     K    D  S    +  + FSPN      +  + + ++KIW
Sbjct  120  QIVSASRDKSIRLWNTLGECKYIIQDGDSHSDWVSCVRFSPNNLQPTIVSGSWDRTVKIW  179

Query  379  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRV  200
            +L +      LR  L             A     +  T++S   DGS   SG  DGVI +
Sbjct  180  NLTN----CKLRATL-------------AGHTGYVNTTAVS--PDGSLCASGGKDGVILL  220

Query  199  WGIGRY*MEEFRRSHMIIGHVCY  131
            W +          S  II  +C+
Sbjct  221  WDLAEGKKLYSLESGSIIHSLCF  243



>sp|P49026.1|GBLP_TOBAC RecName: Full=Guanine nucleotide-binding protein subunit beta-like 
protein [Nicotiana tabacum]
 dbj|BAA04478.1| G protein beta subunit-like protein [Nicotiana tabacum]
Length=326

 Score =   344 bits (882),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 164/190 (86%), Positives = 180/190 (95%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTIQDGD H++WVSCVRFSP+ LQPTIVSGSWDRTVK+WNL+NCKLR TLAGHTGYV
Sbjct  138  ECKYTIQDGDSHSDWVSCVRFSPNNLQPTIVSGSWDRTVKIWNLTNCKLRLTLAGHTGYV  197

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NT AVSPDGSLCASGGKDGVILLWDLAEGKKLYSL++GSIIH+LCFSPNRYWLCAATE+S
Sbjct  198  NTPAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLESGSIIHSLCFSPNRYWLCAATESS  257

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            IKIWDLESKSIV DL+VDLKQESEMS+EG   + KNK+I+CTSLSW+ADGSTLFSGYTDG
Sbjct  258  IKIWDLESKSIVDDLKVDLKQESEMSSEG-TASGKNKVIYCTSLSWSADGSTLFSGYTDG  316

Query  211  VIRVWGIGRY  182
            +IRVWGI RY
Sbjct  317  LIRVWGIDRY  326



>ref|XP_003631071.1| Guanine nucleotide-binding protein subunit beta-like protein 
[Medicago truncatula]
 gb|AET05547.1| guanine nucleotide-binding protein beta subunit-like protein 
[Medicago truncatula]
Length=325

 Score =   343 bits (880),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 163/190 (86%), Positives = 180/190 (95%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTIQDGD H++WVSCVRFSPSTLQPTIVS SWDRTVKVWNL+NCKLR+TLAGH+GYV
Sbjct  137  ECKYTIQDGDAHSDWVSCVRFSPSTLQPTIVSASWDRTVKVWNLTNCKLRNTLAGHSGYV  196

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTVAVSPDGSLCASGGKDGVILLWDLAEGK+LYSLDAGSIIHALCFSPNRYWLCAATE+S
Sbjct  197  NTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDAGSIIHALCFSPNRYWLCAATESS  256

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            IKIWDLESKSIV DL+VDLK E++ +A G +T  K K+I+CTSL+W+ADGSTLFSGYTDG
Sbjct  257  IKIWDLESKSIVEDLKVDLKTEAD-AAIGGDTTTKKKVIYCTSLNWSADGSTLFSGYTDG  315

Query  211  VIRVWGIGRY  182
            V+RVWGIGRY
Sbjct  316  VVRVWGIGRY  325



>gb|EYU17645.1| hypothetical protein MIMGU_mgv1a009858mg [Erythranthe guttata]
Length=329

 Score =   343 bits (880),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 163/192 (85%), Positives = 181/192 (94%), Gaps = 2/192 (1%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTIQD DGH++WVSCVRFSP+ LQPTIVSGS D+TVK+WNL+NCKL+STLAGH+GYV
Sbjct  138  ECKYTIQDQDGHSDWVSCVRFSPNNLQPTIVSGSCDKTVKIWNLTNCKLKSTLAGHSGYV  197

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTVAVSPDGSLCASGGKDG ILLWDLAEGKKLYSLDAGSI+HA+CFSPNRYWLCAATEA 
Sbjct  198  NTVAVSPDGSLCASGGKDGFILLWDLAEGKKLYSLDAGSIVHAVCFSPNRYWLCAATEAG  257

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGN--NTAAKNKIIFCTSLSWNADGSTLFSGYT  218
            IKIWDLESKS+VVDL+VDLKQESEM +EGN    A+KNKII+CT L+W+ADGSTLFSGYT
Sbjct  258  IKIWDLESKSVVVDLKVDLKQESEMISEGNGQTAASKNKIIYCTCLNWSADGSTLFSGYT  317

Query  217  DGVIRVWGIGRY  182
            DGV+RVWGIGRY
Sbjct  318  DGVVRVWGIGRY  329


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 47/186 (25%), Positives = 79/186 (42%), Gaps = 27/186 (15%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  557
             H +WV+ +  +P      IV+ S D+++ +WNL+         R  L GH+ +V  V +
Sbjct  14   AHTDWVTAIA-TPIDNSDMIVTSSRDKSLILWNLTKEDKNYGVARRRLTGHSHFVQDVVL  72

Query  556  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  383
            S DG    SG  DG + LWDL  G         +  + ++ FS  NR  +  + + +IK+
Sbjct  73   SSDGQFALSGSWDGELRLWDLQTGATTRRFVGHTKDVLSVAFSVDNRQIVSGSRDKTIKL  132

Query  382  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            W+   E K  + D                     +  + C   S N    T+ SG  D  
Sbjct  133  WNTLGECKYTIQD-----------------QDGHSDWVSCVRFSPNNLQPTIVSGSCDKT  175

Query  208  IRVWGI  191
            +++W +
Sbjct  176  VKIWNL  181


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 50/185 (27%), Positives = 77/185 (42%), Gaps = 27/185 (15%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  542
            GH+ +V  V  S        +SGSWD  +++W+L          GHT  V +VA S D  
Sbjct  62   GHSHFVQDVVLSSD--GQFALSGSWDGELRLWDLQTGATTRRFVGHTKDVLSVAFSVDNR  119

Query  541  LCASGGKDGVILLWD-LAEGKKLYSLDAGSIIHALC--FSPNRYW---LCAATEASIKIW  380
               SG +D  I LW+ L E K       G      C  FSPN      +  + + ++KIW
Sbjct  120  QIVSGSRDKTIKLWNTLGECKYTIQDQDGHSDWVSCVRFSPNNLQPTIVSGSCDKTVKIW  179

Query  379  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRV  200
            +L           + K +S ++             +  +++ + DGS   SG  DG I +
Sbjct  180  NL----------TNCKLKSTLAGHSG---------YVNTVAVSPDGSLCASGGKDGFILL  220

Query  199  WGIGR  185
            W +  
Sbjct  221  WDLAE  225



>ref|XP_006365404.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein-like [Solanum tuberosum]
Length=326

 Score =   342 bits (877),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 163/190 (86%), Positives = 178/190 (94%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTIQ+ D H++WVSCVRFSP+ LQPTIVSGSWDRTVK+WNL+NCKLRSTLAGH+GYV
Sbjct  138  ECKYTIQEQDSHSDWVSCVRFSPNNLQPTIVSGSWDRTVKIWNLTNCKLRSTLAGHSGYV  197

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIH LCFSPNRYWLCAATE+S
Sbjct  198  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHTLCFSPNRYWLCAATESS  257

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            IKIWDLESKS+VVDL+VDLKQESEM      T +K K+I+CTSLSW+ADGSTLFSGYTDG
Sbjct  258  IKIWDLESKSVVVDLKVDLKQESEMFGTA-ATDSKTKVIYCTSLSWSADGSTLFSGYTDG  316

Query  211  VIRVWGIGRY  182
            +IRVWGIGRY
Sbjct  317  LIRVWGIGRY  326


 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 49/186 (26%), Positives = 82/186 (44%), Gaps = 27/186 (15%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSN-----CKLRSTLAGHTGYVNTVAV  557
             H +WV+ +  +P      IV+ S D+++ VW+L+         R  L GH  +V  V +
Sbjct  14   AHTDWVTAIA-TPIDNSDMIVTSSRDKSIIVWSLTKDGSHYGVPRRRLTGHGHFVEDVVL  72

Query  556  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  383
            S DG    SG  DG + LWDL  G         +  + ++ FS  NR  + A+ + +IK+
Sbjct  73   SSDGMFALSGSWDGELRLWDLQAGTTARRFVGHTKDVLSVAFSVDNRQIVSASRDRTIKL  132

Query  382  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            W+   E K  +        QE +         + +  + C   S N    T+ SG  D  
Sbjct  133  WNTLGECKYTI--------QEQD---------SHSDWVSCVRFSPNNLQPTIVSGSWDRT  175

Query  208  IRVWGI  191
            +++W +
Sbjct  176  VKIWNL  181



>gb|KHN21658.1| Guanine nucleotide-binding protein subunit beta-like protein 
[Glycine soja]
Length=223

 Score =   338 bits (867),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 162/190 (85%), Positives = 177/190 (93%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTIQDGD H++WVSCVRFSPSTLQPTIVS SWDRTVKVWNL+NCKLR+TLAGH GYV
Sbjct  35   ECKYTIQDGDAHSDWVSCVRFSPSTLQPTIVSASWDRTVKVWNLTNCKLRNTLAGHNGYV  94

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTVAVSPDGSLCASGGKDGVILLWDLAEGK+LYSLDAGSIIHALCFSPNRYWLCAATE S
Sbjct  95   NTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDAGSIIHALCFSPNRYWLCAATEQS  154

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            IKIWDLESKSIV DL+VDLK E++ ++ G N A K K+I+CTSL+W+ADGSTLFSGYTDG
Sbjct  155  IKIWDLESKSIVEDLKVDLKTEADATSGGGN-ANKKKVIYCTSLNWSADGSTLFSGYTDG  213

Query  211  VIRVWGIGRY  182
            V+RVW IGRY
Sbjct  214  VVRVWAIGRY  223



>ref|NP_001233876.1| ArcA1 protein [Solanum lycopersicum]
 dbj|BAA76895.1| LeArcA1 protein [Solanum lycopersicum]
Length=326

 Score =   342 bits (876),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 163/190 (86%), Positives = 177/190 (93%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTIQ+ D H++WVSCVRFSP+ LQPTIVSGSWDRTVK+WNL+NCKLRSTLAGH+GYV
Sbjct  138  ECKYTIQEQDSHSDWVSCVRFSPNNLQPTIVSGSWDRTVKIWNLTNCKLRSTLAGHSGYV  197

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIH  CFSPNRYWLCAATE+S
Sbjct  198  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHTFCFSPNRYWLCAATESS  257

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            IKIWDLESKSIVVDL+VDLKQESEM      T +K K+I+CTSLSW+ADGSTLFSGYTDG
Sbjct  258  IKIWDLESKSIVVDLKVDLKQESEMFGTA-ATDSKTKVIYCTSLSWSADGSTLFSGYTDG  316

Query  211  VIRVWGIGRY  182
            +IRVWGIGRY
Sbjct  317  LIRVWGIGRY  326


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 49/186 (26%), Positives = 82/186 (44%), Gaps = 27/186 (15%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSN-----CKLRSTLAGHTGYVNTVAV  557
             H +WV+ +  +P      IV+ S D+++ VW+L+         R  L GH  +V  V +
Sbjct  14   AHTDWVTAIA-TPIDNSDMIVTSSRDKSIIVWSLTKDGSQYGVPRRRLTGHGHFVEDVVL  72

Query  556  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  383
            S DG    SG  DG + LWDL  G         +  + ++ FS  NR  + A+ + +IK+
Sbjct  73   SSDGMFALSGSWDGELRLWDLQAGTTARRFVGHTKDVLSVAFSVDNRQIVSASRDKTIKL  132

Query  382  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            W+   E K  +        QE +         + +  + C   S N    T+ SG  D  
Sbjct  133  WNTLGECKYTI--------QEQD---------SHSDWVSCVRFSPNNLQPTIVSGSWDRT  175

Query  208  IRVWGI  191
            +++W +
Sbjct  176  VKIWNL  181



>gb|AFK36580.1| unknown [Medicago truncatula]
Length=325

 Score =   341 bits (874),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 162/190 (85%), Positives = 179/190 (94%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTIQDGD H++WVSCVRFSPSTLQPTIVS SWDRTVKVWNL+NCKLR+TLAGH+GYV
Sbjct  137  ECKYTIQDGDAHSDWVSCVRFSPSTLQPTIVSASWDRTVKVWNLTNCKLRNTLAGHSGYV  196

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTVAVSPDGSLCASGGKDGVILLWDLAEGK+LYSLDAG IIHALCFSPNRYWLCAATE+S
Sbjct  197  NTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDAGFIIHALCFSPNRYWLCAATESS  256

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            IKIWDLESKSIV DL+VDLK E++ +A G +T  K K+I+CTSL+W+ADGSTLFSGYTDG
Sbjct  257  IKIWDLESKSIVEDLKVDLKTEAD-AAIGGDTTTKKKVIYCTSLNWSADGSTLFSGYTDG  315

Query  211  VIRVWGIGRY  182
            V+RVWGIGRY
Sbjct  316  VVRVWGIGRY  325



>gb|EPS70887.1| hypothetical protein M569_03871 [Genlisea aurea]
Length=326

 Score =   341 bits (874),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 161/190 (85%), Positives = 178/190 (94%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTIQD D H++WVSCVRFSP+T QPTIVSGSWD TVK+WNLSNCKLRSTLAGHTGYV
Sbjct  138  ECKYTIQDQDSHSDWVSCVRFSPNTQQPTIVSGSWDSTVKIWNLSNCKLRSTLAGHTGYV  197

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            N V+VSPDGSLCAS G+DGVILLWDLAEGK+LYSL+AGSI HALCFSPNRYWLCAATEAS
Sbjct  198  NAVSVSPDGSLCASAGRDGVILLWDLAEGKRLYSLEAGSITHALCFSPNRYWLCAATEAS  257

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            IKIWDLESKS+VVDL+VDLKQESE++AE    + K+K+IFCTSL+W+ADGSTLFSGYTDG
Sbjct  258  IKIWDLESKSVVVDLKVDLKQESELAAE-ETASRKHKVIFCTSLNWSADGSTLFSGYTDG  316

Query  211  VIRVWGIGRY  182
            VIRVWGIGRY
Sbjct  317  VIRVWGIGRY  326


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 49/186 (26%), Positives = 82/186 (44%), Gaps = 27/186 (15%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  557
             H  WV+ +  +P      IV+ S D+++ +W L+         R  L GH+ YV  V +
Sbjct  14   AHTNWVTAI-ATPIDNSDMIVTASRDKSIILWALTKEDRTYGVPRRRLTGHSNYVQDVVL  72

Query  556  SPDGSLCASGGKDGVILLWDLAEGK--KLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  383
            S DG    SG  DG + LWDL  G+  + ++     ++     S NR  + A+ + +IK+
Sbjct  73   SSDGQFALSGSWDGDLRLWDLQTGRSARRFAGHTKDVLSVAFSSDNRQIVSASRDKTIKL  132

Query  382  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            W+   E K  + D      Q+S            +  + C   S N    T+ SG  D  
Sbjct  133  WNTLGECKYTIQD------QDSH-----------SDWVSCVRFSPNTQQPTIVSGSWDST  175

Query  208  IRVWGI  191
            +++W +
Sbjct  176  VKIWNL  181


 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 51/184 (28%), Positives = 82/184 (45%), Gaps = 27/184 (15%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  542
            GH+ +V  V  S        +SGSWD  +++W+L   +     AGHT  V +VA S D  
Sbjct  62   GHSNYVQDVVLSSD--GQFALSGSWDGDLRLWDLQTGRSARRFAGHTKDVLSVAFSSDNR  119

Query  541  LCASGGKDGVILLWD-LAEGK-KLYSLDAGSI-IHALCFSPNRYW---LCAATEASIKIW  380
               S  +D  I LW+ L E K  +   D+ S  +  + FSPN      +  + ++++KIW
Sbjct  120  QIVSASRDKTIKLWNTLGECKYTIQDQDSHSDWVSCVRFSPNTQQPTIVSGSWDSTVKIW  179

Query  379  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRV  200
            +L           + K  S ++             +  ++S + DGS   S   DGVI +
Sbjct  180  NLS----------NCKLRSTLAGHTG---------YVNAVSVSPDGSLCASAGRDGVILL  220

Query  199  WGIG  188
            W + 
Sbjct  221  WDLA  224



>sp|O24076.1|GBLP_MEDSA RecName: Full=Guanine nucleotide-binding protein subunit beta-like 
protein [Medicago sativa]
 emb|CAA69934.1| G protein beta subunit-like [Medicago sativa subsp. x varia]
Length=325

 Score =   340 bits (873),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 162/190 (85%), Positives = 179/190 (94%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTIQDGD H++WVSCVRFSPST QPTIVS SWDRTVKVWNL+NCKLR+TLAGH+GYV
Sbjct  137  ECKYTIQDGDAHSDWVSCVRFSPSTPQPTIVSASWDRTVKVWNLTNCKLRNTLAGHSGYV  196

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTVAVSPDGSLCASGGKDGVILLWDLAEGK+LYSLDAGSIIHALCFSPNRYWLCAATE+S
Sbjct  197  NTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDAGSIIHALCFSPNRYWLCAATESS  256

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            IKIWDLESKSIV DL+VDLK E++ +A G +T  K K+I+CTSL+W+ADGSTLFSGYTDG
Sbjct  257  IKIWDLESKSIVEDLKVDLKTEAD-AAIGGDTTTKKKVIYCTSLNWSADGSTLFSGYTDG  315

Query  211  VIRVWGIGRY  182
            V+RVWGIGRY
Sbjct  316  VVRVWGIGRY  325



>gb|ACR77528.1| heterotrimeric G protein beta 1 subunit [Nicotiana benthamiana]
Length=326

 Score =   340 bits (873),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 159/190 (84%), Positives = 180/190 (95%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECK+ IQDGD H++WVSCVRFSP+ +QPTIVSGSWDRTVK+WNL+NCKLR+TLAGHTGYV
Sbjct  138  ECKFIIQDGDSHSDWVSCVRFSPNNIQPTIVSGSWDRTVKIWNLTNCKLRATLAGHTGYV  197

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NT AVSP+GSLCASGGKDGVILLWDLAEGKKLYSL++GSIIH+LCFSPNRYWLCAATE+S
Sbjct  198  NTTAVSPEGSLCASGGKDGVILLWDLAEGKKLYSLESGSIIHSLCFSPNRYWLCAATESS  257

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            IKIWDLESK+IV DL+VDLKQE+EMSAEG   + KNK+I+CTSL W+ADGSTLFSGYTDG
Sbjct  258  IKIWDLESKTIVDDLKVDLKQETEMSAEG-TASGKNKVIYCTSLGWSADGSTLFSGYTDG  316

Query  211  VIRVWGIGRY  182
            +IRVWGIGRY
Sbjct  317  LIRVWGIGRY  326


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 46/185 (25%), Positives = 80/185 (43%), Gaps = 27/185 (15%)
 Frame = -1

Query  718  HNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSN-----CKLRSTLAGHTGYVNTVAVS  554
            H +WV+ +  +P      IV+ S D+++ VW+++         R  L GH  +V  V +S
Sbjct  15   HTDWVTAIA-TPVDNSDMIVTSSRDKSIIVWSITKDGPLYGVPRRRLTGHGHFVQDVVLS  73

Query  553  PDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIW  380
             DG    SG  DG + LWDL  G   + +      ++     + NR  + A+ + SI++W
Sbjct  74   SDGMFALSGSWDGELRLWDLQAGTTARRFVGHTKDVLSVAFSADNRQIVSASRDKSIRLW  133

Query  379  DL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVI  206
            +   E K I+ D                   + +  + C   S N    T+ SG  D  +
Sbjct  134  NTLGECKFIIQD-----------------GDSHSDWVSCVRFSPNNIQPTIVSGSWDRTV  176

Query  205  RVWGI  191
            ++W +
Sbjct  177  KIWNL  181



>gb|KHN00175.1| Guanine nucleotide-binding protein subunit beta-like protein 
[Glycine soja]
Length=223

 Score =   336 bits (862),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 161/190 (85%), Positives = 176/190 (93%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTIQDGD H++WVSCVRFSPSTLQPTIVS SWDRTVKVWNL+NCKLR+TLAGH GYV
Sbjct  35   ECKYTIQDGDAHSDWVSCVRFSPSTLQPTIVSASWDRTVKVWNLTNCKLRNTLAGHNGYV  94

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTVAVSPDGSLCASGGKDGVILLWDLAEGK+LYSLDAGSIIHALCFSPNRYWLCAATE S
Sbjct  95   NTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDAGSIIHALCFSPNRYWLCAATEQS  154

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            IKIWDLESKSIV DL+VDLK E++ +  G N   K K+I+CTSL+W++DGSTLFSGYTDG
Sbjct  155  IKIWDLESKSIVEDLKVDLKTEADATTGGGN-PNKKKVIYCTSLNWSSDGSTLFSGYTDG  213

Query  211  VIRVWGIGRY  182
            V+RVWGIGRY
Sbjct  214  VVRVWGIGRY  223



>emb|CDO98381.1| unnamed protein product [Coffea canephora]
Length=1395

 Score =   365 bits (936),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 172/193 (89%), Positives = 182/193 (94%), Gaps = 3/193 (2%)
 Frame = -1

Query  751   ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
             ECKYTIQD DGH +WVSCVRFSP+ LQPTIVSGSWDRTVK+WNLSNCK+R+TLAGHTGYV
Sbjct  1203  ECKYTIQDADGHTDWVSCVRFSPNNLQPTIVSGSWDRTVKIWNLSNCKMRATLAGHTGYV  1262

Query  571   NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
             NT AVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS
Sbjct  1263  NTAAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  1322

Query  391   IKIWDLESKSIVVDLRVDLKQESEMSAEG---NNTAAKNKIIFCTSLSWNADGSTLFSGY  221
             IKIWDLESKSIVVDLRVDLKQESEM+AEG     T AKNK+I+CTSL+W+ADGSTLFSGY
Sbjct  1323  IKIWDLESKSIVVDLRVDLKQESEMAAEGTTVQTTGAKNKVIYCTSLNWSADGSTLFSGY  1382

Query  220   TDGVIRVWGIGRY  182
             TDGVIRVWGI RY
Sbjct  1383  TDGVIRVWGIMRY  1395


 Score = 57.8 bits (138),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 53/208 (25%), Positives = 90/208 (43%), Gaps = 32/208 (15%)
 Frame = -1

Query  721   GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  557
              H +WV+ +  +P      IV+ S D+++ +W+L+         R  L GH+ +V  V +
Sbjct  1079  AHTDWVTAI-ATPIDNTDMIVTSSRDKSIILWSLTKEDKTYGVPRRRLTGHSHFVQDVVL  1137

Query  556   SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  383
             S DG    SG  DG + LWDL  G         +  + ++ FS  NR  + A+ + +IK+
Sbjct  1138  SSDGQFALSGSWDGELRLWDLQSGTTARRFVGHTKDVLSVAFSIDNRQIVSASRDKTIKL  1197

Query  382   WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
             W+   E K  + D            A+G+        + C   S N    T+ SG  D  
Sbjct  1198  WNTLGECKYTIQD------------ADGH-----TDWVSCVRFSPNNLQPTIVSGSWDRT  1240

Query  208   IRVWGIGRY*MEEFRRSHMIIGHVCYLS  125
             +++W +    M        + GH  Y++
Sbjct  1241  VKIWNLSNCKMRA-----TLAGHTGYVN  1263



>gb|KJB37175.1| hypothetical protein B456_006G192600 [Gossypium raimondii]
Length=327

 Score =   339 bits (870),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 160/190 (84%), Positives = 178/190 (94%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTIQ+GD H +WVSCVRFSP+TLQPTIVS SWD+TVKVWNL+NCK+R+TLAGHTGYV
Sbjct  139  ECKYTIQEGDAHTDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLTNCKIRNTLAGHTGYV  198

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+AG++IH+LCFSPNRYWLCAATE S
Sbjct  199  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAGAVIHSLCFSPNRYWLCAATEQS  258

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            IKIWDLESKSIV DL+VDLK E+E SA  +N A K K+I+CTSL+W+ADGSTLFSGYTDG
Sbjct  259  IKIWDLESKSIVEDLKVDLKAEAETSAATDN-ANKKKVIYCTSLNWSADGSTLFSGYTDG  317

Query  211  VIRVWGIGRY  182
            VIRVWGIGRY
Sbjct  318  VIRVWGIGRY  327


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 53/187 (28%), Positives = 84/187 (45%), Gaps = 31/187 (17%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  542
            GH+ +V  V  S  +     +SGSWD  +++W+LS         GHT  V +VA S D  
Sbjct  63   GHSHFVQDVVLSSDS--QFALSGSWDGELRLWDLSAGTSARRFVGHTKDVLSVAFSIDNR  120

Query  541  LCASGGKDGVILLWD-LAEGKKLYSLDAGSI----IHALCFSPNRYW---LCAATEASIK  386
               S  +D  I LW+ L E K  Y++  G      +  + FSPN      + A+ + ++K
Sbjct  121  QIVSASRDRTIKLWNTLGECK--YTIQEGDAHTDWVSCVRFSPNTLQPTIVSASWDKTVK  178

Query  385  IWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVI  206
            +W+L +  I                   NT A +   +  +++ + DGS   SG  DGVI
Sbjct  179  VWNLTNCKI------------------RNTLAGH-TGYVNTVAVSPDGSLCASGGKDGVI  219

Query  205  RVWGIGR  185
             +W +  
Sbjct  220  LLWDLAE  226


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 49/206 (24%), Positives = 88/206 (43%), Gaps = 28/206 (14%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  557
             H + V+ +  +P      IV+ S D+++ +W+L+  +      R  L GH+ +V  V +
Sbjct  15   AHTDMVTAIA-TPIDNSDMIVTSSRDKSIILWHLTKDEKTYGVARRRLTGHSHFVQDVVL  73

Query  556  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  383
            S D     SG  DG + LWDL+ G         +  + ++ FS  NR  + A+ + +IK+
Sbjct  74   SSDSQFALSGSWDGELRLWDLSAGTSARRFVGHTKDVLSVAFSIDNRQIVSASRDRTIKL  133

Query  382  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  203
            W+             L +      EG+   A    + C   S N    T+ S   D  ++
Sbjct  134  WNT------------LGECKYTIQEGD---AHTDWVSCVRFSPNTLQPTIVSASWDKTVK  178

Query  202  VWGIGRY*MEEFRRSHMIIGHVCYLS  125
            VW      +   +  + + GH  Y++
Sbjct  179  VWN-----LTNCKIRNTLAGHTGYVN  199



>gb|KHG00880.1| Guanine nucleotide-binding protein subunit beta-like protein 
[Gossypium arboreum]
Length=327

 Score =   339 bits (869),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 159/190 (84%), Positives = 178/190 (94%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTIQ+GD H +WVSCVRFSP+TLQPTIVS SWD+TVKVWNL+NCK+R+TLAGHTGYV
Sbjct  139  ECKYTIQEGDAHTDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLTNCKIRNTLAGHTGYV  198

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+AG++IH+LCFSPNRYWLCAATE S
Sbjct  199  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAGAVIHSLCFSPNRYWLCAATEQS  258

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            IKIWDLESKS+V DL+VDLK E+E SA  +N A K K+I+CTSL+W+ADGSTLFSGYTDG
Sbjct  259  IKIWDLESKSVVEDLKVDLKAEAETSAATDN-ANKKKVIYCTSLNWSADGSTLFSGYTDG  317

Query  211  VIRVWGIGRY  182
            VIRVWGIGRY
Sbjct  318  VIRVWGIGRY  327


 Score = 52.8 bits (125),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 53/187 (28%), Positives = 84/187 (45%), Gaps = 31/187 (17%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  542
            GH+ +V  V  S  +     +SGSWD  +++W+LS         GHT  V +VA S D  
Sbjct  63   GHSHFVQDVVLSSDS--QFALSGSWDGELRLWDLSAGTSARRFVGHTKDVLSVAFSIDNR  120

Query  541  LCASGGKDGVILLWD-LAEGKKLYSLDAGSI----IHALCFSPNRYW---LCAATEASIK  386
               S  +D  I LW+ L E K  Y++  G      +  + FSPN      + A+ + ++K
Sbjct  121  QIVSASRDRTIKLWNTLGECK--YTIQEGDAHTDWVSCVRFSPNTLQPTIVSASWDKTVK  178

Query  385  IWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVI  206
            +W+L +  I                   NT A +   +  +++ + DGS   SG  DGVI
Sbjct  179  VWNLTNCKI------------------RNTLAGH-TGYVNTVAVSPDGSLCASGGKDGVI  219

Query  205  RVWGIGR  185
             +W +  
Sbjct  220  LLWDLAE  226


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 49/206 (24%), Positives = 88/206 (43%), Gaps = 28/206 (14%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  557
             H + V+ +  +P      IV+ S D+++ +W+L+  +      R  L GH+ +V  V +
Sbjct  15   AHTDMVTAIA-TPIDNSDMIVTSSRDKSIILWHLTKDEKTYGVARRRLTGHSHFVQDVVL  73

Query  556  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  383
            S D     SG  DG + LWDL+ G         +  + ++ FS  NR  + A+ + +IK+
Sbjct  74   SSDSQFALSGSWDGELRLWDLSAGTSARRFVGHTKDVLSVAFSIDNRQIVSASRDRTIKL  133

Query  382  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  203
            W+             L +      EG+   A    + C   S N    T+ S   D  ++
Sbjct  134  WNT------------LGECKYTIQEGD---AHTDWVSCVRFSPNTLQPTIVSASWDKTVK  178

Query  202  VWGIGRY*MEEFRRSHMIIGHVCYLS  125
            VW      +   +  + + GH  Y++
Sbjct  179  VWN-----LTNCKIRNTLAGHTGYVN  199



>ref|XP_004299548.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Fragaria vesca subsp. vesca]
Length=326

 Score =   338 bits (868),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 161/190 (85%), Positives = 176/190 (93%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTIQ+ DGHN+WVSCVRFSP+TLQPTIVS SWDRTVKVWNL+NCKLR+TL GH GYV
Sbjct  138  ECKYTIQEQDGHNDWVSCVRFSPNTLQPTIVSASWDRTVKVWNLTNCKLRNTLEGHNGYV  197

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTVAVSPDGSLCASGGKDGVILLWDLAEGK+LYSLDAG+IIHALCFSPNRYWLCAATE S
Sbjct  198  NTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDAGAIIHALCFSPNRYWLCAATEQS  257

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            IKIWDLESKSIV DL+VDLK E+E + E   TA K K+I+CTSL+W+ADGSTLFSGYTDG
Sbjct  258  IKIWDLESKSIVEDLKVDLKTEAEKTKE-TGTANKKKVIYCTSLNWSADGSTLFSGYTDG  316

Query  211  VIRVWGIGRY  182
            VIRVWGIGR+
Sbjct  317  VIRVWGIGRF  326


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 48/186 (26%), Positives = 79/186 (42%), Gaps = 27/186 (15%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  557
             H + V+ +   P      IVS S D+++ +W L+  +      R  L GH+ +V  V +
Sbjct  14   AHTDMVTAIAI-PIDNSEMIVSASRDKSIILWQLNKDENSYGVPRRRLTGHSHFVQDVVL  72

Query  556  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  383
            S DG    SG  DG + LWDLA+G   + +      ++       NR  + A+ + +IK+
Sbjct  73   SSDGQFALSGSWDGELRLWDLAQGVSARRFVGHTKDVLSVAFSIDNRQIVSASRDRTIKL  132

Query  382  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            W+   E K  +        QE +           N  + C   S N    T+ S   D  
Sbjct  133  WNTLGECKYTI--------QEQD---------GHNDWVSCVRFSPNTLQPTIVSASWDRT  175

Query  208  IRVWGI  191
            ++VW +
Sbjct  176  VKVWNL  181



>gb|KJB53022.1| hypothetical protein B456_008G288800 [Gossypium raimondii]
Length=326

 Score =   338 bits (867),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 161/190 (85%), Positives = 177/190 (93%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTIQDGD H +WVSCVRFSP+TLQPTIVS SWD+TVKVWNL+NCK+R+TLAGH+GYV
Sbjct  138  ECKYTIQDGDAHTDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLTNCKIRNTLAGHSGYV  197

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGS+IH+LCFSPNRYWLCAATE S
Sbjct  198  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSVIHSLCFSPNRYWLCAATEQS  257

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            IKIWDLESKSIV DL+VDLK E+E S   +N A K K+I+CTSL+W+ADGSTLFSGYTDG
Sbjct  258  IKIWDLESKSIVEDLKVDLKAEAEKSDVTDN-ANKKKVIYCTSLNWSADGSTLFSGYTDG  316

Query  211  VIRVWGIGRY  182
            VIRVWGIGRY
Sbjct  317  VIRVWGIGRY  326


 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 52/187 (28%), Positives = 84/187 (45%), Gaps = 31/187 (17%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  542
            GH+ +V  V  S  +     +SGSWD  +++W+L+         GHT  V +VA S D  
Sbjct  62   GHSHFVQDVVLSFDS--QFALSGSWDGELRLWDLNAGTSARRFVGHTKDVLSVAFSIDNR  119

Query  541  LCASGGKDGVILLWD-LAEGKKLYSLDAGSI----IHALCFSPNRYW---LCAATEASIK  386
               S  +D  I LW+ L E K  Y++  G      +  + FSPN      + A+ + ++K
Sbjct  120  QIVSASRDRSIKLWNTLGECK--YTIQDGDAHTDWVSCVRFSPNTLQPTIVSASWDKTVK  177

Query  385  IWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVI  206
            +W+L +  I                   NT A +   +  +++ + DGS   SG  DGVI
Sbjct  178  VWNLTNCKI------------------RNTLAGHS-GYVNTVAVSPDGSLCASGGKDGVI  218

Query  205  RVWGIGR  185
             +W +  
Sbjct  219  LLWDLAE  225



>ref|NP_001241455.1| uncharacterized protein LOC100778205 [Glycine max]
 gb|ACU23023.1| unknown [Glycine max]
Length=325

 Score =   338 bits (867),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 161/190 (85%), Positives = 176/190 (93%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTIQDGD H++WVSCVRFSPSTLQPTIVS SWDRTVKVWNL+NCKLR+TLAGH GYV
Sbjct  137  ECKYTIQDGDAHSDWVSCVRFSPSTLQPTIVSASWDRTVKVWNLTNCKLRNTLAGHNGYV  196

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTVAVSPDGSLCASGGKDGVILLWDLAEGK+LYSLDAGSIIHALCFSPNRYWLCAATE S
Sbjct  197  NTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDAGSIIHALCFSPNRYWLCAATEQS  256

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            IKIWDLESKSIV DL+VDLK E++ +  G N   K K+I+CTSL+W++DGSTLFSGYTDG
Sbjct  257  IKIWDLESKSIVEDLKVDLKTEADATTGGGN-PNKKKVIYCTSLNWSSDGSTLFSGYTDG  315

Query  211  VIRVWGIGRY  182
            V+RVWGIGRY
Sbjct  316  VVRVWGIGRY  325


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 54/212 (25%), Positives = 92/212 (43%), Gaps = 35/212 (17%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  557
             H + V+ +  +P      IV+ S D+++ +W+L+         R  L GH+ +V  V +
Sbjct  13   AHTDVVTAIA-TPIDNSDMIVTASRDKSIILWHLTKEDKTYGVPRRRLTGHSHFVQDVVL  71

Query  556  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  383
            S DG    SG  DG + LWDLA G         +  + ++ FS  NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLAAGTSARRFVGHTKDVLSVAFSIDNRQIVSASRDRTIKL  131

Query  382  WDL--ESKSIVVD------------LRVDLKQESEMSAEGNNTAA---------KNKII-  275
            W+   E K  + D                  Q + +SA  + T           +N +  
Sbjct  132  WNTLGECKYTIQDGDAHSDWVSCVRFSPSTLQPTIVSASWDRTVKVWNLTNCKLRNTLAG  191

Query  274  ---FCTSLSWNADGSTLFSGYTDGVIRVWGIG  188
               +  +++ + DGS   SG  DGVI +W + 
Sbjct  192  HNGYVNTVAVSPDGSLCASGGKDGVILLWDLA  223



>ref|XP_002529557.1| receptor for activated protein kinase C, putative [Ricinus communis]
 gb|EEF32826.1| receptor for activated protein kinase C, putative [Ricinus communis]
Length=328

 Score =   337 bits (865),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 163/192 (85%), Positives = 176/192 (92%), Gaps = 2/192 (1%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTIQDGD HN+WVSCVRFSP+TLQPTIVS SWDRTVKVWNL+NCKLR TLAGH GYV
Sbjct  137  ECKYTIQDGDAHNDWVSCVRFSPNTLQPTIVSASWDRTVKVWNLTNCKLRCTLAGHGGYV  196

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTVAVSPDGSLCASGGKDGVILLWDLAEGK+LY+LDAG++IHALCFSPNRYWLCAATE S
Sbjct  197  NTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYNLDAGAVIHALCFSPNRYWLCAATENS  256

Query  391  IKIWDLESKSIVVDLRVDLKQESEMS--AEGNNTAAKNKIIFCTSLSWNADGSTLFSGYT  218
            IKIWDLESKSIV DL+VDLK E+E S  +   +T AK K I+CTSLSWNADGSTLFSGYT
Sbjct  257  IKIWDLESKSIVEDLKVDLKAEAEKSDGSTVASTGAKKKNIYCTSLSWNADGSTLFSGYT  316

Query  217  DGVIRVWGIGRY  182
            DGVIRVWGIGR+
Sbjct  317  DGVIRVWGIGRF  328


 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 46/186 (25%), Positives = 76/186 (41%), Gaps = 27/186 (15%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  557
             H + V+ +  +P      IV+ S D+++ +W L   +         L GH+ +V  V +
Sbjct  13   AHTDQVTAIA-TPIDNSDMIVTASRDKSIILWKLIKDEKTYGVAHRRLTGHSHFVQDVVL  71

Query  556  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  383
            S DG    SG  DG + LWDLA G   + +      ++       NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLAAGVSARRFVGHTKDVLSVAFSIDNRQIVSASRDRTIKL  131

Query  382  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            W+   E K  + D                   A N  + C   S N    T+ S   D  
Sbjct  132  WNTLGECKYTIQD-----------------GDAHNDWVSCVRFSPNTLQPTIVSASWDRT  174

Query  208  IRVWGI  191
            ++VW +
Sbjct  175  VKVWNL  180



>ref|NP_001235369.1| guanine nucleotide-binding protein subunit beta-like protein 
[Glycine max]
 sp|Q39836.1|GBLP_SOYBN RecName: Full=Guanine nucleotide-binding protein subunit beta-like 
protein [Glycine max]
 gb|AAB05941.1| G beta-like protein [Glycine max]
Length=325

 Score =   337 bits (863),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 161/190 (85%), Positives = 176/190 (93%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTIQDGD H++WVSCVRFSPSTLQPTIVS SWDRTVKVWNL+NCKLR+TLAGH GYV
Sbjct  137  ECKYTIQDGDAHSDWVSCVRFSPSTLQPTIVSASWDRTVKVWNLTNCKLRNTLAGHNGYV  196

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTVAVSPDGSLCASGGKDGVILLWDLAEGK+LYSLDAGSIIHALCFSP+RYWLCAATE S
Sbjct  197  NTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDAGSIIHALCFSPSRYWLCAATEQS  256

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            IKIWDLESKSIV DL+VDLK E++ ++ G N A K K+I+CTSL+W+ADGSTLFSGYTDG
Sbjct  257  IKIWDLESKSIVEDLKVDLKTEADATSGGGN-ANKKKVIYCTSLNWSADGSTLFSGYTDG  315

Query  211  VIRVWGIGRY  182
            V RVW IGRY
Sbjct  316  VARVWAIGRY  325


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 55/212 (26%), Positives = 92/212 (43%), Gaps = 35/212 (17%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  557
             H + V+ +  +P      IV+ S DR++ +W+L+         R  L GH+ +V  V +
Sbjct  13   AHTDVVTAIA-TPIDNSDMIVTASRDRSIILWHLTKEDKTYGVPRRRLTGHSHFVQDVVL  71

Query  556  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  383
            S DG    SG  DG + LWDLA G         +  + ++ FS  NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLAAGTSARRFVGHTKDVLSVAFSIDNRQIVSASRDRTIKL  131

Query  382  WDL--ESKSIVVD------------LRVDLKQESEMSAEGNNTAA---------KNKII-  275
            W+   E K  + D                  Q + +SA  + T           +N +  
Sbjct  132  WNTLGECKYTIQDGDAHSDWVSCVRFSPSTLQPTIVSASWDRTVKVWNLTNCKLRNTLAG  191

Query  274  ---FCTSLSWNADGSTLFSGYTDGVIRVWGIG  188
               +  +++ + DGS   SG  DGVI +W + 
Sbjct  192  HNGYVNTVAVSPDGSLCASGGKDGVILLWDLA  223



>gb|KHG17882.1| Guanine nucleotide-binding protein subunit beta-like protein 
[Gossypium arboreum]
Length=326

 Score =   337 bits (863),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 160/190 (84%), Positives = 176/190 (93%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTIQDGD H +WVSCVRFSP+ LQPTIVS SWD+TVKVWNL+NCK+R+TLAGH+GYV
Sbjct  138  ECKYTIQDGDAHTDWVSCVRFSPNNLQPTIVSASWDKTVKVWNLTNCKIRNTLAGHSGYV  197

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGS+IH+LCFSPNRYWLCAATE S
Sbjct  198  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSVIHSLCFSPNRYWLCAATEQS  257

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            IKIWDLESKSIV DL+VDLK E+E S   +N A K K+I+CTSL+W+ADGSTLFSGYTDG
Sbjct  258  IKIWDLESKSIVEDLKVDLKAEAEKSDVTDN-ANKKKVIYCTSLNWSADGSTLFSGYTDG  316

Query  211  VIRVWGIGRY  182
            VIRVWGIGRY
Sbjct  317  VIRVWGIGRY  326


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 52/187 (28%), Positives = 84/187 (45%), Gaps = 31/187 (17%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  542
            GH+ +V  V  S  +     +SGSWD  +++W+L+         GHT  V +VA S D  
Sbjct  62   GHSHFVQDVVLSSDS--QFALSGSWDGELRLWDLNAGTSARRFVGHTKDVLSVAFSIDNR  119

Query  541  LCASGGKDGVILLWD-LAEGKKLYSLDAGSI----IHALCFSPNRYW---LCAATEASIK  386
               S  +D  I LW+ L E K  Y++  G      +  + FSPN      + A+ + ++K
Sbjct  120  QIVSASRDRSIKLWNTLGECK--YTIQDGDAHTDWVSCVRFSPNNLQPTIVSASWDKTVK  177

Query  385  IWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVI  206
            +W+L +  I                   NT A +   +  +++ + DGS   SG  DGVI
Sbjct  178  VWNLTNCKI------------------RNTLAGHS-GYVNTVAVSPDGSLCASGGKDGVI  218

Query  205  RVWGIGR  185
             +W +  
Sbjct  219  LLWDLAE  225



>gb|ACJ24167.1| Rack [Phaseolus vulgaris]
Length=324

 Score =   336 bits (862),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 160/190 (84%), Positives = 175/190 (92%), Gaps = 2/190 (1%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTIQD D H++WVSCVRFSPSTLQPTIVS SWDRTVKVWNL+NCKLR+TLAGH+GYV
Sbjct  137  ECKYTIQDSDAHSDWVSCVRFSPSTLQPTIVSASWDRTVKVWNLTNCKLRNTLAGHSGYV  196

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTVAVSPDGSLCASGGKDGVILLWDLAEGK+LYSLDAGSIIHALCFSPNRYWLCAATE S
Sbjct  197  NTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDAGSIIHALCFSPNRYWLCAATEQS  256

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            IKIWDLESKSIV DL+VDLK E++ +  GN    K K+I+CTSL+W+ADGSTLFSGYTDG
Sbjct  257  IKIWDLESKSIVEDLKVDLKTEADGTTGGNTN--KKKVIYCTSLNWSADGSTLFSGYTDG  314

Query  211  VIRVWGIGRY  182
            V+RVW IGRY
Sbjct  315  VVRVWAIGRY  324


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 54/212 (25%), Positives = 91/212 (43%), Gaps = 35/212 (17%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  557
             H + V+ +  +P      IV+ S D+++ +W L+         R  L GH+ +V  V +
Sbjct  13   AHTDVVTAIA-TPIDNSDMIVTASRDKSIILWQLTKEDKTYGVPRRRLTGHSHFVQDVVL  71

Query  556  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  383
            S DG    SG  DG + LWDLA G         +  + ++ FS  NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLAAGTSARRFVGHTKDVLSVAFSIDNRQIVSASRDRTIKL  131

Query  382  WDL--ESKSIVVD------------LRVDLKQESEMSAEGNNTAA---------KNKII-  275
            W+   E K  + D                  Q + +SA  + T           +N +  
Sbjct  132  WNTLGECKYTIQDSDAHSDWVSCVRFSPSTLQPTIVSASWDRTVKVWNLTNCKLRNTLAG  191

Query  274  ---FCTSLSWNADGSTLFSGYTDGVIRVWGIG  188
               +  +++ + DGS   SG  DGVI +W + 
Sbjct  192  HSGYVNTVAVSPDGSLCASGGKDGVILLWDLA  223



>ref|XP_008453452.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Cucumis melo]
Length=327

 Score =   336 bits (862),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 161/191 (84%), Positives = 177/191 (93%), Gaps = 1/191 (1%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTIQDGD H++WVSCVRFSP+TLQPTIVS SWD+TVKVWNL+NCKLR TLAGH GYV
Sbjct  137  ECKYTIQDGDAHSDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLTNCKLRVTLAGHAGYV  196

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTVAVSPDGSLCASGGKDGVILLWDLAEGK+LYSLDAGSIIHALCFSPNRYWLCAATE+S
Sbjct  197  NTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDAGSIIHALCFSPNRYWLCAATESS  256

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGN-NTAAKNKIIFCTSLSWNADGSTLFSGYTD  215
            IKIWDLESKSIV DL+VDLK E+E + + +  TA K K+I+CTSLSW+ADGSTLF GYTD
Sbjct  257  IKIWDLESKSIVEDLKVDLKTEAEKTDDTHAATANKIKVIYCTSLSWSADGSTLFGGYTD  316

Query  214  GVIRVWGIGRY  182
            GV+RVWGIGRY
Sbjct  317  GVVRVWGIGRY  327


 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 46/186 (25%), Positives = 81/186 (44%), Gaps = 27/186 (15%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  557
             H + V+ +  +P      IV+ S D+++ +W L+  +      +  L GH+ +V  V +
Sbjct  13   AHTDMVTAIA-TPIDNSDMIVTSSRDKSIILWRLTKEEKTYGVPQRRLNGHSHFVQDVVL  71

Query  556  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  383
            S DG    SG  DG + LWDLA G   + +   +  ++       NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLATGLTSRRFVGHSKDVLSVAFSIDNRQIVSASRDRTIKL  131

Query  382  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            W+   E K  + D              G+   A +  + C   S N    T+ S   D  
Sbjct  132  WNTLGECKYTIQD--------------GD---AHSDWVSCVRFSPNTLQPTIVSASWDKT  174

Query  208  IRVWGI  191
            ++VW +
Sbjct  175  VKVWNL  180



>ref|XP_004137327.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein-like [Cucumis sativus]
 ref|XP_004160431.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein-like [Cucumis sativus]
 gb|KGN63851.1| hypothetical protein Csa_1G024830 [Cucumis sativus]
Length=327

 Score =   336 bits (862),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 161/191 (84%), Positives = 177/191 (93%), Gaps = 1/191 (1%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTIQDGD H++WVSCVRFSP+TLQPTIVS SWD+TVKVWNL+NCKLR TLAGH GYV
Sbjct  137  ECKYTIQDGDAHSDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLTNCKLRVTLAGHAGYV  196

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTVAVSPDGSLCASGGKDGVILLWDLAEGK+LYSLDAGSIIHALCFSPNRYWLCAATE+S
Sbjct  197  NTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDAGSIIHALCFSPNRYWLCAATESS  256

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGN-NTAAKNKIIFCTSLSWNADGSTLFSGYTD  215
            IKIWDLESKSIV DL+VDLK E+E + + +  TA K K+I+CTSLSW+ADGSTLF GYTD
Sbjct  257  IKIWDLESKSIVEDLKVDLKTEAEKTDDTHAATANKIKVIYCTSLSWSADGSTLFGGYTD  316

Query  214  GVIRVWGIGRY  182
            GV+RVWGIGRY
Sbjct  317  GVVRVWGIGRY  327


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 51/187 (27%), Positives = 84/187 (45%), Gaps = 31/187 (17%)
 Frame = -1

Query  724  DGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDG  545
            +GH+ +V  V  S        +SGSWD  +++W+L+         GH+  V +VA S D 
Sbjct  60   NGHSHFVQDVVLSSD--GQFALSGSWDGELRLWDLATGNTSRRFVGHSKDVLSVAFSIDN  117

Query  544  SLCASGGKDGVILLWD-LAEGKKLYSLDAGSI----IHALCFSPNRYW---LCAATEASI  389
                S  +D  I LW+ L E K  Y++  G      +  + FSPN      + A+ + ++
Sbjct  118  RQIVSASRDRTIKLWNTLGECK--YTIQDGDAHSDWVSCVRFSPNTLQPTIVSASWDKTV  175

Query  388  KIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            K+W+L +      LRV L   +                +  +++ + DGS   SG  DGV
Sbjct  176  KVWNLTN----CKLRVTLAGHAG---------------YVNTVAVSPDGSLCASGGKDGV  216

Query  208  IRVWGIG  188
            I +W + 
Sbjct  217  ILLWDLA  223



>ref|XP_007160506.1| hypothetical protein PHAVU_002G327500g [Phaseolus vulgaris]
 gb|ACV72060.1| RACK1 [Phaseolus vulgaris]
 gb|ESW32500.1| hypothetical protein PHAVU_002G327500g [Phaseolus vulgaris]
Length=324

 Score =   336 bits (862),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 160/190 (84%), Positives = 175/190 (92%), Gaps = 2/190 (1%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTIQD D H++WVSCVRFSPSTLQPTIVS SWDRTVKVWNL+NCKLR+TLAGH+GYV
Sbjct  137  ECKYTIQDSDAHSDWVSCVRFSPSTLQPTIVSASWDRTVKVWNLTNCKLRNTLAGHSGYV  196

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTVAVSPDGSLCASGGKDGVILLWDLAEGK+LYSLDAGSIIHALCFSPNRYWLCAATE S
Sbjct  197  NTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDAGSIIHALCFSPNRYWLCAATEQS  256

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            IKIWDLESKSIV DL+VDLK E++ +  GN    K K+I+CTSL+W+ADGSTLFSGYTDG
Sbjct  257  IKIWDLESKSIVEDLKVDLKTEADGTTGGNTN--KKKVIYCTSLNWSADGSTLFSGYTDG  314

Query  211  VIRVWGIGRY  182
            V+RVW IGRY
Sbjct  315  VVRVWAIGRY  324


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 54/212 (25%), Positives = 91/212 (43%), Gaps = 35/212 (17%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  557
             H + V+ +  +P      IV+ S D+++ +W L+         R  L GH+ +V  V +
Sbjct  13   AHTDVVTAIA-TPIDNSDMIVTASRDKSIILWQLTKEDKTYGVPRRRLTGHSHFVQDVVL  71

Query  556  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  383
            S DG    SG  DG + LWDLA G         +  + ++ FS  NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLAAGTSARRFVGHTKDVLSVAFSIDNRQIVSASRDRTIKL  131

Query  382  WDL--ESKSIVVD------------LRVDLKQESEMSAEGNNTAA---------KNKII-  275
            W+   E K  + D                  Q + +SA  + T           +N +  
Sbjct  132  WNTLGECKYTIQDSDAHSDWVSCVRFSPSTLQPTIVSASWDRTVKVWNLTNCKLRNTLAG  191

Query  274  ---FCTSLSWNADGSTLFSGYTDGVIRVWGIG  188
               +  +++ + DGS   SG  DGVI +W + 
Sbjct  192  HSGYVNTVAVSPDGSLCASGGKDGVILLWDLA  223



>gb|KDO62873.1| hypothetical protein CISIN_1g048118mg [Citrus sinensis]
Length=303

 Score =   335 bits (860),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 162/191 (85%), Positives = 173/191 (91%), Gaps = 1/191 (1%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTIQ+GD H EWVSCVRFSP+TLQPTIVS SWDRTVKVWNLSNCKLR+TLAGHTGYV
Sbjct  113  ECKYTIQEGDAHTEWVSCVRFSPNTLQPTIVSASWDRTVKVWNLSNCKLRATLAGHTGYV  172

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTVAVSPDGSLCASGGKDGVILLWDLAEGK+LYSLDAG++IHALCFSPNRYWLCAATE S
Sbjct  173  NTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDAGAVIHALCFSPNRYWLCAATEQS  232

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAA-KNKIIFCTSLSWNADGSTLFSGYTD  215
            IKIWDLESKSIV DL+VDLK E+E S     T   K K I+CTSL+W+ DGSTLFSGYTD
Sbjct  233  IKIWDLESKSIVEDLKVDLKTEAEKSEATTATTTIKKKNIYCTSLNWSVDGSTLFSGYTD  292

Query  214  GVIRVWGIGRY  182
            GVIRVWGIGRY
Sbjct  293  GVIRVWGIGRY  303



>ref|XP_006451669.1| hypothetical protein CICLE_v10008909mg [Citrus clementina]
 ref|XP_006490737.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein-like [Citrus sinensis]
 gb|ESR64909.1| hypothetical protein CICLE_v10008909mg [Citrus clementina]
Length=327

 Score =   336 bits (862),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 163/191 (85%), Positives = 174/191 (91%), Gaps = 1/191 (1%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTIQ+GD H EWVSCVRFSP+TLQPTIVS SWDRTVKVWNLSNCKLR+TLAGHTGYV
Sbjct  137  ECKYTIQEGDAHTEWVSCVRFSPNTLQPTIVSASWDRTVKVWNLSNCKLRATLAGHTGYV  196

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTVAVSPDGSLCASGGKDGVILLWDLAEGK+LYSLDAG++IHALCFSPNRYWLCAATE S
Sbjct  197  NTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDAGAVIHALCFSPNRYWLCAATEQS  256

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAA-KNKIIFCTSLSWNADGSTLFSGYTD  215
            IKIWDLESKSIV DL+VDLK E+E S     T   K K I+CTSL+W+ADGSTLFSGYTD
Sbjct  257  IKIWDLESKSIVEDLKVDLKTEAEKSEATTATTTIKKKNIYCTSLNWSADGSTLFSGYTD  316

Query  214  GVIRVWGIGRY  182
            GVIRVWGIGRY
Sbjct  317  GVIRVWGIGRY  327


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 51/184 (28%), Positives = 84/184 (46%), Gaps = 23/184 (13%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  557
             H + V+ +  +P      IV+ S D+++ VW+L+  +      R  L GH+ +V  V +
Sbjct  13   AHTDMVTAIA-TPIDNSDMIVTASRDKSIIVWHLTKEEKTYGVARRRLTGHSHFVQDVVL  71

Query  556  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  383
            S DG    SG  DG + LWDLAEGK        +  + ++ FS  NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLAEGKSARRFVGHTKDVLSVAFSIDNRQIVSASRDRTIKL  131

Query  382  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  203
            W+             L +      EG+   A  + + C   S N    T+ S   D  ++
Sbjct  132  WNT------------LGECKYTIQEGD---AHTEWVSCVRFSPNTLQPTIVSASWDRTVK  176

Query  202  VWGI  191
            VW +
Sbjct  177  VWNL  180



>ref|XP_007036696.1| Transducin/WD40 repeat-like superfamily protein [Theobroma cacao]
 gb|EOY21197.1| Transducin/WD40 repeat-like superfamily protein [Theobroma cacao]
Length=327

 Score =   334 bits (857),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 157/190 (83%), Positives = 177/190 (93%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTIQDG+ H +WVSCVRFSP+TLQPTIVS SWD+TVKVWNL+NCK+R+TL GH+GYV
Sbjct  139  ECKYTIQDGEAHTDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLTNCKIRNTLTGHSGYV  198

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG++IH+LCFSPNRYWLCAATE S
Sbjct  199  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGAVIHSLCFSPNRYWLCAATEQS  258

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            IKIWDLESKSIV DL+VDLK E+E S +  +TA K K+I+CTSL+W+ADGSTLFSGYTDG
Sbjct  259  IKIWDLESKSIVEDLKVDLKAEAEKS-DVTDTANKKKVIYCTSLNWSADGSTLFSGYTDG  317

Query  211  VIRVWGIGRY  182
            VIRVWGIGR+
Sbjct  318  VIRVWGIGRF  327


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 52/187 (28%), Positives = 83/187 (44%), Gaps = 31/187 (17%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  542
            GH+ +V  V  S  +     +SGSWD  +++W+L+         GHT  V +VA S D  
Sbjct  63   GHSHFVQDVVLSSDS--QFALSGSWDGELRLWDLNAGTSARRFVGHTKDVLSVAFSIDNR  120

Query  541  LCASGGKDGVILLWD-LAEGKKLYSLDAGSI----IHALCFSPNRYW---LCAATEASIK  386
               S  +D  I LW+ L E K  Y++  G      +  + FSPN      + A+ + ++K
Sbjct  121  QIVSASRDRTIKLWNTLGECK--YTIQDGEAHTDWVSCVRFSPNTLQPTIVSASWDKTVK  178

Query  385  IWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVI  206
            +W+L +  I    R  L   S                +  +++ + DGS   SG  DGVI
Sbjct  179  VWNLTNCKI----RNTLTGHSG---------------YVNTVAVSPDGSLCASGGKDGVI  219

Query  205  RVWGIGR  185
             +W +  
Sbjct  220  LLWDLAE  226



>gb|KFK43977.1| guanine nucleotide-binding protein subunit beta-like protein 
[Arabis alpina]
Length=327

 Score =   333 bits (853),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 159/191 (83%), Positives = 174/191 (91%), Gaps = 1/191 (1%)
 Frame = -1

Query  751  ECKYTIQDG-DGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  575
            ECKYTIQ+G +GH EWVSCVRFSP+TLQPTIVS SWD+TVKVWNLSNCKLRSTLAGHTGY
Sbjct  137  ECKYTIQEGGEGHTEWVSCVRFSPNTLQPTIVSASWDKTVKVWNLSNCKLRSTLAGHTGY  196

Query  574  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  395
            V+TVAVSPDGSLCASGGKDGV+LLWDLAEGKKLYSL+A S+IHALCFSPNRYWLCAATE 
Sbjct  197  VSTVAVSPDGSLCASGGKDGVVLLWDLAEGKKLYSLEANSVIHALCFSPNRYWLCAATEQ  256

Query  394  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  215
             IKIWDLESKSIV DL+VDLK E+E S      A K K+I+CTSL+W+ADGSTLFSGYTD
Sbjct  257  GIKIWDLESKSIVEDLKVDLKAEAEKSDGSGTAATKKKVIYCTSLNWSADGSTLFSGYTD  316

Query  214  GVIRVWGIGRY  182
            GVIRVWGIGR+
Sbjct  317  GVIRVWGIGRF  327


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 52/209 (25%), Positives = 88/209 (42%), Gaps = 33/209 (16%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  557
             H + V+ +  +P      IVS S D+++ +W L+         +  L GH+ +V  V +
Sbjct  13   AHTDMVTAIA-TPIDNADIIVSASRDKSIILWKLTKDDKAYGVAQRRLTGHSHFVEDVVL  71

Query  556  SPDGSLCASGGKDGVILLWDLAEGKKL-----YSLDAGSIIHALCFSPNRYWLCAATEAS  392
            S DG    SG  DG + LWDLA G        ++ D  S+  +L    NR  + A+ + +
Sbjct  72   SSDGQFALSGSWDGELRLWDLAAGVSTRRFVGHTKDVLSVAFSL---DNRQIVSASRDRT  128

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            IK+W+            + K   +   EG+      + + C   S N    T+ S   D 
Sbjct  129  IKLWNTLG---------ECKYTIQEGGEGH-----TEWVSCVRFSPNTLQPTIVSASWDK  174

Query  211  VIRVWGIGRY*MEEFRRSHMIIGHVCYLS  125
             ++VW      +   +    + GH  Y+S
Sbjct  175  TVKVWN-----LSNCKLRSTLAGHTGYVS  198



>ref|XP_010032559.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Eucalyptus grandis]
 gb|KCW83972.1| hypothetical protein EUGRSUZ_B00856 [Eucalyptus grandis]
Length=327

 Score =   332 bits (852),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 158/191 (83%), Positives = 175/191 (92%), Gaps = 1/191 (1%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTIQ+G+ HN+WVSCVRFSP+TLQPTIVS SWDRTVKVWNL+NCKLR+TL GH+GYV
Sbjct  137  ECKYTIQEGEAHNDWVSCVRFSPNTLQPTIVSASWDRTVKVWNLTNCKLRNTLQGHSGYV  196

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+AG+IIH+LCFSPNRYWLCAATE S
Sbjct  197  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAGAIIHSLCFSPNRYWLCAATENS  256

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKN-KIIFCTSLSWNADGSTLFSGYTD  215
            IKIWDLESKSIV DLRVDLK E++MS       + N K+I+CTSL+W+ADGSTLFSGY D
Sbjct  257  IKIWDLESKSIVEDLRVDLKNEADMSDGTTGAMSSNKKVIYCTSLNWSADGSTLFSGYND  316

Query  214  GVIRVWGIGRY  182
            GVIRVWGIGRY
Sbjct  317  GVIRVWGIGRY  327


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 49/186 (26%), Positives = 79/186 (42%), Gaps = 27/186 (15%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  557
             H + V+ +   P      IV+ S D+++ +W+L+         R  L GH+ +V  V +
Sbjct  13   AHTDMVTAIAV-PIDNADMIVTSSRDKSIILWHLTKEDKVYGVPRRRLTGHSHFVQDVVL  71

Query  556  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  383
            S DG    SG  DG + LWDLA G   + +      ++       NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLATGVSARRFVGHTKDVLSVAFSIDNRQIVSASRDRTIKL  131

Query  382  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            W+   E K  +        QE E         A N  + C   S N    T+ S   D  
Sbjct  132  WNTLGECKYTI--------QEGE---------AHNDWVSCVRFSPNTLQPTIVSASWDRT  174

Query  208  IRVWGI  191
            ++VW +
Sbjct  175  VKVWNL  180



>gb|KHG29145.1| Guanine nucleotide-binding protein subunit beta-like protein 
[Gossypium arboreum]
Length=327

 Score =   332 bits (851),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 157/190 (83%), Positives = 175/190 (92%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTIQ+GD H +WVSCVRFSP+TLQPTIVS SWD+TVKVWNL+NCK+R+TLAGH+GYV
Sbjct  139  ECKYTIQEGDAHTDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLTNCKIRNTLAGHSGYV  198

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGS+IH+LCFSPNRYWLCAATE  
Sbjct  199  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSVIHSLCFSPNRYWLCAATEQG  258

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            IKIWDLESKSIV DL+VDLK E+E S +  +   K K+I+CTSL+W+ADGSTLFSGYTDG
Sbjct  259  IKIWDLESKSIVEDLKVDLKAEAEKS-DVTDIGNKKKVIYCTSLNWSADGSTLFSGYTDG  317

Query  211  VIRVWGIGRY  182
            VIRVWGIGRY
Sbjct  318  VIRVWGIGRY  327


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 53/187 (28%), Positives = 84/187 (45%), Gaps = 31/187 (17%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  542
            GH+ +V  V  S  +     +SGSWD  +++W+LS         GHT  V +VA S D  
Sbjct  63   GHSHFVQDVVLSSDS--QFALSGSWDGELRLWDLSAGTSARRFVGHTKDVLSVAFSIDNR  120

Query  541  LCASGGKDGVILLWD-LAEGKKLYSLDAGSI----IHALCFSPNRYW---LCAATEASIK  386
               S  +D  I LW+ L E K  Y++  G      +  + FSPN      + A+ + ++K
Sbjct  121  QIVSASRDRTIKLWNTLGECK--YTIQEGDAHTDWVSCVRFSPNTLQPTIVSASWDKTVK  178

Query  385  IWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVI  206
            +W+L +  I                   NT A +   +  +++ + DGS   SG  DGVI
Sbjct  179  VWNLTNCKI------------------RNTLAGHS-GYVNTVAVSPDGSLCASGGKDGVI  219

Query  205  RVWGIGR  185
             +W +  
Sbjct  220  LLWDLAE  226


 Score = 50.1 bits (118),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 46/184 (25%), Positives = 80/184 (43%), Gaps = 23/184 (13%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  557
             H + V+ +  +P      IV+ S D+++ +W+L+  +      R  L GH+ +V  V +
Sbjct  15   AHTDMVTAIA-TPIDNSDMIVTSSRDKSIILWHLTKDEKTYGVPRRRLTGHSHFVQDVVL  73

Query  556  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  383
            S D     SG  DG + LWDL+ G         +  + ++ FS  NR  + A+ + +IK+
Sbjct  74   SSDSQFALSGSWDGELRLWDLSAGTSARRFVGHTKDVLSVAFSIDNRQIVSASRDRTIKL  133

Query  382  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  203
            W+             L +      EG+   A    + C   S N    T+ S   D  ++
Sbjct  134  WNT------------LGECKYTIQEGD---AHTDWVSCVRFSPNTLQPTIVSASWDKTVK  178

Query  202  VWGI  191
            VW +
Sbjct  179  VWNL  182



>ref|XP_009110365.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Brassica rapa]
Length=327

 Score =   332 bits (851),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 159/191 (83%), Positives = 172/191 (90%), Gaps = 1/191 (1%)
 Frame = -1

Query  751  ECKYTIQDG-DGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  575
            ECKYTI +G +GH +WVSCVRFSP+TLQPTIVS SWD+TVKVWNLSNCKLRSTLAGHTGY
Sbjct  137  ECKYTIAEGGEGHGDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLSNCKLRSTLAGHTGY  196

Query  574  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  395
            VNTVAVSPDGSLCASGGKDGV+LLWDLAEGKKLYSL+A S+IHALCFSPNRYWLCAATE 
Sbjct  197  VNTVAVSPDGSLCASGGKDGVVLLWDLAEGKKLYSLEANSVIHALCFSPNRYWLCAATEQ  256

Query  394  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  215
             IKIWDLESKS+V DL+VDLK E+E S        K K+I+CTSLSWNADGSTLFSGYTD
Sbjct  257  GIKIWDLESKSVVEDLKVDLKAEAEKSDGSGTAGNKKKVIYCTSLSWNADGSTLFSGYTD  316

Query  214  GVIRVWGIGRY  182
            GVIRVWGIGRY
Sbjct  317  GVIRVWGIGRY  327


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 52/208 (25%), Positives = 86/208 (41%), Gaps = 33/208 (16%)
 Frame = -1

Query  718  HNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAVS  554
            H + V+ +  +P      IVS S D+++ +W L+         +  L GH+ +V  V +S
Sbjct  14   HTDQVTAIA-TPIDNSDIIVSASRDKSIILWKLTKDDKSYGVAQRRLTGHSHFVEDVVLS  72

Query  553  PDGSLCASGGKDGVILLWDLAEGKKL-----YSLDAGSIIHALCFSPNRYWLCAATEASI  389
             DG    SG  DG + LWDLA G        ++ D  S+  +L    NR  + A+ + +I
Sbjct  73   SDGQFALSGSWDGKLRLWDLAAGVSTRRFVGHTKDVLSVAFSL---DNRQIVSASRDRTI  129

Query  388  KIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            K+W+             L +     AEG         + C   S N    T+ S   D  
Sbjct  130  KLWNT------------LGECKYTIAEGGE--GHGDWVSCVRFSPNTLQPTIVSASWDKT  175

Query  208  IRVWGIGRY*MEEFRRSHMIIGHVCYLS  125
            ++VW      +   +    + GH  Y++
Sbjct  176  VKVWN-----LSNCKLRSTLAGHTGYVN  198



>ref|XP_006416642.1| hypothetical protein EUTSA_v10008183mg [Eutrema salsugineum]
 gb|ESQ34995.1| hypothetical protein EUTSA_v10008183mg [Eutrema salsugineum]
Length=328

 Score =   331 bits (849),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 159/192 (83%), Positives = 174/192 (91%), Gaps = 2/192 (1%)
 Frame = -1

Query  751  ECKYTIQDG--DGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTG  578
            ECKYTI +G  +GHN+WVSCVRFSP+TLQPTIVS SWD+TVKVWNLSNCKLRSTLAGHTG
Sbjct  137  ECKYTISEGGSEGHNDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLSNCKLRSTLAGHTG  196

Query  577  YVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATE  398
            YV+TVAVSPDGSLCASGGKDGV+LLWDLAEGKKLYSL+A S+IHALCFSPNRYWLCAATE
Sbjct  197  YVSTVAVSPDGSLCASGGKDGVVLLWDLAEGKKLYSLEANSVIHALCFSPNRYWLCAATE  256

Query  397  ASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYT  218
              IKIWDLESKSIV DL+VDLK E+E S      A K K+I+CTSL+W+ADGSTLFSGYT
Sbjct  257  QGIKIWDLESKSIVEDLKVDLKAEAEKSDGSGTAATKKKVIYCTSLNWSADGSTLFSGYT  316

Query  217  DGVIRVWGIGRY  182
            DGVIRVWGIGRY
Sbjct  317  DGVIRVWGIGRY  328


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 56/211 (27%), Positives = 91/211 (43%), Gaps = 36/211 (17%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  557
             H + V+ +  +P      IVS S D+++ +W L+         +  L GH+ +V  V +
Sbjct  13   AHTDMVTAIA-TPIDNADIIVSASRDKSIILWKLTKDDKAYGVAQRRLTGHSHFVEDVVL  71

Query  556  SPDGSLCASGGKDGVILLWDLAEGKKL-----YSLDAGSIIHALCFSPNRYWLCAATEAS  392
            S DG    SG  DG + LWDLA G        ++ D  S+  +L    NR  + A+ + +
Sbjct  72   SSDGQFALSGSWDGELRLWDLAAGISTRRFVGHNKDVLSVAFSL---DNRQIVSASRDRT  128

Query  391  IKIWDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYT  218
            IK+W+   E K  +          SE  +EG+     N  + C   S N    T+ S   
Sbjct  129  IKLWNTLGECKYTI----------SEGGSEGH-----NDWVSCVRFSPNTLQPTIVSASW  173

Query  217  DGVIRVWGIGRY*MEEFRRSHMIIGHVCYLS  125
            D  ++VW      +   +    + GH  Y+S
Sbjct  174  DKTVKVWN-----LSNCKLRSTLAGHTGYVS  199



>ref|XP_009117627.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Brassica rapa]
Length=327

 Score =   331 bits (848),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 158/191 (83%), Positives = 173/191 (91%), Gaps = 1/191 (1%)
 Frame = -1

Query  751  ECKYTIQDG-DGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  575
            ECKYTI +G +GH +WVSCVRFSP+TLQPTIVS SWD+TVKVWNLSNCKLRSTLAGHTGY
Sbjct  137  ECKYTISEGGEGHRDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLSNCKLRSTLAGHTGY  196

Query  574  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  395
            V+TVAVSPDGSLCASGGKDGV+LLWDLAEGKKLYSL+A S+IHALCFSPNRYWLCAATE 
Sbjct  197  VSTVAVSPDGSLCASGGKDGVVLLWDLAEGKKLYSLEANSVIHALCFSPNRYWLCAATEQ  256

Query  394  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  215
             IKIWDLESKS+V DL+VDLK E+E S      A K K+I+CTSLSW+ADGSTLFSGYTD
Sbjct  257  GIKIWDLESKSVVEDLKVDLKAEAEKSDGSGTAATKRKVIYCTSLSWSADGSTLFSGYTD  316

Query  214  GVIRVWGIGRY  182
            GVIRVWGIGRY
Sbjct  317  GVIRVWGIGRY  327


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 54/209 (26%), Positives = 87/209 (42%), Gaps = 33/209 (16%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  557
             H + V+ +  +P     TIVS S D+++ VW L+         +  L GH+ +V  V +
Sbjct  13   AHTDMVTAIA-TPIDNSDTIVSASRDKSIIVWKLTKDDKSYGVAQRRLTGHSHFVEDVVL  71

Query  556  SPDGSLCASGGKDGVILLWDLAEGKKL-----YSLDAGSIIHALCFSPNRYWLCAATEAS  392
            S DG    SG  DG + LWDLA G        ++ D  S+  +L    NR  + A+ + +
Sbjct  72   SSDGQFALSGSWDGELRLWDLAAGVSTRRFVGHTKDVLSVAFSL---DNRQIVSASRDRT  128

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            IK+W+             L +     +EG         + C   S N    T+ S   D 
Sbjct  129  IKLWNT------------LGECKYTISEGGE--GHRDWVSCVRFSPNTLQPTIVSASWDK  174

Query  211  VIRVWGIGRY*MEEFRRSHMIIGHVCYLS  125
             ++VW      +   +    + GH  Y+S
Sbjct  175  TVKVWN-----LSNCKLRSTLAGHTGYVS  198



>ref|XP_002894122.1| hypothetical protein ARALYDRAFT_474002 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70381.1| hypothetical protein ARALYDRAFT_474002 [Arabidopsis lyrata subsp. 
lyrata]
Length=326

 Score =   331 bits (848),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 156/190 (82%), Positives = 172/190 (91%), Gaps = 0/190 (0%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTI + DGH EWVSCVRFSP+TL PTIVS SWD+TVKVWNL NCKLR+TLAGH+GY+
Sbjct  137  ECKYTISEADGHKEWVSCVRFSPNTLVPTIVSASWDKTVKVWNLQNCKLRNTLAGHSGYL  196

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+AGSIIH+LCFSPNRYWLCAATE S
Sbjct  197  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAGSIIHSLCFSPNRYWLCAATENS  256

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            I+IWDLESKS+V DL+VDLK E+E S     T  K K+I+CTSL+W+ADGSTLFSGYTDG
Sbjct  257  IRIWDLESKSVVEDLKVDLKTEAEKSDVSTGTGNKTKVIYCTSLNWSADGSTLFSGYTDG  316

Query  211  VIRVWGIGRY  182
            VIRVWGIGRY
Sbjct  317  VIRVWGIGRY  326


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 48/208 (23%), Positives = 91/208 (44%), Gaps = 32/208 (15%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  557
             H + V+ +  +P      IV+ S D+++ +W L+         +  + GH+ +V  V +
Sbjct  13   AHTDMVTAIA-TPVDNSDVIVTSSRDKSIILWKLTKEDKSYGVAQRRMTGHSHFVQDVVL  71

Query  556  SPDGSLCASGGKDGVILLWDLAEGK--KLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  383
            S DG    SG  DG + LWDLA G+  + +      ++     + NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLATGESTRRFVGHTKDVLSVAFSTDNRQIVSASRDRTIKL  131

Query  382  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            W+   E K  + +            A+G+      + + C   S N    T+ S   D  
Sbjct  132  WNTLGECKYTISE------------ADGH-----KEWVSCVRFSPNTLVPTIVSASWDKT  174

Query  208  IRVWGIGRY*MEEFRRSHMIIGHVCYLS  125
            ++VW      ++  +  + + GH  YL+
Sbjct  175  VKVWN-----LQNCKLRNTLAGHSGYLN  197


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 53/185 (29%), Positives = 81/185 (44%), Gaps = 27/185 (15%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  542
            GH+ +V  V  S        +SGSWD  +++W+L+  +      GHT  V +VA S D  
Sbjct  61   GHSHFVQDVVLSSD--GQFALSGSWDGELRLWDLATGESTRRFVGHTKDVLSVAFSTDNR  118

Query  541  LCASGGKDGVILLWD-LAEGKKLYSLDAGSIIHALC--FSPNRY---WLCAATEASIKIW  380
               S  +D  I LW+ L E K   S   G      C  FSPN      + A+ + ++K+W
Sbjct  119  QIVSASRDRTIKLWNTLGECKYTISEADGHKEWVSCVRFSPNTLVPTIVSASWDKTVKVW  178

Query  379  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRV  200
            +L++      LR  L   S                +  +++ + DGS   SG  DGVI +
Sbjct  179  NLQN----CKLRNTLAGHSG---------------YLNTVAVSPDGSLCASGGKDGVILL  219

Query  199  WGIGR  185
            W +  
Sbjct  220  WDLAE  224



>gb|KJB08186.1| hypothetical protein B456_001G069800 [Gossypium raimondii]
Length=327

 Score =   331 bits (848),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 156/190 (82%), Positives = 175/190 (92%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTIQ+GD H +WVSCVRFSP+T+QPTIVS SWD+TVKVWNL+NCK+R+TLAGH+GYV
Sbjct  139  ECKYTIQEGDAHTDWVSCVRFSPNTVQPTIVSASWDKTVKVWNLTNCKIRNTLAGHSGYV  198

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGS+IH+LCFSPNRYWLCAATE  
Sbjct  199  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSVIHSLCFSPNRYWLCAATEQG  258

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            IKIWDLESKSIV DL+VDLK E+E S +  +   K K+I+CTSL+W+ADGSTLFSGYTDG
Sbjct  259  IKIWDLESKSIVEDLKVDLKAEAEKS-DVTDIGNKKKVIYCTSLNWSADGSTLFSGYTDG  317

Query  211  VIRVWGIGRY  182
            VIRVWGIGRY
Sbjct  318  VIRVWGIGRY  327


 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 53/186 (28%), Positives = 84/186 (45%), Gaps = 31/186 (17%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  542
            GH+ +V  V  S  +     +SGSWD  +++W+LS         GHT  V +VA S D  
Sbjct  63   GHSHFVQDVVLSSDS--QFALSGSWDGELRLWDLSAGTSARRFVGHTKDVLSVAFSIDNR  120

Query  541  LCASGGKDGVILLWD-LAEGKKLYSLDAGSI----IHALCFSPNRYW---LCAATEASIK  386
               S  +D  I LW+ L E K  Y++  G      +  + FSPN      + A+ + ++K
Sbjct  121  QIVSASRDRTIRLWNTLGECK--YTIQEGDAHTDWVSCVRFSPNTVQPTIVSASWDKTVK  178

Query  385  IWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVI  206
            +W+L +  I                   NT A +   +  +++ + DGS   SG  DGVI
Sbjct  179  VWNLTNCKI------------------RNTLAGHS-GYVNTVAVSPDGSLCASGGKDGVI  219

Query  205  RVWGIG  188
             +W + 
Sbjct  220  LLWDLA  225



>ref|XP_010678120.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Beta vulgaris subsp. vulgaris]
Length=326

 Score =   330 bits (847),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 153/190 (81%), Positives = 172/190 (91%), Gaps = 0/190 (0%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTIQD DGH +WVSCVRFSP+T+QPTIVS SWD+TVK+WNLSNCKLR+TLAGH GYV
Sbjct  137  ECKYTIQDSDGHTDWVSCVRFSPNTMQPTIVSASWDKTVKIWNLSNCKLRATLAGHNGYV  196

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTVAVSPDGSLCASGGKD VILLWDLAEGK+LYSLDAG+IIHALCFSPNRYWLCAATE+ 
Sbjct  197  NTVAVSPDGSLCASGGKDSVILLWDLAEGKRLYSLDAGTIIHALCFSPNRYWLCAATESG  256

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            IKIWDLESKS+V DL+VDLK E++       TA+K K+I+CTSLSW+ADG TLFSGYTDG
Sbjct  257  IKIWDLESKSVVEDLKVDLKTEADHLEGSGTTASKKKVIYCTSLSWSADGQTLFSGYTDG  316

Query  211  VIRVWGIGRY  182
            V+RV+GI RY
Sbjct  317  VVRVYGIARY  326


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 61/122 (50%), Gaps = 8/122 (7%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  557
             H + V+ +  +P      IV+ S D+++ VWNL+         +  L GH+ +V  V +
Sbjct  13   AHTDMVTAIA-TPIDNSDMIVTASRDKSIIVWNLTKEDKIYGVPKRRLTGHSHFVEDVVL  71

Query  556  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  383
            S DG    SG  DG + LWDLA G         +  + ++ FS  NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLAAGTTARRFVGHTKDVLSVAFSIDNRQIVSASRDRTIKL  131

Query  382  WD  377
            W+
Sbjct  132  WN  133



>ref|XP_009149259.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Brassica rapa]
Length=328

 Score =   330 bits (847),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 158/192 (82%), Positives = 173/192 (90%), Gaps = 2/192 (1%)
 Frame = -1

Query  751  ECKYTIQDG--DGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTG  578
            ECKYTI +G  +GH +WVSCVRFSP+TLQPTIVS SWD+TVKVWNLSNCKLRSTLAGHTG
Sbjct  137  ECKYTIAEGGGEGHRDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLSNCKLRSTLAGHTG  196

Query  577  YVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATE  398
            YVNTVAVSPDGSLCASGGKDGV+LLWDLAEGKKLYSL+A S+IHALCFSPNRYWLCAATE
Sbjct  197  YVNTVAVSPDGSLCASGGKDGVVLLWDLAEGKKLYSLEANSVIHALCFSPNRYWLCAATE  256

Query  397  ASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYT  218
              IKIWDLESKS+V DL+VDLK E+E S      A K K+I+CTSL+W+ADGSTLFSGYT
Sbjct  257  QGIKIWDLESKSVVEDLKVDLKAEAEKSDGSGTAATKRKVIYCTSLNWSADGSTLFSGYT  316

Query  217  DGVIRVWGIGRY  182
            DGVIRVWGIGRY
Sbjct  317  DGVIRVWGIGRY  328


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 53/208 (25%), Positives = 87/208 (42%), Gaps = 32/208 (15%)
 Frame = -1

Query  718  HNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAVS  554
            H + V+ +        P IVS S D+++ VW L+         +  L GH+ +V  V +S
Sbjct  14   HTDMVTAIATPIDNSDP-IVSASRDKSIIVWKLTKDDKSYGVAQRRLTGHSHFVEDVVLS  72

Query  553  PDGSLCASGGKDGVILLWDLAEGKKL-----YSLDAGSIIHALCFSPNRYWLCAATEASI  389
             DG    SG  DG + LWDLA G        ++ D  S+  +L    NR  + A+ + +I
Sbjct  73   SDGQFALSGSWDGELRLWDLAAGVSTRRFVGHTKDVLSVAFSL---DNRQIVSASRDRTI  129

Query  388  KIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            K+W+             L +     AEG     ++  + C   S N    T+ S   D  
Sbjct  130  KLWNT------------LGECKYTIAEGGGEGHRD-WVSCVRFSPNTLQPTIVSASWDKT  176

Query  208  IRVWGIGRY*MEEFRRSHMIIGHVCYLS  125
            ++VW      +   +    + GH  Y++
Sbjct  177  VKVWN-----LSNCKLRSTLAGHTGYVN  199



>gb|KDP37901.1| hypothetical protein JCGZ_05340 [Jatropha curcas]
Length=329

 Score =   330 bits (847),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 158/192 (82%), Positives = 174/192 (91%), Gaps = 2/192 (1%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTIQDGD H++WVSCVRFSP+T QPTIVS SWDRTVKVWNL+NCKLR TLAGH GYV
Sbjct  138  ECKYTIQDGDAHSDWVSCVRFSPNTHQPTIVSASWDRTVKVWNLTNCKLRCTLAGHNGYV  197

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTVAVSPDGSLCASGGKDGVILLWDLAEGK+LY+LDAG++IHALCFSPNRYWLCAATE S
Sbjct  198  NTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYNLDAGAVIHALCFSPNRYWLCAATEHS  257

Query  391  IKIWDLESKSIVVDLRVDLKQESEMS--AEGNNTAAKNKIIFCTSLSWNADGSTLFSGYT  218
            IKIWDLESKSIV DL+VDLK E+E S  +    T+ K K I+CTSL+W+ADGSTLFSGYT
Sbjct  258  IKIWDLESKSIVEDLKVDLKAEAEKSEGSTATGTSIKKKNIYCTSLNWSADGSTLFSGYT  317

Query  217  DGVIRVWGIGRY  182
            DGV+RVWGIGRY
Sbjct  318  DGVVRVWGIGRY  329


 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 54/212 (25%), Positives = 92/212 (43%), Gaps = 35/212 (17%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  557
             H + V+ +  +P      IV+ S D+++ +W+L+  +      R  L GH+ +V  V +
Sbjct  14   AHTDQVTAIA-TPIDNSDMIVTSSRDKSIILWHLTKEEKTYGVPRRRLTGHSHFVQDVVL  72

Query  556  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  383
            S DG    SG  DG + LWDLA G   + +      ++       NR  + A+ + +IK+
Sbjct  73   SSDGQFALSGSWDGELRLWDLAAGVSARRFVGHTKDVLSVAFSIDNRQIVSASRDRTIKL  132

Query  382  WDL--ESKSIVVD------------LRVDLKQESEMSAEGNNTAA----KNKIIFCT---  266
            W+   E K  + D               +  Q + +SA  + T       N  + CT   
Sbjct  133  WNTLGECKYTIQDGDAHSDWVSCVRFSPNTHQPTIVSASWDRTVKVWNLTNCKLRCTLAG  192

Query  265  ------SLSWNADGSTLFSGYTDGVIRVWGIG  188
                  +++ + DGS   SG  DGVI +W + 
Sbjct  193  HNGYVNTVAVSPDGSLCASGGKDGVILLWDLA  224



>ref|XP_002890259.1| hypothetical protein ARALYDRAFT_889221 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66518.1| hypothetical protein ARALYDRAFT_889221 [Arabidopsis lyrata subsp. 
lyrata]
Length=327

 Score =   330 bits (846),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 158/191 (83%), Positives = 173/191 (91%), Gaps = 1/191 (1%)
 Frame = -1

Query  751  ECKYTIQDG-DGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  575
            ECKYTI +G +GH +WVSCVRFSP+TLQPTIVS SWD+TVKVWNLSNCKLRSTLAGHTGY
Sbjct  137  ECKYTISEGGEGHRDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLSNCKLRSTLAGHTGY  196

Query  574  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  395
            V+TVAVSPDGSLCASGGKDGV+LLWDLAEGKKLYSL+A S+IHALCFSPNRYWLCAATE 
Sbjct  197  VSTVAVSPDGSLCASGGKDGVVLLWDLAEGKKLYSLEANSVIHALCFSPNRYWLCAATEQ  256

Query  394  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  215
             IKIWDLESKSIV DL+VDLK E+E S      A K K+I+CTSL+W+ADGSTLFSGYTD
Sbjct  257  GIKIWDLESKSIVEDLKVDLKAEAEKSDNSGPAATKRKVIYCTSLNWSADGSTLFSGYTD  316

Query  214  GVIRVWGIGRY  182
            GVIRVWGIGRY
Sbjct  317  GVIRVWGIGRY  327


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 52/209 (25%), Positives = 86/209 (41%), Gaps = 33/209 (16%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  557
             H + V+ +  +P      IVS S D+++ +W L+         +  L GH+ +V  V +
Sbjct  13   AHTDMVTAIA-TPIDNADIIVSASRDKSIILWKLTKDDKAYGVAQRRLTGHSHFVEDVVL  71

Query  556  SPDGSLCASGGKDGVILLWDLAEGKKL-----YSLDAGSIIHALCFSPNRYWLCAATEAS  392
            S DG    SG  DG + LWDLA G        ++ D  S+  +L    NR  + A+ + +
Sbjct  72   SSDGQFALSGSWDGELRLWDLAAGVSTRRFVGHTKDVLSVAFSL---DNRQIVSASRDRT  128

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            IK+W+             L +     +EG         + C   S N    T+ S   D 
Sbjct  129  IKLWNT------------LGECKYTISEGGE--GHRDWVSCVRFSPNTLQPTIVSASWDK  174

Query  211  VIRVWGIGRY*MEEFRRSHMIIGHVCYLS  125
             ++VW      +   +    + GH  Y+S
Sbjct  175  TVKVWN-----LSNCKLRSTLAGHTGYVS  198



>ref|XP_002281279.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Vitis vinifera]
 emb|CAN61810.1| hypothetical protein VITISV_026180 [Vitis vinifera]
Length=327

 Score =   329 bits (843),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 160/191 (84%), Positives = 173/191 (91%), Gaps = 1/191 (1%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTIQD D H++WVSCVRFSP+ LQPTIVS SWDRTVKVWNL+NCKLR+TLAGH GYV
Sbjct  137  ECKYTIQDADAHSDWVSCVRFSPNNLQPTIVSASWDRTVKVWNLTNCKLRATLAGHGGYV  196

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTVAVSPDGSLCASGGKDGVILLWDLAEGK+LYSLDAG+IIHALCFSPNRYWLCAATE S
Sbjct  197  NTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDAGAIIHALCFSPNRYWLCAATEQS  256

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAE-GNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  215
            IKIWDLESKSIV DL+VDLK E+E S +       K KII+CTSLSW+ADGSTLFSGYTD
Sbjct  257  IKIWDLESKSIVEDLKVDLKTEAEKSEDTTTTAKKKGKIIYCTSLSWSADGSTLFSGYTD  316

Query  214  GVIRVWGIGRY  182
            GV+RVWGIGRY
Sbjct  317  GVVRVWGIGRY  327


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 48/186 (26%), Positives = 80/186 (43%), Gaps = 27/186 (15%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  557
             H + V+ +  +P      IV+ S D+++ +W+L+         R  L GH+ +V  V +
Sbjct  13   AHTDMVTAIA-TPIDNSDMIVTSSRDKSIILWHLTKDDKTYGVPRRRLTGHSHFVQDVVL  71

Query  556  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  383
            S DG    SG  DG + LWDLA G         +  + ++ FS  NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLAAGTSARRFVGHTKDVLSVAFSVDNRQIVSASRDRTIKL  131

Query  382  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            W+   E K  + D                   A +  + C   S N    T+ S   D  
Sbjct  132  WNTLGECKYTIQD-----------------ADAHSDWVSCVRFSPNNLQPTIVSASWDRT  174

Query  208  IRVWGI  191
            ++VW +
Sbjct  175  VKVWNL  180



>emb|CAA06154.1| arcA 3 [Nicotiana tabacum]
Length=290

 Score =   327 bits (839),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 162/190 (85%), Positives = 176/190 (93%), Gaps = 2/190 (1%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTI DGD H++WVSCVRFSP+ LQPTIVSGSWDRTVK+WNL+NCKLRSTLAGH+GYV
Sbjct  103  ECKYTITDGDSHSDWVSCVRFSPNNLQPTIVSGSWDRTVKIWNLTNCKLRSTLAGHSGYV  162

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+AGSIIH+LCFSPNRYWLCAATE+S
Sbjct  163  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAGSIIHSLCFSPNRYWLCAATESS  222

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            IKIWDLESKSIVVDL+VDLKQESEMSAEG   AAKNKII+CT LSW+ADGSTLF G T  
Sbjct  223  IKIWDLESKSIVVDLKVDLKQESEMSAEG-TAAAKNKIIYCTCLSWSADGSTLFGG-TQM  280

Query  211  VIRVWGIGRY  182
            V+  +G GRY
Sbjct  281  VLIEYGDGRY  290



>ref|XP_010036939.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Eucalyptus grandis]
 gb|KCW48591.1| hypothetical protein EUGRSUZ_K02261 [Eucalyptus grandis]
Length=326

 Score =   328 bits (842),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 156/191 (82%), Positives = 176/191 (92%), Gaps = 2/191 (1%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTIQ+G+ H +WVSCVRFSP+TLQPTIVS SWDRT+KVWNL+NCKLR+TLAGH GYV
Sbjct  137  ECKYTIQEGEAHTDWVSCVRFSPNTLQPTIVSASWDRTIKVWNLTNCKLRNTLAGHNGYV  196

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTVAVSPDGSLCASGGKDGVILLWDLAEGK+LY+L+AG+IIH+LCFSPNRYWLCAATE S
Sbjct  197  NTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYNLEAGAIIHSLCFSPNRYWLCAATENS  256

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKN-KIIFCTSLSWNADGSTLFSGYTD  215
            IKIWDLESKSIV DLRVDLK E++ + +G  TAA N K+I+CTSL+W+ADGSTLFSGY D
Sbjct  257  IKIWDLESKSIVEDLRVDLKNEADKT-DGTTTAASNKKVIYCTSLNWSADGSTLFSGYND  315

Query  214  GVIRVWGIGRY  182
            GVIRVWG GRY
Sbjct  316  GVIRVWGTGRY  326


 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 48/186 (26%), Positives = 79/186 (42%), Gaps = 27/186 (15%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  557
             H + V+ +   P      +V+ S D+++ +W+L+  +      R  L GH+ +V  V +
Sbjct  13   AHTDMVTAIAI-PIDNSDMVVTSSRDKSIILWHLTKEEKVYGVPRRRLTGHSHFVQDVVL  71

Query  556  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  383
            S DG    SG  DG + LWDLA G   + +      ++       NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLATGVSARRFVGHTKDVLSVAFSIDNRQIVSASRDRTIKL  131

Query  382  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            W+   E K  +        QE E         A    + C   S N    T+ S   D  
Sbjct  132  WNTLGECKYTI--------QEGE---------AHTDWVSCVRFSPNTLQPTIVSASWDRT  174

Query  208  IRVWGI  191
            I+VW +
Sbjct  175  IKVWNL  180



>ref|NP_173248.1| guanine nucleotide-binding protein subunit beta-like protein 
A [Arabidopsis thaliana]
 sp|O24456.2|GBLPA_ARATH RecName: Full=Guanine nucleotide-binding protein subunit beta-like 
protein A; AltName: Full=Receptor for activated C kinase 
1A; AltName: Full=WD-40 repeat auxin-dependent protein ARCA 
[Arabidopsis thaliana]
 gb|AAF78369.1|AC069551_2 T10O22.6 [Arabidopsis thaliana]
 gb|AAF97825.1|AC034107_8 Identical to WD-40 repeat protein (AtArcA) from Arabidopsis thaliana 
gb|U77381 and contains multiple WD (G-beta repeat) PF|00400 
domains. ESTs gb|Z17972, gb|AI099926, gb|T42961, gb|R30131, 
gb|AV541608, gb|AV532234, gb|AV543299, gb|AV440652 come 
from this gene [Arabidopsis thaliana]
 gb|AAK59512.1| putative WD-40 repeat protein [Arabidopsis thaliana]
 gb|AAL34190.1| putative WD-40 repeat protein [Arabidopsis thaliana]
 gb|AAM66016.1| WD-40 repeat protein [Arabidopsis thaliana]
 gb|AEE29673.1| WD-40 repeat ArcA-like protein [Arabidopsis thaliana]
Length=327

 Score =   328 bits (842),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 157/191 (82%), Positives = 173/191 (91%), Gaps = 1/191 (1%)
 Frame = -1

Query  751  ECKYTIQDG-DGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  575
            ECKYTI +G +GH +WVSCVRFSP+TLQPTIVS SWD+TVKVWNLSNCKLRSTLAGHTGY
Sbjct  137  ECKYTISEGGEGHRDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLSNCKLRSTLAGHTGY  196

Query  574  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  395
            V+TVAVSPDGSLCASGGKDGV+LLWDLAEGKKLYSL+A S+IHALCFSPNRYWLCAATE 
Sbjct  197  VSTVAVSPDGSLCASGGKDGVVLLWDLAEGKKLYSLEANSVIHALCFSPNRYWLCAATEH  256

Query  394  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  215
             IKIWDLESKSIV DL+VDLK E+E +      A K K+I+CTSL+W+ADGSTLFSGYTD
Sbjct  257  GIKIWDLESKSIVEDLKVDLKAEAEKADNSGPAATKRKVIYCTSLNWSADGSTLFSGYTD  316

Query  214  GVIRVWGIGRY  182
            GVIRVWGIGRY
Sbjct  317  GVIRVWGIGRY  327


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 52/209 (25%), Positives = 86/209 (41%), Gaps = 33/209 (16%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  557
             H + V+ +  +P      IVS S D+++ +W L+         +  L GH+ +V  V +
Sbjct  13   AHTDMVTAIA-TPIDNADIIVSASRDKSIILWKLTKDDKAYGVAQRRLTGHSHFVEDVVL  71

Query  556  SPDGSLCASGGKDGVILLWDLAEGKKL-----YSLDAGSIIHALCFSPNRYWLCAATEAS  392
            S DG    SG  DG + LWDLA G        ++ D  S+  +L    NR  + A+ + +
Sbjct  72   SSDGQFALSGSWDGELRLWDLAAGVSTRRFVGHTKDVLSVAFSL---DNRQIVSASRDRT  128

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            IK+W+             L +     +EG         + C   S N    T+ S   D 
Sbjct  129  IKLWNT------------LGECKYTISEGGE--GHRDWVSCVRFSPNTLQPTIVSASWDK  174

Query  211  VIRVWGIGRY*MEEFRRSHMIIGHVCYLS  125
             ++VW      +   +    + GH  Y+S
Sbjct  175  TVKVWN-----LSNCKLRSTLAGHTGYVS  198



>ref|XP_010540016.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Tarenaya hassleriana]
Length=328

 Score =   328 bits (842),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 156/192 (81%), Positives = 175/192 (91%), Gaps = 2/192 (1%)
 Frame = -1

Query  751  ECKYTIQDG--DGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTG  578
            ECKYTI +G  +GH +WVSCVRFSP+TLQPTIVS SWD+TVKVWNLSNCKLRSTL GHTG
Sbjct  137  ECKYTIAEGAGEGHRDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLSNCKLRSTLVGHTG  196

Query  577  YVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATE  398
            YV+TVAVSPDGSLCASGGKDGV+LLWDLAEGKKLYSL+AG++IH+LCFSPNRYWLCAATE
Sbjct  197  YVSTVAVSPDGSLCASGGKDGVVLLWDLAEGKKLYSLEAGAVIHSLCFSPNRYWLCAATE  256

Query  397  ASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYT  218
             SIKIWDLESKSIV DL+VDLK E+E S    + A K K+I+CTSL+W+ADG+TLFSGYT
Sbjct  257  QSIKIWDLESKSIVEDLKVDLKAEAEKSDGAGSAATKTKVIYCTSLNWSADGNTLFSGYT  316

Query  217  DGVIRVWGIGRY  182
            DGVIRVWGIGRY
Sbjct  317  DGVIRVWGIGRY  328


 Score = 59.3 bits (142),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 57/209 (27%), Positives = 90/209 (43%), Gaps = 32/209 (15%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  557
             H + V+ +  +P     TIVS S D++V +W L+         +  L GH+ +V  V +
Sbjct  13   AHTDMVTAIA-TPIDNADTIVSSSRDKSVILWKLTKDDKAYGVPQRRLTGHSHFVEDVVL  71

Query  556  SPDGSLCASGGKDGVILLWDLAEGKKL-----YSLDAGSIIHALCFSPNRYWLCAATEAS  392
            S DG    SG  DG + LWDLA G        +S D  S+  +L    NR  + A+ + S
Sbjct  72   SSDGQFALSGSWDGELRLWDLATGTSTRRFVGHSKDVLSVAFSL---DNRQIVSASRDRS  128

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            IK+W+             L +     AEG     ++  + C   S N    T+ S   D 
Sbjct  129  IKLWNT------------LGECKYTIAEGAGEGHRD-WVSCVRFSPNTLQPTIVSASWDK  175

Query  211  VIRVWGIGRY*MEEFRRSHMIIGHVCYLS  125
             ++VW      +   +    ++GH  Y+S
Sbjct  176  TVKVWN-----LSNCKLRSTLVGHTGYVS  199



>ref|XP_010537487.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Tarenaya hassleriana]
Length=328

 Score =   328 bits (842),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 158/192 (82%), Positives = 174/192 (91%), Gaps = 2/192 (1%)
 Frame = -1

Query  751  ECKYTIQDG--DGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTG  578
            ECKYTI +G  +GH +WVSCVRFSP+TLQPTIVS SWD+TVKVWNL NCKLRSTL GHTG
Sbjct  137  ECKYTIAEGAGEGHRDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLLNCKLRSTLVGHTG  196

Query  577  YVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATE  398
            YV+TVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+AG++IHALCFSPNRYWLCAATE
Sbjct  197  YVSTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAGAVIHALCFSPNRYWLCAATE  256

Query  397  ASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYT  218
             SIKIWDLESKSIV DL+VDLK E+E S     TA K K+I+CTSL+W+ADG+TLFSGYT
Sbjct  257  QSIKIWDLESKSIVEDLKVDLKAEAEKSDGAGATANKKKVIYCTSLNWSADGNTLFSGYT  316

Query  217  DGVIRVWGIGRY  182
            DGVIRVWGIGRY
Sbjct  317  DGVIRVWGIGRY  328


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 52/206 (25%), Positives = 87/206 (42%), Gaps = 26/206 (13%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  557
             H + V+ +  +P      IVS S D+++ +W L+  +      +  L GH+ +V  V +
Sbjct  13   AHTDEVTAIA-TPIDNADIIVSSSRDKSIVLWKLTKDEKAYGVPQRRLTGHSHFVQDVVL  71

Query  556  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  383
            S DG    SG  DG + LWDLA G   + +      +I       NR  + A+ + SIK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLATGTSTRRFVGHTKDVISVAFSIDNRQIVSASRDRSIKL  131

Query  382  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  203
            W+             L +     AEG     ++  + C   S N    T+ S   D  ++
Sbjct  132  WNT------------LGECKYTIAEGAGEGHRD-WVSCVRFSPNTLQPTIVSASWDKTVK  178

Query  202  VWGIGRY*MEEFRRSHMIIGHVCYLS  125
            VW      +   +    ++GH  Y+S
Sbjct  179  VWN-----LLNCKLRSTLVGHTGYVS  199



>ref|XP_006305354.1| hypothetical protein CARUB_v10009733mg [Capsella rubella]
 gb|EOA38252.1| hypothetical protein CARUB_v10009733mg [Capsella rubella]
Length=326

 Score =   328 bits (841),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 154/190 (81%), Positives = 174/190 (92%), Gaps = 0/190 (0%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTI +GDGH++WVSCVRFSP+T +PTIVS SWDRTVKVWNL NCKLR+TLAGH+GY+
Sbjct  137  ECKYTISEGDGHSDWVSCVRFSPNTHEPTIVSASWDRTVKVWNLQNCKLRNTLAGHSGYL  196

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+AGSIIH+LCFSPNRYWLCAATE S
Sbjct  197  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAGSIIHSLCFSPNRYWLCAATENS  256

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            I+IWDLESKS+V DL+VDLK E+E S     T  K K+I+CTSL+W+ADG+TLFSGYTDG
Sbjct  257  IRIWDLESKSVVEDLKVDLKVEAEKSDGAVGTGNKTKVIYCTSLNWSADGNTLFSGYTDG  316

Query  211  VIRVWGIGRY  182
            +IRVWGIGRY
Sbjct  317  IIRVWGIGRY  326


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 47/206 (23%), Positives = 89/206 (43%), Gaps = 28/206 (14%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  557
             H + V+ +  +P      IV+ S D+++ +W L+         +  + GH+ +V  V +
Sbjct  13   AHTDMVTAIA-TPVDNSDVIVTSSRDKSIILWKLTKEDKSYGVAQRRMTGHSHFVEDVVL  71

Query  556  SPDGSLCASGGKDGVILLWDLAEGK--KLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  383
            S DG    SG  DG + LWDLA G+  + +      ++     + NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLATGESTRRFVGHKKDVLSVAFSTDNRQIVSASRDRTIKL  131

Query  382  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  203
            W+             L +     +EG+     +  + C   S N    T+ S   D  ++
Sbjct  132  WNT------------LGECKYTISEGD---GHSDWVSCVRFSPNTHEPTIVSASWDRTVK  176

Query  202  VWGIGRY*MEEFRRSHMIIGHVCYLS  125
            VW      ++  +  + + GH  YL+
Sbjct  177  VWN-----LQNCKLRNTLAGHSGYLN  197


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 52/185 (28%), Positives = 81/185 (44%), Gaps = 27/185 (15%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  542
            GH+ +V  V  S        +SGSWD  +++W+L+  +      GH   V +VA S D  
Sbjct  61   GHSHFVEDVVLSSD--GQFALSGSWDGELRLWDLATGESTRRFVGHKKDVLSVAFSTDNR  118

Query  541  LCASGGKDGVILLWD-LAEGKKLYSLDAGSIIHALC--FSPNRY---WLCAATEASIKIW  380
               S  +D  I LW+ L E K   S   G      C  FSPN +    + A+ + ++K+W
Sbjct  119  QIVSASRDRTIKLWNTLGECKYTISEGDGHSDWVSCVRFSPNTHEPTIVSASWDRTVKVW  178

Query  379  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRV  200
            +L++      LR  L   S                +  +++ + DGS   SG  DGVI +
Sbjct  179  NLQN----CKLRNTLAGHSG---------------YLNTVAVSPDGSLCASGGKDGVILL  219

Query  199  WGIGR  185
            W +  
Sbjct  220  WDLAE  224



>ref|NP_188441.1| receptor for activated C kinase 1C [Arabidopsis thaliana]
 sp|Q9LV28.1|GPLPC_ARATH RecName: Full=Guanine nucleotide-binding protein subunit beta-like 
protein C; AltName: Full=Receptor for activated C kinase 
1C [Arabidopsis thaliana]
 dbj|BAB02025.1| guanine nucleotide-binding protein; activated protein kinase 
C receptor; RACK1 [Arabidopsis thaliana]
 gb|AAK91355.1| AT3g18130/MRC8_11 [Arabidopsis thaliana]
 gb|AAM26650.1| AT3g18130/MRC8_11 [Arabidopsis thaliana]
 gb|AEE76051.1| receptor for activated C kinase 1C [Arabidopsis thaliana]
Length=326

 Score =   328 bits (841),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 153/190 (81%), Positives = 173/190 (91%), Gaps = 0/190 (0%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTI +GDGH EWVSCVRFSP+TL PTIVS SWD+TVKVWNL NCKLR++L GH+GY+
Sbjct  137  ECKYTISEGDGHKEWVSCVRFSPNTLVPTIVSASWDKTVKVWNLQNCKLRNSLVGHSGYL  196

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+AGSIIH+LCFSPNRYWLCAATE S
Sbjct  197  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAGSIIHSLCFSPNRYWLCAATENS  256

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            I+IWDLESKS+V DL+VDLK E+E +  G  T  + K+I+CTSL+W+ADGSTLFSGYTDG
Sbjct  257  IRIWDLESKSVVEDLKVDLKSEAEKNEGGVGTGNQKKVIYCTSLNWSADGSTLFSGYTDG  316

Query  211  VIRVWGIGRY  182
            V+RVWGIGRY
Sbjct  317  VVRVWGIGRY  326


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 48/205 (23%), Positives = 90/205 (44%), Gaps = 28/205 (14%)
 Frame = -1

Query  718  HNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAVS  554
            H + V+ +  +P      IV+ S D+++ +W L+         +  L GH+ +V  V +S
Sbjct  14   HTDIVTAIA-TPIDNSDIIVTASRDKSIILWKLTKDDKSYGVAQRRLTGHSHFVEDVVLS  72

Query  553  PDGSLCASGGKDGVILLWDLAEGK--KLYSLDAGSIIHALCFSPNRYWLCAATEASIKIW  380
             DG    SG  DG + LWDLA G+  + +      ++     + NR  + A+ + +IK+W
Sbjct  73   SDGQFALSGSWDGELRLWDLATGETTRRFVGHTKDVLSVAFSTDNRQIVSASRDRTIKLW  132

Query  379  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRV  200
            +             L +     +EG+      + + C   S N    T+ S   D  ++V
Sbjct  133  NT------------LGECKYTISEGD---GHKEWVSCVRFSPNTLVPTIVSASWDKTVKV  177

Query  199  WGIGRY*MEEFRRSHMIIGHVCYLS  125
            W      ++  +  + ++GH  YL+
Sbjct  178  WN-----LQNCKLRNSLVGHSGYLN  197


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 51/189 (27%), Positives = 81/189 (43%), Gaps = 35/189 (19%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  542
            GH+ +V  V  S        +SGSWD  +++W+L+  +      GHT  V +VA S D  
Sbjct  61   GHSHFVEDVVLSSD--GQFALSGSWDGELRLWDLATGETTRRFVGHTKDVLSVAFSTDNR  118

Query  541  LCASGGKDGVILLWD-LAEGKKLYSLDAGSIIHALC--FSPNRY---WLCAATEASIKIW  380
               S  +D  I LW+ L E K   S   G      C  FSPN      + A+ + ++K+W
Sbjct  119  QIVSASRDRTIKLWNTLGECKYTISEGDGHKEWVSCVRFSPNTLVPTIVSASWDKTVKVW  178

Query  379  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKII----FCTSLSWNADGSTLFSGYTDG  212
            +L+                       N   +N ++    +  +++ + DGS   SG  DG
Sbjct  179  NLQ-----------------------NCKLRNSLVGHSGYLNTVAVSPDGSLCASGGKDG  215

Query  211  VIRVWGIGR  185
            VI +W +  
Sbjct  216  VILLWDLAE  224



>ref|XP_009360100.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Pyrus x bretschneideri]
Length=326

 Score =   328 bits (840),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 156/190 (82%), Positives = 174/190 (92%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECK+TIQD DGH +WVSCVRFSPST+QPTIVS SWD+TVKVWNLSNCKLR+TL GH GYV
Sbjct  137  ECKFTIQDQDGHGDWVSCVRFSPSTMQPTIVSASWDKTVKVWNLSNCKLRNTLEGHNGYV  196

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTVAVSPDGSLCASGGKDGVILLWDLAEGK+LY L+AGSIIHALCFSPNRYWLCAATE S
Sbjct  197  NTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYHLEAGSIIHALCFSPNRYWLCAATEQS  256

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGN-NTAAKNKIIFCTSLSWNADGSTLFSGYTD  215
            IKIWDLESKSIV +L+VDLK E+E + + +  T+ K K+I+CTSL+W+ADGSTLFSGYTD
Sbjct  257  IKIWDLESKSIVEELKVDLKTEAEKTEDTHAATSYKKKVIYCTSLNWSADGSTLFSGYTD  316

Query  214  GVIRVWGIGR  185
            GVIRVWGIGR
Sbjct  317  GVIRVWGIGR  326


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 57/231 (25%), Positives = 97/231 (42%), Gaps = 39/231 (17%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  557
             H + V+ +   P      IVS S D+++ +W+L+  +      R  L GH+ +V  V +
Sbjct  13   AHTDMVTAIAI-PIDNSEMIVSASRDKSIILWHLNKDEKTYGVPRRRLTGHSHFVEDVVL  71

Query  556  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  383
            S DG    SG  DG + LWDLA G   + +      ++       NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLALGVSARRFVGHTKDVLSVAFSIDNRQIVSASRDRTIKL  131

Query  382  WDL--ESKSIVVD------------LRVDLKQESEMSAEGNNTAA---------KNKII-  275
            W+   E K  + D                  Q + +SA  + T           +N +  
Sbjct  132  WNTLGECKFTIQDQDGHGDWVSCVRFSPSTMQPTIVSASWDKTVKVWNLSNCKLRNTLEG  191

Query  274  ---FCTSLSWNADGSTLFSGYTDGVIRVWGIGRY*MEEFRRSHMIIGHVCY  131
               +  +++ + DGS   SG  DGVI +W +     E  R  H+  G + +
Sbjct  192  HNGYVNTVAVSPDGSLCASGGKDGVILLWDLA----EGKRLYHLEAGSIIH  238



>gb|AAB82647.1| WD-40 repeat protein [Arabidopsis thaliana]
Length=327

 Score =   327 bits (839),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 156/191 (82%), Positives = 173/191 (91%), Gaps = 1/191 (1%)
 Frame = -1

Query  751  ECKYTIQDG-DGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  575
            ECKYTI +G +GH +WVSCVRFSP+TLQPTIVS SWD+TVK+WNLSNCKLRSTLAGHTGY
Sbjct  137  ECKYTISEGGEGHRDWVSCVRFSPNTLQPTIVSASWDKTVKMWNLSNCKLRSTLAGHTGY  196

Query  574  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  395
            V+TVAVSPDGSLCASGGKDGV+LLWDLAEGKKLYSL+A S+IHALCFSPNRYWLCAATE 
Sbjct  197  VSTVAVSPDGSLCASGGKDGVVLLWDLAEGKKLYSLEANSVIHALCFSPNRYWLCAATEH  256

Query  394  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  215
             IKIWDLESKSIV DL+VDLK E+E +      A K K+I+CTSL+W+ADGSTLFSGYTD
Sbjct  257  GIKIWDLESKSIVEDLKVDLKAEAEKADNSGPAATKRKVIYCTSLNWSADGSTLFSGYTD  316

Query  214  GVIRVWGIGRY  182
            GVIRVWGIGRY
Sbjct  317  GVIRVWGIGRY  327


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 51/209 (24%), Positives = 86/209 (41%), Gaps = 33/209 (16%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  557
             H + V+ +  +P      IVS S D+++ +W L+         +  L GH+ +V  V +
Sbjct  13   AHTDMVTAIA-TPIDNADIIVSASRDKSIILWKLTKDDKAYGVAQRRLTGHSHFVEDVVL  71

Query  556  SPDGSLCASGGKDGVILLWDLAEGKKL-----YSLDAGSIIHALCFSPNRYWLCAATEAS  392
            S DG    SG  DG + LWDLA G        ++ D  S+  +L    NR  + A+ + +
Sbjct  72   SSDGQFALSGSWDGELRLWDLAAGVSTRRFVGHTKDVLSVAFSL---DNRQIVSASRDRT  128

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            IK+W+             L +     +EG         + C   S N    T+ S   D 
Sbjct  129  IKLWNT------------LGECKYTISEGGE--GHRDWVSCVRFSPNTLQPTIVSASWDK  174

Query  211  VIRVWGIGRY*MEEFRRSHMIIGHVCYLS  125
             +++W      +   +    + GH  Y+S
Sbjct  175  TVKMWN-----LSNCKLRSTLAGHTGYVS  198



>gb|AGV54321.1| RACK1 [Phaseolus vulgaris]
Length=324

 Score =   327 bits (838),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 156/190 (82%), Positives = 173/190 (91%), Gaps = 2/190 (1%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTIQD D H++WVSCVRFSPSTLQPTIVS SWDRT KVWNL+NCKL++TLAG++GYV
Sbjct  137  ECKYTIQDSDAHSDWVSCVRFSPSTLQPTIVSASWDRTGKVWNLTNCKLKNTLAGNSGYV  196

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            N VAVSPDGSLCASGGKDGVILLWDLAEGK+LYSLDAGSIIHALCFSPNRYWLCAATE S
Sbjct  197  NNVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDAGSIIHALCFSPNRYWLCAATEQS  256

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            IKIWDLESKSIV DL+VDLK E++ +  GN    K K+I+CTSL+W+ADGSTLFSGYTDG
Sbjct  257  IKIWDLESKSIVEDLKVDLKTEADGTTGGNTN--KKKVIYCTSLNWSADGSTLFSGYTDG  314

Query  211  VIRVWGIGRY  182
            V+RVW IGRY
Sbjct  315  VVRVWAIGRY  324


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 55/212 (26%), Positives = 91/212 (43%), Gaps = 35/212 (17%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  557
             H + V+ +  +P      IV+ S D+++ +W L+         R  L GH+ +V  V +
Sbjct  13   AHTDVVTAIA-TPIDNSDMIVTASRDKSIILWQLTKEDKTYGVPRRRLTGHSHFVQDVVL  71

Query  556  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  383
            S DG    SG  DG + LWDLA G         +  + ++ FS  NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLAAGTSARRFVGHTKDVLSVAFSIDNRQIVSASRDRTIKL  131

Query  382  WDL--ESKSIVVD------------LRVDLKQESEMSAEGNNTAA---------KNKII-  275
            W+   E K  + D                  Q + +SA  + T           KN +  
Sbjct  132  WNTLGECKYTIQDSDAHSDWVSCVRFSPSTLQPTIVSASWDRTGKVWNLTNCKLKNTLAG  191

Query  274  ---FCTSLSWNADGSTLFSGYTDGVIRVWGIG  188
               +  +++ + DGS   SG  DGVI +W + 
Sbjct  192  NSGYVNNVAVSPDGSLCASGGKDGVILLWDLA  223



>ref|XP_010097592.1| Guanine nucleotide-binding protein subunit beta-like protein 
[Morus notabilis]
 gb|EXB69124.1| Guanine nucleotide-binding protein subunit beta-like protein 
[Morus notabilis]
Length=330

 Score =   327 bits (838),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 160/193 (83%), Positives = 175/193 (91%), Gaps = 3/193 (2%)
 Frame = -1

Query  751  ECKYTI--QDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTG  578
            ECKYTI    G+ H++WVSCVRFSPS LQPTIVS SWDRTVKVWNLSNCKLR+TL+GH G
Sbjct  138  ECKYTISGDGGEAHSDWVSCVRFSPSNLQPTIVSASWDRTVKVWNLSNCKLRNTLSGHGG  197

Query  577  YVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATE  398
            YVNTVAVSPDGSLCASGGKDGVILLWDLAEGK+LYSLDAG+IIHALCFSPNRYWLCAATE
Sbjct  198  YVNTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDAGAIIHALCFSPNRYWLCAATE  257

Query  397  ASIKIWDLESKSIVVDLRVDLKQESEMSAEGN-NTAAKNKIIFCTSLSWNADGSTLFSGY  221
             SIKIWDLESKSIV DL+VDLK E+E + + +  TA K K+I+CTSLSW+ADGSTLFSGY
Sbjct  258  NSIKIWDLESKSIVEDLKVDLKTEAEKTEDTHAATANKKKVIYCTSLSWSADGSTLFSGY  317

Query  220  TDGVIRVWGIGRY  182
            TDGVIRVWGIGRY
Sbjct  318  TDGVIRVWGIGRY  330


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 51/186 (27%), Positives = 83/186 (45%), Gaps = 29/186 (16%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  542
            GH+ +V  V  S  +     +SGSWD  +++W+L+         GHT  V +VA S D  
Sbjct  62   GHSHFVEDVVLSSDS--QFALSGSWDGELRLWDLAAGVSARRFVGHTKDVLSVAFSIDNR  119

Query  541  LCASGGKDGVILLWD-LAEGKKLYSLDAGSI----IHALCFSPNRYW---LCAATEASIK  386
               S  +D  I LW+ L E K   S D G      +  + FSP+      + A+ + ++K
Sbjct  120  QIVSASRDRTIKLWNTLGECKYTISGDGGEAHSDWVSCVRFSPSNLQPTIVSASWDRTVK  179

Query  385  IWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVI  206
            +W+L           + K  + +S  G          +  +++ + DGS   SG  DGVI
Sbjct  180  VWNLS----------NCKLRNTLSGHGG---------YVNTVAVSPDGSLCASGGKDGVI  220

Query  205  RVWGIG  188
             +W + 
Sbjct  221  LLWDLA  226


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 43/184 (23%), Positives = 78/184 (42%), Gaps = 21/184 (11%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  557
             H + V+ +  +P      IV+ S D+++ +W+L+         R  L GH+ +V  V +
Sbjct  14   AHTDMVTAIA-TPIDNSDIIVTASRDKSIILWHLTKEDKAYGVPRRRLTGHSHFVEDVVL  72

Query  556  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  383
            S D     SG  DG + LWDLA G   + +      ++       NR  + A+ + +IK+
Sbjct  73   SSDSQFALSGSWDGELRLWDLAAGVSARRFVGHTKDVLSVAFSIDNRQIVSASRDRTIKL  132

Query  382  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  203
            W+                E + +  G+   A +  + C   S +    T+ S   D  ++
Sbjct  133  WNTLG-------------ECKYTISGDGGEAHSDWVSCVRFSPSNLQPTIVSASWDRTVK  179

Query  202  VWGI  191
            VW +
Sbjct  180  VWNL  183



>ref|XP_010506450.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein C [Camelina sativa]
Length=326

 Score =   327 bits (837),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 152/190 (80%), Positives = 172/190 (91%), Gaps = 0/190 (0%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTI +GDGH EW+SCVRFSP+TL PTIVS SWD TVKVWNL NCKL+++L GHTGY+
Sbjct  137  ECKYTISEGDGHKEWISCVRFSPNTLVPTIVSASWDHTVKVWNLQNCKLKNSLVGHTGYL  196

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+AGSIIH+LCFSPNRYWLCAATE S
Sbjct  197  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAGSIIHSLCFSPNRYWLCAATENS  256

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            IKIWDLESK++V DL+VDLK E+E +  G  T  + K+I+CTSL+W+ADGSTLFSGYTDG
Sbjct  257  IKIWDLESKTVVEDLKVDLKAEAEKADGGVGTGNQKKVIYCTSLNWSADGSTLFSGYTDG  316

Query  211  VIRVWGIGRY  182
            V+RVWGIGRY
Sbjct  317  VVRVWGIGRY  326


 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 49/205 (24%), Positives = 88/205 (43%), Gaps = 28/205 (14%)
 Frame = -1

Query  718  HNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAVS  554
            H + V+ +  +P      IV+ S D+++ +W L+         +  L GH+ +V  V +S
Sbjct  14   HTDMVTAIA-TPIDNSDIIVTASRDKSIILWKLTKDDKSYGVAQRRLTGHSHFVEDVVLS  72

Query  553  PDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIW  380
             DG    SG  DG + LWDLA G   + +      ++       NR  + A+ + +IK+W
Sbjct  73   SDGQFALSGSWDGELRLWDLATGVSTRRFVGHTKDVLSVAFSVDNRQIVSASRDRTIKLW  132

Query  379  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRV  200
            +             L +     +EG+      + I C   S N    T+ S   D  ++V
Sbjct  133  NT------------LGECKYTISEGD---GHKEWISCVRFSPNTLVPTIVSASWDHTVKV  177

Query  199  WGIGRY*MEEFRRSHMIIGHVCYLS  125
            W      ++  +  + ++GH  YL+
Sbjct  178  WN-----LQNCKLKNSLVGHTGYLN  197


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 52/189 (28%), Positives = 81/189 (43%), Gaps = 35/189 (19%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  542
            GH+ +V  V  S        +SGSWD  +++W+L+         GHT  V +VA S D  
Sbjct  61   GHSHFVEDVVLSSD--GQFALSGSWDGELRLWDLATGVSTRRFVGHTKDVLSVAFSVDNR  118

Query  541  LCASGGKDGVILLWD-LAEGKKLYSLDAGSI--IHALCFSPNRY---WLCAATEASIKIW  380
               S  +D  I LW+ L E K   S   G    I  + FSPN      + A+ + ++K+W
Sbjct  119  QIVSASRDRTIKLWNTLGECKYTISEGDGHKEWISCVRFSPNTLVPTIVSASWDHTVKVW  178

Query  379  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKII----FCTSLSWNADGSTLFSGYTDG  212
            +L+                       N   KN ++    +  +++ + DGS   SG  DG
Sbjct  179  NLQ-----------------------NCKLKNSLVGHTGYLNTVAVSPDGSLCASGGKDG  215

Query  211  VIRVWGIGR  185
            VI +W +  
Sbjct  216  VILLWDLAE  224



>ref|XP_008374821.1| PREDICTED: LOW QUALITY PROTEIN: guanine nucleotide-binding protein 
subunit beta-like protein [Malus domestica]
 ref|XP_008364648.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Malus domestica]
 ref|XP_009347770.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Pyrus x bretschneideri]
Length=326

 Score =   327 bits (837),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 155/190 (82%), Positives = 174/190 (92%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECK+TIQD DGH +WVSCVRFSP+T+QPTIVS SWD+TVKVWNLSNCKLR+TL GH GYV
Sbjct  137  ECKFTIQDQDGHGDWVSCVRFSPNTMQPTIVSASWDKTVKVWNLSNCKLRNTLEGHNGYV  196

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTVAVSPDGSLCASGGKDGVILLWDLAEGK+LY L+AGSIIHALCFSPNRYWLCAATE S
Sbjct  197  NTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYHLEAGSIIHALCFSPNRYWLCAATEQS  256

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGN-NTAAKNKIIFCTSLSWNADGSTLFSGYTD  215
            IKIWDLESKSIV +L+VDLK E+E + + +  T+ K K+I+CTSL+W+ADGSTLFSGYTD
Sbjct  257  IKIWDLESKSIVEELKVDLKTEAEKTEDTHAATSYKKKVIYCTSLNWSADGSTLFSGYTD  316

Query  214  GVIRVWGIGR  185
            GVIRVWGIGR
Sbjct  317  GVIRVWGIGR  326


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 57/231 (25%), Positives = 98/231 (42%), Gaps = 39/231 (17%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  557
             H + V+ +   P      IVS S D+++ +W+L+  +      R  L GH+ +V  V +
Sbjct  13   AHTDMVTAIAI-PIDNSEMIVSASRDKSIILWHLNKDEKTYGVPRRRLTGHSHFVQDVVL  71

Query  556  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  383
            S DG    SG  DG + LWDLA G   + +      ++       NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLALGVSARRFVGHTKDVLSVAFSIDNRQIVSASRDRTIKL  131

Query  382  WDL--ESKSIVVD------------LRVDLKQESEMSAEGNNTAA---------KNKII-  275
            W+   E K  + D               +  Q + +SA  + T           +N +  
Sbjct  132  WNTLGECKFTIQDQDGHGDWVSCVRFSPNTMQPTIVSASWDKTVKVWNLSNCKLRNTLEG  191

Query  274  ---FCTSLSWNADGSTLFSGYTDGVIRVWGIGRY*MEEFRRSHMIIGHVCY  131
               +  +++ + DGS   SG  DGVI +W +     E  R  H+  G + +
Sbjct  192  HNGYVNTVAVSPDGSLCASGGKDGVILLWDLA----EGKRLYHLEAGSIIH  238



>ref|XP_008393404.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Malus domestica]
Length=326

 Score =   327 bits (837),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 155/190 (82%), Positives = 174/190 (92%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECK+TIQD DGH +WVSCVRFSP+T+QPTIVS SWD+TVKVWNLSNCKLR+TL GH GYV
Sbjct  137  ECKFTIQDQDGHGDWVSCVRFSPNTMQPTIVSASWDKTVKVWNLSNCKLRNTLEGHNGYV  196

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTVAVSPDGSLCASGGKDGVILLWDLAEGK+LY L+AGSIIHALCFSPNRYWLCAATE S
Sbjct  197  NTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYHLEAGSIIHALCFSPNRYWLCAATEQS  256

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGN-NTAAKNKIIFCTSLSWNADGSTLFSGYTD  215
            IKIWDLESKSIV +L+VDLK E+E + + +  T+ K K+I+CTSL+W+ADGSTLFSGYTD
Sbjct  257  IKIWDLESKSIVEELKVDLKTEAEKTEDTHAATSYKKKVIYCTSLNWSADGSTLFSGYTD  316

Query  214  GVIRVWGIGR  185
            GVIRVWGIGR
Sbjct  317  GVIRVWGIGR  326


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 57/231 (25%), Positives = 98/231 (42%), Gaps = 39/231 (17%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  557
             H + V+ +   P      IVS S D+++ +W+L+  +      R  L GH+ +V  V +
Sbjct  13   AHTDMVTAIAI-PIDNSEMIVSASRDKSIILWHLNKDEKTYGVPRRRLTGHSHFVEDVVL  71

Query  556  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  383
            S DG    SG  DG + LWDLA G   + +      ++       NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLALGVSARRFVGHTKDVLSVAFSIDNRQIVSASRDRTIKL  131

Query  382  WDL--ESKSIVVD------------LRVDLKQESEMSAEGNNTAA---------KNKII-  275
            W+   E K  + D               +  Q + +SA  + T           +N +  
Sbjct  132  WNTLGECKFTIQDQDGHGDWVSCVRFSPNTMQPTIVSASWDKTVKVWNLSNCKLRNTLEG  191

Query  274  ---FCTSLSWNADGSTLFSGYTDGVIRVWGIGRY*MEEFRRSHMIIGHVCY  131
               +  +++ + DGS   SG  DGVI +W +     E  R  H+  G + +
Sbjct  192  HNGYVNTVAVSPDGSLCASGGKDGVILLWDLA----EGKRLYHLEAGSIIH  238



>ref|XP_010498185.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Camelina sativa]
Length=328

 Score =   326 bits (836),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 155/192 (81%), Positives = 173/192 (90%), Gaps = 2/192 (1%)
 Frame = -1

Query  751  ECKYTIQDG--DGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTG  578
            ECKYTI +G  +GH +WVSCVRFSP+TLQPTIVS SWD+TVKVWNLSNCKLRSTLAGHTG
Sbjct  137  ECKYTISEGGGEGHRDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLSNCKLRSTLAGHTG  196

Query  577  YVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATE  398
            YV+TVAVSPDGSLCASGGKDGV+LLWDLAEGKKLYSL+A S+IHA+CFSPNRYWLCAATE
Sbjct  197  YVSTVAVSPDGSLCASGGKDGVVLLWDLAEGKKLYSLEANSVIHAVCFSPNRYWLCAATE  256

Query  397  ASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYT  218
              IKIWDLESK+IV DL+VDLK E+E +      A K K+I+CTSL+W+ADGSTLFSGYT
Sbjct  257  QGIKIWDLESKTIVEDLKVDLKAEAEKADNSGPAATKKKVIYCTSLNWSADGSTLFSGYT  316

Query  217  DGVIRVWGIGRY  182
            DGVIRVWGIGRY
Sbjct  317  DGVIRVWGIGRY  328


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 55/211 (26%), Positives = 90/211 (43%), Gaps = 36/211 (17%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  557
             H + V+ +  +P      IVS S D+++ +W L+  +      +  L GH+ +V  V +
Sbjct  13   AHTDMVTAIA-TPIDNADIIVSASRDKSIILWKLTKDEKSYGVAQRRLTGHSHFVEDVVL  71

Query  556  SPDGSLCASGGKDGVILLWDLAEGKKL-----YSLDAGSIIHALCFSPNRYWLCAATEAS  392
            S DG    SG  DG + LWDLA G        ++ D  S+  +L    NR  + A+ + +
Sbjct  72   SSDGQFALSGSWDGELRLWDLAAGVSTRRFVGHTKDVLSVAFSL---DNRQIVSASRDRT  128

Query  391  IKIWDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYT  218
            IK+W+   E K  +          SE   EG+        + C   S N    T+ S   
Sbjct  129  IKLWNTLGECKYTI----------SEGGGEGH-----RDWVSCVRFSPNTLQPTIVSASW  173

Query  217  DGVIRVWGIGRY*MEEFRRSHMIIGHVCYLS  125
            D  ++VW      +   +    + GH  Y+S
Sbjct  174  DKTVKVWN-----LSNCKLRSTLAGHTGYVS  199



>ref|XP_006305339.1| hypothetical protein CARUB_v10009720mg [Capsella rubella]
 gb|EOA38237.1| hypothetical protein CARUB_v10009720mg [Capsella rubella]
Length=328

 Score =   326 bits (836),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 156/192 (81%), Positives = 172/192 (90%), Gaps = 2/192 (1%)
 Frame = -1

Query  751  ECKYTIQDG--DGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTG  578
            ECKYTI +G  +GH +WVSCVRFSP+TL PTIVS SWD+TVKVWNLSNCKLRSTLAGHTG
Sbjct  137  ECKYTISEGGGEGHRDWVSCVRFSPNTLHPTIVSASWDKTVKVWNLSNCKLRSTLAGHTG  196

Query  577  YVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATE  398
            YV+TVAVSPDGSLCASGGKDGV+LLWDLAEGKKLYSL+A S+IHALCFSPNRYWLCAATE
Sbjct  197  YVSTVAVSPDGSLCASGGKDGVVLLWDLAEGKKLYSLEANSVIHALCFSPNRYWLCAATE  256

Query  397  ASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYT  218
              IKIWDLESKSIV DL+VDLK E+E +      A K K+I+CTSL+W+ADGSTLFSGYT
Sbjct  257  QGIKIWDLESKSIVEDLKVDLKAEAEKADNSGPAATKRKVIYCTSLNWSADGSTLFSGYT  316

Query  217  DGVIRVWGIGRY  182
            DGVIRVWGIGRY
Sbjct  317  DGVIRVWGIGRY  328


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 55/211 (26%), Positives = 89/211 (42%), Gaps = 36/211 (17%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  557
             H + V+ +  +P      IVS S D+++ +W L+         +  L GH+ +V  V +
Sbjct  13   AHTDMVTAIA-TPIDNADIIVSASRDKSIILWKLTKDDKAYGVAQRRLTGHSHFVEDVVL  71

Query  556  SPDGSLCASGGKDGVILLWDLAEGKKL-----YSLDAGSIIHALCFSPNRYWLCAATEAS  392
            S DG    SG  DG + LWDLA G        ++ D  S+  +L    NR  + A+ + +
Sbjct  72   SSDGQFALSGSWDGELRLWDLAAGVSTRRFVGHTKDVLSVAFSL---DNRQIVSASRDRT  128

Query  391  IKIWDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYT  218
            IK+W+   E K  +          SE   EG+        + C   S N    T+ S   
Sbjct  129  IKLWNTLGECKYTI----------SEGGGEGH-----RDWVSCVRFSPNTLHPTIVSASW  173

Query  217  DGVIRVWGIGRY*MEEFRRSHMIIGHVCYLS  125
            D  ++VW      +   +    + GH  Y+S
Sbjct  174  DKTVKVWN-----LSNCKLRSTLAGHTGYVS  199



>ref|NP_175296.1| receptor for activated C kinase 1B [Arabidopsis thaliana]
 sp|Q9C4Z6.1|GPLPB_ARATH RecName: Full=Guanine nucleotide-binding protein subunit beta-like 
protein B; AltName: Full=Receptor for activated C kinase 
1B [Arabidopsis thaliana]
 gb|AAG50846.1|AC074308_2 guanine nucleotide-binding protein, putative [Arabidopsis thaliana]
 gb|AAG60127.1|AC073555_11 guanine nucleotide-binding protein, putative [Arabidopsis thaliana]
 gb|AAL24080.1| putative guanine nucleotide-binding protein [Arabidopsis thaliana]
 gb|AAM14291.1| putative guanine nucleotide-binding protein [Arabidopsis thaliana]
 gb|AEE32329.1| receptor for activated C kinase 1B [Arabidopsis thaliana]
Length=326

 Score =   326 bits (836),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 153/190 (81%), Positives = 171/190 (90%), Gaps = 0/190 (0%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTI + DGH EWVSCVRFSP+TL PTIVS SWD+TVKVWNL NCKLR+TLAGH+GY+
Sbjct  137  ECKYTISEADGHKEWVSCVRFSPNTLVPTIVSASWDKTVKVWNLQNCKLRNTLAGHSGYL  196

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+AGSIIH+LCFSPNRYWLCAATE S
Sbjct  197  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAGSIIHSLCFSPNRYWLCAATENS  256

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            I+IWDLESKS+V DL+VDLK E+E +        K K+I+CTSL+W+ADG+TLFSGYTDG
Sbjct  257  IRIWDLESKSVVEDLKVDLKAEAEKTDGSTGIGNKTKVIYCTSLNWSADGNTLFSGYTDG  316

Query  211  VIRVWGIGRY  182
            VIRVWGIGRY
Sbjct  317  VIRVWGIGRY  326


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 48/208 (23%), Positives = 91/208 (44%), Gaps = 32/208 (15%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  557
             H + V+ +  +P      IV+ S D+++ +W L+         +  + GH+ +V  V +
Sbjct  13   AHTDMVTAIA-TPVDNSDVIVTSSRDKSIILWKLTKEDKSYGVAQRRMTGHSHFVQDVVL  71

Query  556  SPDGSLCASGGKDGVILLWDLAEGK--KLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  383
            S DG    SG  DG + LWDLA G+  + +      ++     + NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLATGESTRRFVGHTKDVLSVAFSTDNRQIVSASRDRTIKL  131

Query  382  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            W+   E K  + +            A+G+      + + C   S N    T+ S   D  
Sbjct  132  WNTLGECKYTISE------------ADGH-----KEWVSCVRFSPNTLVPTIVSASWDKT  174

Query  208  IRVWGIGRY*MEEFRRSHMIIGHVCYLS  125
            ++VW      ++  +  + + GH  YL+
Sbjct  175  VKVWN-----LQNCKLRNTLAGHSGYLN  197


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 53/185 (29%), Positives = 81/185 (44%), Gaps = 27/185 (15%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  542
            GH+ +V  V  S        +SGSWD  +++W+L+  +      GHT  V +VA S D  
Sbjct  61   GHSHFVQDVVLSSD--GQFALSGSWDGELRLWDLATGESTRRFVGHTKDVLSVAFSTDNR  118

Query  541  LCASGGKDGVILLWD-LAEGKKLYSLDAGSIIHALC--FSPNRY---WLCAATEASIKIW  380
               S  +D  I LW+ L E K   S   G      C  FSPN      + A+ + ++K+W
Sbjct  119  QIVSASRDRTIKLWNTLGECKYTISEADGHKEWVSCVRFSPNTLVPTIVSASWDKTVKVW  178

Query  379  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRV  200
            +L++      LR  L   S                +  +++ + DGS   SG  DGVI +
Sbjct  179  NLQN----CKLRNTLAGHSG---------------YLNTVAVSPDGSLCASGGKDGVILL  219

Query  199  WGIGR  185
            W +  
Sbjct  220  WDLAE  224



>ref|XP_010476972.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Camelina sativa]
Length=328

 Score =   326 bits (836),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 155/192 (81%), Positives = 172/192 (90%), Gaps = 2/192 (1%)
 Frame = -1

Query  751  ECKYTIQDG--DGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTG  578
            ECKYTI +G  +GH +WVSCVRFSP+TLQPTIVS SWD+TVKVWNLSNCKLRSTLAGHTG
Sbjct  137  ECKYTISEGGGEGHRDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLSNCKLRSTLAGHTG  196

Query  577  YVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATE  398
            YV+TVAVSPDGSLCASGGKDGV+LLWDLAEGKKLYS +A S+IHALCFSPNRYWLCAATE
Sbjct  197  YVSTVAVSPDGSLCASGGKDGVVLLWDLAEGKKLYSFEANSVIHALCFSPNRYWLCAATE  256

Query  397  ASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYT  218
              IKIWDLESK+IV DL+VDLK E+E +      A K K+I+CTSL+W+ADGSTLFSGYT
Sbjct  257  QGIKIWDLESKTIVEDLKVDLKAEAEKADNSGPAATKRKVIYCTSLNWSADGSTLFSGYT  316

Query  217  DGVIRVWGIGRY  182
            DGVIRVWGIGRY
Sbjct  317  DGVIRVWGIGRY  328


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 55/211 (26%), Positives = 89/211 (42%), Gaps = 36/211 (17%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  557
             H + V+ +  +P      IVS S D+++ +W L+         +  L GH+ +V  V +
Sbjct  13   AHTDMVTAIA-TPIDNADIIVSASRDKSIILWKLTKDDKSYGVAQRRLTGHSHFVEDVVL  71

Query  556  SPDGSLCASGGKDGVILLWDLAEGKKL-----YSLDAGSIIHALCFSPNRYWLCAATEAS  392
            S DG    SG  DG + LWDLA G        ++ D  S+  +L    NR  + A+ + +
Sbjct  72   SSDGQFALSGSWDGELRLWDLAAGVSTRRFVGHTKDVLSVAFSL---DNRQIVSASRDRT  128

Query  391  IKIWDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYT  218
            IK+W+   E K  +          SE   EG+        + C   S N    T+ S   
Sbjct  129  IKLWNTLGECKYTI----------SEGGGEGH-----RDWVSCVRFSPNTLQPTIVSASW  173

Query  217  DGVIRVWGIGRY*MEEFRRSHMIIGHVCYLS  125
            D  ++VW      +   +    + GH  Y+S
Sbjct  174  DKTVKVWN-----LSNCKLRSTLAGHTGYVS  199



>ref|XP_002318528.1| GTP-binding protein beta chain [Populus trichocarpa]
 gb|EEE96748.1| GTP-binding protein beta chain [Populus trichocarpa]
Length=328

 Score =   326 bits (836),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 156/191 (82%), Positives = 173/191 (91%), Gaps = 1/191 (1%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTIQ+ + H +WVSCVRFSPSTLQPTIVS SWD+TVKVWNL+NCKLRSTLAGH+GYV
Sbjct  138  ECKYTIQEAESHTDWVSCVRFSPSTLQPTIVSASWDKTVKVWNLTNCKLRSTLAGHSGYV  197

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG++I+ALCFSPNRYWLCAATE S
Sbjct  198  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGAVINALCFSPNRYWLCAATENS  257

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTA-AKNKIIFCTSLSWNADGSTLFSGYTD  215
            IKIWDLESK +V DL+VDLK E+E S     TA +  K I+CTSL+W+ADGSTLFSGYTD
Sbjct  258  IKIWDLESKMVVDDLKVDLKAEAEKSEGTTATAVSTKKKIYCTSLNWSADGSTLFSGYTD  317

Query  214  GVIRVWGIGRY  182
            GVIRVWG+GRY
Sbjct  318  GVIRVWGVGRY  328


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 61/123 (50%), Gaps = 10/123 (8%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  557
             H + V+ +  +P      IVS S D+++ +W+L+  +      R  L GH+ +V  V +
Sbjct  14   AHTDQVTAIA-TPIDNTDMIVSASRDKSIILWHLTKDEKTYGVARRRLTGHSHFVQDVVL  72

Query  556  SPDGSLCASGGKDGVILLWDLAEG---KKLYSLDAGSIIHALCFSPNRYWLCAATEASIK  386
            S DG    SG  DG + LWDLA G   ++        +  A  F  NR  + A+ + +IK
Sbjct  73   SSDGQFALSGSWDGELRLWDLATGVSARRFVGHTKDVLSVAFSFD-NRQIVSASRDKTIK  131

Query  385  IWD  377
            +W+
Sbjct  132  LWN  134



>ref|XP_011039103.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Populus euphratica]
Length=328

 Score =   326 bits (836),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 156/191 (82%), Positives = 173/191 (91%), Gaps = 1/191 (1%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTIQ+ + H +WVSCVRFSPSTLQPTIVS SWD+TVKVWNL+NCKLRSTLAGH+GYV
Sbjct  138  ECKYTIQEAESHTDWVSCVRFSPSTLQPTIVSASWDKTVKVWNLTNCKLRSTLAGHSGYV  197

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG++I+ALCFSPNRYWLCAATE S
Sbjct  198  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGAVINALCFSPNRYWLCAATENS  257

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTA-AKNKIIFCTSLSWNADGSTLFSGYTD  215
            IKIWDLESK +V DL+VDLK E+E S     TA +  K I+CTSL+W+ADGSTLFSGYTD
Sbjct  258  IKIWDLESKMVVDDLKVDLKAEAEKSEGTTATAVSTKKKIYCTSLNWSADGSTLFSGYTD  317

Query  214  GVIRVWGIGRY  182
            GVIRVWG+GRY
Sbjct  318  GVIRVWGVGRY  328


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 61/123 (50%), Gaps = 10/123 (8%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  557
             H + V+ +  +P      IVS S D+++ +W+L+  +      R  L GH+ +V  V +
Sbjct  14   AHTDQVTAIA-TPIDNTDMIVSSSRDKSIILWHLTKDEKTYGVARRRLTGHSHFVQDVVL  72

Query  556  SPDGSLCASGGKDGVILLWDLAEG---KKLYSLDAGSIIHALCFSPNRYWLCAATEASIK  386
            S DG    SG  DG + LWDLA G   ++        +  A  F  NR  + A+ + +IK
Sbjct  73   SSDGQFALSGSWDGELRLWDLATGVSARRFVGHTKDVLSVAFSFD-NRQIVSASRDKTIK  131

Query  385  IWD  377
            +W+
Sbjct  132  LWN  134



>ref|XP_007209348.1| hypothetical protein PRUPE_ppa008536mg [Prunus persica]
 gb|EMJ10547.1| hypothetical protein PRUPE_ppa008536mg [Prunus persica]
Length=327

 Score =   326 bits (836),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 156/191 (82%), Positives = 172/191 (90%), Gaps = 1/191 (1%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECK+TIQD DGH +WVSCVRFSP+TLQPTIVS SWD+TVKVWNL+NCKLR TL GH GYV
Sbjct  137  ECKFTIQDQDGHGDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLTNCKLRCTLEGHNGYV  196

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTVAVSPDGSLCASGGKDGVILLWDLAEGK LYSL AG+IIHALCFSPNRYWLCAATE S
Sbjct  197  NTVAVSPDGSLCASGGKDGVILLWDLAEGKMLYSLGAGAIIHALCFSPNRYWLCAATEQS  256

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGN-NTAAKNKIIFCTSLSWNADGSTLFSGYTD  215
            IKIWDLESK IV DL+VDLK E+E + + +  TA K K+I+CTSL+W+ADGSTLFSGY+D
Sbjct  257  IKIWDLESKQIVEDLKVDLKTEAEKTEDTHAATAYKKKVIYCTSLNWSADGSTLFSGYSD  316

Query  214  GVIRVWGIGRY  182
            GVIRVWGIGRY
Sbjct  317  GVIRVWGIGRY  327


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 59/231 (26%), Positives = 98/231 (42%), Gaps = 35/231 (15%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  557
             H + V+ +   P      IVS S D+++ +W+L+  +      R  L GH+ +V  V +
Sbjct  13   AHTDMVTAIAI-PIDNSEMIVSASRDKSIILWHLTKDEKTYGVPRRRLTGHSHFVQDVVL  71

Query  556  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  383
            S DG    SG  DG + LWDLA G   + +      ++       NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLALGVSARRFVGHTKDVLSVAFSIDNRQIVSASRDRTIKL  131

Query  382  WDL--ESKSIVVD------------LRVDLKQESEMSAEGNNTAA----KNKIIFCT---  266
            W+   E K  + D               +  Q + +SA  + T       N  + CT   
Sbjct  132  WNTLGECKFTIQDQDGHGDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLTNCKLRCTLEG  191

Query  265  ------SLSWNADGSTLFSGYTDGVIRVWGIGRY*MEEFRRSHMIIGHVCY  131
                  +++ + DGS   SG  DGVI +W +    M     +  II  +C+
Sbjct  192  HNGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKMLYSLGAGAIIHALCF  242



>ref|XP_008240184.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Prunus mume]
Length=327

 Score =   326 bits (836),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 156/191 (82%), Positives = 172/191 (90%), Gaps = 1/191 (1%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECK+TIQD DGH +WVSCVRFSP+TLQPTIVS SWD+TVKVWNL+NCKLR TL GH GYV
Sbjct  137  ECKFTIQDQDGHGDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLTNCKLRCTLEGHNGYV  196

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTVAVSPDGSLCASGGKDGVILLWDLAEGK LYSL AG+IIHALCFSPNRYWLCAATE S
Sbjct  197  NTVAVSPDGSLCASGGKDGVILLWDLAEGKMLYSLGAGAIIHALCFSPNRYWLCAATEQS  256

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGN-NTAAKNKIIFCTSLSWNADGSTLFSGYTD  215
            IKIWDLESK IV DL+VDLK E+E + + +  TA K K+I+CTSL+W+ADGSTLFSGY+D
Sbjct  257  IKIWDLESKQIVEDLKVDLKTEAEKTEDTHAATAYKKKVIYCTSLNWSADGSTLFSGYSD  316

Query  214  GVIRVWGIGRY  182
            GVIRVWGIGRY
Sbjct  317  GVIRVWGIGRY  327


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 59/231 (26%), Positives = 98/231 (42%), Gaps = 35/231 (15%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  557
             H + V+ +   P      IVS S D+++ +W+L+  +      R  L GH+ +V  V +
Sbjct  13   AHTDMVTAIAI-PIDNSEMIVSASRDKSIILWHLTKDEKTYGVPRRRLTGHSHFVQDVVL  71

Query  556  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  383
            S DG    SG  DG + LWDLA G   + +      ++       NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLALGVSARRFVGHTKDVLSVAFSIDNRQIVSASRDRTIKL  131

Query  382  WDL--ESKSIVVD------------LRVDLKQESEMSAEGNNTAA----KNKIIFCT---  266
            W+   E K  + D               +  Q + +SA  + T       N  + CT   
Sbjct  132  WNTLGECKFTIQDQDGHGDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLTNCKLRCTLEG  191

Query  265  ------SLSWNADGSTLFSGYTDGVIRVWGIGRY*MEEFRRSHMIIGHVCY  131
                  +++ + DGS   SG  DGVI +W +    M     +  II  +C+
Sbjct  192  HNGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKMLYSLGAGAIIHALCF  242



>ref|XP_011039104.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Populus euphratica]
Length=328

 Score =   326 bits (835),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 156/191 (82%), Positives = 173/191 (91%), Gaps = 1/191 (1%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTIQ+ + H +WVSCVRFSPSTLQPTIVS SWD+TVKVWNL+NCKLRSTLAGH+GYV
Sbjct  138  ECKYTIQEAESHTDWVSCVRFSPSTLQPTIVSASWDKTVKVWNLTNCKLRSTLAGHSGYV  197

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG++I+ALCFSPNRYWLCAATE S
Sbjct  198  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGAVINALCFSPNRYWLCAATENS  257

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTA-AKNKIIFCTSLSWNADGSTLFSGYTD  215
            IKIWDLESK +V DL+VDLK E+E S     TA +  K I+CTSL+W+ADGSTLFSGYTD
Sbjct  258  IKIWDLESKLVVDDLKVDLKAEAEKSEGTTATAVSTKKKIYCTSLNWSADGSTLFSGYTD  317

Query  214  GVIRVWGIGRY  182
            GVIRVWG+GRY
Sbjct  318  GVIRVWGVGRY  328


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 61/123 (50%), Gaps = 10/123 (8%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  557
             H + V+ +  +P      IVS S D+++ +W+L+  +      R  L GH+ +V  V +
Sbjct  14   AHTDQVTAIA-TPIDNTDMIVSSSRDKSIILWHLTKDEKTYGVARRRLTGHSHFVQDVVL  72

Query  556  SPDGSLCASGGKDGVILLWDLAEG---KKLYSLDAGSIIHALCFSPNRYWLCAATEASIK  386
            S DG    SG  DG + LWDLA G   ++        +  A  F  NR  + A+ + +IK
Sbjct  73   SSDGQFALSGSWDGELRLWDLATGVSARRFVGHTKDVLSVAFSFD-NRQIVSASRDKTIK  131

Query  385  IWD  377
            +W+
Sbjct  132  LWN  134



>ref|XP_010487724.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein C [Camelina sativa]
Length=326

 Score =   325 bits (833),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 152/190 (80%), Positives = 171/190 (90%), Gaps = 0/190 (0%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTI +GDGH EW+SCVRFSP+TL PTIVS SWD TVKVWNL NCKL+++L GHTGY+
Sbjct  137  ECKYTISEGDGHKEWISCVRFSPNTLVPTIVSASWDHTVKVWNLQNCKLKNSLVGHTGYL  196

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+AGSIIH+LCFSPNRYWLCAATE S
Sbjct  197  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAGSIIHSLCFSPNRYWLCAATENS  256

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            IKIWDLESK +V DL+VDLK E+E +  G  T  + K+I+CTSL+W+ADGSTLFSGYTDG
Sbjct  257  IKIWDLESKLVVEDLKVDLKAEAEKADGGVGTGNQKKVIYCTSLNWSADGSTLFSGYTDG  316

Query  211  VIRVWGIGRY  182
            V+RVWGIGRY
Sbjct  317  VVRVWGIGRY  326


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 49/205 (24%), Positives = 88/205 (43%), Gaps = 28/205 (14%)
 Frame = -1

Query  718  HNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAVS  554
            H + V+ +  +P      IV+ S D+++ +W L+         +  L GH+ +V  V +S
Sbjct  14   HTDMVTAIA-TPIDNSDIIVTASRDKSIILWKLTKDDKSYGVAQRRLTGHSHFVEDVVLS  72

Query  553  PDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIW  380
             DG    SG  DG + LWDLA G   + +      ++       NR  + A+ + +IK+W
Sbjct  73   SDGQFALSGSWDGELRLWDLATGVSTRRFVGHTKDVLSVAFSVDNRQIVSASRDRTIKLW  132

Query  379  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRV  200
            +             L +     +EG+      + I C   S N    T+ S   D  ++V
Sbjct  133  NT------------LGECKYTISEGD---GHKEWISCVRFSPNTLVPTIVSASWDHTVKV  177

Query  199  WGIGRY*MEEFRRSHMIIGHVCYLS  125
            W      ++  +  + ++GH  YL+
Sbjct  178  WN-----LQNCKLKNSLVGHTGYLN  197


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 52/189 (28%), Positives = 81/189 (43%), Gaps = 35/189 (19%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  542
            GH+ +V  V  S        +SGSWD  +++W+L+         GHT  V +VA S D  
Sbjct  61   GHSHFVEDVVLSSD--GQFALSGSWDGELRLWDLATGVSTRRFVGHTKDVLSVAFSVDNR  118

Query  541  LCASGGKDGVILLWD-LAEGKKLYSLDAGSI--IHALCFSPNRY---WLCAATEASIKIW  380
               S  +D  I LW+ L E K   S   G    I  + FSPN      + A+ + ++K+W
Sbjct  119  QIVSASRDRTIKLWNTLGECKYTISEGDGHKEWISCVRFSPNTLVPTIVSASWDHTVKVW  178

Query  379  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKII----FCTSLSWNADGSTLFSGYTDG  212
            +L+                       N   KN ++    +  +++ + DGS   SG  DG
Sbjct  179  NLQ-----------------------NCKLKNSLVGHTGYLNTVAVSPDGSLCASGGKDG  215

Query  211  VIRVWGIGR  185
            VI +W +  
Sbjct  216  VILLWDLAE  224



>emb|CDY64888.1| BnaC06g40840D [Brassica napus]
Length=299

 Score =   323 bits (829),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 154/193 (80%), Positives = 173/193 (90%), Gaps = 3/193 (2%)
 Frame = -1

Query  751  ECKYTI---QDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHT  581
            ECKYTI   Q GDGH +WVSCVRFSP+TL PTIVS SWD+TVKVWNL NCKLR+TLAGH+
Sbjct  107  ECKYTIGSDQGGDGHKQWVSCVRFSPNTLVPTIVSASWDQTVKVWNLQNCKLRNTLAGHS  166

Query  580  GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAAT  401
            GY+NTVAVSPDGSLCASGGKDG ILLWDLAEGKKLYSL+AG+IIH+LCFSPNRYWLCAAT
Sbjct  167  GYLNTVAVSPDGSLCASGGKDGAILLWDLAEGKKLYSLEAGAIIHSLCFSPNRYWLCAAT  226

Query  400  EASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGY  221
            E SI+IWDLESKS+V DL+VDLK E+EMS     T  K K+I+CTSL+W+ADGSTLFSGY
Sbjct  227  ENSIRIWDLESKSVVEDLKVDLKAEAEMSDASVGTGNKTKVIYCTSLNWSADGSTLFSGY  286

Query  220  TDGVIRVWGIGRY  182
            TDGVIRVWG+GR+
Sbjct  287  TDGVIRVWGLGRF  299


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 56/206 (27%), Positives = 87/206 (42%), Gaps = 30/206 (15%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  542
            GH+ +V  V  S        +SGSWD  +++W+L+         GHT  V +VA S D  
Sbjct  31   GHSHFVEDVALSSD--GQFALSGSWDGELRLWDLATGVSTRRFVGHTKDVLSVAFSTDNR  88

Query  541  LCASGGKDGVILLWD-LAEGKKLYSLDAGSIIHA-----LCFSPNRY---WLCAATEASI  389
               S  +DG I LW+ L E K     D G   H      + FSPN      + A+ + ++
Sbjct  89   QIVSASRDGTIKLWNTLGECKYTIGSDQGGDGHKQWVSCVRFSPNTLVPTIVSASWDQTV  148

Query  388  KIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            K+W+L++      LR  L   S                +  +++ + DGS   SG  DG 
Sbjct  149  KVWNLQN----CKLRNTLAGHSG---------------YLNTVAVSPDGSLCASGGKDGA  189

Query  208  IRVWGIGRY*MEEFRRSHMIIGHVCY  131
            I +W +          +  II  +C+
Sbjct  190  ILLWDLAEGKKLYSLEAGAIIHSLCF  215



>ref|XP_010500401.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein B [Camelina sativa]
Length=326

 Score =   324 bits (830),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 151/190 (79%), Positives = 173/190 (91%), Gaps = 0/190 (0%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTI +GDGH++WVSCVRFSP+TL PTIVS SWD+TVKVWNL NCKLR+TLAGH+GY+
Sbjct  137  ECKYTITEGDGHSDWVSCVRFSPNTLVPTIVSASWDKTVKVWNLQNCKLRNTLAGHSGYL  196

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+AGS+IH+LCFSPNRYWLCAATE S
Sbjct  197  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAGSVIHSLCFSPNRYWLCAATENS  256

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            I+IWDLESK++V DL+VDLK E+E S        K K+I+CTSL+W+ADG+TLFSGYTDG
Sbjct  257  IRIWDLESKTVVEDLKVDLKVEAEKSDGAVGIGNKTKVIYCTSLNWSADGNTLFSGYTDG  316

Query  211  VIRVWGIGRY  182
            +IRVWGIGRY
Sbjct  317  IIRVWGIGRY  326


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 47/206 (23%), Positives = 88/206 (43%), Gaps = 28/206 (14%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  557
             H + V+ +  +P      IV+ S D+++ +W L+         +  + GH+ +V  V +
Sbjct  13   AHTDMVTAIA-TPIDNSDVIVTSSRDKSIILWKLTKEDKSYGVAQRRMTGHSHFVQDVVL  71

Query  556  SPDGSLCASGGKDGVILLWDLAEGK--KLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  383
            S DG    SG  DG + LWDLA G+  + +      ++     + NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLATGESTRRFVGHTKDVLSVAFSTDNRQIVSASRDRTIKL  131

Query  382  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  203
            W+             L +      EG+     +  + C   S N    T+ S   D  ++
Sbjct  132  WNT------------LGECKYTITEGD---GHSDWVSCVRFSPNTLVPTIVSASWDKTVK  176

Query  202  VWGIGRY*MEEFRRSHMIIGHVCYLS  125
            VW      ++  +  + + GH  YL+
Sbjct  177  VWN-----LQNCKLRNTLAGHSGYLN  197


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 52/187 (28%), Positives = 84/187 (45%), Gaps = 31/187 (17%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  542
            GH+ +V  V  S        +SGSWD  +++W+L+  +      GHT  V +VA S D  
Sbjct  61   GHSHFVQDVVLSSD--GQFALSGSWDGELRLWDLATGESTRRFVGHTKDVLSVAFSTDNR  118

Query  541  LCASGGKDGVILLWD-LAEGKKLYSLDAG----SIIHALCFSPNRY---WLCAATEASIK  386
               S  +D  I LW+ L E K  Y++  G      +  + FSPN      + A+ + ++K
Sbjct  119  QIVSASRDRTIKLWNTLGECK--YTITEGDGHSDWVSCVRFSPNTLVPTIVSASWDKTVK  176

Query  385  IWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVI  206
            +W+L++      LR  L   S                +  +++ + DGS   SG  DGVI
Sbjct  177  VWNLQN----CKLRNTLAGHSG---------------YLNTVAVSPDGSLCASGGKDGVI  217

Query  205  RVWGIGR  185
             +W +  
Sbjct  218  LLWDLAE  224



>ref|XP_006393380.1| hypothetical protein EUTSA_v10011646mg [Eutrema salsugineum]
 gb|ESQ30666.1| hypothetical protein EUTSA_v10011646mg [Eutrema salsugineum]
Length=327

 Score =   324 bits (830),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 154/191 (81%), Positives = 172/191 (90%), Gaps = 1/191 (1%)
 Frame = -1

Query  751  ECKYTIQD-GDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  575
            ECKYTI D GDGH EWVSCVRFSP+ L PTIVS SWD TVKVWNL NCKL++TLAGH+GY
Sbjct  137  ECKYTISDQGDGHKEWVSCVRFSPNMLVPTIVSASWDHTVKVWNLQNCKLKNTLAGHSGY  196

Query  574  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  395
            +NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+AGS+IH+LCFSPNRYWLCAATE+
Sbjct  197  LNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAGSVIHSLCFSPNRYWLCAATES  256

Query  394  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  215
            SI+IWDLESKS+V DL+VDLK E+E S     T  K K+I+CTSL+W+ADG+TLFSGYTD
Sbjct  257  SIRIWDLESKSVVEDLKVDLKAEAEKSDGSAGTGNKTKVIYCTSLNWSADGNTLFSGYTD  316

Query  214  GVIRVWGIGRY  182
            GVIRVWGIGRY
Sbjct  317  GVIRVWGIGRY  327


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 49/208 (24%), Positives = 90/208 (43%), Gaps = 31/208 (15%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  557
             H + V+ +  +P      IV+ S D+++ +W L+         +  L GH+ +V  V +
Sbjct  13   AHTDMVTAIA-TPIDNSDIIVTSSRDKSIILWKLTKEDKSYGVAQRRLTGHSHFVEDVVL  71

Query  556  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  383
            S DG    SG  DG + LWDLA G   + +   +  ++     + NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLATGVSTRRFVGHSKDVLSVAFSADNRQIVSASRDRTIKL  131

Query  382  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            W+   E K  + D             +G+      + + C   S N    T+ S   D  
Sbjct  132  WNTLGECKYTISD-------------QGD---GHKEWVSCVRFSPNMLVPTIVSASWDHT  175

Query  208  IRVWGIGRY*MEEFRRSHMIIGHVCYLS  125
            ++VW      ++  +  + + GH  YL+
Sbjct  176  VKVWN-----LQNCKLKNTLAGHSGYLN  198



>gb|AAM65407.1| guanine nucleotide-binding protein, putative [Arabidopsis thaliana]
Length=326

 Score =   324 bits (830),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 152/190 (80%), Positives = 170/190 (89%), Gaps = 0/190 (0%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTI + DGH EWVSCVRFSP+TL PTIVS SWD+TVKVWNL NCKLR+TLAGH+GY+
Sbjct  137  ECKYTISEADGHKEWVSCVRFSPNTLVPTIVSASWDKTVKVWNLQNCKLRNTLAGHSGYL  196

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+AGSIIH+LCFSPNRYWLCAATE S
Sbjct  197  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAGSIIHSLCFSPNRYWLCAATENS  256

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            I+IWDLESKS+V DL+VDLK E+E +        K K+I+CTSL+W+ADG+TLFSGYT G
Sbjct  257  IRIWDLESKSVVEDLKVDLKAEAEKTDGSTGIGNKTKVIYCTSLNWSADGNTLFSGYTHG  316

Query  211  VIRVWGIGRY  182
            VIRVWGIGRY
Sbjct  317  VIRVWGIGRY  326


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 53/185 (29%), Positives = 81/185 (44%), Gaps = 27/185 (15%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  542
            GH+ +V  V  S        +SGSWD  +++W+L+  +      GHT  V +VA S D  
Sbjct  61   GHSHFVQDVVLSSD--GQFALSGSWDGELRLWDLATGESTRRFVGHTKDVLSVAFSTDNR  118

Query  541  LCASGGKDGVILLWD-LAEGKKLYSLDAGSIIHALC--FSPNRY---WLCAATEASIKIW  380
               S  +D  I LW+ L E K   S   G      C  FSPN      + A+ + ++K+W
Sbjct  119  QIVSASRDRTIKLWNTLGECKYTISEADGHKEWVSCVRFSPNTLVPTIVSASWDKTVKVW  178

Query  379  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRV  200
            +L++      LR  L   S                +  +++ + DGS   SG  DGVI +
Sbjct  179  NLQN----CKLRNTLAGHSG---------------YLNTVAVSPDGSLCASGGKDGVILL  219

Query  199  WGIGR  185
            W +  
Sbjct  220  WDLAE  224


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 48/208 (23%), Positives = 91/208 (44%), Gaps = 32/208 (15%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  557
             H + V+ +  +P      IV+ S D+++ +W L+         +  + GH+ +V  V +
Sbjct  13   AHTDMVTAIA-TPVDNSDVIVTSSRDKSIILWKLTKEDKSYGVAQRRMTGHSHFVQDVVL  71

Query  556  SPDGSLCASGGKDGVILLWDLAEGK--KLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  383
            S DG    SG  DG + LWDLA G+  + +      ++     + NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLATGESTRRFVGHTKDVLSVAFSTDNRQIVSASRDRTIKL  131

Query  382  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            W+   E K  + +            A+G+      + + C   S N    T+ S   D  
Sbjct  132  WNTLGECKYTISE------------ADGH-----KEWVSCVRFSPNTLVPTIVSASWDKT  174

Query  208  IRVWGIGRY*MEEFRRSHMIIGHVCYLS  125
            ++VW      ++  +  + + GH  YL+
Sbjct  175  VKVWN-----LQNCKLRNTLAGHSGYLN  197



>ref|XP_010465892.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein C [Camelina sativa]
Length=326

 Score =   324 bits (830),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 151/190 (79%), Positives = 171/190 (90%), Gaps = 0/190 (0%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTI +GDGH EW+SCVRFSP+T  PTIVS SWD TVKVWNL NCKL+++L GHTGY+
Sbjct  137  ECKYTISEGDGHKEWISCVRFSPNTHVPTIVSASWDHTVKVWNLQNCKLKNSLVGHTGYL  196

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+AGSIIH+LCFSPNRYWLCAATE S
Sbjct  197  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAGSIIHSLCFSPNRYWLCAATENS  256

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            IKIWDLESK++V DL+VDLK E+E +  G  T  + K+I+CTSL+W+ADGSTLFSGYTDG
Sbjct  257  IKIWDLESKTVVEDLKVDLKAEAEKADGGVGTGNQKKVIYCTSLNWSADGSTLFSGYTDG  316

Query  211  VIRVWGIGRY  182
            V+RVWGIGRY
Sbjct  317  VVRVWGIGRY  326


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 49/205 (24%), Positives = 88/205 (43%), Gaps = 28/205 (14%)
 Frame = -1

Query  718  HNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAVS  554
            H + V+ +  +P      IV+ S D+++ +W L+         +  L GH+ +V  V +S
Sbjct  14   HTDMVTAIA-TPIDNSDIIVTASRDKSIILWKLTKDDKSYGVAQRRLTGHSHFVEDVVLS  72

Query  553  PDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIW  380
             DG    SG  DG + LWDLA G   + +      ++       NR  + A+ + +IK+W
Sbjct  73   SDGQFALSGSWDGELRLWDLATGVSTRRFVGHTKDVLSVAFSVDNRQIVSASRDCTIKLW  132

Query  379  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRV  200
            +             L +     +EG+      + I C   S N    T+ S   D  ++V
Sbjct  133  NT------------LGECKYTISEGD---GHKEWISCVRFSPNTHVPTIVSASWDHTVKV  177

Query  199  WGIGRY*MEEFRRSHMIIGHVCYLS  125
            W      ++  +  + ++GH  YL+
Sbjct  178  WN-----LQNCKLKNSLVGHTGYLN  197


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 52/189 (28%), Positives = 82/189 (43%), Gaps = 35/189 (19%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  542
            GH+ +V  V  S        +SGSWD  +++W+L+         GHT  V +VA S D  
Sbjct  61   GHSHFVEDVVLSSD--GQFALSGSWDGELRLWDLATGVSTRRFVGHTKDVLSVAFSVDNR  118

Query  541  LCASGGKDGVILLWD-LAEGKKLYSLDAGSI--IHALCFSPNRY---WLCAATEASIKIW  380
               S  +D  I LW+ L E K   S   G    I  + FSPN +    + A+ + ++K+W
Sbjct  119  QIVSASRDCTIKLWNTLGECKYTISEGDGHKEWISCVRFSPNTHVPTIVSASWDHTVKVW  178

Query  379  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKII----FCTSLSWNADGSTLFSGYTDG  212
            +L+                       N   KN ++    +  +++ + DGS   SG  DG
Sbjct  179  NLQ-----------------------NCKLKNSLVGHTGYLNTVAVSPDGSLCASGGKDG  215

Query  211  VIRVWGIGR  185
            VI +W +  
Sbjct  216  VILLWDLAE  224



>gb|KFK39137.1| guanine nucleotide-binding protein subunit beta-like protein 
[Arabis alpina]
Length=327

 Score =   324 bits (830),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 154/191 (81%), Positives = 172/191 (90%), Gaps = 1/191 (1%)
 Frame = -1

Query  751  ECKYTI-QDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  575
            ECKYTI + GDGH EW+SCVRFSP+TL PTIVS SWD TVKVWNL NCKLR++LAGH+GY
Sbjct  137  ECKYTISEQGDGHKEWISCVRFSPNTLVPTIVSASWDHTVKVWNLQNCKLRNSLAGHSGY  196

Query  574  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  395
            +NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+AGSIIH+LCFSPNRYWLCAATE 
Sbjct  197  LNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAGSIIHSLCFSPNRYWLCAATEN  256

Query  394  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  215
            SIKIWDLESKS+V DL+VDLK E+E S  G     + K+I+CTSL+W+ADGSTLFSGYTD
Sbjct  257  SIKIWDLESKSVVEDLKVDLKAEAEKSDGGVGMGNQKKVIYCTSLNWSADGSTLFSGYTD  316

Query  214  GVIRVWGIGRY  182
            GV+RVWGIGRY
Sbjct  317  GVVRVWGIGRY  327


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 49/205 (24%), Positives = 88/205 (43%), Gaps = 27/205 (13%)
 Frame = -1

Query  718  HNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNL-----SNCKLRSTLAGHTGYVNTVAVS  554
            H + V+ +  +P      IV+ S D+++ +W L     S    +  L GH+ +V  V +S
Sbjct  14   HTDQVTAIA-TPIDNSDIIVTASRDKSIILWKLNKDDKSYGVAQRRLTGHSHFVEDVVLS  72

Query  553  PDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIW  380
             DG    SG  DG + LWDLA G   + +      ++       NR  + A+ + +IK+W
Sbjct  73   SDGQFALSGSWDGELRLWDLATGLTTRRFVGHTKDVLSVAFSVDNRQIVSASRDRTIKLW  132

Query  379  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRV  200
            +   +            +  +S +G+      + I C   S N    T+ S   D  ++V
Sbjct  133  NTLGEC-----------KYTISEQGD---GHKEWISCVRFSPNTLVPTIVSASWDHTVKV  178

Query  199  WGIGRY*MEEFRRSHMIIGHVCYLS  125
            W      ++  +  + + GH  YL+
Sbjct  179  WN-----LQNCKLRNSLAGHSGYLN  198



>ref|XP_006297909.1| hypothetical protein CARUB_v10013951mg, partial [Capsella rubella]
 gb|EOA30807.1| hypothetical protein CARUB_v10013951mg, partial [Capsella rubella]
Length=380

 Score =   325 bits (834),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 152/190 (80%), Positives = 171/190 (90%), Gaps = 0/190 (0%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTI +GDGH EW+SCVRFSP+T  PTIVS SWD TVKVWNL NCKL+++L GHTGY+
Sbjct  191  ECKYTISEGDGHKEWISCVRFSPNTNVPTIVSASWDHTVKVWNLQNCKLKNSLVGHTGYL  250

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+AGSIIH+LCFSPNRYWLCAATE S
Sbjct  251  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAGSIIHSLCFSPNRYWLCAATENS  310

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            IKIWDLESKS+V DL+VDLK E+E +  G  T  + K+I+CTSL+W+ADGSTLFSGYTDG
Sbjct  311  IKIWDLESKSVVEDLKVDLKAEAEKADGGVGTGNQKKVIYCTSLNWSADGSTLFSGYTDG  370

Query  211  VIRVWGIGRY  182
            V+RVWGIGRY
Sbjct  371  VVRVWGIGRY  380


 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 49/206 (24%), Positives = 89/206 (43%), Gaps = 28/206 (14%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  557
             H + V+ +  +P      IV+ S D+++ +W L+         +  L GH+ +V  V +
Sbjct  67   AHTDMVTAIA-TPIDNSDIIVTASRDKSIILWKLTKDDKSYGVAQRRLTGHSHFVEDVVL  125

Query  556  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  383
            S DG    SG  DG + LWDLA G   + +      ++       NR  + A+ + +IK+
Sbjct  126  SSDGQFALSGSWDGELRLWDLATGVSTRRFVGHTKDVLSVAFSVDNRQIVSASRDRTIKL  185

Query  382  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  203
            W+             L +     +EG+      + I C   S N +  T+ S   D  ++
Sbjct  186  WNT------------LGECKYTISEGD---GHKEWISCVRFSPNTNVPTIVSASWDHTVK  230

Query  202  VWGIGRY*MEEFRRSHMIIGHVCYLS  125
            VW      ++  +  + ++GH  YL+
Sbjct  231  VWN-----LQNCKLKNSLVGHTGYLN  251


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 52/189 (28%), Positives = 81/189 (43%), Gaps = 35/189 (19%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  542
            GH+ +V  V  S        +SGSWD  +++W+L+         GHT  V +VA S D  
Sbjct  115  GHSHFVEDVVLSSD--GQFALSGSWDGELRLWDLATGVSTRRFVGHTKDVLSVAFSVDNR  172

Query  541  LCASGGKDGVILLWD-LAEGKKLYSLDAGSI--IHALCFSPNR---YWLCAATEASIKIW  380
               S  +D  I LW+ L E K   S   G    I  + FSPN      + A+ + ++K+W
Sbjct  173  QIVSASRDRTIKLWNTLGECKYTISEGDGHKEWISCVRFSPNTNVPTIVSASWDHTVKVW  232

Query  379  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKII----FCTSLSWNADGSTLFSGYTDG  212
            +L+                       N   KN ++    +  +++ + DGS   SG  DG
Sbjct  233  NLQ-----------------------NCKLKNSLVGHTGYLNTVAVSPDGSLCASGGKDG  269

Query  211  VIRVWGIGR  185
            VI +W +  
Sbjct  270  VILLWDLAE  278



>ref|XP_010479287.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein B [Camelina sativa]
Length=326

 Score =   323 bits (827),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 150/190 (79%), Positives = 173/190 (91%), Gaps = 0/190 (0%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTI +GDGH++WVSCVRFSP+TL PTIVS SWD+TVKVWNL NCKLR+TLAGH+GY+
Sbjct  137  ECKYTITEGDGHSDWVSCVRFSPNTLVPTIVSASWDKTVKVWNLQNCKLRNTLAGHSGYL  196

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+AGS+IH+LCFSPNRYWLCAATE S
Sbjct  197  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAGSVIHSLCFSPNRYWLCAATENS  256

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            I+IWDLESK++V DL+VDLK E+E S        K K+I+CTSL+W+ADG+TLFSGYTDG
Sbjct  257  IRIWDLESKTVVEDLKVDLKVEAEKSDGAVGIGNKTKVIYCTSLNWSADGNTLFSGYTDG  316

Query  211  VIRVWGIGRY  182
            +IRVWGIGR+
Sbjct  317  IIRVWGIGRF  326


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 47/206 (23%), Positives = 88/206 (43%), Gaps = 28/206 (14%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  557
             H + V+ +  +P      IV+ S D+++ +W L+         +  + GH+ +V  V +
Sbjct  13   AHTDMVTAIA-TPIDNSDVIVTSSRDKSIILWKLTKEDKSYGVAQRRMTGHSHFVQDVVL  71

Query  556  SPDGSLCASGGKDGVILLWDLAEGK--KLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  383
            S DG    SG  DG + LWDLA G+  + +      ++     + NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLATGESTRRFVGHTKDVLSVAFSTDNRQIVSASRDRTIKL  131

Query  382  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  203
            W+             L +      EG+     +  + C   S N    T+ S   D  ++
Sbjct  132  WNT------------LGECKYTITEGD---GHSDWVSCVRFSPNTLVPTIVSASWDKTVK  176

Query  202  VWGIGRY*MEEFRRSHMIIGHVCYLS  125
            VW      ++  +  + + GH  YL+
Sbjct  177  VWN-----LQNCKLRNTLAGHSGYLN  197


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 52/187 (28%), Positives = 84/187 (45%), Gaps = 31/187 (17%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  542
            GH+ +V  V  S        +SGSWD  +++W+L+  +      GHT  V +VA S D  
Sbjct  61   GHSHFVQDVVLSSD--GQFALSGSWDGELRLWDLATGESTRRFVGHTKDVLSVAFSTDNR  118

Query  541  LCASGGKDGVILLWD-LAEGKKLYSLDAG----SIIHALCFSPNRY---WLCAATEASIK  386
               S  +D  I LW+ L E K  Y++  G      +  + FSPN      + A+ + ++K
Sbjct  119  QIVSASRDRTIKLWNTLGECK--YTITEGDGHSDWVSCVRFSPNTLVPTIVSASWDKTVK  176

Query  385  IWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVI  206
            +W+L++      LR  L   S                +  +++ + DGS   SG  DGVI
Sbjct  177  VWNLQN----CKLRNTLAGHSG---------------YLNTVAVSPDGSLCASGGKDGVI  217

Query  205  RVWGIGR  185
             +W +  
Sbjct  218  LLWDLAE  224



>sp|Q39336.1|GBLP_BRANA RecName: Full=Guanine nucleotide-binding protein subunit beta-like 
protein [Brassica napus]
 emb|CAA83924.1| guanine nucleotide regulatory protein [Brassica napus]
Length=327

 Score =   323 bits (827),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 154/191 (81%), Positives = 172/191 (90%), Gaps = 1/191 (1%)
 Frame = -1

Query  751  ECKYTIQDG-DGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  575
            ECKYTI +G +GH +WVSCVRFSP+TLQPTIVS S D+TVKVWNLSNCKLRSTLAGHTGY
Sbjct  137  ECKYTISEGGEGHRDWVSCVRFSPNTLQPTIVSASCDKTVKVWNLSNCKLRSTLAGHTGY  196

Query  574  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  395
            V+TVAVSPDGSLCASGGKDGV+LLWDLAEGKKLYSL+A S+IHALCF+PNRYWLCAATE 
Sbjct  197  VSTVAVSPDGSLCASGGKDGVVLLWDLAEGKKLYSLEANSVIHALCFTPNRYWLCAATEQ  256

Query  394  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  215
             IKIWDLESK++V DL+VDLK E+E S      A K K+I+CTSL+W+ADGSTLFSGYTD
Sbjct  257  GIKIWDLESKTVVEDLKVDLKAEAEKSDGSGTAATKRKVIYCTSLNWSADGSTLFSGYTD  316

Query  214  GVIRVWGIGRY  182
            GVIRVWGIGRY
Sbjct  317  GVIRVWGIGRY  327


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 54/209 (26%), Positives = 87/209 (42%), Gaps = 33/209 (16%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  557
             H + V+ +  +P     TIVS S D+++ VW L+         +  L GH+ +V  V +
Sbjct  13   AHTDMVTAIA-TPIDNSDTIVSASRDKSIIVWKLTKDDKSYGVRQRRLTGHSHFVEDVVL  71

Query  556  SPDGSLCASGGKDGVILLWDLAEGKKL-----YSLDAGSIIHALCFSPNRYWLCAATEAS  392
            S DG    SG  DG + LWDLA G        ++ D  S+  +L    NR  + A+ + +
Sbjct  72   SSDGQFALSGSWDGELRLWDLAAGVSTRRFVGHTKDVLSVAFSL---DNRQIVSASRDRT  128

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            IK+W+             L +     +EG         + C   S N    T+ S   D 
Sbjct  129  IKLWNT------------LGECKYTISEGGE--GHRDWVSCVRFSPNTLQPTIVSASCDK  174

Query  211  VIRVWGIGRY*MEEFRRSHMIIGHVCYLS  125
             ++VW      +   +    + GH  Y+S
Sbjct  175  TVKVWN-----LSNCKLRSTLAGHTGYVS  198



>ref|XP_010461692.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein B [Camelina sativa]
Length=326

 Score =   323 bits (827),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 151/190 (79%), Positives = 172/190 (91%), Gaps = 0/190 (0%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTI +GDGH++WVSCVRFSP+TL PTIVS SWD+TVKVWNL NCKLR+TLAGH+GY+
Sbjct  137  ECKYTITEGDGHSDWVSCVRFSPNTLVPTIVSASWDKTVKVWNLQNCKLRNTLAGHSGYL  196

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+AGS+IH+LCFSPNRYWLCAATE S
Sbjct  197  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAGSVIHSLCFSPNRYWLCAATENS  256

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            I+IWDLESK +V DL+VDLK E+E S        K K+I+CTSL+W+ADG+TLFSGYTDG
Sbjct  257  IRIWDLESKIVVEDLKVDLKVEAEKSDGAVGIGNKTKVIYCTSLNWSADGNTLFSGYTDG  316

Query  211  VIRVWGIGRY  182
            +IRVWGIGRY
Sbjct  317  IIRVWGIGRY  326


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 47/206 (23%), Positives = 88/206 (43%), Gaps = 28/206 (14%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  557
             H + V+ +  +P      IV+ S D+++ +W L+         +  + GH+ +V  V +
Sbjct  13   AHTDMVTAIA-TPIDNSDVIVTSSRDKSIILWKLTKEDKSYGVAQRRMTGHSHFVQDVVL  71

Query  556  SPDGSLCASGGKDGVILLWDLAEGK--KLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  383
            S DG    SG  DG + LWDLA G+  + +      ++     + NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLATGESTRRFVGHTKDVLSVAFSTDNRQIVSASRDRTIKL  131

Query  382  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  203
            W+             L +      EG+     +  + C   S N    T+ S   D  ++
Sbjct  132  WNT------------LGECKYTITEGD---GHSDWVSCVRFSPNTLVPTIVSASWDKTVK  176

Query  202  VWGIGRY*MEEFRRSHMIIGHVCYLS  125
            VW      ++  +  + + GH  YL+
Sbjct  177  VWN-----LQNCKLRNTLAGHSGYLN  197


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 52/187 (28%), Positives = 84/187 (45%), Gaps = 31/187 (17%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  542
            GH+ +V  V  S        +SGSWD  +++W+L+  +      GHT  V +VA S D  
Sbjct  61   GHSHFVQDVVLSSD--GQFALSGSWDGELRLWDLATGESTRRFVGHTKDVLSVAFSTDNR  118

Query  541  LCASGGKDGVILLWD-LAEGKKLYSLDAG----SIIHALCFSPNRY---WLCAATEASIK  386
               S  +D  I LW+ L E K  Y++  G      +  + FSPN      + A+ + ++K
Sbjct  119  QIVSASRDRTIKLWNTLGECK--YTITEGDGHSDWVSCVRFSPNTLVPTIVSASWDKTVK  176

Query  385  IWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVI  206
            +W+L++      LR  L   S                +  +++ + DGS   SG  DGVI
Sbjct  177  VWNLQN----CKLRNTLAGHSG---------------YLNTVAVSPDGSLCASGGKDGVI  217

Query  205  RVWGIGR  185
             +W +  
Sbjct  218  LLWDLAE  224



>ref|XP_010549078.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein B [Tarenaya hassleriana]
Length=327

 Score =   322 bits (825),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 154/191 (81%), Positives = 169/191 (88%), Gaps = 1/191 (1%)
 Frame = -1

Query  751  ECKYTIQD-GDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  575
            ECKYTI D  +GH EWVSCVRFSP+TL PTIVS SWD TVKVWNL NCKLR+TL GH+GY
Sbjct  137  ECKYTISDQSEGHREWVSCVRFSPNTLVPTIVSASWDHTVKVWNLQNCKLRNTLVGHSGY  196

Query  574  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  395
            +NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG++IH+LCFSPNRYWLCAATE 
Sbjct  197  LNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGAVIHSLCFSPNRYWLCAATEH  256

Query  394  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  215
             IKIWDLESKSIV DL+VDLK E+E S      A K K+I+CTSLSW+ADG+TLFSGYTD
Sbjct  257  GIKIWDLESKSIVEDLKVDLKAEAEKSDGDTGAANKQKVIYCTSLSWSADGNTLFSGYTD  316

Query  214  GVIRVWGIGRY  182
            G+IRVWGIGRY
Sbjct  317  GIIRVWGIGRY  327


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 51/208 (25%), Positives = 90/208 (43%), Gaps = 31/208 (15%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  557
             H + V+ +  +P      IVS S D+++ +W L+         +  L GH+ +V  V +
Sbjct  13   AHTDAVTAIA-TPVDNADFIVSSSRDKSIVLWKLTKDDKSYGVPQRRLTGHSHFVQDVVL  71

Query  556  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  383
            S DG    SG  DG + LWDLA G   + +      ++       NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLATGVSTRRFVGHTKDVLSVAFSVDNRQIVSASRDRTIKL  131

Query  382  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            W+   E K  + D            +EG+      + + C   S N    T+ S   D  
Sbjct  132  WNTLGECKYTISD-----------QSEGH-----REWVSCVRFSPNTLVPTIVSASWDHT  175

Query  208  IRVWGIGRY*MEEFRRSHMIIGHVCYLS  125
            ++VW      ++  +  + ++GH  YL+
Sbjct  176  VKVWN-----LQNCKLRNTLVGHSGYLN  198



>ref|XP_006406649.1| hypothetical protein EUTSA_v10021128mg [Eutrema salsugineum]
 gb|ESQ48102.1| hypothetical protein EUTSA_v10021128mg [Eutrema salsugineum]
Length=327

 Score =   322 bits (824),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 153/191 (80%), Positives = 172/191 (90%), Gaps = 1/191 (1%)
 Frame = -1

Query  751  ECKYTI-QDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  575
            ECKYTI + GDGH EW+SCVRFSP+TL PTIVS SWD TVKVWNL NCKL+++LAGH+GY
Sbjct  137  ECKYTISEQGDGHKEWISCVRFSPNTLVPTIVSASWDHTVKVWNLQNCKLKNSLAGHSGY  196

Query  574  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  395
            +NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+AGSIIH+LCFSPNRYWLCAATE 
Sbjct  197  LNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAGSIIHSLCFSPNRYWLCAATEN  256

Query  394  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  215
            SIKIWDLESKS+V DL+VDLK E+E S  G  T  + K+ +CTSL+W+ADGSTLFSGYTD
Sbjct  257  SIKIWDLESKSVVEDLKVDLKAEAEKSDGGVGTGNQKKVNYCTSLNWSADGSTLFSGYTD  316

Query  214  GVIRVWGIGRY  182
            GV+RVWGIGRY
Sbjct  317  GVVRVWGIGRY  327


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 48/205 (23%), Positives = 89/205 (43%), Gaps = 27/205 (13%)
 Frame = -1

Query  718  HNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAVS  554
            H + V+ +  +P      IV+ S D+++ +W L+  +      +  L GH+ +V  V +S
Sbjct  14   HTDMVTAIA-TPIDNSDIIVTASRDKSIILWKLTKDEKSYGYAQRRLTGHSHFVEDVVLS  72

Query  553  PDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIW  380
             DG    SG  DG + LWDLA G   + +      ++       NR  + A+ + +IK+W
Sbjct  73   SDGQFALSGSWDGELRLWDLATGVSTRRFVGHTKDVLSVAFSVDNRQIVSASRDRTIKLW  132

Query  379  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRV  200
            +   +            +  +S +G+      + I C   S N    T+ S   D  ++V
Sbjct  133  NTLGEC-----------KYTISEQGD---GHKEWISCVRFSPNTLVPTIVSASWDHTVKV  178

Query  199  WGIGRY*MEEFRRSHMIIGHVCYLS  125
            W      ++  +  + + GH  YL+
Sbjct  179  WN-----LQNCKLKNSLAGHSGYLN  198



>ref|XP_009147950.1| PREDICTED: LOW QUALITY PROTEIN: guanine nucleotide-binding protein 
subunit beta-like protein B [Brassica rapa]
Length=328

 Score =   321 bits (823),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 152/192 (79%), Positives = 172/192 (90%), Gaps = 2/192 (1%)
 Frame = -1

Query  751  ECKYTI--QDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTG  578
            ECKYTI    GDGH +WVSCVRFSP+TL PTIVSGSWD+TVKVWNL NCK+R+TLAGH+G
Sbjct  137  ECKYTIGSDHGDGHKQWVSCVRFSPNTLVPTIVSGSWDQTVKVWNLQNCKIRNTLAGHSG  196

Query  577  YVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATE  398
            Y+NTVAVSPDGSLCASGGKDG ILLWDLAEGKKLYSL+AG+IIH+LCFSPNRYWLCAATE
Sbjct  197  YLNTVAVSPDGSLCASGGKDGAILLWDLAEGKKLYSLEAGAIIHSLCFSPNRYWLCAATE  256

Query  397  ASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYT  218
             SI+IWDLESKS+V DL+VDLK E+E S     T  K K+I+CTSL+W+ADGSTLFSGYT
Sbjct  257  NSIRIWDLESKSVVEDLKVDLKAEAEKSDASVGTGNKTKVIYCTSLNWSADGSTLFSGYT  316

Query  217  DGVIRVWGIGRY  182
            DGVIRVWG+GR+
Sbjct  317  DGVIRVWGLGRF  328


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 54/205 (26%), Positives = 87/205 (42%), Gaps = 29/205 (14%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  542
            GH+ +V  V  S        +SGSWD  +++W+L+         GHT  V +VA S D  
Sbjct  61   GHSHFVEDVALSSD--GQFALSGSWDDELRLWDLATGVSTRRFVGHTKDVLSVAFSTDNR  118

Query  541  LCASGGKDGVILLWD-LAEGKKLYSLDAG----SIIHALCFSPNRY---WLCAATEASIK  386
               S  +DG I LW+ L E K     D G      +  + FSPN      +  + + ++K
Sbjct  119  QIVSASRDGTIKLWNTLGECKYTIGSDHGDGHKQWVSCVRFSPNTLVPTIVSGSWDQTVK  178

Query  385  IWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVI  206
            +W+L++  I                   NT A +   +  +++ + DGS   SG  DG I
Sbjct  179  VWNLQNCKI------------------RNTLAGHS-GYLNTVAVSPDGSLCASGGKDGAI  219

Query  205  RVWGIGRY*MEEFRRSHMIIGHVCY  131
             +W +          +  II  +C+
Sbjct  220  LLWDLAEGKKLYSLEAGAIIHSLCF  244


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 47/205 (23%), Positives = 88/205 (43%), Gaps = 26/205 (13%)
 Frame = -1

Query  718  HNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAVS  554
            H + V+ +  +P     TIV+ S D+++ +  L+         +  L GH+ +V  VA+S
Sbjct  14   HTDMVTAIA-TPIDSSDTIVTSSRDKSIILXKLTKDDKSYGVAQRRLTGHSHFVEDVALS  72

Query  553  PDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIW  380
             DG    SG  D  + LWDLA G   + +      ++     + NR  + A+ + +IK+W
Sbjct  73   SDGQFALSGSWDDELRLWDLATGVSTRRFVGHTKDVLSVAFSTDNRQIVSASRDGTIKLW  132

Query  379  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRV  200
            +                E + +   ++     + + C   S N    T+ SG  D  ++V
Sbjct  133  NTLG-------------ECKYTIGSDHGDGHKQWVSCVRFSPNTLVPTIVSGSWDQTVKV  179

Query  199  WGIGRY*MEEFRRSHMIIGHVCYLS  125
            W      ++  +  + + GH  YL+
Sbjct  180  WN-----LQNCKIRNTLAGHSGYLN  199



>ref|XP_010549077.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein B [Tarenaya hassleriana]
Length=327

 Score =   321 bits (823),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 154/191 (81%), Positives = 168/191 (88%), Gaps = 1/191 (1%)
 Frame = -1

Query  751  ECKYTIQD-GDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  575
            ECKYTI D  +GH EWVSCVRFSP+ L PTIVS SWD TVKVWNL NCKLR+TL GH+GY
Sbjct  137  ECKYTISDQSEGHREWVSCVRFSPNMLVPTIVSASWDHTVKVWNLHNCKLRNTLVGHSGY  196

Query  574  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  395
            VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG++IH+LCFSPNRYWLCAATE 
Sbjct  197  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGAVIHSLCFSPNRYWLCAATEH  256

Query  394  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  215
             IKIWDLESKSIV DL+VDLK E+E S      A K K+I+CTSLSW+ADG+TLFSGYTD
Sbjct  257  GIKIWDLESKSIVEDLKVDLKTEAEKSDGDTGAANKQKVIYCTSLSWSADGNTLFSGYTD  316

Query  214  GVIRVWGIGRY  182
            G+IRVWGIGRY
Sbjct  317  GIIRVWGIGRY  327


 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 49/189 (26%), Positives = 82/189 (43%), Gaps = 30/189 (16%)
 Frame = -1

Query  664  IVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAVSPDGSLCASGGKDGVILLW  500
            IVS S D+++ VW LS         +  L GH+ +V  V +S DG    SG  DG + LW
Sbjct  31   IVSSSRDKSIVVWKLSKDDKSYGVPQRRLTGHSHFVQDVVLSSDGQFALSGSWDGELRLW  90

Query  499  DLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDL--ESKSIVVDLRVDLK  332
            DLA G   + +      ++       NR  + A+ + +IK+W+   E K  + D      
Sbjct  91   DLATGVSTRRFVGHTKDVLSVAFSVDNRQIVSASRDRTIKLWNTLGECKYTISD------  144

Query  331  QESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY*MEEFRRSHM  152
                  +EG+      + + C   S N    T+ S   D  ++VW      +   +  + 
Sbjct  145  -----QSEGH-----REWVSCVRFSPNMLVPTIVSASWDHTVKVWN-----LHNCKLRNT  189

Query  151  IIGHVCYLS  125
            ++GH  Y++
Sbjct  190  LVGHSGYVN  198



>ref|XP_004503304.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein-like [Cicer arietinum]
Length=317

 Score =   320 bits (820),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 156/190 (82%), Positives = 169/190 (89%), Gaps = 9/190 (5%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTIQDGD H++WVSCVRFSPSTLQPTIVS SWDRTVKVWNL+NCKLR+TLAGH+GYV
Sbjct  137  ECKYTIQDGDAHSDWVSCVRFSPSTLQPTIVSASWDRTVKVWNLTNCKLRNTLAGHSGYV  196

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTVAVSPDGSLCASGGKDGVILLWDLAEG       AGSIIHALCFSPNRYWLCAATE S
Sbjct  197  NTVAVSPDGSLCASGGKDGVILLWDLAEGNY-----AGSIIHALCFSPNRYWLCAATETS  251

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            IKIWDLESKSIV DL+VDLK E+E  +E      K K+I+CTSL+W+ADGSTLFSGYTDG
Sbjct  252  IKIWDLESKSIVEDLKVDLKAEAESGSE----TTKKKVIYCTSLNWSADGSTLFSGYTDG  307

Query  211  VIRVWGIGRY  182
            V+RVWGIGRY
Sbjct  308  VVRVWGIGRY  317



>ref|XP_002885240.1| guanine nucleotide-binding family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH61499.1| guanine nucleotide-binding family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=327

 Score =   320 bits (821),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 152/191 (80%), Positives = 171/191 (90%), Gaps = 1/191 (1%)
 Frame = -1

Query  751  ECKYTI-QDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  575
            ECKYTI + GDGH EW+SCVRFSP+TL PTIVS SWD TVKVWNL NCKLR++L GH+GY
Sbjct  137  ECKYTISEQGDGHKEWISCVRFSPNTLVPTIVSASWDHTVKVWNLQNCKLRNSLVGHSGY  196

Query  574  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  395
            +NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+AGSIIH+LCFSPNRYWLCAATE 
Sbjct  197  LNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAGSIIHSLCFSPNRYWLCAATEN  256

Query  394  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  215
            SIKIWDLESKS+V DL+VDLK E+E +  G  T  + K+ +CTSL+W+ADGSTLFSGYTD
Sbjct  257  SIKIWDLESKSVVEDLKVDLKAEAEKTDGGVGTGNQKKVNYCTSLNWSADGSTLFSGYTD  316

Query  214  GVIRVWGIGRY  182
            GV+RVWGIGRY
Sbjct  317  GVVRVWGIGRY  327


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 48/205 (23%), Positives = 89/205 (43%), Gaps = 27/205 (13%)
 Frame = -1

Query  718  HNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAVS  554
            H + V+ +  +P      IV+ S D+++ +W L+         +  L GH+ +V  V +S
Sbjct  14   HTDMVTAIA-TPIDNSDIIVTASRDKSIILWKLTKDDKSYGVAQRRLTGHSHFVEDVVLS  72

Query  553  PDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIW  380
             DG    SG  DG + LWDLA G   + +      ++       NR  + A+ + +IK+W
Sbjct  73   SDGQFALSGSWDGELRLWDLATGVSTRRFVGHTKDVLSVAFSVDNRQIVSASRDRTIKLW  132

Query  379  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRV  200
            +   +            +  +S +G+      + I C   S N    T+ S   D  ++V
Sbjct  133  NTLGEC-----------KYTISEQGD---GHKEWISCVRFSPNTLVPTIVSASWDHTVKV  178

Query  199  WGIGRY*MEEFRRSHMIIGHVCYLS  125
            W      ++  +  + ++GH  YL+
Sbjct  179  WN-----LQNCKLRNSLVGHSGYLN  198



>ref|XP_009145001.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein B [Brassica rapa]
Length=327

 Score =   320 bits (821),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 153/191 (80%), Positives = 171/191 (90%), Gaps = 1/191 (1%)
 Frame = -1

Query  751  ECKYTIQD-GDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  575
            ECKYTI D G+GH +WVSCVRFSP+TL PTIVS SWD TVKVWNL+NCKLR+TLAGH+GY
Sbjct  137  ECKYTISDQGEGHKQWVSCVRFSPNTLVPTIVSASWDHTVKVWNLANCKLRNTLAGHSGY  196

Query  574  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  395
            +NTVAVSPDGSLCASGGKDG ILLWDLAEGKKLYSL+AGSIIH+LCFSPNRYWLCAATE 
Sbjct  197  LNTVAVSPDGSLCASGGKDGAILLWDLAEGKKLYSLEAGSIIHSLCFSPNRYWLCAATEN  256

Query  394  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  215
            SI+IWDLESKS+V DL+VDLK E+E S     T  K K+I+CTSL+W+ADG+TLFSGYTD
Sbjct  257  SIRIWDLESKSVVEDLKVDLKAEAEKSDVSAATGNKTKVIYCTSLNWSADGNTLFSGYTD  316

Query  214  GVIRVWGIGRY  182
            GVIRVWGIG Y
Sbjct  317  GVIRVWGIGHY  327


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 50/208 (24%), Positives = 89/208 (43%), Gaps = 31/208 (15%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  557
             H + V+ +  +P      IV+ S D+++ +W L+  +      +  L GH+ +V  V +
Sbjct  13   AHTDMVTAIA-TPVDNSDMIVTSSRDKSIILWKLNRDEKSYGVAQRRLTGHSHFVEDVVL  71

Query  556  SPDGSLCASGGKDGVILLWDLAEGK--KLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  383
            S DG    SG  DG + LWDLA G   + +      ++     + NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLATGASTRRFVGHTKDVLSVAFSTDNRQIVSASRDGTIKL  131

Query  382  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            W+   E K  + D             EG+      + + C   S N    T+ S   D  
Sbjct  132  WNTLGECKYTISD-----------QGEGH-----KQWVSCVRFSPNTLVPTIVSASWDHT  175

Query  208  IRVWGIGRY*MEEFRRSHMIIGHVCYLS  125
            ++VW +        +  + + GH  YL+
Sbjct  176  VKVWNLA-----NCKLRNTLAGHSGYLN  198


 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 53/187 (28%), Positives = 81/187 (43%), Gaps = 30/187 (16%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  542
            GH+ +V  V  S        +SGSWD  +++W+L+         GHT  V +VA S D  
Sbjct  61   GHSHFVEDVVLSSD--GQFALSGSWDGELRLWDLATGASTRRFVGHTKDVLSVAFSTDNR  118

Query  541  LCASGGKDGVILLWD-LAEGKKLYSLDAG----SIIHALCFSPNRY---WLCAATEASIK  386
               S  +DG I LW+ L E K   S D G      +  + FSPN      + A+ + ++K
Sbjct  119  QIVSASRDGTIKLWNTLGECKYTIS-DQGEGHKQWVSCVRFSPNTLVPTIVSASWDHTVK  177

Query  385  IWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVI  206
            +W+L +      LR  L   S                +  +++ + DGS   SG  DG I
Sbjct  178  VWNLAN----CKLRNTLAGHSG---------------YLNTVAVSPDGSLCASGGKDGAI  218

Query  205  RVWGIGR  185
             +W +  
Sbjct  219  LLWDLAE  225



>pdb|3DM0|A Chain A, Maltose Binding Protein Fusion With Rack1 From A. Thaliana
Length=694

 Score =   331 bits (849),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 157/191 (82%), Positives = 173/191 (91%), Gaps = 1/191 (1%)
 Frame = -1

Query  751  ECKYTIQDG-DGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  575
            ECKYTI +G +GH +WVSCVRFSP+TLQPTIVS SWD+TVKVWNLSNCKLRSTLAGHTGY
Sbjct  504  ECKYTISEGGEGHRDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLSNCKLRSTLAGHTGY  563

Query  574  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  395
            V+TVAVSPDGSLCASGGKDGV+LLWDLAEGKKLYSL+A S+IHALCFSPNRYWLCAATE 
Sbjct  564  VSTVAVSPDGSLCASGGKDGVVLLWDLAEGKKLYSLEANSVIHALCFSPNRYWLCAATEH  623

Query  394  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  215
             IKIWDLESKSIV DL+VDLK E+E +      A K K+I+CTSL+W+ADGSTLFSGYTD
Sbjct  624  GIKIWDLESKSIVEDLKVDLKAEAEKADNSGPAATKRKVIYCTSLNWSADGSTLFSGYTD  683

Query  214  GVIRVWGIGRY  182
            GVIRVWGIGRY
Sbjct  684  GVIRVWGIGRY  694


 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 52/209 (25%), Positives = 86/209 (41%), Gaps = 33/209 (16%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  557
             H + V+ +  +P      IVS S D+++ +W L+         +  L GH+ +V  V +
Sbjct  380  AHTDMVTAIA-TPIDNADIIVSASRDKSIILWKLTKDDKAYGVAQRRLTGHSHFVEDVVL  438

Query  556  SPDGSLCASGGKDGVILLWDLAEGKKL-----YSLDAGSIIHALCFSPNRYWLCAATEAS  392
            S DG    SG  DG + LWDLA G        ++ D  S+  +L    NR  + A+ + +
Sbjct  439  SSDGQFALSGSWDGELRLWDLAAGVSTRRFVGHTKDVLSVAFSL---DNRQIVSASRDRT  495

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            IK+W+            + K       EG+        + C   S N    T+ S   D 
Sbjct  496  IKLWNTLG---------ECKYTISEGGEGH-----RDWVSCVRFSPNTLQPTIVSASWDK  541

Query  211  VIRVWGIGRY*MEEFRRSHMIIGHVCYLS  125
             ++VW      +   +    + GH  Y+S
Sbjct  542  TVKVWN-----LSNCKLRSTLAGHTGYVS  565



>emb|CDY18497.1| BnaA01g26980D [Brassica napus]
Length=326

 Score =   319 bits (818),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 149/190 (78%), Positives = 171/190 (90%), Gaps = 0/190 (0%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTI + DGH +W+SCVRFSP+TL PTIVS SWD+TVKVWNL NCKL+S+LAGH+GY+
Sbjct  137  ECKYTISEADGHKDWISCVRFSPNTLVPTIVSASWDKTVKVWNLQNCKLKSSLAGHSGYL  196

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+ GSIIH+LCFSPNRYWLCAATE+S
Sbjct  197  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEGGSIIHSLCFSPNRYWLCAATESS  256

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            IKIWDLESKS+V +L+VDLK E+E    G  T  + K+ +CTSL+W+ADGSTLFSGYTDG
Sbjct  257  IKIWDLESKSVVDELKVDLKAEAEKCDGGVGTGNQKKVNYCTSLNWSADGSTLFSGYTDG  316

Query  211  VIRVWGIGRY  182
            V+RVWGIGRY
Sbjct  317  VVRVWGIGRY  326


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 51/185 (28%), Positives = 82/185 (44%), Gaps = 27/185 (15%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  542
            GH+ +V  V  S        +SGSWD  +++W+L+         GHT  V +VA S D  
Sbjct  61   GHSHFVEDVVLSSD--GQFALSGSWDGELRLWDLATGVSTRRFVGHTKDVLSVAFSVDNR  118

Query  541  LCASGGKDGVILLWD-LAEGKKLYSLDAGSI--IHALCFSPNRY---WLCAATEASIKIW  380
               S  +D  I LW+ L E K   S   G    I  + FSPN      + A+ + ++K+W
Sbjct  119  QIVSASRDRTIKLWNTLGECKYTISEADGHKDWISCVRFSPNTLVPTIVSASWDKTVKVW  178

Query  379  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRV  200
            +L+          + K +S ++             +  +++ + DGS   SG  DGVI +
Sbjct  179  NLQ----------NCKLKSSLAGHSG---------YLNTVAVSPDGSLCASGGKDGVILL  219

Query  199  WGIGR  185
            W +  
Sbjct  220  WDLAE  224


 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 50/207 (24%), Positives = 88/207 (43%), Gaps = 32/207 (15%)
 Frame = -1

Query  718  HNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAVS  554
            H + V+ +  +P      IV+ S D+++ +W L+  +      +  L GH+ +V  V +S
Sbjct  14   HTDMVTAIA-TPIDNSDIIVTSSRDKSIILWKLTKDEKSYGVAQRRLTGHSHFVEDVVLS  72

Query  553  PDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIW  380
             DG    SG  DG + LWDLA G   + +      ++       NR  + A+ + +IK+W
Sbjct  73   SDGQFALSGSWDGELRLWDLATGVSTRRFVGHTKDVLSVAFSVDNRQIVSASRDRTIKLW  132

Query  379  DL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVI  206
            +   E K  + +            A+G+        I C   S N    T+ S   D  +
Sbjct  133  NTLGECKYTISE------------ADGH-----KDWISCVRFSPNTLVPTIVSASWDKTV  175

Query  205  RVWGIGRY*MEEFRRSHMIIGHVCYLS  125
            +VW      ++  +    + GH  YL+
Sbjct  176  KVWN-----LQNCKLKSSLAGHSGYLN  197



>ref|XP_009113515.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein C [Brassica rapa]
Length=326

 Score =   319 bits (818),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 149/190 (78%), Positives = 171/190 (90%), Gaps = 0/190 (0%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTI + DGH +W+SCVRFSP+TL PTIVS SWD+TVKVWNL NCKL+S+LAGH+GY+
Sbjct  137  ECKYTISEADGHKDWISCVRFSPNTLVPTIVSASWDKTVKVWNLQNCKLKSSLAGHSGYL  196

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+ GSIIH+LCFSPNRYWLCAATE+S
Sbjct  197  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEGGSIIHSLCFSPNRYWLCAATESS  256

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            IKIWDLESKS+V +L+VDLK E+E    G  T  + K+ +CTSL+W+ADGSTLFSGYTDG
Sbjct  257  IKIWDLESKSVVDELKVDLKAEAEKCDGGVGTGNQKKVNYCTSLNWSADGSTLFSGYTDG  316

Query  211  VIRVWGIGRY  182
            V+RVWGIGRY
Sbjct  317  VVRVWGIGRY  326


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 53/185 (29%), Positives = 85/185 (46%), Gaps = 27/185 (15%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  542
            GH+ +V  V  SP+      +SGSWD  +++W+L+         GHT YV +VA S    
Sbjct  61   GHSHFVEDVVLSPA--GQFALSGSWDGELRLWDLATGVSTRRFVGHTKYVLSVAFSVANR  118

Query  541  LCASGGKDGVILLWD-LAEGKKLYSLDAGSI--IHALCFSPNRY---WLCAATEASIKIW  380
              AS  +D  I LW+ L E K   S   G    I  + FSPN      + A+ + ++K+W
Sbjct  119  QIASASRDRTIKLWNTLGECKYTISEADGHKDWISCVRFSPNTLVPTIVSASWDKTVKVW  178

Query  379  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRV  200
            +L+          + K +S ++             +  +++ + DGS   SG  DGVI +
Sbjct  179  NLQ----------NCKLKSSLAGHSG---------YLNTVAVSPDGSLCASGGKDGVILL  219

Query  199  WGIGR  185
            W +  
Sbjct  220  WDLAE  224


 Score = 50.1 bits (118),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 52/207 (25%), Positives = 89/207 (43%), Gaps = 32/207 (15%)
 Frame = -1

Query  718  HNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAVS  554
            H + V+ +  +P      IV+ S D+++ +W L+  +      +  L GH+ +V  V +S
Sbjct  14   HTDMVTAIA-TPIDNSDIIVTSSRDKSIILWKLTKDEKSYGVAQRRLTGHSHFVEDVVLS  72

Query  553  PDGSLCASGGKDGVILLWDLAEGKKLYSLDAGS-IIHALCFS-PNRYWLCAATEASIKIW  380
            P G    SG  DG + LWDLA G         +  + ++ FS  NR    A+ + +IK+W
Sbjct  73   PAGQFALSGSWDGELRLWDLATGVSTRRFVGHTKYVLSVAFSVANRQIASASRDRTIKLW  132

Query  379  DL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVI  206
            +   E K  + +            A+G+        I C   S N    T+ S   D  +
Sbjct  133  NTLGECKYTISE------------ADGH-----KDWISCVRFSPNTLVPTIVSASWDKTV  175

Query  205  RVWGIGRY*MEEFRRSHMIIGHVCYLS  125
            +VW      ++  +    + GH  YL+
Sbjct  176  KVWN-----LQNCKLKSSLAGHSGYLN  197



>ref|XP_010551145.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein B [Tarenaya hassleriana]
Length=327

 Score =   318 bits (816),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 150/191 (79%), Positives = 169/191 (88%), Gaps = 1/191 (1%)
 Frame = -1

Query  751  ECKYTIQD-GDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  575
            ECKYTI D  +GH EWVSCVRFSP+TL PTIVS SWD TVKVWNL NCKLR+TL GH+GY
Sbjct  137  ECKYTISDQSEGHREWVSCVRFSPNTLVPTIVSASWDHTVKVWNLQNCKLRNTLVGHSGY  196

Query  574  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  395
            +NTVAVSPDGSLCASGGKDG+ILLWDLAEGKKLYSLDAG +IH+LCFSPNRYWLCAATE 
Sbjct  197  LNTVAVSPDGSLCASGGKDGMILLWDLAEGKKLYSLDAGDVIHSLCFSPNRYWLCAATEQ  256

Query  394  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  215
            SIKIWDLESKS+V DL+VDLK E+E S      A K K+I+CTSL+W+ADG+TLFSGY+D
Sbjct  257  SIKIWDLESKSVVEDLKVDLKAEAEKSDGDTGAANKQKVIYCTSLNWSADGNTLFSGYSD  316

Query  214  GVIRVWGIGRY  182
            G+IRVWGIGR+
Sbjct  317  GIIRVWGIGRF  327


 Score = 55.8 bits (133),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 49/189 (26%), Positives = 84/189 (44%), Gaps = 30/189 (16%)
 Frame = -1

Query  664  IVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAVSPDGSLCASGGKDGVILLW  500
            IVS S D+++ +W L+         +  L GH+ +V  VA+S DG    SG  DG + LW
Sbjct  31   IVSSSRDKSIVLWKLTKEDKSYGVPQRRLTGHSHFVQDVALSSDGQFALSGSWDGELRLW  90

Query  499  DLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDL--ESKSIVVDLRVDLK  332
            DLA G   + +      ++       NR  + A+ + +IK+W+   E K  + D      
Sbjct  91   DLATGVSSRRFVGHTKDVLSVAFSVDNRQIVSASRDRTIKLWNTLGECKYTISD------  144

Query  331  QESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY*MEEFRRSHM  152
                  +EG+      + + C   S N    T+ S   D  ++VW      ++  +  + 
Sbjct  145  -----QSEGH-----REWVSCVRFSPNTLVPTIVSASWDHTVKVWN-----LQNCKLRNT  189

Query  151  IIGHVCYLS  125
            ++GH  YL+
Sbjct  190  LVGHSGYLN  198



>ref|XP_011000479.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Populus euphratica]
Length=328

 Score =   318 bits (815),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 156/192 (81%), Positives = 173/192 (90%), Gaps = 3/192 (2%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTIQ+ + H +WVSCVRFSP+TLQPTIVS SWD+TVKVWNL+NCKLRSTLAGH GYV
Sbjct  138  ECKYTIQEAESHTDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLTNCKLRSTLAGHGGYV  197

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTVAVSPDGSLCASGGKDGVILLWDLAEGK+LYSLDAG++I+ALCFSPNRYWLCAATE S
Sbjct  198  NTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDAGAVINALCFSPNRYWLCAATENS  257

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEG--NNTAAKNKIIFCTSLSWNADGSTLFSGYT  218
            IKIWDLESK +V DL+VDLK E+E S EG     A+  K I+CTSL+W+ADGSTLFSGYT
Sbjct  258  IKIWDLESKLVVDDLKVDLKAEAEKS-EGTTATAASTTKKIYCTSLNWSADGSTLFSGYT  316

Query  217  DGVIRVWGIGRY  182
            DGVIRVWGIGRY
Sbjct  317  DGVIRVWGIGRY  328


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 48/186 (26%), Positives = 81/186 (44%), Gaps = 27/186 (15%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  557
             H + V+ +  +P      IVS S D+++ +W+L+  +      R  L GH+ +V  V +
Sbjct  14   AHTDQVTAIA-TPIDNSDMIVSSSRDKSIILWSLTKDEKTYGVARRRLTGHSHFVQDVVL  72

Query  556  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  383
            S DG    SG  DG + LWDLA G   + +      ++       NR  + A+ + +IK+
Sbjct  73   SSDGQFALSGSWDGELRLWDLATGVSARRFVGHTKDVLSVAFSIDNRQIVSASRDKTIKL  132

Query  382  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            W+   E K  +        QE+E         +    + C   S N    T+ S   D  
Sbjct  133  WNTLGECKYTI--------QEAE---------SHTDWVSCVRFSPNTLQPTIVSASWDKT  175

Query  208  IRVWGI  191
            ++VW +
Sbjct  176  VKVWNL  181



>emb|CDX95554.1| BnaC01g34460D [Brassica napus]
Length=326

 Score =   318 bits (815),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 148/190 (78%), Positives = 171/190 (90%), Gaps = 0/190 (0%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTI + DGH +W+SCVRFSP+T+ PTIVS SWD+TVKVWNL NCKL+S+LAGH+GY+
Sbjct  137  ECKYTISEADGHKDWISCVRFSPNTVVPTIVSASWDKTVKVWNLQNCKLKSSLAGHSGYL  196

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+ GSIIH+LCFSPNRYWLCAATE+S
Sbjct  197  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEGGSIIHSLCFSPNRYWLCAATESS  256

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            IKIWDLESKS+V +L+VDLK E+E    G  T  + K+ +CTSL+W+ADGSTLFSGYTDG
Sbjct  257  IKIWDLESKSVVDELKVDLKAEAEKCDGGVGTGNQKKVNYCTSLNWSADGSTLFSGYTDG  316

Query  211  VIRVWGIGRY  182
            V+RVWGIGRY
Sbjct  317  VVRVWGIGRY  326


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 51/185 (28%), Positives = 82/185 (44%), Gaps = 27/185 (15%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  542
            GH+ +V  V  S        +SGSWD  +++W+L+         GHT  V +VA S D  
Sbjct  61   GHSHFVEDVVLSSD--GQFALSGSWDGELRLWDLATGVSTRRFVGHTKDVLSVAFSVDNR  118

Query  541  LCASGGKDGVILLWD-LAEGKKLYSLDAGSI--IHALCFSPNRY---WLCAATEASIKIW  380
               S  +D  I LW+ L E K   S   G    I  + FSPN      + A+ + ++K+W
Sbjct  119  QIVSASRDRTIKLWNTLGECKYTISEADGHKDWISCVRFSPNTVVPTIVSASWDKTVKVW  178

Query  379  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRV  200
            +L+          + K +S ++             +  +++ + DGS   SG  DGVI +
Sbjct  179  NLQ----------NCKLKSSLAGHSG---------YLNTVAVSPDGSLCASGGKDGVILL  219

Query  199  WGIGR  185
            W +  
Sbjct  220  WDLAE  224


 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 50/207 (24%), Positives = 88/207 (43%), Gaps = 32/207 (15%)
 Frame = -1

Query  718  HNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAVS  554
            H + V+ +  +P      IV+ S D+++ +W L+  +      +  L GH+ +V  V +S
Sbjct  14   HTDMVTAIA-TPIDNSDIIVTSSRDKSIILWKLTKDEKSYGVAQRRLTGHSHFVEDVVLS  72

Query  553  PDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIW  380
             DG    SG  DG + LWDLA G   + +      ++       NR  + A+ + +IK+W
Sbjct  73   SDGQFALSGSWDGELRLWDLATGVSTRRFVGHTKDVLSVAFSVDNRQIVSASRDRTIKLW  132

Query  379  DL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVI  206
            +   E K  + +            A+G+        I C   S N    T+ S   D  +
Sbjct  133  NTLGECKYTISE------------ADGH-----KDWISCVRFSPNTVVPTIVSASWDKTV  175

Query  205  RVWGIGRY*MEEFRRSHMIIGHVCYLS  125
            +VW      ++  +    + GH  YL+
Sbjct  176  KVWN-----LQNCKLKSSLAGHSGYLN  197



>emb|CDY44104.1| BnaA01g13120D [Brassica napus]
 emb|CDX93686.1| BnaA06g03620D [Brassica napus]
 emb|CDX86074.1| BnaC03g55890D [Brassica napus]
Length=298

 Score =   317 bits (811),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 152/192 (79%), Positives = 171/192 (89%), Gaps = 2/192 (1%)
 Frame = -1

Query  751  ECKYTI--QDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTG  578
            ECKYTI    GDGH +WVSCVRFSP+TL PTIVSGSWD+TVKVWNL NCK+R+TLAGH+G
Sbjct  107  ECKYTIGSDHGDGHKQWVSCVRFSPNTLVPTIVSGSWDQTVKVWNLQNCKIRNTLAGHSG  166

Query  577  YVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATE  398
            Y+NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+AG+IIH+LCFSPNRYWLCAATE
Sbjct  167  YLNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAGAIIHSLCFSPNRYWLCAATE  226

Query  397  ASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYT  218
             SI+IWDLESKS+V DL+VDLK E+E S     T  K K+I CTSL+W+ADGSTLF GYT
Sbjct  227  NSIRIWDLESKSVVEDLKVDLKAEAEKSDASVGTGNKTKVICCTSLNWSADGSTLFGGYT  286

Query  217  DGVIRVWGIGRY  182
            DGVIRVWG+GR+
Sbjct  287  DGVIRVWGLGRF  298



>ref|XP_009145932.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein C [Brassica rapa]
Length=325

 Score =   317 bits (812),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 148/190 (78%), Positives = 171/190 (90%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTI + DGH +W+SCVRFSP+TL PTIVS SWD+TVKVWNL NCKL+S+LAGH+GY+
Sbjct  137  ECKYTISEADGHKDWISCVRFSPNTLVPTIVSASWDKTVKVWNLQNCKLKSSLAGHSGYL  196

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+ GSIIH+LCFSPNRYWLCAATE+S
Sbjct  197  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEGGSIIHSLCFSPNRYWLCAATESS  256

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            IKIWDLESK++V +L+VDLK E+E    G  T  + K+ +CTSL+W+ADGSTLFSGYTDG
Sbjct  257  IKIWDLESKTVVDELKVDLKAEAEKDG-GAGTGNQKKVNYCTSLNWSADGSTLFSGYTDG  315

Query  211  VIRVWGIGRY  182
            V+RVWGIGRY
Sbjct  316  VVRVWGIGRY  325



>emb|CDX92200.1| BnaA05g22070D [Brassica napus]
Length=325

 Score =   317 bits (811),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 148/190 (78%), Positives = 171/190 (90%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTI + DGH +W+SCVRFSP+TL PTIVS SWD+TVKVWNL NCKL+S+LAGH+GY+
Sbjct  137  ECKYTISEADGHKDWISCVRFSPNTLVPTIVSASWDKTVKVWNLQNCKLKSSLAGHSGYL  196

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+ GSIIH+LCFSPNRYWLCAATE+S
Sbjct  197  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEGGSIIHSLCFSPNRYWLCAATESS  256

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            IKIWDLESK++V +L+VDLK E+E    G  T  + K+ +CTSL+W+ADGSTLFSGYTDG
Sbjct  257  IKIWDLESKTVVDELKVDLKAEAEKDG-GAGTGNQKKVNYCTSLNWSADGSTLFSGYTDG  315

Query  211  VIRVWGIGRY  182
            V+RVWGIGRY
Sbjct  316  VVRVWGIGRY  325


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 51/185 (28%), Positives = 82/185 (44%), Gaps = 27/185 (15%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  542
            GH+ +V  V  S        +SGSWD  +++W+L+         GHT  V +VA S D  
Sbjct  61   GHSHFVEDVVLSSD--GQFALSGSWDGELRLWDLATGVSTRRFVGHTKDVLSVAFSVDNR  118

Query  541  LCASGGKDGVILLWD-LAEGKKLYSLDAGSI--IHALCFSPNRY---WLCAATEASIKIW  380
               S  +D  I LW+ L E K   S   G    I  + FSPN      + A+ + ++K+W
Sbjct  119  QIVSASRDRTIKLWNTLGECKYTISEADGHKDWISCVRFSPNTLVPTIVSASWDKTVKVW  178

Query  379  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRV  200
            +L+          + K +S ++             +  +++ + DGS   SG  DGVI +
Sbjct  179  NLQ----------NCKLKSSLAGHSG---------YLNTVAVSPDGSLCASGGKDGVILL  219

Query  199  WGIGR  185
            W +  
Sbjct  220  WDLAE  224



>emb|CDX95784.1| BnaC05g35350D [Brassica napus]
Length=325

 Score =   316 bits (809),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 148/190 (78%), Positives = 170/190 (89%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTI + DGH +W+SCVRFSP+TL PTIVS SWD+TVKVWNL NCKL+S+LAGH GY+
Sbjct  137  ECKYTISEADGHKDWISCVRFSPNTLVPTIVSASWDKTVKVWNLQNCKLKSSLAGHLGYL  196

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+ GSIIH+LCFSPNRYWLCAATE+S
Sbjct  197  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEGGSIIHSLCFSPNRYWLCAATESS  256

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            IKIWDLESK++V +L+VDLK E+E    G  T  + K+ +CTSL+W+ADGSTLFSGYTDG
Sbjct  257  IKIWDLESKTVVDELKVDLKAEAEKDG-GAGTGNQKKVNYCTSLNWSADGSTLFSGYTDG  315

Query  211  VIRVWGIGRY  182
            V+RVWGIGRY
Sbjct  316  VVRVWGIGRY  325


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 51/185 (28%), Positives = 83/185 (45%), Gaps = 27/185 (15%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  542
            GH+ +V  V  S        +SGSWD  +++W+L+         GHT  V +VA S D  
Sbjct  61   GHSHFVEDVVLSSD--GQFALSGSWDGELRLWDLATGVSTRRFVGHTKDVLSVAFSVDNR  118

Query  541  LCASGGKDGVILLWD-LAEGKKLYSLDAGSI--IHALCFSPNRY---WLCAATEASIKIW  380
               S  +D  I LW+ L E K   S   G    I  + FSPN      + A+ + ++K+W
Sbjct  119  QIVSASRDRTIKLWNTLGECKYTISEADGHKDWISCVRFSPNTLVPTIVSASWDKTVKVW  178

Query  379  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRV  200
            +L+          + K +S ++           + +  +++ + DGS   SG  DGVI +
Sbjct  179  NLQ----------NCKLKSSLAGH---------LGYLNTVAVSPDGSLCASGGKDGVILL  219

Query  199  WGIGR  185
            W +  
Sbjct  220  WDLAE  224


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 50/207 (24%), Positives = 88/207 (43%), Gaps = 32/207 (15%)
 Frame = -1

Query  718  HNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAVS  554
            H + V+ +  +P      IV+ S D+++ +W L+         +  L GH+ +V  V +S
Sbjct  14   HTDMVTAIA-TPIDNSDIIVTSSRDKSIILWKLTKDDKSYGVAQRRLTGHSHFVEDVVLS  72

Query  553  PDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIW  380
             DG    SG  DG + LWDLA G   + +      ++       NR  + A+ + +IK+W
Sbjct  73   SDGQFALSGSWDGELRLWDLATGVSTRRFVGHTKDVLSVAFSVDNRQIVSASRDRTIKLW  132

Query  379  DL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVI  206
            +   E K  + +            A+G+        I C   S N    T+ S   D  +
Sbjct  133  NTLGECKYTISE------------ADGH-----KDWISCVRFSPNTLVPTIVSASWDKTV  175

Query  205  RVWGIGRY*MEEFRRSHMIIGHVCYLS  125
            +VW      ++  +    + GH+ YL+
Sbjct  176  KVWN-----LQNCKLKSSLAGHLGYLN  197



>ref|XP_002321505.1| GTP-binding protein beta chain [Populus trichocarpa]
 gb|ABK92879.1| unknown [Populus trichocarpa]
 gb|EEF05632.1| GTP-binding protein beta chain [Populus trichocarpa]
Length=328

 Score =   315 bits (808),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 153/191 (80%), Positives = 170/191 (89%), Gaps = 1/191 (1%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTIQ+ + H +WVSCVRFSP+TLQPTIVS SWD+TVKVWNL+NCKLRSTLAGH GYV
Sbjct  138  ECKYTIQEAESHTDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLTNCKLRSTLAGHGGYV  197

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTVAVSPDGSLCASGGKDGVILLWDLAEGK+LYSLDAG++I+ALCFSPNRYWLCAATE S
Sbjct  198  NTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDAGAVINALCFSPNRYWLCAATENS  257

Query  391  IKIWDLESKSIVVDLRVDLKQESEMS-AEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  215
            IKIWDLESK +V DL+VDLK E+E S       A+  K I+CT L+W+ADGSTLFSGYTD
Sbjct  258  IKIWDLESKLVVDDLKVDLKAEAEKSEGTTGTAASTTKKIYCTCLNWSADGSTLFSGYTD  317

Query  214  GVIRVWGIGRY  182
            GVIRVWGIGRY
Sbjct  318  GVIRVWGIGRY  328


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 48/186 (26%), Positives = 81/186 (44%), Gaps = 27/186 (15%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  557
             H + V+ +  +P      IVS S D+++ +W+L+  +      R  L GH+ +V  V +
Sbjct  14   AHTDQVTAIA-TPIDNSDMIVSSSRDKSIILWSLTKDEKTYGVARRRLTGHSHFVQDVVL  72

Query  556  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  383
            S DG    SG  DG + LWDLA G   + +      ++       NR  + A+ + +IK+
Sbjct  73   SSDGQFALSGSWDGELRLWDLATGVSARRFVGHTKDVLSVAFSIDNRQIVSASRDKTIKL  132

Query  382  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            W+   E K  +        QE+E         +    + C   S N    T+ S   D  
Sbjct  133  WNTLGECKYTI--------QEAE---------SHTDWVSCVRFSPNTLQPTIVSASWDKT  175

Query  208  IRVWGI  191
            ++VW +
Sbjct  176  VKVWNL  181



>ref|XP_011084467.1| PREDICTED: LOW QUALITY PROTEIN: guanine nucleotide-binding protein 
subunit beta-like protein [Sesamum indicum]
Length=318

 Score =   314 bits (805),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 152/191 (80%), Positives = 170/191 (89%), Gaps = 11/191 (6%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTIQD D H++WVSCVRFSP+TLQPTIVSGSWDRTVK+WNL+NCKLRSTLAGH+GYV
Sbjct  138  ECKYTIQDQDAHSDWVSCVRFSPNTLQPTIVSGSWDRTVKIWNLTNCKLRSTLAGHSGYV  197

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTVAVSPDGSLCASGGKDGVI              DAGSII+ALCFSPNRYWLCAATE+S
Sbjct  198  NTVAVSPDGSLCASGGKDGVI----------XXXXDAGSIINALCFSPNRYWLCAATESS  247

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGN-NTAAKNKIIFCTSLSWNADGSTLFSGYTD  215
            IKIWDLESKS+VVDL+VDLKQESE++ EG   T+ KNK+I+CTSL+W+ADGSTLFSGYTD
Sbjct  248  IKIWDLESKSVVVDLKVDLKQESELATEGTAPTSGKNKVIYCTSLNWSADGSTLFSGYTD  307

Query  214  GVIRVWGIGRY  182
            GV+RVWGIGRY
Sbjct  308  GVVRVWGIGRY  318


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 46/186 (25%), Positives = 78/186 (42%), Gaps = 27/186 (15%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  557
             H +WV+ +  +P      IV+ S D+++ +W L+         R  L GH+ +V  V +
Sbjct  14   AHTDWVTAIA-TPIDNSDMIVTSSRDKSIILWALTKEDKTYGVARRRLNGHSHFVQDVVL  72

Query  556  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  383
            S DG    SG  DG + LWDL  G   + +      ++       NR  + A+ + +IK+
Sbjct  73   SSDGQFALSGSWDGELRLWDLQTGVTARRFVGHTKDVLSVAFSVDNRQIVSASRDKTIKL  132

Query  382  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            W+   E K  + D                   A +  + C   S N    T+ SG  D  
Sbjct  133  WNTLGECKYTIQD-----------------QDAHSDWVSCVRFSPNTLQPTIVSGSWDRT  175

Query  208  IRVWGI  191
            +++W +
Sbjct  176  VKIWNL  181



>ref|XP_010256121.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Nelumbo nucifera]
Length=314

 Score =   310 bits (795),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 148/190 (78%), Positives = 163/190 (86%), Gaps = 12/190 (6%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTIQD D H  WVSCVRFSP+T QPTIVSGSWDRTVKVWNL+NCKLR TLAGH GYV
Sbjct  137  ECKYTIQDADSHTNWVSCVRFSPNTFQPTIVSGSWDRTVKVWNLTNCKLRCTLAGHGGYV  196

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTVAVSPDGSLCASGGKDGV LLWDLAEGK+LYSLDAG+IIHALCFSPNRYWLCAAT+ S
Sbjct  197  NTVAVSPDGSLCASGGKDGVTLLWDLAEGKRLYSLDAGAIIHALCFSPNRYWLCAATQDS  256

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            +KIWDLESKSIV DL+ +  Q             KN++++CTSLSW++DGSTLF+GYTDG
Sbjct  257  VKIWDLESKSIVQDLKPEATQ------------GKNQMLYCTSLSWSSDGSTLFTGYTDG  304

Query  211  VIRVWGIGRY  182
             IRVWGIGRY
Sbjct  305  SIRVWGIGRY  314


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 50/186 (27%), Positives = 81/186 (44%), Gaps = 27/186 (15%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  557
            GH++ V+ +  +P      IVS S D++V VW+L+  +      R  L GH+ +V  V +
Sbjct  13   GHSDMVTAIA-TPIDNSDMIVSSSRDKSVLVWHLTKEEGIYGVPRRRLTGHSHFVQDVVL  71

Query  556  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  383
            S DG    SG  D  + LWDL  G         +  + ++ FS  NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDSELRLWDLNTGATTRRFVGHTKDVLSVAFSIDNRQIVSASRDRTIKL  131

Query  382  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            W+   E K  + D                   +    + C   S N    T+ SG  D  
Sbjct  132  WNTLGECKYTIQD-----------------ADSHTNWVSCVRFSPNTFQPTIVSGSWDRT  174

Query  208  IRVWGI  191
            ++VW +
Sbjct  175  VKVWNL  180


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 47/184 (26%), Positives = 78/184 (42%), Gaps = 27/184 (15%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  542
            GH+ +V  V  S        +SGSWD  +++W+L+         GHT  V +VA S D  
Sbjct  61   GHSHFVQDVVLSSD--GQFALSGSWDSELRLWDLNTGATTRRFVGHTKDVLSVAFSIDNR  118

Query  541  LCASGGKDGVILLWDLAEGKKLYSLDAGSI---IHALCFSPNRYW---LCAATEASIKIW  380
               S  +D  I LW+     K    DA S    +  + FSPN +    +  + + ++K+W
Sbjct  119  QIVSASRDRTIKLWNTLGECKYTIQDADSHTNWVSCVRFSPNTFQPTIVSGSWDRTVKVW  178

Query  379  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRV  200
            +L           + K    ++  G          +  +++ + DGS   SG  DGV  +
Sbjct  179  NL----------TNCKLRCTLAGHGG---------YVNTVAVSPDGSLCASGGKDGVTLL  219

Query  199  WGIG  188
            W + 
Sbjct  220  WDLA  223



>ref|XP_010243791.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Nelumbo nucifera]
Length=314

 Score =   308 bits (789),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 146/190 (77%), Positives = 162/190 (85%), Gaps = 12/190 (6%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTIQD D H  WVSCVRFSP+T QPTIVSGSWDRTVKVWNL+NCKLR TL GH GYV
Sbjct  137  ECKYTIQDADSHTNWVSCVRFSPNTFQPTIVSGSWDRTVKVWNLTNCKLRCTLTGHGGYV  196

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTVAVSPDGSLCASGGKDGV LLWDLAEGK+LYSLDAG+IIH+LCFSPNRYWLCAAT+ S
Sbjct  197  NTVAVSPDGSLCASGGKDGVTLLWDLAEGKRLYSLDAGAIIHSLCFSPNRYWLCAATQDS  256

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            +KIWDLESKSIV DL+ +  Q             KN++++CTSLSW++DGSTLF+GYTDG
Sbjct  257  VKIWDLESKSIVQDLKPEATQ------------GKNQMLYCTSLSWSSDGSTLFTGYTDG  304

Query  211  VIRVWGIGRY  182
             IRVWGIGRY
Sbjct  305  AIRVWGIGRY  314


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 48/186 (26%), Positives = 79/186 (42%), Gaps = 27/186 (15%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  557
            GH++ V+ +  +P      IVS S D++V VW+L+  +      R  L GH+ +V  V +
Sbjct  13   GHSDMVTAIA-TPIDNSDMIVSSSRDKSVLVWHLTKEEGTYGVPRRRLTGHSHFVQDVVL  71

Query  556  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  383
            S DG    SG  D  + LWDL  G   + +      ++       NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDSELRLWDLNTGVTTRRFVGHTKDVLSVAFSIDNRQIVSASRDRTIKL  131

Query  382  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            W+   E K  + D                   +    + C   S N    T+ SG  D  
Sbjct  132  WNTLGECKYTIQD-----------------ADSHTNWVSCVRFSPNTFQPTIVSGSWDRT  174

Query  208  IRVWGI  191
            ++VW +
Sbjct  175  VKVWNL  180



>ref|XP_010916329.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Elaeis guineensis]
Length=324

 Score =   307 bits (787),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 149/190 (78%), Positives = 163/190 (86%), Gaps = 12/190 (6%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTIQD D H  WVSCVRFSP+T QPTIVSGSWDRTVKVWNL+NCKLRSTL GH GYV
Sbjct  147  ECKYTIQDADAHTNWVSCVRFSPNTFQPTIVSGSWDRTVKVWNLTNCKLRSTLTGHGGYV  206

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            N VAVSPDGSLCASGGKDGV LLWDLAEGK+LYSLDAG+II+ALCFSPNRYWLCAAT+ S
Sbjct  207  NAVAVSPDGSLCASGGKDGVTLLWDLAEGKRLYSLDAGAIIYALCFSPNRYWLCAATQDS  266

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            +KIWDLESKSIV     DLK E+  S        KN+I++CTSL+W+ADGSTLF+GYTDG
Sbjct  267  VKIWDLESKSIV----QDLKPETPTS--------KNQILYCTSLNWSADGSTLFTGYTDG  314

Query  211  VIRVWGIGRY  182
            VIRVWGI RY
Sbjct  315  VIRVWGISRY  324


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 52/196 (27%), Positives = 81/196 (41%), Gaps = 37/196 (19%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL---------------RSTLAG  587
            GH+  V+ +  +P      +VS S D++V VW+L+                   R  L G
Sbjct  13   GHSGAVTAIA-APLDNSDMVVSSSRDKSVLVWHLTKDSPAAAAGEPGGSAYGVPRRRLTG  71

Query  586  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWL  413
            H+ +V  V +S DG    SG  DG + LWDLA G         +  + ++ FS  NR  +
Sbjct  72   HSHFVQDVVLSSDGQFALSGSWDGELRLWDLATGATTRRFVGHTKDVLSVAFSVDNRQIV  131

Query  412  CAATEASIKIWDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  239
             A+ + +IK+W+   E K  + D                   A    + C   S N    
Sbjct  132  SASRDRTIKLWNTLGECKYTIQD-----------------ADAHTNWVSCVRFSPNTFQP  174

Query  238  TLFSGYTDGVIRVWGI  191
            T+ SG  D  ++VW +
Sbjct  175  TIVSGSWDRTVKVWNL  190


 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 47/184 (26%), Positives = 79/184 (43%), Gaps = 27/184 (15%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  542
            GH+ +V  V  S        +SGSWD  +++W+L+         GHT  V +VA S D  
Sbjct  71   GHSHFVQDVVLSSD--GQFALSGSWDGELRLWDLATGATTRRFVGHTKDVLSVAFSVDNR  128

Query  541  LCASGGKDGVILLWDLAEGKKLYSLDAGSI---IHALCFSPNRYW---LCAATEASIKIW  380
               S  +D  I LW+     K    DA +    +  + FSPN +    +  + + ++K+W
Sbjct  129  QIVSASRDRTIKLWNTLGECKYTIQDADAHTNWVSCVRFSPNTFQPTIVSGSWDRTVKVW  188

Query  379  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRV  200
            +L           + K  S ++  G          +  +++ + DGS   SG  DGV  +
Sbjct  189  NL----------TNCKLRSTLTGHGG---------YVNAVAVSPDGSLCASGGKDGVTLL  229

Query  199  WGIG  188
            W + 
Sbjct  230  WDLA  233



>ref|XP_006837182.1| hypothetical protein AMTR_s00105p00058690 [Amborella trichopoda]
 gb|ERN00036.1| hypothetical protein AMTR_s00105p00058690 [Amborella trichopoda]
Length=314

 Score =   303 bits (775),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 144/190 (76%), Positives = 158/190 (83%), Gaps = 12/190 (6%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTIQD D H  WVSCVRFSP+T QPTIVSGSWDRTVKVWNL+NCKLR TL GH GYV
Sbjct  137  ECKYTIQDQDSHTNWVSCVRFSPNTYQPTIVSGSWDRTVKVWNLTNCKLRCTLTGHAGYV  196

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            N+VAVSPDGSLCASGGKDGV LLWDLAEGK+LYSL+AG IIHALCFSPNRYWLCAATE S
Sbjct  197  NSVAVSPDGSLCASGGKDGVTLLWDLAEGKRLYSLEAGGIIHALCFSPNRYWLCAATEES  256

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            +KIWDLESKSIV DL+ D                KN++++CTSLSW+ DGSTLF+GYTDG
Sbjct  257  VKIWDLESKSIVQDLKTDAPTN------------KNQMLYCTSLSWSTDGSTLFTGYTDG  304

Query  211  VIRVWGIGRY  182
             IRVW +GRY
Sbjct  305  AIRVWVVGRY  314


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 50/186 (27%), Positives = 83/186 (45%), Gaps = 27/186 (15%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  557
            GH++ V+ +  +P      IVS S D++V +W+L+  +      R  L GH+ +V  V +
Sbjct  13   GHSDMVTAIA-TPVDNSDVIVSSSRDKSVLLWHLTKEEGTYGVPRRRLTGHSHFVQDVVM  71

Query  556  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  383
            S DG    SG  DG + LWDL  G   + +     +++       NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLNTGMTTRRFVGHTKNVLSVAFSIDNRQIVSASRDRTIKL  131

Query  382  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            W+   E K  + D      Q+S               + C   S N    T+ SG  D  
Sbjct  132  WNTLGECKYTIQD------QDSH-----------TNWVSCVRFSPNTYQPTIVSGSWDRT  174

Query  208  IRVWGI  191
            ++VW +
Sbjct  175  VKVWNL  180



>ref|XP_010924141.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Elaeis guineensis]
Length=323

 Score =   303 bits (775),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 145/190 (76%), Positives = 160/190 (84%), Gaps = 12/190 (6%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTIQD D H  WVSCVRFSP+  QPTIVS SWDRTVKVWNL+NCKLRSTL GH+GYV
Sbjct  146  ECKYTIQDADAHTNWVSCVRFSPNAFQPTIVSASWDRTVKVWNLTNCKLRSTLTGHSGYV  205

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            N VAVSPDGSLCASGGKDGV LLWDLAEGK+LYSLDAG+IIH+LCFSPNRYWLCAAT+ S
Sbjct  206  NAVAVSPDGSLCASGGKDGVTLLWDLAEGKRLYSLDAGAIIHSLCFSPNRYWLCAATQES  265

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            +KIWDLESKSIV     DLK E+  S        KN++++CTSLSW+ADGSTLF+GYTDG
Sbjct  266  VKIWDLESKSIV----QDLKPETPTS--------KNQMLYCTSLSWSADGSTLFTGYTDG  313

Query  211  VIRVWGIGRY  182
             IRVW I RY
Sbjct  314  TIRVWEISRY  323


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 52/195 (27%), Positives = 83/195 (43%), Gaps = 36/195 (18%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLS-NCKL-------------RSTLAGH  584
            GH++ V+ +  +P      IVS S D+++ VW+L+ +  L             R  L GH
Sbjct  13   GHSDMVTAIA-TPIDNSDMIVSSSRDKSILVWHLTKDAPLSAEGAAASSYGVPRRRLTGH  71

Query  583  TGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLC  410
            + +V  V +S DG    SG  DG + LWDL  G         +  + ++ FS  NR  + 
Sbjct  72   SHFVEDVVLSSDGQFALSGSWDGELRLWDLNTGTTTRRFVGHTKDVLSVAFSIDNRQIVS  131

Query  409  AATEASIKIWDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGST  236
            A+ + +IK+W+   E K  + D                   A    + C   S NA   T
Sbjct  132  ASRDRTIKLWNTLGECKYTIQD-----------------ADAHTNWVSCVRFSPNAFQPT  174

Query  235  LFSGYTDGVIRVWGI  191
            + S   D  ++VW +
Sbjct  175  IVSASWDRTVKVWNL  189



>ref|XP_010430893.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A, partial [Camelina sativa]
Length=284

 Score =   301 bits (771),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 144/181 (80%), Positives = 161/181 (89%), Gaps = 2/181 (1%)
 Frame = -1

Query  751  ECKYTIQDG--DGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTG  578
            ECKYTI +G  DGH +WVSCVRFSP+TLQPTIVS SWD+TVKVWNLSNCKLRSTLAGHTG
Sbjct  70   ECKYTISEGGGDGHRDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLSNCKLRSTLAGHTG  129

Query  577  YVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATE  398
            YV+TVAVSPDGSLCASGGKDGV+LLWDLAEGKKLYS +A S+IHALCFSPNRYWLCAATE
Sbjct  130  YVSTVAVSPDGSLCASGGKDGVVLLWDLAEGKKLYSFEANSVIHALCFSPNRYWLCAATE  189

Query  397  ASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYT  218
              IKIWDLESK+IV DL+VDLK E+E +      A K K+I+CTSL+W+ADGSTLFSGYT
Sbjct  190  QGIKIWDLESKTIVEDLKVDLKAEAEKADNSGPAATKRKVIYCTSLNWSADGSTLFSGYT  249

Query  217  D  215
            +
Sbjct  250  E  250



>ref|XP_009405003.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Musa acuminata subsp. malaccensis]
Length=324

 Score =   302 bits (773),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 143/190 (75%), Positives = 162/190 (85%), Gaps = 13/190 (7%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTIQD D H  WVSCVRFSP+  QPTIVSGSWDRT+KVWNL+NCKLRSTLAGH+GYV
Sbjct  148  ECKYTIQDADAHTNWVSCVRFSPNAYQPTIVSGSWDRTIKVWNLTNCKLRSTLAGHSGYV  207

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTVAVSPDGSLCASGGKDGV LLWDLAEGK+LYSLDAG+IIH+LCFSPNRYWLCAAT+ S
Sbjct  208  NTVAVSPDGSLCASGGKDGVTLLWDLAEGKRLYSLDAGAIIHSLCFSPNRYWLCAATQES  267

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            +KIWDLESK+IV DL+ +             T  KN++++CTSL+W+ADGSTLF+GYTDG
Sbjct  268  VKIWDLESKTIVQDLKPE------------TTTTKNQMLYCTSLTWSADGSTLFTGYTDG  315

Query  211  VIRVWGIGRY  182
             IRVW I RY
Sbjct  316  TIRVWEI-RY  324


 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 53/197 (27%), Positives = 82/197 (42%), Gaps = 38/197 (19%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL----------------RSTLA  590
            GH++ V+ +  +P      IVS S D++V VW+L+                    R  L 
Sbjct  13   GHSDMVTAIA-APVDNSDMIVSSSRDKSVLVWHLTKDAPAALADGSGAGSAYGVPRRRLT  71

Query  589  GHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYW  416
            GH+ +V  V +S DG    SG  DG + LWDL+ G   + +S     ++       NR  
Sbjct  72   GHSHFVEDVVLSSDGQFALSGSWDGDLRLWDLSTGATTRRFSGHTKDVLSVSFSVDNRQI  131

Query  415  LCAATEASIKIWDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADG  242
            + A+ + +IK+W+   E K  + D                   A    + C   S NA  
Sbjct  132  VSASRDRTIKLWNTLGECKYTIQD-----------------ADAHTNWVSCVRFSPNAYQ  174

Query  241  STLFSGYTDGVIRVWGI  191
             T+ SG  D  I+VW +
Sbjct  175  PTIVSGSWDRTIKVWNL  191


 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 48/184 (26%), Positives = 79/184 (43%), Gaps = 27/184 (15%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  542
            GH+ +V  V  S        +SGSWD  +++W+LS        +GHT  V +V+ S D  
Sbjct  72   GHSHFVEDVVLSSD--GQFALSGSWDGDLRLWDLSTGATTRRFSGHTKDVLSVSFSVDNR  129

Query  541  LCASGGKDGVILLWDLAEGKKLYSLDAGSI---IHALCFSPNRYW---LCAATEASIKIW  380
               S  +D  I LW+     K    DA +    +  + FSPN Y    +  + + +IK+W
Sbjct  130  QIVSASRDRTIKLWNTLGECKYTIQDADAHTNWVSCVRFSPNAYQPTIVSGSWDRTIKVW  189

Query  379  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRV  200
            +L           + K  S ++             +  +++ + DGS   SG  DGV  +
Sbjct  190  NL----------TNCKLRSTLAGHSG---------YVNTVAVSPDGSLCASGGKDGVTLL  230

Query  199  WGIG  188
            W + 
Sbjct  231  WDLA  234



>emb|CAC09579.1| gbf1 protein [Fagus sylvatica]
Length=267

 Score =   300 bits (768),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 141/182 (77%), Positives = 163/182 (90%), Gaps = 1/182 (1%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECK+TIQ+ D H +WVSCVRFSP+T QPTIVS SWD+T+KVW+L+NCK+++TLAGH+GYV
Sbjct  84   ECKFTIQEQDAHTDWVSCVRFSPNTTQPTIVSASWDKTIKVWHLTNCKIKNTLAGHSGYV  143

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTVAVSPDGSLCASGGKDGVILLWDLAEGK+LYSLDAG+IIHALCFSPNRYWLCAATE S
Sbjct  144  NTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDAGAIIHALCFSPNRYWLCAATEQS  203

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNN-TAAKNKIIFCTSLSWNADGSTLFSGYTD  215
            IKIWDLESKSIV DL+VDLK E+    +     + K K+I+CTSL+W+ADGSTLFSGYTD
Sbjct  204  IKIWDLESKSIVEDLKVDLKTEAADKDDATTINSTKKKVIYCTSLNWSADGSTLFSGYTD  263

Query  214  GV  209
            GV
Sbjct  264  GV  265



>ref|XP_010495439.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Camelina sativa]
Length=308

 Score =   300 bits (769),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 143/181 (79%), Positives = 161/181 (89%), Gaps = 2/181 (1%)
 Frame = -1

Query  751  ECKYTIQDG--DGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTG  578
            ECKYTI +G  DGH +WVSCVRFSP+TLQPTIVS SWD+TVKVWNLSNCKLRSTLAGHTG
Sbjct  94   ECKYTISEGGGDGHRDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLSNCKLRSTLAGHTG  153

Query  577  YVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATE  398
            YV+TVAVSPDGSLCASGGKDGV+LLWDLAEGKKLYS +A S+IHALCFSPNRYWLCAATE
Sbjct  154  YVSTVAVSPDGSLCASGGKDGVVLLWDLAEGKKLYSFEANSVIHALCFSPNRYWLCAATE  213

Query  397  ASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYT  218
              IKIWDLESK+IV DL+VDL+ E+E +      A K K+I+CTSL+W+ADGSTLFSGYT
Sbjct  214  QGIKIWDLESKTIVEDLKVDLEAEAEKADHRGPAATKRKVIYCTSLNWSADGSTLFSGYT  273

Query  217  D  215
            +
Sbjct  274  E  274



>ref|XP_008803271.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Phoenix dactylifera]
Length=323

 Score =   298 bits (762),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 144/190 (76%), Positives = 159/190 (84%), Gaps = 12/190 (6%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTIQD D H  WVSCVRFSP+  QPTIVS SWDRTVKVWNL+NCKLR TL GH GYV
Sbjct  146  ECKYTIQDADAHTNWVSCVRFSPNAYQPTIVSASWDRTVKVWNLTNCKLRCTLTGHGGYV  205

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            N VAVSPDGSLCASGGKDGV LLWDLAEGK+LYSLDAG+IIH+LCFSPNRYWLCAAT+ S
Sbjct  206  NAVAVSPDGSLCASGGKDGVTLLWDLAEGKRLYSLDAGAIIHSLCFSPNRYWLCAATQDS  265

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            +KIWDLESKSIV     DLK E+ +S        KN++++CTSLSW+ADGSTLF+GYTDG
Sbjct  266  VKIWDLESKSIV----QDLKPETPIS--------KNQMLYCTSLSWSADGSTLFTGYTDG  313

Query  211  VIRVWGIGRY  182
             IRVW I RY
Sbjct  314  TIRVWEITRY  323


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 50/195 (26%), Positives = 81/195 (42%), Gaps = 36/195 (18%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLS-NCKL-------------RSTLAGH  584
            GH++ V+ +  +P      IVS S D+++ VWNL+ +  L             R  L GH
Sbjct  13   GHSDMVTAIA-APIDNSDMIVSSSRDKSILVWNLTKDAPLSAEGAAASSYGVPRRRLTGH  71

Query  583  TGYVNTVAVSPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLC  410
            + +V  V +S DG    SG  DG + LWDL  G   + +      ++       NR  + 
Sbjct  72   SHFVEDVVLSSDGQFALSGAWDGELRLWDLNTGITTRRFVGHTKDVLSVAFSIDNRQIVS  131

Query  409  AATEASIKIWDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGST  236
            A+ + +I++W+   E K  + D                   A    + C   S NA   T
Sbjct  132  ASRDRTIRLWNTLGECKYTIQD-----------------ADAHTNWVSCVRFSPNAYQPT  174

Query  235  LFSGYTDGVIRVWGI  191
            + S   D  ++VW +
Sbjct  175  IVSASWDRTVKVWNL  189



>ref|XP_009400497.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Musa acuminata subsp. malaccensis]
Length=324

 Score =   298 bits (762),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 142/190 (75%), Positives = 159/190 (84%), Gaps = 13/190 (7%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTIQD D H  WVSCVRFSP+  QPTIVS SWDRT+KVWNL+NCKLR TLAGH GYV
Sbjct  148  ECKYTIQDADAHTNWVSCVRFSPNAYQPTIVSASWDRTIKVWNLTNCKLRCTLAGHAGYV  207

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTVAVSPDGSLCASGGKDGV LLWDLAEGK+LYSLDAG+IIH+LCFSPNRYWLCAAT+ S
Sbjct  208  NTVAVSPDGSLCASGGKDGVTLLWDLAEGKRLYSLDAGAIIHSLCFSPNRYWLCAATQES  267

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            +KIWDLESKSIV DL+ +             T  KN++++CTSL+W+ADGSTLF+GYTDG
Sbjct  268  VKIWDLESKSIVQDLKPE------------TTGTKNQMLYCTSLTWSADGSTLFTGYTDG  315

Query  211  VIRVWGIGRY  182
             IRVW I RY
Sbjct  316  TIRVWEI-RY  324


 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 51/197 (26%), Positives = 80/197 (41%), Gaps = 38/197 (19%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL----------------RSTLA  590
            GH + V+ +  +P      IVS S D++V VW+L+                    +  L 
Sbjct  13   GHTDMVTAIA-APIDNSDMIVSSSRDKSVLVWHLTKDAPSASGDGTATGSSYGVPKRRLT  71

Query  589  GHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYW  416
            GH+ +V  V +S DG    SG  DG + LWDL+ G   + +S     ++       NR  
Sbjct  72   GHSHFVQDVVLSSDGQFALSGSWDGDLRLWDLSTGVTTRRFSGHTKDVLSVAFSIDNRQI  131

Query  415  LCAATEASIKIWDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADG  242
            + A+ + +IK+W+   E K  + D                   A    + C   S NA  
Sbjct  132  VSASRDRTIKLWNTLGECKYTIQD-----------------ADAHTNWVSCVRFSPNAYQ  174

Query  241  STLFSGYTDGVIRVWGI  191
             T+ S   D  I+VW +
Sbjct  175  PTIVSASWDRTIKVWNL  191


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 51/184 (28%), Positives = 80/184 (43%), Gaps = 27/184 (15%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  542
            GH+ +V  V  S        +SGSWD  +++W+LS        +GHT  V +VA S D  
Sbjct  72   GHSHFVQDVVLSSD--GQFALSGSWDGDLRLWDLSTGVTTRRFSGHTKDVLSVAFSIDNR  129

Query  541  LCASGGKDGVILLWDLAEGKKLYSLDAGSI---IHALCFSPNRYW---LCAATEASIKIW  380
               S  +D  I LW+     K    DA +    +  + FSPN Y    + A+ + +IK+W
Sbjct  130  QIVSASRDRTIKLWNTLGECKYTIQDADAHTNWVSCVRFSPNAYQPTIVSASWDRTIKVW  189

Query  379  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRV  200
            +L +      LR  L   +                +  +++ + DGS   SG  DGV  +
Sbjct  190  NLTN----CKLRCTLAGHAG---------------YVNTVAVSPDGSLCASGGKDGVTLL  230

Query  199  WGIG  188
            W + 
Sbjct  231  WDLA  234



>ref|XP_010923802.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Elaeis guineensis]
Length=323

 Score =   297 bits (760),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 143/190 (75%), Positives = 159/190 (84%), Gaps = 12/190 (6%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTIQD D H  WVSCVRFSP+  QPTIVSGSWDRTVKVWNL+NCKLR TL GH GYV
Sbjct  146  ECKYTIQDADAHTNWVSCVRFSPNAYQPTIVSGSWDRTVKVWNLTNCKLRCTLTGHGGYV  205

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            N VAVSPDGSLCASGGKDG+ LLWDLAEGK+LYSLDAG+II+ALCFSPNRYWLCAAT+ S
Sbjct  206  NAVAVSPDGSLCASGGKDGITLLWDLAEGKRLYSLDAGAIIYALCFSPNRYWLCAATQDS  265

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            +KIWDLESKSIV     DLK E+  S        KN++++CTSLSW+ADGSTLF+GYTDG
Sbjct  266  VKIWDLESKSIV----QDLKPETPTS--------KNQMLYCTSLSWSADGSTLFTGYTDG  313

Query  211  VIRVWGIGRY  182
             IRVW + RY
Sbjct  314  TIRVWEVSRY  323


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 52/195 (27%), Positives = 80/195 (41%), Gaps = 36/195 (18%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLS-NCKL-------------RSTLAGH  584
            GH + V+ +  +P      IVS S D++V VWNL+ +  L             R  L GH
Sbjct  13   GHTDVVTAIA-TPIDNSDMIVSSSRDKSVLVWNLTKDAPLSSEGAGASSYGVPRRRLTGH  71

Query  583  TGYVNTVAVSPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLC  410
            + +V  V +S DG    SG  D  + LWDL  G   + +      ++       NR  + 
Sbjct  72   SHFVEDVVLSSDGQFALSGSWDSELRLWDLNTGVTTRRFVGHTKDVLSVAFSVDNRQIVS  131

Query  409  AATEASIKIWDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGST  236
            A+ + +IK+W+   E K  + D                   A    + C   S NA   T
Sbjct  132  ASRDRTIKLWNTLGECKYTIQD-----------------ADAHTNWVSCVRFSPNAYQPT  174

Query  235  LFSGYTDGVIRVWGI  191
            + SG  D  ++VW +
Sbjct  175  IVSGSWDRTVKVWNL  189



>gb|AFV60006.1| heterotrimeric guanine nucleotide-binding protein subunit beta 
[Eschscholzia californica]
Length=313

 Score =   296 bits (759),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 141/189 (75%), Positives = 159/189 (84%), Gaps = 12/189 (6%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTIQD D H  WVSCVRFSP+TLQPTIVSG WDRTVKVWNL+NCKLRSTLAGH GYV
Sbjct  137  ECKYTIQDADSHTNWVSCVRFSPNTLQPTIVSGFWDRTVKVWNLTNCKLRSTLAGHGGYV  196

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL AG IIHALCFSPNRYWLCAAT+  
Sbjct  197  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLPAGHIIHALCFSPNRYWLCAATQGD  256

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            I+IWDLESKS+V +L+ ++ Q             KNK+ +CTSL+W++DGSTLF+G+TDG
Sbjct  257  IQIWDLESKSLVQELKPEVTQ------------GKNKMFYCTSLNWSSDGSTLFTGFTDG  304

Query  211  VIRVWGIGR  185
             IRV+ + R
Sbjct  305  TIRVYAVSR  313


 Score = 59.3 bits (142),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 51/186 (27%), Positives = 82/186 (44%), Gaps = 27/186 (15%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  557
            GH++ V+ +  +P      IVS S D+++ VW+L+         R  L GH+ +V  V +
Sbjct  13   GHDDMVTAIA-TPIDNSDMIVSSSRDKSILVWHLTKEDPTYGVPRRRLTGHSHFVQDVVL  71

Query  556  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  383
            S DG    SG  DG + LWDL  G         +  + ++ FS  NR  + A+ + SIK+
Sbjct  72   SSDGQFALSGAWDGELRLWDLNTGTTTRRFVGHTKDVLSVAFSIDNRQIVSASRDRSIKL  131

Query  382  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            W+   E K  + D                   +    + C   S N    T+ SG+ D  
Sbjct  132  WNTLGECKYTIQD-----------------ADSHTNWVSCVRFSPNTLQPTIVSGFWDRT  174

Query  208  IRVWGI  191
            ++VW +
Sbjct  175  VKVWNL  180


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 51/203 (25%), Positives = 85/203 (42%), Gaps = 31/203 (15%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  542
            GH+ +V  V  S        +SG+WD  +++W+L+         GHT  V +VA S D  
Sbjct  61   GHSHFVQDVVLSSD--GQFALSGAWDGELRLWDLNTGTTTRRFVGHTKDVLSVAFSIDNR  118

Query  541  LCASGGKDGVILLWDLAEGKKLYSLDAGSI---IHALCFSPNRYWLCAAT---EASIKIW  380
               S  +D  I LW+     K    DA S    +  + FSPN       +   + ++K+W
Sbjct  119  QIVSASRDRSIKLWNTLGECKYTIQDADSHTNWVSCVRFSPNTLQPTIVSGFWDRTVKVW  178

Query  379  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRV  200
            +L           + K  S ++  G          +  +++ + DGS   SG  DGVI +
Sbjct  179  NL----------TNCKLRSTLAGHGG---------YVNTVAVSPDGSLCASGGKDGVILL  219

Query  199  WGIGRY*MEEFRRSHMIIGHVCY  131
            W +     E  +   +  GH+ +
Sbjct  220  WDLA----EGKKLYSLPAGHIIH  238



>ref|XP_009380503.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Musa acuminata subsp. malaccensis]
Length=323

 Score =   296 bits (757),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 142/190 (75%), Positives = 160/190 (84%), Gaps = 13/190 (7%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTIQD D H  WVSCVRFSP+  QPTIVSGSWDRTVKVWNL+NCKLR TLAGH G V
Sbjct  147  ECKYTIQDADAHTNWVSCVRFSPNAYQPTIVSGSWDRTVKVWNLTNCKLRCTLAGHAGSV  206

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTVAVSPDGSLCASGGKDGV LLWDLAEGK+LYSLDAG+IIH+LCFSPNRYWLCAAT+ S
Sbjct  207  NTVAVSPDGSLCASGGKDGVTLLWDLAEGKRLYSLDAGAIIHSLCFSPNRYWLCAATQES  266

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            +KIWDLESKSIV DL+ ++            T  KN++++CTSL+W+A+GSTLF+GYTDG
Sbjct  267  VKIWDLESKSIVQDLKPEI------------TTTKNQMLYCTSLTWSANGSTLFTGYTDG  314

Query  211  VIRVWGIGRY  182
             IRVW I RY
Sbjct  315  TIRVWEI-RY  323


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 51/196 (26%), Positives = 80/196 (41%), Gaps = 37/196 (19%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL---------------RSTLAG  587
            GH + V+ +  +P      IVS S D++V VW+L+                   R  L G
Sbjct  13   GHTDMVTAIA-APIDNSDMIVSSSRDKSVLVWHLTKDAPAASADGSGVGSYGVPRRRLTG  71

Query  586  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWL  413
            H+ +V  V +S DG    SG  DG + LWDL+ G   + +      ++       NR  +
Sbjct  72   HSHFVQDVVLSSDGQFALSGSWDGDLRLWDLSTGVTTRRFFGHTKDVLSVAFSIDNRQIV  131

Query  412  CAATEASIKIWDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  239
             A+ + +IK+W+   E K  + D                   A    + C   S NA   
Sbjct  132  SASRDGTIKLWNTLGECKYTIQD-----------------ADAHTNWVSCVRFSPNAYQP  174

Query  238  TLFSGYTDGVIRVWGI  191
            T+ SG  D  ++VW +
Sbjct  175  TIVSGSWDRTVKVWNL  190


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 54/184 (29%), Positives = 78/184 (42%), Gaps = 27/184 (15%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  542
            GH+ +V  V  S        +SGSWD  +++W+LS         GHT  V +VA S D  
Sbjct  71   GHSHFVQDVVLSSD--GQFALSGSWDGDLRLWDLSTGVTTRRFFGHTKDVLSVAFSIDNR  128

Query  541  LCASGGKDGVILLWDLAEGKKLYSLDAGSI---IHALCFSPNRYW---LCAATEASIKIW  380
               S  +DG I LW+     K    DA +    +  + FSPN Y    +  + + ++K+W
Sbjct  129  QIVSASRDGTIKLWNTLGECKYTIQDADAHTNWVSCVRFSPNAYQPTIVSGSWDRTVKVW  188

Query  379  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRV  200
            +L +      LR  L       A   NT A +            DGS   SG  DGV  +
Sbjct  189  NLTN----CKLRCTLAGH----AGSVNTVAVSP-----------DGSLCASGGKDGVTLL  229

Query  199  WGIG  188
            W + 
Sbjct  230  WDLA  233



>ref|XP_004252271.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein isoform X2 [Solanum lycopersicum]
Length=301

 Score =   293 bits (750),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 138/164 (84%), Positives = 149/164 (91%), Gaps = 0/164 (0%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTIQD D H++WVSCVRFSP+ LQPTIVSGSWDRTVK+WNLSNCKLR+TLAGHTGYV
Sbjct  138  ECKYTIQDQDSHSDWVSCVRFSPNNLQPTIVSGSWDRTVKIWNLSNCKLRATLAGHTGYV  197

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NT AVSPDGSLCASGGKDGVILLWDLAEGKKLYSLD+GSIIHALCFSPNRYWLCAATE+S
Sbjct  198  NTAAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDSGSIIHALCFSPNRYWLCAATESS  257

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSL  260
            IKIWDLESKSIVVDLRVDLKQE+EMS    +T+  +K  F  S 
Sbjct  258  IKIWDLESKSIVVDLRVDLKQETEMSGNATSTSGNSKTKFLASF  301


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 51/186 (27%), Positives = 82/186 (44%), Gaps = 27/186 (15%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSN-----CKLRSTLAGHTGYVNTVAV  557
             H +WV+ +  +P      IV+ S D+++ VW+L+         R  L GH  +V  V +
Sbjct  14   AHTDWVTAIA-TPIDNSDMIVTSSRDKSIIVWSLTKEGSQYGVPRRRLTGHGHFVQDVVL  72

Query  556  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  383
            S DG    SG  DG + LWDL  G         +  + ++ FS  NR  + A+ + SIK+
Sbjct  73   SSDGMFALSGSWDGELRLWDLQAGTTARRFVGHTKDVLSVAFSVDNRQIVSASRDKSIKL  132

Query  382  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            W+   E K  + D      Q+S            +  + C   S N    T+ SG  D  
Sbjct  133  WNTLGECKYTIQD------QDSH-----------SDWVSCVRFSPNNLQPTIVSGSWDRT  175

Query  208  IRVWGI  191
            +++W +
Sbjct  176  VKIWNL  181



>gb|ABK25010.1| unknown [Picea sitchensis]
 gb|ACN41136.1| unknown [Picea sitchensis]
Length=321

 Score =   292 bits (748),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 137/189 (72%), Positives = 158/189 (84%), Gaps = 11/189 (6%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTIQD D H+ WVSCVRFSPST+ P IVSGSWDRTVKVWNL+NCKLR+TL GH+GY+
Sbjct  143  ECKYTIQDADAHSNWVSCVRFSPSTVNPMIVSGSWDRTVKVWNLANCKLRTTLTGHSGYI  202

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NT  VSPDGSLCASGGKDGV +LWDLAEGK+LYSLD+G II++LCFSPNRYWLCAAT+  
Sbjct  203  NTCTVSPDGSLCASGGKDGVAMLWDLAEGKRLYSLDSGDIINSLCFSPNRYWLCAATQQC  262

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            +KIWDLESKS+V +LR +            N   K ++ FCTSL+W+ADGSTLFSGYTDG
Sbjct  263  VKIWDLESKSVVEELRPNF-----------NPTKKGQVPFCTSLAWSADGSTLFSGYTDG  311

Query  211  VIRVWGIGR  185
            VIRVWG+GR
Sbjct  312  VIRVWGVGR  320


 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 46/193 (24%), Positives = 82/193 (42%), Gaps = 33/193 (17%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----------RSTLAGHTGY  575
            GH+ WV+ +  +P      I+SGS D+++ VW+L+               +  L GH+ +
Sbjct  13   GHDNWVTSIA-TPIDNSDMIISGSRDKSILVWHLTKETTGGEEGGTYGVAKRRLTGHSHF  71

Query  574  VNTVAVSPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAAT  401
            ++ V +S DG    SG  D  + LWDL  G   + +   +  ++     + NR  + A+ 
Sbjct  72   IHDVVISSDGQFALSGSWDATLRLWDLNVGITTRRFVGHSKDVLSVAFSADNRQIVSASR  131

Query  400  EASIKIWDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFS  227
            + SIK+W+   E K  + D                   A +  + C   S +     + S
Sbjct  132  DRSIKLWNTLGECKYTIQD-----------------ADAHSNWVSCVRFSPSTVNPMIVS  174

Query  226  GYTDGVIRVWGIG  188
            G  D  ++VW + 
Sbjct  175  GSWDRTVKVWNLA  187



>gb|ACN41093.1| unknown [Picea sitchensis]
Length=321

 Score =   292 bits (747),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 137/189 (72%), Positives = 157/189 (83%), Gaps = 11/189 (6%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTIQD D H  WVSCVRFSPST+ P IVSGSWDRTVKVWNL+NCKLR+TL GH+GY+
Sbjct  143  ECKYTIQDADAHTNWVSCVRFSPSTVNPMIVSGSWDRTVKVWNLANCKLRTTLTGHSGYI  202

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NT  VSPDGSLCASGGKDGV +LWDLAEGK+LYSLD+G II++LCFSPNRYWLCAAT+  
Sbjct  203  NTCTVSPDGSLCASGGKDGVAMLWDLAEGKRLYSLDSGDIINSLCFSPNRYWLCAATQQC  262

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            +KIWDLESKS+V +LR +            N   K ++ FCTSL+W+ADGSTLFSGYTDG
Sbjct  263  VKIWDLESKSVVEELRPNF-----------NPTKKGQVPFCTSLAWSADGSTLFSGYTDG  311

Query  211  VIRVWGIGR  185
            VIRVWG+GR
Sbjct  312  VIRVWGVGR  320


 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 46/193 (24%), Positives = 81/193 (42%), Gaps = 33/193 (17%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----------RSTLAGHTGY  575
            GH+ WV+ +  +P      I+SGS D+++ VW+L+               +  L GH+ +
Sbjct  13   GHDNWVTSIA-TPIDNSDMIISGSRDKSILVWHLTKETTGGEEGGTYGVAKRRLTGHSHF  71

Query  574  VNTVAVSPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAAT  401
            ++ V +S DG    SG  D  + LWDL  G   + +   +  ++     + NR  + A+ 
Sbjct  72   IHDVVISSDGQFALSGSWDATLRLWDLNVGITTRRFVGHSKDVLSVAFSADNRQIVSASR  131

Query  400  EASIKIWDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFS  227
            + SIK+W+   E K  + D                   A    + C   S +     + S
Sbjct  132  DRSIKLWNTLGECKYTIQD-----------------ADAHTNWVSCVRFSPSTVNPMIVS  174

Query  226  GYTDGVIRVWGIG  188
            G  D  ++VW + 
Sbjct  175  GSWDRTVKVWNLA  187



>ref|XP_008812615.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Phoenix dactylifera]
Length=331

 Score =   290 bits (743),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 143/198 (72%), Positives = 160/198 (81%), Gaps = 20/198 (10%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEW--------VSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRST  596
            ECKYTIQD DGH  W        VSCVRFSP+  QP IVSGSWDRTVKVWNL+NCKLR T
Sbjct  146  ECKYTIQDADGHTNWDADGHTNWVSCVRFSPNAFQPIIVSGSWDRTVKVWNLTNCKLRCT  205

Query  595  LAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYW  416
            LAGH GYV+ VAVSPDGSLCASGGKDG+ LLWDLAEGK+LYSLDAG+IIHALCFSPNRYW
Sbjct  206  LAGHGGYVSAVAVSPDGSLCASGGKDGITLLWDLAEGKRLYSLDAGAIIHALCFSPNRYW  265

Query  415  LCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGST  236
            LCAAT+ S+KIWDLE+KSIV     DLK E+  S        KN++++CTSLSW+ADGST
Sbjct  266  LCAATQDSVKIWDLENKSIV----QDLKPETPTS--------KNQMLYCTSLSWSADGST  313

Query  235  LFSGYTDGVIRVWGIGRY  182
            LF+GYTDG IRVW + RY
Sbjct  314  LFTGYTDGTIRVWEVSRY  331


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 53/195 (27%), Positives = 86/195 (44%), Gaps = 28/195 (14%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRST--------------LAGH  584
            GH++ V+ +  +P      IVS S D+++ VW+L+     ST              L GH
Sbjct  13   GHSDVVTGIA-TPIDNSDMIVSSSRDKSILVWHLTKDAPLSTDGAAASSYGVPRRRLTGH  71

Query  583  TGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLC  410
            + +V  V +S DG    SG  DG + LWDL  G         +  + ++ FS  NR  + 
Sbjct  72   SHFVEDVVLSSDGQFALSGSWDGELRLWDLNTGATTRRFVGHTKDVLSVAFSVDNRQIVS  131

Query  409  AATEASIKIWDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGST  236
            A+ + +IK+W+   E K  +     D    +   A+G+        + C   S NA    
Sbjct  132  ASRDRTIKLWNTLGECKYTI----QDADGHTNWDADGH-----TNWVSCVRFSPNAFQPI  182

Query  235  LFSGYTDGVIRVWGI  191
            + SG  D  ++VW +
Sbjct  183  IVSGSWDRTVKVWNL  197



>gb|ABK26798.1| unknown [Picea sitchensis]
 gb|ACN40746.1| unknown [Picea sitchensis]
 gb|ACN40912.1| unknown [Picea sitchensis]
Length=316

 Score =   286 bits (732),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 141/190 (74%), Positives = 154/190 (81%), Gaps = 12/190 (6%)
 Frame = -1

Query  751  ECKYTIQ-DGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  575
            ECKYTIQ D +GH+ W+SCVRFSPS   PTIVS SWDRTVKVWNL+NCKLR+TL GH GY
Sbjct  137  ECKYTIQPDAEGHSNWISCVRFSPSATNPTIVSCSWDRTVKVWNLTNCKLRNTLVGHGGY  196

Query  574  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  395
            VNT AVSPDGSLCASGGKDGV +LWDLAEGK+LYSLDAG II+ALCFSPNRYWLCAAT+ 
Sbjct  197  VNTAAVSPDGSLCASGGKDGVTMLWDLAEGKRLYSLDAGDIIYALCFSPNRYWLCAATQQ  256

Query  394  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  215
             +KIWDLESKSIV DLR D                K +I +CTSLSW+ADGSTLFSGYTD
Sbjct  257  CVKIWDLESKSIVADLRPDFIPNK-----------KAQIPYCTSLSWSADGSTLFSGYTD  305

Query  214  GVIRVWGIGR  185
            G IRVWGIG 
Sbjct  306  GKIRVWGIGH  315


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 51/207 (25%), Positives = 90/207 (43%), Gaps = 27/207 (13%)
 Frame = -1

Query  724  DGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVA  560
            +GH + V+ +  +P      IVS S D+++ +WNL+         R  L GH+ +V  V 
Sbjct  12   EGHTDAVTAIA-TPIDNSDMIVSSSRDKSILLWNLTKEPEKYGVPRRRLTGHSHFVQDVV  70

Query  559  VSPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIK  386
            +S DG    SG  D  + LWDL  G   + +      ++       NR  + A+ + +IK
Sbjct  71   ISSDGQFALSGSWDSELRLWDLNTGLTTRRFVGHTKDVLSVAFSIDNRQIVSASRDRTIK  130

Query  385  IWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVI  206
            +W+            + K   +  AEG+     +  I C   S +A   T+ S   D  +
Sbjct  131  LWNTLG---------ECKYTIQPDAEGH-----SNWISCVRFSPSATNPTIVSCSWDRTV  176

Query  205  RVWGIGRY*MEEFRRSHMIIGHVCYLS  125
            +VW      +   +  + ++GH  Y++
Sbjct  177  KVWN-----LTNCKLRNTLVGHGGYVN  198



>ref|NP_001136800.1| guanine nucleotide-binding protein beta subunit-like protein 
[Zea mays]
 gb|ACF82664.1| unknown [Zea mays]
 gb|ACG34796.1| guanine nucleotide-binding protein beta subunit-like protein 
[Zea mays]
 gb|AFW81011.1| guanine nucleotide-binding protein beta subunit-like protein 
[Zea mays]
Length=334

 Score =   284 bits (726),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 141/194 (73%), Positives = 158/194 (81%), Gaps = 16/194 (8%)
 Frame = -1

Query  751  ECKYTIQDGDG----HNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGH  584
            ECKYTI    G    HN WVSCVRFSP+T QPTIVSGSWDRTVKVWNL+NCKLR TL GH
Sbjct  149  ECKYTIGGDLGGGEGHNGWVSCVRFSPNTFQPTIVSGSWDRTVKVWNLTNCKLRCTLDGH  208

Query  583  TGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAA  404
             GYVN VAVSPDGSLCASGGKDGV LLWDLAEGK+LYSLDAGSIIH+LCFSPNRYWLCAA
Sbjct  209  GGYVNAVAVSPDGSLCASGGKDGVTLLWDLAEGKRLYSLDAGSIIHSLCFSPNRYWLCAA  268

Query  403  TEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSG  224
            T+ S+KIWDLESK +V DL+ D++             +KN+I++CTSLSW+ADGSTL++G
Sbjct  269  TQDSVKIWDLESKHVVQDLKPDIQ------------VSKNQILYCTSLSWSADGSTLYTG  316

Query  223  YTDGVIRVWGIGRY  182
            YTDG IRVW I  Y
Sbjct  317  YTDGSIRVWKISGY  330


 Score = 58.9 bits (141),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 52/194 (27%), Positives = 83/194 (43%), Gaps = 30/194 (15%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRST---------------LAG  587
            GHN  V+ +  +P    P IVS S D++V VW+L+N  + ST               L G
Sbjct  16   GHNGEVTAIA-TPIDNSPFIVSSSRDKSVLVWDLTN-PVHSTPESGVTADYGVPFRRLTG  73

Query  586  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWL  413
            H+ +V  V +S DG    SG  DG + LWDL+ G   + +      +I       NR  +
Sbjct  74   HSHFVQDVVLSSDGQFALSGSWDGELRLWDLSTGLTTRRFVGHEKDVISVAFSVDNRQIV  133

Query  412  CAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTL  233
             A+ + +IK+W+   +            +  +  +       N  + C   S N    T+
Sbjct  134  SASRDKTIKLWNTLGEC-----------KYTIGGDLGGGEGHNGWVSCVRFSPNTFQPTI  182

Query  232  FSGYTDGVIRVWGI  191
             SG  D  ++VW +
Sbjct  183  VSGSWDRTVKVWNL  196



>gb|ACL54313.1| unknown [Zea mays]
Length=334

 Score =   283 bits (725),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 141/194 (73%), Positives = 158/194 (81%), Gaps = 16/194 (8%)
 Frame = -1

Query  751  ECKYTIQDGDG----HNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGH  584
            ECKYTI    G    HN WVSCVRFSP+T QPTIVSGSWDRTVKVWNL+NCKLR TL GH
Sbjct  149  ECKYTIGGDLGGGEGHNGWVSCVRFSPNTFQPTIVSGSWDRTVKVWNLTNCKLRCTLDGH  208

Query  583  TGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAA  404
             GYVN VAVSPDGSLCASGGKDGV LLWDLAEGK+LYSLDAGSIIH+LCFSPNRYWLCAA
Sbjct  209  GGYVNAVAVSPDGSLCASGGKDGVTLLWDLAEGKRLYSLDAGSIIHSLCFSPNRYWLCAA  268

Query  403  TEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSG  224
            T+ S+KIWDLESK +V DL+ D++             +KN+I++CTSLSW+ADGSTL++G
Sbjct  269  TQDSVKIWDLESKHVVQDLKPDIQ------------ISKNQILYCTSLSWSADGSTLYTG  316

Query  223  YTDGVIRVWGIGRY  182
            YTDG IRVW I  Y
Sbjct  317  YTDGSIRVWKISGY  330


 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 50/194 (26%), Positives = 83/194 (43%), Gaps = 30/194 (15%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRST---------------LAG  587
            GHN  V+ +  +P    P IVS S D+++ VW+L+N  + ST               L G
Sbjct  16   GHNGEVTTIA-TPIDNSPFIVSSSRDKSLLVWDLTN-PVHSTPESGATADYGVPFRRLTG  73

Query  586  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWL  413
            H+ +V  V +S DG    SG  DG + LWDL+ G   + +      ++       NR  +
Sbjct  74   HSHFVQDVVLSSDGQFALSGSWDGELRLWDLSTGLTTRRFVGHEKDVLSVAFSVDNRQIV  133

Query  412  CAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTL  233
             A+ + +IK+W+   +            +  +  +       N  + C   S N    T+
Sbjct  134  SASRDKTIKLWNTLGEC-----------KYTIGGDLGGGEGHNGWVSCVRFSPNTFQPTI  182

Query  232  FSGYTDGVIRVWGI  191
             SG  D  ++VW +
Sbjct  183  VSGSWDRTVKVWNL  196



>ref|NP_001146976.1| LOC100280585 [Zea mays]
 gb|ACG24854.1| guanine nucleotide-binding protein beta subunit-like protein 
[Zea mays]
 gb|AFW79043.1| guanine nucleotide-binding protein beta subunit-like protein 
[Zea mays]
Length=334

 Score =   283 bits (725),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 141/194 (73%), Positives = 158/194 (81%), Gaps = 16/194 (8%)
 Frame = -1

Query  751  ECKYTIQDGDG----HNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGH  584
            ECKYTI    G    HN WVSCVRFSP+T QPTIVSGSWDRTVKVWNL+NCKLR TL GH
Sbjct  149  ECKYTIGGDLGGGEGHNGWVSCVRFSPNTFQPTIVSGSWDRTVKVWNLTNCKLRCTLDGH  208

Query  583  TGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAA  404
             GYVN VAVSPDGSLCASGGKDGV LLWDLAEGK+LYSLDAGSIIH+LCFSPNRYWLCAA
Sbjct  209  GGYVNAVAVSPDGSLCASGGKDGVTLLWDLAEGKRLYSLDAGSIIHSLCFSPNRYWLCAA  268

Query  403  TEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSG  224
            T+ S+KIWDLESK +V DL+ D++             +KN+I++CTSLSW+ADGSTL++G
Sbjct  269  TQDSVKIWDLESKHVVQDLKPDIQ------------ISKNQILYCTSLSWSADGSTLYTG  316

Query  223  YTDGVIRVWGIGRY  182
            YTDG IRVW I  Y
Sbjct  317  YTDGSIRVWKISGY  330


 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 50/194 (26%), Positives = 83/194 (43%), Gaps = 30/194 (15%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRST---------------LAG  587
            GHN  V+ +  +P    P IVS S D+++ VW+L+N  + ST               L G
Sbjct  16   GHNGEVTAIA-TPIDNSPFIVSSSRDKSLLVWDLTN-PVHSTPESGATADYGVPFRRLTG  73

Query  586  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWL  413
            H+ +V  V +S DG    SG  DG + LWDL+ G   + +      ++       NR  +
Sbjct  74   HSHFVQDVVLSSDGQFALSGSWDGELRLWDLSTGLTTRRFVGHEKDVLSVAFSVDNRQIV  133

Query  412  CAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTL  233
             A+ + +IK+W+   +            +  +  +       N  + C   S N    T+
Sbjct  134  SASRDKTIKLWNTLGEC-----------KYTIGGDLGGGEGHNGWVSCVRFSPNTFQPTI  182

Query  232  FSGYTDGVIRVWGI  191
             SG  D  ++VW +
Sbjct  183  VSGSWDRTVKVWNL  196



>ref|XP_002440202.1| hypothetical protein SORBIDRAFT_09g027690 [Sorghum bicolor]
 gb|EES18632.1| hypothetical protein SORBIDRAFT_09g027690 [Sorghum bicolor]
Length=334

 Score =   283 bits (723),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 140/194 (72%), Positives = 158/194 (81%), Gaps = 16/194 (8%)
 Frame = -1

Query  751  ECKYTIQDGDG----HNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGH  584
            ECKYTI    G    HN WVSCVRFSP+T QPTIVSGSWDRTVKVWNL+NCKLR TL GH
Sbjct  149  ECKYTIGGDLGGGEGHNGWVSCVRFSPNTFQPTIVSGSWDRTVKVWNLTNCKLRCTLDGH  208

Query  583  TGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAA  404
             GYVN VAVSPDGSLCASGGKDGV LLWDLAEGK+LYSLDAGSIIH+LCFSPNRYWLCAA
Sbjct  209  GGYVNAVAVSPDGSLCASGGKDGVTLLWDLAEGKRLYSLDAGSIIHSLCFSPNRYWLCAA  268

Query  403  TEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSG  224
            T+ S+KIWDLESK +V DL+ D++             +KN+I++C+SLSW+ADGSTL++G
Sbjct  269  TQDSVKIWDLESKHVVQDLKPDIQ------------ISKNQILYCSSLSWSADGSTLYTG  316

Query  223  YTDGVIRVWGIGRY  182
            YTDG IRVW I  Y
Sbjct  317  YTDGSIRVWKISAY  330


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 53/193 (27%), Positives = 83/193 (43%), Gaps = 30/193 (16%)
 Frame = -1

Query  718  HNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRST---------------LAGH  584
            HN  V+ +  +P    P IVS S D++V +W+L N  + ST               L GH
Sbjct  17   HNGEVTAIA-TPIDNSPFIVSASRDKSVLLWDLEN-PVHSTPESGVTADYGVPKRRLTGH  74

Query  583  TGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL-DAGSIIHALCFS-PNRYWLC  410
            + +V  V +S DG    SG  DG + LWDL+ G         G  I ++ FS  NR  + 
Sbjct  75   SHFVQDVVLSSDGMFALSGSWDGELRLWDLSTGATTRRFVGHGKDILSVAFSVDNRQIIS  134

Query  409  AATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLF  230
            A+ + +IK+W+   +            +  +  +       N  + C   S N    T+ 
Sbjct  135  ASRDKTIKLWNTLGEC-----------KYTIGGDLGGGEGHNGWVSCVRFSPNTFQPTIV  183

Query  229  SGYTDGVIRVWGI  191
            SG  D  ++VW +
Sbjct  184  SGSWDRTVKVWNL  196



>ref|XP_001780288.1| predicted protein [Physcomitrella patens]
 gb|EDQ54847.1| predicted protein [Physcomitrella patens]
Length=316

 Score =   280 bits (717),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 134/189 (71%), Positives = 153/189 (81%), Gaps = 10/189 (5%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTIQD DGH  WVSCVRFSP T  P IVSG WD+ VKVWNL+NCK+R+ L GHTGYV
Sbjct  137  ECKYTIQDVDGHTGWVSCVRFSPVTANPIIVSGGWDKVVKVWNLTNCKIRTNLVGHTGYV  196

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTV VSPDGSLCASGGKDGV +LWDLAEGK+LYSLDAG IIH+LCFSPNRYWLCAAT++ 
Sbjct  197  NTVTVSPDGSLCASGGKDGVAMLWDLAEGKRLYSLDAGDIIHSLCFSPNRYWLCAATQSC  256

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            IKIWDLESKS+V +LR +    S+          K ++ +C SL+W+ADGSTLFSGYTDG
Sbjct  257  IKIWDLESKSVVDELRPEFTFVSK----------KAQVPYCVSLNWSADGSTLFSGYTDG  306

Query  211  VIRVWGIGR  185
             IRVW +GR
Sbjct  307  HIRVWAVGR  315


 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 59/122 (48%), Gaps = 8/122 (7%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  557
            GH+ WV+ +   P      I+S S D+++ VW L+  +      R  L GH  +V  V +
Sbjct  13   GHSNWVTAIA-CPLDNPDLILSSSRDKSIIVWTLTREEGNYGVARRRLTGHAHFVQDVVI  71

Query  556  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  383
            S DG    SG  DG + LWDL  G         +  + ++ FS  NR  +  + + +IK+
Sbjct  72   SSDGQFALSGSWDGTLRLWDLNTGTTTRRFIGHTKDVLSVAFSVDNRQIVSGSRDKTIKL  131

Query  382  WD  377
            W+
Sbjct  132  WN  133



>ref|XP_002945887.1| hypothetical protein VOLCADRAFT_78914 [Volvox carteri f. nagariensis]
 gb|EFJ52882.1| hypothetical protein VOLCADRAFT_78914 [Volvox carteri f. nagariensis]
Length=318

 Score =   280 bits (716),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 131/187 (70%), Positives = 155/187 (83%), Gaps = 10/187 (5%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTI + +GH EWVSCVRFSP+T+ P IVSG WD+ VKVWNL+NCKL++ L GHTGYV
Sbjct  138  ECKYTIGEPEGHTEWVSCVRFSPTTVNPIIVSGGWDKMVKVWNLTNCKLKNNLVGHTGYV  197

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTV VSPDGSLCASGGKDGV +LWDLAEGK+LYSLDAG +IH LCFSPNRYWLCAAT+++
Sbjct  198  NTVTVSPDGSLCASGGKDGVAMLWDLAEGKRLYSLDAGDVIHCLCFSPNRYWLCAATQST  257

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            IKIWDLESKS+V DL+V          E N T+ K ++ +C SL+W+ADGSTL+SGYTDG
Sbjct  258  IKIWDLESKSVVDDLKV----------EFNITSKKAQVPYCVSLAWSADGSTLYSGYTDG  307

Query  211  VIRVWGI  191
             IRVW +
Sbjct  308  QIRVWAV  314


 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 36/122 (30%), Positives = 58/122 (48%), Gaps = 7/122 (6%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  557
            GH  WV+ +         T++S S D+TV VW L   +      +  L GH+ +V  V +
Sbjct  13   GHTNWVTAIATPLDPSSNTLLSASRDKTVLVWELERSESNYGYAKKALRGHSHFVQDVVI  72

Query  556  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  383
            S DG  C +G  DG + LWDL  G   + +      ++     + NR  +  A + +IK+
Sbjct  73   SSDGQFCLTGSWDGTLRLWDLNTGTTTRRFVGHTKDVLSVAFSADNRQIVSGARDKTIKL  132

Query  382  WD  377
            W+
Sbjct  133  WN  134



>ref|XP_008811978.1| PREDICTED: LOW QUALITY PROTEIN: guanine nucleotide-binding protein 
subunit beta-like protein A [Phoenix dactylifera]
Length=316

 Score =   280 bits (715),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 139/190 (73%), Positives = 151/190 (79%), Gaps = 20/190 (11%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTIQD D H  WVSCVRFSP+  QPTIVSGSWDRTVKVWNL+NCKLRSTL GH GYV
Sbjct  147  ECKYTIQDADAHTNWVSCVRFSPNNFQPTIVSGSWDRTVKVWNLTNCKLRSTLTGHGGYV  206

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            N VAVSPDGSLCASGGKDGV LLWDLAE K     D G   H+LCFSPNRYWLCAAT+ S
Sbjct  207  NAVAVSPDGSLCASGGKDGVTLLWDLAEEK-----DXG---HSLCFSPNRYWLCAATQDS  258

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            +KIWDLESKSIV DLR +               +KN+I++CTSLSW+ADGSTLF+GYTDG
Sbjct  259  VKIWDLESKSIVQDLRPE------------TPTSKNQILYCTSLSWSADGSTLFTGYTDG  306

Query  211  VIRVWGIGRY  182
            VIRVWGI RY
Sbjct  307  VIRVWGISRY  316


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 53/196 (27%), Positives = 81/196 (41%), Gaps = 37/196 (19%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL---------------RSTLAG  587
            GH+  V+ +  +P      IVS S D++V VW+L+                   R  L G
Sbjct  13   GHSGPVTAIA-APLDNSDMIVSSSRDKSVLVWHLTKDSPAAAAGEPGGAAYGIPRRRLTG  71

Query  586  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWL  413
            H+ +V  V +S DG    SG  DG + LWDLA G         +  + ++ FS  NR  +
Sbjct  72   HSHFVQDVVLSSDGQFALSGSWDGELRLWDLATGATTRRFVGHTKDVLSVAFSIDNRQIV  131

Query  412  CAATEASIKIWDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  239
             A+ + +IK+W+   E K  + D                   A    + C   S N    
Sbjct  132  SASRDRTIKLWNTLGECKYTIQD-----------------ADAHTNWVSCVRFSPNNFQP  174

Query  238  TLFSGYTDGVIRVWGI  191
            T+ SG  D  ++VW +
Sbjct  175  TIVSGSWDRTVKVWNL  190



>ref|XP_001779496.1| predicted protein [Physcomitrella patens]
 gb|EDQ55672.1| predicted protein [Physcomitrella patens]
Length=316

 Score =   279 bits (714),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 135/189 (71%), Positives = 152/189 (80%), Gaps = 10/189 (5%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTIQD D H  WVSCVRFSP T  P IVSG WD+ VKVWNL+NCK+RS L GHTGYV
Sbjct  137  ECKYTIQDVDAHTGWVSCVRFSPVTANPIIVSGGWDKVVKVWNLTNCKIRSNLVGHTGYV  196

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTV VSPDGSLCASGGKDGV +LWDL+EGK+LYSLDAG IIH+LCFSPNRYWLCAAT++ 
Sbjct  197  NTVTVSPDGSLCASGGKDGVAMLWDLSEGKRLYSLDAGDIIHSLCFSPNRYWLCAATQSC  256

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            IKIWDLESKSIV +LR +    S+          K +I +C SL+W+ADGSTLFSGYTDG
Sbjct  257  IKIWDLESKSIVDELRPEFTFVSK----------KAQIPYCVSLNWSADGSTLFSGYTDG  306

Query  211  VIRVWGIGR  185
             IRVW +GR
Sbjct  307  HIRVWAVGR  315


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 52/208 (25%), Positives = 86/208 (41%), Gaps = 32/208 (15%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  557
            GH+ WV+ +   P      I+S S D+++ VW L+  +      R  L GH  +V  V +
Sbjct  13   GHSNWVTAIA-CPLDNPDLILSSSRDKSIIVWTLTREEGNYGVARRRLTGHAHFVQDVVI  71

Query  556  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  383
            S DG    SG  DG + LWDL  G         +  + ++ FS  NR  +  + + +IK+
Sbjct  72   SSDGQFALSGSWDGTLRLWDLNTGTTTRRFIGHTKDVLSVAFSVDNRQIVSGSRDKTIKL  131

Query  382  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            W+   E K  + D+                  A    + C   S       + SG  D V
Sbjct  132  WNTLGECKYTIQDVD-----------------AHTGWVSCVRFSPVTANPIIVSGGWDKV  174

Query  208  IRVWGIGRY*MEEFRRSHMIIGHVCYLS  125
            ++VW      +   +    ++GH  Y++
Sbjct  175  VKVWN-----LTNCKIRSNLVGHTGYVN  197



>ref|XP_001754916.1| predicted protein [Physcomitrella patens]
 gb|EDQ80370.1| predicted protein [Physcomitrella patens]
Length=316

 Score =   278 bits (712),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 134/189 (71%), Positives = 151/189 (80%), Gaps = 10/189 (5%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTIQD D H  WVSCVRFSP T  P IVSG WD+ VKVWNL+NCK+R+ L GHTGYV
Sbjct  137  ECKYTIQDVDAHTGWVSCVRFSPVTANPIIVSGGWDKVVKVWNLTNCKIRTNLVGHTGYV  196

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTV VSPDGSLCASGGKDGV +LWDLAEGK+LYSLDAG IIH+LCFSPNRYWLCAAT+  
Sbjct  197  NTVTVSPDGSLCASGGKDGVAMLWDLAEGKRLYSLDAGDIIHSLCFSPNRYWLCAATQTC  256

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            IKIWDLESKS+V +LR +    S+          K +I +C SL+W+ADGSTLFSGYTDG
Sbjct  257  IKIWDLESKSVVDELRPEFTFVSK----------KAQIPYCVSLNWSADGSTLFSGYTDG  306

Query  211  VIRVWGIGR  185
             IRVW +GR
Sbjct  307  HIRVWAVGR  315


 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 53/208 (25%), Positives = 86/208 (41%), Gaps = 32/208 (15%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  557
            GH  WV+ +   P      I+S S D+++ VW+LS  +      R  L GH  +V  V +
Sbjct  13   GHANWVTAIA-CPLDNPDLILSSSRDKSIIVWHLSREEGNYGVARRRLTGHAHFVQDVVI  71

Query  556  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  383
            S DG    SG  DG + LWDL  G         +  + ++ FS  NR  +  + + +IK+
Sbjct  72   SSDGQFALSGSWDGTLRLWDLNTGTTTRRFIGHTKDVLSVAFSVDNRQIVSGSRDKTIKL  131

Query  382  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            W+   E K  + D+                  A    + C   S       + SG  D V
Sbjct  132  WNTLGECKYTIQDVD-----------------AHTGWVSCVRFSPVTANPIIVSGGWDKV  174

Query  208  IRVWGIGRY*MEEFRRSHMIIGHVCYLS  125
            ++VW      +   +    ++GH  Y++
Sbjct  175  VKVWN-----LTNCKIRTNLVGHTGYVN  197



>ref|XP_001698065.1| receptor of activated protein kinase C 1 [Chlamydomonas reinhardtii]
 sp|P25387.1|GBLP_CHLRE RecName: Full=Guanine nucleotide-binding protein subunit beta-like 
protein [Chlamydomonas reinhardtii]
 emb|CAA37638.1| putative protein has homology to G protein beta subunit [Chlamydomonas 
reinhardtii]
 gb|EDO99650.1| receptor of activated protein kinase C 1 [Chlamydomonas reinhardtii]
Length=318

 Score =   278 bits (712),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 132/189 (70%), Positives = 152/189 (80%), Gaps = 10/189 (5%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTI + +GH EWVSCVRFSP T  P IVSG WD+ VKVWNL+NCKL++ L GH GYV
Sbjct  138  ECKYTIGEPEGHTEWVSCVRFSPMTTNPIIVSGGWDKMVKVWNLTNCKLKNNLVGHHGYV  197

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTV VSPDGSLCASGGKDG+ +LWDLAEGK+LYSLDAG +IH LCFSPNRYWLCAAT++S
Sbjct  198  NTVTVSPDGSLCASGGKDGIAMLWDLAEGKRLYSLDAGDVIHCLCFSPNRYWLCAATQSS  257

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            IKIWDLESKSIV DLR           E N T+ K ++ +C SL+W+ADGSTL+SGYTDG
Sbjct  258  IKIWDLESKSIVDDLR----------PEFNITSKKAQVPYCVSLAWSADGSTLYSGYTDG  307

Query  211  VIRVWGIGR  185
             IRVW +G 
Sbjct  308  QIRVWAVGH  316


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 59/122 (48%), Gaps = 7/122 (6%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  557
            GH  WV+ +         T++S S D++V VW L   +      R  L GH+ +V  V +
Sbjct  13   GHTNWVTAIATPLDPSSNTLLSASRDKSVLVWELERSESNYGYARKALRGHSHFVQDVVI  72

Query  556  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  383
            S DG  C +G  DG + LWDL  G         +  + ++ FS  NR  +  + + +IK+
Sbjct  73   SSDGQFCLTGSWDGTLRLWDLNTGTTTRRFVGHTKDVLSVAFSVDNRQIVSGSRDKTIKL  132

Query  382  WD  377
            W+
Sbjct  133  WN  134



>ref|XP_004969582.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A-like [Setaria italica]
Length=334

 Score =   279 bits (713),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 136/194 (70%), Positives = 158/194 (81%), Gaps = 16/194 (8%)
 Frame = -1

Query  751  ECKYTIQD----GDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGH  584
            ECKYTI       +GH+ WVSCVRFSP+T+QPTIVSGSWDR+VKVWNL+NCKLRS L GH
Sbjct  149  ECKYTIGGDHGASEGHSGWVSCVRFSPNTIQPTIVSGSWDRSVKVWNLTNCKLRSNLQGH  208

Query  583  TGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAA  404
             GYVN VAVSPDGSLCASGGKD V LLWDL EGK+LY+LDAGSIIH+LCFSPNRYWLCAA
Sbjct  209  GGYVNAVAVSPDGSLCASGGKDNVTLLWDLTEGKRLYALDAGSIIHSLCFSPNRYWLCAA  268

Query  403  TEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSG  224
            T+ SIKIWDLESK IV DLR ++            +A KN+I++CTSLSW+ADGSTL++G
Sbjct  269  TQDSIKIWDLESKHIVQDLRPEV------------SAGKNQILYCTSLSWSADGSTLYAG  316

Query  223  YTDGVIRVWGIGRY  182
            YTDG IR++ I  +
Sbjct  317  YTDGTIRIFKISGF  330


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 51/196 (26%), Positives = 86/196 (44%), Gaps = 34/196 (17%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSN---------------CKLRSTLAG  587
            GHN+ V+ +  +P    P IVS S D+++ VW+L+N                  R  L G
Sbjct  16   GHNDVVTAIA-APIDNSPFIVSSSRDKSLLVWDLTNPVHVAGDGTTTADYGVPFRR-LTG  73

Query  586  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWL  413
            H+ +V  V +S DG    SG  DG + LWDL+ G   + +      ++       NR  +
Sbjct  74   HSHFVQDVVLSSDGQFALSGSWDGELRLWDLSTGLTTRRFVGHEKDVLSVAFSIDNRQIV  133

Query  412  CAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKI--IFCTSLSWNADGS  239
             A+ + +IK+W+                E + +  G++ A++     + C   S N    
Sbjct  134  SASRDKTIKLWNTLG-------------ECKYTIGGDHGASEGHSGWVSCVRFSPNTIQP  180

Query  238  TLFSGYTDGVIRVWGI  191
            T+ SG  D  ++VW +
Sbjct  181  TIVSGSWDRSVKVWNL  196



>gb|ACJ85349.1| unknown [Medicago truncatula]
Length=285

 Score =   276 bits (707),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 130/144 (90%), Positives = 140/144 (97%), Gaps = 0/144 (0%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTIQDGD H++WVSCVRFSPSTLQPTIVS SWDRTVKVWNL+NCKLR+TLAGH+GYV
Sbjct  137  ECKYTIQDGDAHSDWVSCVRFSPSTLQPTIVSASWDRTVKVWNLTNCKLRNTLAGHSGYV  196

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTVAVSPDGSLCASGGKDGVILLWDLAEGK+LYSLDAGSIIHALCFSPNRYWLCAATE+S
Sbjct  197  NTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDAGSIIHALCFSPNRYWLCAATESS  256

Query  391  IKIWDLESKSIVVDLRVDLKQESE  320
            IKIWDLESKSIV DL+VDLK E++
Sbjct  257  IKIWDLESKSIVEDLKVDLKTEAD  280



>ref|XP_006644561.1| PREDICTED: LOW QUALITY PROTEIN: guanine nucleotide-binding protein 
subunit beta-like protein A-like [Oryza brachyantha]
Length=334

 Score =   276 bits (707),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 136/194 (70%), Positives = 156/194 (80%), Gaps = 16/194 (8%)
 Frame = -1

Query  751  ECKYTIQDGDG----HNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGH  584
            ECKYTI    G    HN WVSCVRFSP+T QPTIVSGSWDRTVKVWNL+NCKLR  L GH
Sbjct  149  ECKYTIGGDLGGGEGHNGWVSCVRFSPNTFQPTIVSGSWDRTVKVWNLTNCKLRCNLEGH  208

Query  583  TGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAA  404
             GYVN VAVSPDGSLCASGGKDGV LLWDLAEGK+LYSLDAGSIIH+LCFSPNRYWLCAA
Sbjct  209  GGYVNAVAVSPDGSLCASGGKDGVTLLWDLAEGKRLYSLDAGSIIHSLCFSPNRYWLCAA  268

Query  403  TEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSG  224
            T+ SIKIWDLESK IV DL+ ++              +KN++++CTSL+W+ADGSTL++G
Sbjct  269  TQDSIKIWDLESKHIVQDLKPEIP------------VSKNQMLYCTSLNWSADGSTLYAG  316

Query  223  YTDGVIRVWGIGRY  182
            YTDG IR++ I  +
Sbjct  317  YTDGTIRIYKISGF  330


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 50/196 (26%), Positives = 85/196 (43%), Gaps = 34/196 (17%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSN---------------CKLRSTLAG  587
            GHN+ V+ +  +P    P IVS S D+++ VW+L+N                  R  L G
Sbjct  16   GHNDVVTAIA-TPIDNSPFIVSSSRDKSLLVWDLTNPVPVVGETASATEYGVPFRR-LTG  73

Query  586  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEG---KKLYSLDAGSIIHALCFS-PNRY  419
            H+ +V  V +S +     SG  DG + LWDL+ G   ++    D    + ++ FS  NR 
Sbjct  74   HSHFVQDVVLSSNDQFTLSGSXDGELRLWDLSTGATTRRFVGHDKD--VLSVAFSVDNRQ  131

Query  418  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  239
             + A+ + +IK+W+   +            +  +  +       N  + C   S N    
Sbjct  132  IVSASRDRTIKLWNTLGEC-----------KYTIGGDLGGGEGHNGWVSCVRFSPNTFQP  180

Query  238  TLFSGYTDGVIRVWGI  191
            T+ SG  D  ++VW +
Sbjct  181  TIVSGSWDRTVKVWNL  196



>ref|XP_004961307.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A-like [Setaria italica]
Length=334

 Score =   276 bits (706),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 137/194 (71%), Positives = 155/194 (80%), Gaps = 16/194 (8%)
 Frame = -1

Query  751  ECKYTIQDGDG----HNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGH  584
            ECKYTI    G    HN WVSCVRFSP+T  PTIVSGSWDRTVKVWNL+NCKLR TL GH
Sbjct  149  ECKYTIGGDLGGGEGHNGWVSCVRFSPNTFAPTIVSGSWDRTVKVWNLTNCKLRCTLDGH  208

Query  583  TGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAA  404
             GYVN VAVSPDGSLCASGGKDG  LLWDL EGK+LYSLDAGSIIH+LCFSPNRYWLCAA
Sbjct  209  GGYVNAVAVSPDGSLCASGGKDGYTLLWDLTEGKRLYSLDAGSIIHSLCFSPNRYWLCAA  268

Query  403  TEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSG  224
            T+ S+KIWDLESK +V DL+ D++             +KN+I++CTSLSW+ADGSTL++G
Sbjct  269  TQDSVKIWDLESKHVVQDLKPDIQ------------ISKNQILYCTSLSWSADGSTLYTG  316

Query  223  YTDGVIRVWGIGRY  182
            YTDG IRVW I  +
Sbjct  317  YTDGSIRVWKISGF  330


 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 52/194 (27%), Positives = 83/194 (43%), Gaps = 30/194 (15%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRST---------------LAG  587
            GHN  V+ +  +P    P IVS S D++V VW+L+N  + ST               L G
Sbjct  16   GHNGEVTAIA-TPIDNSPFIVSSSRDKSVLVWDLTN-PVHSTPDSGAAADYGVPFRRLTG  73

Query  586  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWL  413
            H+ +V  V +S DG    SG  DG + LWDL+ G   + +      +I       NR  +
Sbjct  74   HSHFVQDVVLSSDGQFALSGSWDGELRLWDLSTGLTTRRFVGHEKDVISVAFSVDNRQIV  133

Query  412  CAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTL  233
             A+ + +IK+W+   +            +  +  +       N  + C   S N    T+
Sbjct  134  SASRDKTIKLWNTLGEC-----------KYTIGGDLGGGEGHNGWVSCVRFSPNTFAPTI  182

Query  232  FSGYTDGVIRVWGI  191
             SG  D  ++VW +
Sbjct  183  VSGSWDRTVKVWNL  196



>ref|XP_005847990.1| hypothetical protein CHLNCDRAFT_31033 [Chlorella variabilis]
 gb|EFN55888.1| hypothetical protein CHLNCDRAFT_31033 [Chlorella variabilis]
Length=319

 Score =   275 bits (704),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 130/189 (69%), Positives = 152/189 (80%), Gaps = 10/189 (5%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTI + DGH EWVSCVRFSP T  P IVS  WD+ VKVWNL+NCKLR+ L GH GYV
Sbjct  139  ECKYTIGEPDGHTEWVSCVRFSPVTQNPIIVSAGWDKAVKVWNLTNCKLRNNLVGHQGYV  198

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTV VSPDGSLCASGGKDGV +LWDL+EGK+LYSLDA  IIH+LCFSPNRYWLCAAT+ S
Sbjct  199  NTVTVSPDGSLCASGGKDGVAMLWDLSEGKRLYSLDATDIIHSLCFSPNRYWLCAATQGS  258

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            IKIWDLESKS+V +LR +L + S+          K ++ +C  L+W+ADGSTL+SGYTDG
Sbjct  259  IKIWDLESKSLVDELRPELPERSK----------KAQVPYCVCLAWSADGSTLYSGYTDG  308

Query  211  VIRVWGIGR  185
            +IRVW +GR
Sbjct  309  LIRVWQVGR  317


 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 39/123 (32%), Positives = 60/123 (49%), Gaps = 8/123 (7%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK------LRSTLAGHTGYVNTVA  560
            GH  WV+ +         T++S S D+TV VW L N +       +  L GH+ YV  V 
Sbjct  13   GHRGWVTAIAAPLDPTSETLLSSSRDKTVLVWQLGNAEDGSLGYPKRALRGHSHYVQDVV  72

Query  559  VSPDGSLCASGGKDGVILLWDLAEGKKLYS-LDAGSIIHALCFSP-NRYWLCAATEASIK  386
            +S DG  C +G  DG + LWD+  G      L     + ++ FS  NR  +  + + +IK
Sbjct  73   ISSDGQFCLTGSWDGTLRLWDINTGATTRRFLGHTKDVLSVAFSADNRQIVSGSRDKTIK  132

Query  385  IWD  377
            +W+
Sbjct  133  LWN  135



>ref|NP_001043910.1| Os01g0686800 [Oryza sativa Japonica Group]
 sp|P49027.1|GBLPA_ORYSJ RecName: Full=Guanine nucleotide-binding protein subunit beta-like 
protein A; Short=GPB-LR; AltName: Full=RWD; AltName: Full=Receptor 
for activated C kinase 1A [Oryza sativa Japonica 
Group]
 dbj|BAA07404.1| q group of receptor for activated C-kinase [Oryza sativa Japonica 
Group]
 dbj|BAF05824.1| Os01g0686800 [Oryza sativa Japonica Group]
 gb|EAY75412.1| hypothetical protein OsI_03315 [Oryza sativa Indica Group]
 gb|EAZ13132.1| hypothetical protein OsJ_03054 [Oryza sativa Japonica Group]
 dbj|BAG93799.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87442.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00562.1| unnamed protein product [Oryza sativa Japonica Group]
Length=334

 Score =   276 bits (705),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 136/194 (70%), Positives = 156/194 (80%), Gaps = 16/194 (8%)
 Frame = -1

Query  751  ECKYTIQDGDG----HNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGH  584
            ECKYTI    G    HN WVSCVRFSP+T QPTIVSGSWDRTVKVWNL+NCKLR  L GH
Sbjct  149  ECKYTIGGDLGGGEGHNGWVSCVRFSPNTFQPTIVSGSWDRTVKVWNLTNCKLRCNLEGH  208

Query  583  TGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAA  404
             GYVN VAVSPDGSLCASGGKDGV LLWDLAEGK+LYSLDAGSIIH+LCFSPNRYWLCAA
Sbjct  209  GGYVNAVAVSPDGSLCASGGKDGVTLLWDLAEGKRLYSLDAGSIIHSLCFSPNRYWLCAA  268

Query  403  TEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSG  224
            T+ SIKIWDLESK IV DL+ ++              +KN++++CTSL+W+ADGSTL++G
Sbjct  269  TQDSIKIWDLESKHIVQDLKPEIP------------VSKNQMLYCTSLNWSADGSTLYAG  316

Query  223  YTDGVIRVWGIGRY  182
            YTDG IR++ I  +
Sbjct  317  YTDGTIRIYKISGF  330


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 52/196 (27%), Positives = 86/196 (44%), Gaps = 34/196 (17%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSN---------------CKLRSTLAG  587
            GHN+ V+ +  +P    P IVS S D+++ VW+L+N                  R  L G
Sbjct  16   GHNDVVTAIA-TPIDNSPFIVSSSRDKSLLVWDLTNPVQNVGEGAGASEYGVPFRR-LTG  73

Query  586  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEG---KKLYSLDAGSIIHALCFS-PNRY  419
            H+ +V  V +S DG    SG  DG + LWDL+ G   ++    D    + ++ FS  NR 
Sbjct  74   HSHFVQDVVLSSDGQFALSGSWDGELRLWDLSTGVTTRRFVGHDKD--VLSVAFSVDNRQ  131

Query  418  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  239
             + A+ + +IK+W+   +            +  +  +       N  + C   S N    
Sbjct  132  IVSASRDRTIKLWNTLGEC-----------KYTIGGDLGGGEGHNGWVSCVRFSPNTFQP  180

Query  238  TLFSGYTDGVIRVWGI  191
            T+ SG  D  ++VW +
Sbjct  181  TIVSGSWDRTVKVWNL  196



>emb|CEG00110.1| G-protein beta WD-40 repeat [Ostreococcus tauri]
Length=319

 Score =   275 bits (703),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 129/188 (69%), Positives = 149/188 (79%), Gaps = 10/188 (5%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTIQD D H+EWVSCVRFSP T  P IVSG WD+ VKVWNL+NCK+R+ L GHTGY+
Sbjct  137  ECKYTIQDADAHSEWVSCVRFSPVTTNPIIVSGGWDKLVKVWNLTNCKIRTNLVGHTGYI  196

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTV VSPDGSLCASGGKDGV +LWDL EGK+LYSLDAG II+ LCFSPNRYWLCAATE+ 
Sbjct  197  NTVTVSPDGSLCASGGKDGVAMLWDLGEGKRLYSLDAGDIIYGLCFSPNRYWLCAATESC  256

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            +KIWDLESKSIV +LR +                K++  +CTSL W+ADGSTL++GYTD 
Sbjct  257  VKIWDLESKSIVDELRPEFPP----------VGKKSQQPYCTSLQWSADGSTLYTGYTDN  306

Query  211  VIRVWGIG  188
            VIRVW +G
Sbjct  307  VIRVWSVG  314


 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 53/208 (25%), Positives = 90/208 (43%), Gaps = 32/208 (15%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  557
            GH  WV+ +  +P      ++S S D+TV +WNL+  +      R +L GH+ YV  V +
Sbjct  13   GHENWVTSIA-TPLDNSDILLSSSRDKTVILWNLTREEENYGYPRRSLHGHSHYVQEVVI  71

Query  556  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  383
            S DG    SG  DG + LWDL  G         +  + ++ FS  NR  +  + + +IK+
Sbjct  72   SSDGQFALSGSWDGTLRLWDLNTGTTTRRFVGHTKDVLSVAFSVDNRQIVSGSRDKTIKL  131

Query  382  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            W+   E K  + D                   A ++ + C   S       + SG  D +
Sbjct  132  WNTLGECKYTIQD-----------------ADAHSEWVSCVRFSPVTTNPIIVSGGWDKL  174

Query  208  IRVWGIGRY*MEEFRRSHMIIGHVCYLS  125
            ++VW      +   +    ++GH  Y++
Sbjct  175  VKVWN-----LTNCKIRTNLVGHTGYIN  197


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 54/192 (28%), Positives = 84/192 (44%), Gaps = 27/192 (14%)
 Frame = -1

Query  742  YTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTV  563
            Y  +   GH+ +V  V  S        +SGSWD T+++W+L+         GHT  V +V
Sbjct  54   YPRRSLHGHSHYVQEVVISSD--GQFALSGSWDGTLRLWDLNTGTTTRRFVGHTKDVLSV  111

Query  562  AVSPDGSLCASGGKDGVILLWD-LAEGK-KLYSLDAGSI-IHALCFSP---NRYWLCAAT  401
            A S D     SG +D  I LW+ L E K  +   DA S  +  + FSP   N   +    
Sbjct  112  AFSVDNRQIVSGSRDKTIKLWNTLGECKYTIQDADAHSEWVSCVRFSPVTTNPIIVSGGW  171

Query  400  EASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGY  221
            +  +K+W+L +  I  +L         +   G          +  +++ + DGS   SG 
Sbjct  172  DKLVKVWNLTNCKIRTNL---------VGHTG----------YINTVTVSPDGSLCASGG  212

Query  220  TDGVIRVWGIGR  185
             DGV  +W +G 
Sbjct  213  KDGVAMLWDLGE  224



>gb|EMS52917.1| Guanine nucleotide-binding protein subunit beta-like protein 
B [Triticum urartu]
Length=359

 Score =   275 bits (704),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 135/191 (71%), Positives = 156/191 (82%), Gaps = 16/191 (8%)
 Frame = -1

Query  751  ECKYTIQDGDG----HNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGH  584
            ECKYTI    G    H  WVSCVRFSP+  QPTIVSGSWD+TVKVWNL+NCKLRSTLAGH
Sbjct  173  ECKYTIGGDMGGGEGHTGWVSCVRFSPNIQQPTIVSGSWDKTVKVWNLTNCKLRSTLAGH  232

Query  583  TGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAA  404
             GYVN VAVSPDGSLCASGGKDGV LLWDL+EGK+LY L+AGSIIHALCFSPNRYWLCAA
Sbjct  233  GGYVNAVAVSPDGSLCASGGKDGVTLLWDLSEGKRLYQLEAGSIIHALCFSPNRYWLCAA  292

Query  403  TEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSG  224
            TE S+KIWDLESK +V DL+ +++             +KN++++CTSLSW+ADGSTL++G
Sbjct  293  TEESVKIWDLESKHVVQDLKPEVQ------------VSKNQMLYCTSLSWSADGSTLYTG  340

Query  223  YTDGVIRVWGI  191
            YTDG IRV+ I
Sbjct  341  YTDGTIRVFKI  351



>dbj|BAJ90663.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK06408.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91024.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=335

 Score =   274 bits (701),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 135/191 (71%), Positives = 156/191 (82%), Gaps = 16/191 (8%)
 Frame = -1

Query  751  ECKYTIQDGDG----HNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGH  584
            ECKYTI    G    H  WVSCVRFSP+  QPTIVSGSWD+TVKVWNL+NCKLRSTLAGH
Sbjct  149  ECKYTIGGDMGGGEGHTGWVSCVRFSPNIQQPTIVSGSWDKTVKVWNLANCKLRSTLAGH  208

Query  583  TGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAA  404
             GYVN VAVSPDGSLCASGGKDGV LLWDL+EGK+LY L+AGSIIH+LCFSPNRYWLCAA
Sbjct  209  GGYVNAVAVSPDGSLCASGGKDGVTLLWDLSEGKRLYQLEAGSIIHSLCFSPNRYWLCAA  268

Query  403  TEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSG  224
            TE SIKIWDLESK +V DL+ +++             +KN++++CTSLSW+ADGSTL++G
Sbjct  269  TEESIKIWDLESKHVVQDLKPEVQ------------VSKNQMLYCTSLSWSADGSTLYTG  316

Query  223  YTDGVIRVWGI  191
            YTDG IRV+ I
Sbjct  317  YTDGTIRVFKI  327


 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 50/194 (26%), Positives = 81/194 (42%), Gaps = 30/194 (15%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSN---------------CKLRSTLAG  587
            GHN+ V+ +  +P    P IVSGS D+++ VW+L+N                  R  L G
Sbjct  16   GHNDVVTAIA-APIDNSPYIVSGSRDKSLLVWDLTNPVASLGDGTVGTDYAVPFRR-LTG  73

Query  586  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWL  413
            H  +V  V +S DG    SG  DG + LWDL+ G   + +      +I       NR  +
Sbjct  74   HGHFVQDVVISSDGQFALSGSWDGELRLWDLSTGLTTRRFVGHTKDVISVAFSVDNRQIV  133

Query  412  CAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTL  233
             A+ + +IK+W+   +            +  +  +          + C   S N    T+
Sbjct  134  SASRDNTIKLWNTLGEC-----------KYTIGGDMGGGEGHTGWVSCVRFSPNIQQPTI  182

Query  232  FSGYTDGVIRVWGI  191
             SG  D  ++VW +
Sbjct  183  VSGSWDKTVKVWNL  196



>ref|XP_003567944.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Brachypodium distachyon]
Length=333

 Score =   274 bits (701),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 134/191 (70%), Positives = 155/191 (81%), Gaps = 16/191 (8%)
 Frame = -1

Query  751  ECKYTIQDGDG----HNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGH  584
            ECKYTI    G    H  WVSCVRFSP+T QPTIVSGSWD+TVKVWNL+NCKLR+TLAGH
Sbjct  147  ECKYTIGGDLGGGEGHTGWVSCVRFSPNTFQPTIVSGSWDKTVKVWNLTNCKLRNTLAGH  206

Query  583  TGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAA  404
             GYVN VAVSPDGSLCASGGKDGV LLWDLAEGK+LY L+AGSIIH+LCFSPNRYWLCAA
Sbjct  207  GGYVNAVAVSPDGSLCASGGKDGVTLLWDLAEGKRLYQLEAGSIIHSLCFSPNRYWLCAA  266

Query  403  TEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSG  224
            TE S+KIWDLESK +V DL+ + +             +KN++++CTSL W+ADGSTL++G
Sbjct  267  TEDSVKIWDLESKHVVQDLKPEFQ------------VSKNQMLYCTSLCWSADGSTLYTG  314

Query  223  YTDGVIRVWGI  191
            YTDG IRV+ I
Sbjct  315  YTDGTIRVFKI  325


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 48/193 (25%), Positives = 78/193 (40%), Gaps = 28/193 (15%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRST--------------LAGH  584
            GHN+ V+ +  +P      IVS S D++V VW+L+N                    L GH
Sbjct  14   GHNDVVTAIA-APIDNTAFIVSSSRDKSVLVWDLTNPAPSPADGTVATDYGVPFRRLTGH  72

Query  583  TGYVNTVAVSPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLC  410
              +V  V +S DG    SG  DG + LWDL+ G   + +      +I       NR  + 
Sbjct  73   GHFVQDVVISSDGQFALSGSWDGELRLWDLSTGLTTRRFVGHTKDVISVAFSVDNRQIVS  132

Query  409  AATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLF  230
            A+ + +IK+W+   +            +  +  +          + C   S N    T+ 
Sbjct  133  ASRDNTIKLWNTLGEC-----------KYTIGGDLGGGEGHTGWVSCVRFSPNTFQPTIV  181

Query  229  SGYTDGVIRVWGI  191
            SG  D  ++VW +
Sbjct  182  SGSWDKTVKVWNL  194



>ref|XP_001421096.1| Receptor of activated protein kinase C 1A, component of 40S small 
ribosomal subunit [Ostreococcus lucimarinus CCE9901]
 ref|XP_001422858.1| Receptor of activated protein kinase C 1B, component of 40S small 
ribosomal subunit [Ostreococcus lucimarinus CCE9901]
 gb|ABO99389.1| Receptor of activated protein kinase C 1A, component of 40S small 
ribosomal subunit [Ostreococcus lucimarinus CCE9901]
 gb|ABP01217.1| Receptor of activated protein kinase C 1B, component of 40S small 
ribosomal subunit [Ostreococcus lucimarinus CCE9901]
Length=321

 Score =   272 bits (696),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 128/188 (68%), Positives = 148/188 (79%), Gaps = 10/188 (5%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTIQD D H+EWVSCVRFSP T  P IVSG WD+ VKVWNL+NCK+R+ L GHTGY+
Sbjct  137  ECKYTIQDADAHSEWVSCVRFSPVTSNPIIVSGGWDKLVKVWNLTNCKIRTNLVGHTGYI  196

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            N V VSPDGSLCASGGKDGV +LWDL EGK+LYSLDAG II+ LCFSPNRYWLCAATE+ 
Sbjct  197  NAVTVSPDGSLCASGGKDGVAMLWDLGEGKRLYSLDAGDIIYGLCFSPNRYWLCAATESC  256

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            +KIWDLESKSIV +LR +                K++  +CTSL W+ADGSTL++GYTD 
Sbjct  257  VKIWDLESKSIVDELRPEFPP----------VGKKSQQPYCTSLQWSADGSTLYTGYTDN  306

Query  211  VIRVWGIG  188
            VIRVW +G
Sbjct  307  VIRVWSVG  314


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 52/208 (25%), Positives = 90/208 (43%), Gaps = 32/208 (15%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  557
            GH  WV+ +  +P      ++S S D+TV +WNL+  +      R +L GH+ +V  V +
Sbjct  13   GHENWVTSIA-TPLDNSDILLSSSRDKTVILWNLTREEENYGYPRRSLHGHSHFVQDVVI  71

Query  556  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  383
            S DG    SG  DG + LWDL  G         +  + ++ FS  NR  +  + + +IK+
Sbjct  72   SSDGQFALSGSWDGTLRLWDLNTGTTTRRFVGHTKDVLSVAFSVDNRQIVSGSRDKTIKL  131

Query  382  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            W+   E K  + D                   A ++ + C   S       + SG  D +
Sbjct  132  WNTLGECKYTIQD-----------------ADAHSEWVSCVRFSPVTSNPIIVSGGWDKL  174

Query  208  IRVWGIGRY*MEEFRRSHMIIGHVCYLS  125
            ++VW      +   +    ++GH  Y++
Sbjct  175  VKVWN-----LTNCKIRTNLVGHTGYIN  197


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 54/192 (28%), Positives = 84/192 (44%), Gaps = 27/192 (14%)
 Frame = -1

Query  742  YTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTV  563
            Y  +   GH+ +V  V  S        +SGSWD T+++W+L+         GHT  V +V
Sbjct  54   YPRRSLHGHSHFVQDVVISSD--GQFALSGSWDGTLRLWDLNTGTTTRRFVGHTKDVLSV  111

Query  562  AVSPDGSLCASGGKDGVILLWD-LAEGK-KLYSLDAGSI-IHALCFSP---NRYWLCAAT  401
            A S D     SG +D  I LW+ L E K  +   DA S  +  + FSP   N   +    
Sbjct  112  AFSVDNRQIVSGSRDKTIKLWNTLGECKYTIQDADAHSEWVSCVRFSPVTSNPIIVSGGW  171

Query  400  EASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGY  221
            +  +K+W+L +  I  +L         +   G          +  +++ + DGS   SG 
Sbjct  172  DKLVKVWNLTNCKIRTNL---------VGHTG----------YINAVTVSPDGSLCASGG  212

Query  220  TDGVIRVWGIGR  185
             DGV  +W +G 
Sbjct  213  KDGVAMLWDLGE  224



>gb|AEF79971.1| receptor of activated protein kinase C 1 [Dunaliella salina]
Length=318

 Score =   272 bits (695),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 130/187 (70%), Positives = 152/187 (81%), Gaps = 9/187 (5%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKY+I + +GH+EWVSCVRFSP T  P IVSG WD+ VKVWNL+NCKL++ L GH GYV
Sbjct  138  ECKYSIGEPEGHSEWVSCVRFSPMTANPIIVSGGWDKYVKVWNLTNCKLKNNLIGHMGYV  197

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTV VSPDGSLCASGGKDGV +LWDLAEGK+LYSLDAG IIHALCFSPNRYWLCAAT +S
Sbjct  198  NTVTVSPDGSLCASGGKDGVGMLWDLAEGKRLYSLDAGDIIHALCFSPNRYWLCAATSSS  257

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            IKIWDLESKS+V DLR +  +E +  A          + +C SL+W+ADGSTL+SGYTDG
Sbjct  258  IKIWDLESKSVVDDLRPEWNKEFKKKAT---------VPYCVSLAWSADGSTLYSGYTDG  308

Query  211  VIRVWGI  191
            +IRVW +
Sbjct  309  MIRVWNV  315


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 50/206 (24%), Positives = 90/206 (44%), Gaps = 27/206 (13%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNL-----SNCKLRSTLAGHTGYVNTVAV  557
            GH+ WV+ +          ++S S D++V VW L     S    + +L GH+ +V  V +
Sbjct  13   GHSGWVTALAAPLDPSSNVLLSASRDKSVIVWELERGGDSYGYPKKSLRGHSHFVQDVVI  72

Query  556  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  383
            S DG  C SG  DG + LWDL  G         +  + ++ FS  NR  +  + + +I++
Sbjct  73   SSDGQFCLSGSWDGTLRLWDLNTGATTRRFVGHTKDVLSVAFSVDNRQIVSGSRDKTIRL  132

Query  382  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  203
            W+   +           + S    EG+     ++ + C   S       + SG  D  ++
Sbjct  133  WNTLGEC----------KYSIGEPEGH-----SEWVSCVRFSPMTANPIIVSGGWDKYVK  177

Query  202  VWGIGRY*MEEFRRSHMIIGHVCYLS  125
            VW      +   +  + +IGH+ Y++
Sbjct  178  VWN-----LTNCKLKNNLIGHMGYVN  198



>ref|NP_001056254.1| Os05g0552300 [Oryza sativa Japonica Group]
 sp|Q6L4F8.1|GBLPB_ORYSJ RecName: Full=Guanine nucleotide-binding protein subunit beta-like 
protein B; Short=GPB-LR; AltName: Full=Receptor for activated 
C kinase 1B [Oryza sativa Japonica Group]
 gb|AAT39277.1| putative guanine nucleotide-binding protein beta subunit [Oryza 
sativa Japonica Group]
 gb|AAT85192.1| putative guanine nucleotide binding protein beta subunit [Oryza 
sativa Japonica Group]
 dbj|BAF18168.1| Os05g0552300 [Oryza sativa Japonica Group]
 dbj|BAG88240.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89443.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00554.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64615.1| hypothetical protein OsJ_19467 [Oryza sativa Japonica Group]
Length=336

 Score =   272 bits (696),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 133/197 (68%), Positives = 155/197 (79%), Gaps = 19/197 (10%)
 Frame = -1

Query  751  ECKYTIQD----GDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGH  584
            ECKYTI      G+GH  WVSCVRFSP+ + PTIVSGSWDR+VKVWNL+NCKLR+ L GH
Sbjct  150  ECKYTIGGDHGAGEGHTGWVSCVRFSPNPMAPTIVSGSWDRSVKVWNLTNCKLRTKLEGH  209

Query  583  TGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAA  404
             GYVN VAVSPDGSLCASGGKDG  LLWDL EGK LY LDAG+IIH+LCFSPNRYWLCAA
Sbjct  210  NGYVNAVAVSPDGSLCASGGKDGTTLLWDLTEGKMLYKLDAGAIIHSLCFSPNRYWLCAA  269

Query  403  TEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSG  224
            TE S+KIWDLESK ++ DL+ +++            A K+++++CTSLSW+ADGSTLF+G
Sbjct  270  TEDSVKIWDLESKLVMQDLKPEVQ------------AFKSQMLYCTSLSWSADGSTLFAG  317

Query  223  YTDGVIRVW---GIGRY  182
            YTDG IRVW   G G Y
Sbjct  318  YTDGTIRVWKVSGFGGY  334


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 53/197 (27%), Positives = 87/197 (44%), Gaps = 34/197 (17%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLR----------------STLA  590
            GHN+ V+ +  +P    P IVS S D+++ VW+++N                      L 
Sbjct  15   GHNDMVTAIA-APIDNSPFIVSSSRDKSLLVWDITNPSTAVATDPEAAPPEYGVSYRRLT  73

Query  589  GHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYW  416
            GH+ +V  V +S DG    SG  DG + LWDLA G+        +  + ++ FS  NR  
Sbjct  74   GHSHFVQDVVLSSDGQFALSGSWDGELRLWDLATGRTTRRFVGHTKDVLSVAFSVDNRQI  133

Query  415  LCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKI--IFCTSLSWNADG  242
            + AA + +IK+W+                E + +  G++ A +     + C   S N   
Sbjct  134  VSAARDNTIKLWNTLG-------------ECKYTIGGDHGAGEGHTGWVSCVRFSPNPMA  180

Query  241  STLFSGYTDGVIRVWGI  191
             T+ SG  D  ++VW +
Sbjct  181  PTIVSGSWDRSVKVWNL  197


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 56/207 (27%), Positives = 89/207 (43%), Gaps = 31/207 (15%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  542
            GH+ +V  V  S        +SGSWD  +++W+L+  +      GHT  V +VA S D  
Sbjct  74   GHSHFVQDVVLSSD--GQFALSGSWDGELRLWDLATGRTTRRFVGHTKDVLSVAFSVDNR  131

Query  541  LCASGGKDGVILLWD-LAEGKKLYSLDAGSI------IHALCFSPNRY---WLCAATEAS  392
               S  +D  I LW+ L E K     D G+       +  + FSPN      +  + + S
Sbjct  132  QIVSAARDNTIKLWNTLGECKYTIGGDHGAGEGHTGWVSCVRFSPNPMAPTIVSGSWDRS  191

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            +K+W+L +      LR  L        EG+N        +  +++ + DGS   SG  DG
Sbjct  192  VKVWNLTN----CKLRTKL--------EGHNG-------YVNAVAVSPDGSLCASGGKDG  232

Query  211  VIRVWGIGRY*MEEFRRSHMIIGHVCY  131
               +W +    M     +  II  +C+
Sbjct  233  TTLLWDLTEGKMLYKLDAGAIIHSLCF  259



>ref|XP_003082627.1| GTP-binding regulatory protein beta chain homolog-Ch (ISS) [Ostreococcus 
tauri]
Length=483

 Score =   277 bits (708),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 129/188 (69%), Positives = 149/188 (79%), Gaps = 10/188 (5%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTIQD D H+EWVSCVRFSP T  P IVSG WD+ VKVWNL+NCK+R+ L GHTGY+
Sbjct  301  ECKYTIQDADAHSEWVSCVRFSPVTTNPIIVSGGWDKLVKVWNLTNCKIRTNLVGHTGYI  360

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTV VSPDGSLCASGGKDGV +LWDL EGK+LYSLDAG II+ LCFSPNRYWLCAATE+ 
Sbjct  361  NTVTVSPDGSLCASGGKDGVAMLWDLGEGKRLYSLDAGDIIYGLCFSPNRYWLCAATESC  420

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            +KIWDLESKSIV +LR +                K++  +CTSL W+ADGSTL++GYTD 
Sbjct  421  VKIWDLESKSIVDELRPEFPP----------VGKKSQQPYCTSLQWSADGSTLYTGYTDN  470

Query  211  VIRVWGIG  188
            VIRVW +G
Sbjct  471  VIRVWSVG  478


 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 48/189 (25%), Positives = 82/189 (43%), Gaps = 31/189 (16%)
 Frame = -1

Query  664  IVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAVSPDGSLCASGGKDGVILLW  500
            ++S S D+TV +WNL+  +      R +L GH+ YV  V +S DG    SG  DG + LW
Sbjct  195  LLSSSRDKTVILWNLTREEENYGYPRRSLHGHSHYVQEVVISSDGQFALSGSWDGTLRLW  254

Query  499  DLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKIWDL--ESKSIVVDLRVDLK  332
            DL  G         +  + ++ FS  NR  +  + + +IK+W+   E K  + D      
Sbjct  255  DLNTGTTTRRFVGHTKDVLSVAFSVDNRQIVSGSRDKTIKLWNTLGECKYTIQD------  308

Query  331  QESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY*MEEFRRSHM  152
                         A ++ + C   S       + SG  D +++VW      +   +    
Sbjct  309  -----------ADAHSEWVSCVRFSPVTTNPIIVSGGWDKLVKVWN-----LTNCKIRTN  352

Query  151  IIGHVCYLS  125
            ++GH  Y++
Sbjct  353  LVGHTGYIN  361


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 54/191 (28%), Positives = 84/191 (44%), Gaps = 27/191 (14%)
 Frame = -1

Query  742  YTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTV  563
            Y  +   GH+ +V  V  S        +SGSWD T+++W+L+         GHT  V +V
Sbjct  218  YPRRSLHGHSHYVQEVVISSD--GQFALSGSWDGTLRLWDLNTGTTTRRFVGHTKDVLSV  275

Query  562  AVSPDGSLCASGGKDGVILLWD-LAEGK-KLYSLDAGSI-IHALCFSP---NRYWLCAAT  401
            A S D     SG +D  I LW+ L E K  +   DA S  +  + FSP   N   +    
Sbjct  276  AFSVDNRQIVSGSRDKTIKLWNTLGECKYTIQDADAHSEWVSCVRFSPVTTNPIIVSGGW  335

Query  400  EASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGY  221
            +  +K+W+L +  I  +L         +   G          +  +++ + DGS   SG 
Sbjct  336  DKLVKVWNLTNCKIRTNL---------VGHTG----------YINTVTVSPDGSLCASGG  376

Query  220  TDGVIRVWGIG  188
             DGV  +W +G
Sbjct  377  KDGVAMLWDLG  387



>ref|XP_006654750.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein B-like [Oryza brachyantha]
Length=336

 Score =   271 bits (693),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 134/197 (68%), Positives = 156/197 (79%), Gaps = 19/197 (10%)
 Frame = -1

Query  751  ECKYTIQD----GDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGH  584
            ECKYTI      GDGH+ WVSCVRFSP+ L PTIVSGSWDR+VKVWNL+NCKLR+ L GH
Sbjct  150  ECKYTIGGDLGAGDGHSGWVSCVRFSPNPLMPTIVSGSWDRSVKVWNLTNCKLRTKLEGH  209

Query  583  TGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAA  404
             GYVN VAVSPDGSLCASGGKDGV LLWDL EGK LY L+AG+IIH+LCFSPNRYWLCAA
Sbjct  210  GGYVNAVAVSPDGSLCASGGKDGVTLLWDLTEGKMLYKLEAGAIIHSLCFSPNRYWLCAA  269

Query  403  TEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSG  224
            TE S+KIWDLESK ++ DL+ +++            A K++++ CTSLSW+ADGSTL++G
Sbjct  270  TEDSVKIWDLESKLVMQDLKPEVQ------------AFKSQMLHCTSLSWSADGSTLYTG  317

Query  223  YTDGVIRVW---GIGRY  182
            YTDG IRVW   G G Y
Sbjct  318  YTDGTIRVWKVSGFGGY  334


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 51/198 (26%), Positives = 84/198 (42%), Gaps = 36/198 (18%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSN-----------------CKLRSTL  593
            GHN+ V+ +  +P    P +VS S D+++ VW++SN                    R  L
Sbjct  15   GHNDVVTAIA-APIDNSPFVVSSSRDKSLMVWDISNPAPAVATDPDSAPPEYGVPFRR-L  72

Query  592  AGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGK--KLYSLDAGSIIHALCFSPNRY  419
             GH+ +V  V +S DG    SG  DG + LWDL+ G   + +   A  ++       NR 
Sbjct  73   TGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLSTGATTRRFVGHAKDVLSVAFSVDNRQ  132

Query  418  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKI--IFCTSLSWNAD  245
             + A+ + +IK+W+                E + +  G+  A       + C   S N  
Sbjct  133  IVSASRDNTIKLWNTLG-------------ECKYTIGGDLGAGDGHSGWVSCVRFSPNPL  179

Query  244  GSTLFSGYTDGVIRVWGI  191
              T+ SG  D  ++VW +
Sbjct  180  MPTIVSGSWDRSVKVWNL  197


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 53/207 (26%), Positives = 86/207 (42%), Gaps = 31/207 (15%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  542
            GH+ +V  V  S        +SGSWD  +++W+LS         GH   V +VA S D  
Sbjct  74   GHSHFVQDVVLSSD--GQFALSGSWDGELRLWDLSTGATTRRFVGHAKDVLSVAFSVDNR  131

Query  541  LCASGGKDGVILLWD-LAEGKKLYSLDAGSI------IHALCFSPNRYW---LCAATEAS  392
               S  +D  I LW+ L E K     D G+       +  + FSPN      +  + + S
Sbjct  132  QIVSASRDNTIKLWNTLGECKYTIGGDLGAGDGHSGWVSCVRFSPNPLMPTIVSGSWDRS  191

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            +K+W+L           + K  +++   G          +  +++ + DGS   SG  DG
Sbjct  192  VKVWNL----------TNCKLRTKLEGHGG---------YVNAVAVSPDGSLCASGGKDG  232

Query  211  VIRVWGIGRY*MEEFRRSHMIIGHVCY  131
            V  +W +    M     +  II  +C+
Sbjct  233  VTLLWDLTEGKMLYKLEAGAIIHSLCF  259



>gb|AEO44580.1| receptor for activated C kinase 1 [Dunaliella salina]
Length=318

 Score =   270 bits (691),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 129/187 (69%), Positives = 152/187 (81%), Gaps = 9/187 (5%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKY+I + +GH+EWVSCVRFSP T  P IVSG WD+ VKVWNL+NCKL++ L GH+GYV
Sbjct  138  ECKYSIGEPEGHSEWVSCVRFSPMTANPIIVSGGWDKYVKVWNLTNCKLKNNLIGHSGYV  197

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTV VSPDGSLCASGGKD V +LWDLAEGK+LYSLDAG IIHALCFSPNRYWLCAAT +S
Sbjct  198  NTVTVSPDGSLCASGGKDNVGMLWDLAEGKRLYSLDAGDIIHALCFSPNRYWLCAATSSS  257

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            IKIWDLESKS+V DLR +  +E +  A          + +C SL+W+ADGSTL+SGYTDG
Sbjct  258  IKIWDLESKSVVDDLRPEWNKEFKKKAT---------VPYCVSLAWSADGSTLYSGYTDG  308

Query  211  VIRVWGI  191
            +IRVW +
Sbjct  309  MIRVWNV  315


 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 60/122 (49%), Gaps = 7/122 (6%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNL-----SNCKLRSTLAGHTGYVNTVAV  557
            GH+ WV+ +          ++S S D+TV VW L     S    + +L GH+ +V  V +
Sbjct  13   GHSGWVTALAAPLDPASNVLLSASRDKTVIVWELERGGDSYGYPKKSLHGHSHFVQDVVI  72

Query  556  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  383
            S DG  C SG  DG + LWDL  G         +  + ++ FS  NR  +  + + +I++
Sbjct  73   SSDGQFCLSGSWDGTLRLWDLNTGATTRRFVGHTKDVLSVAFSVDNRQIVSGSRDKTIRL  132

Query  382  WD  377
            W+
Sbjct  133  WN  134



>ref|XP_002456166.1| hypothetical protein SORBIDRAFT_03g031520 [Sorghum bicolor]
 gb|EES01286.1| hypothetical protein SORBIDRAFT_03g031520 [Sorghum bicolor]
Length=332

 Score =   271 bits (692),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 131/194 (68%), Positives = 155/194 (80%), Gaps = 16/194 (8%)
 Frame = -1

Query  751  ECKYTIQD----GDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGH  584
            ECKYTI       +GHN WVSCVRFSP+T QPTIVSGSWDR+VKVWNL+NCKLR TL GH
Sbjct  149  ECKYTIGGDLGGAEGHNGWVSCVRFSPNTYQPTIVSGSWDRSVKVWNLTNCKLRCTLQGH  208

Query  583  TGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAA  404
             GYVN VAVSPDGSLCASGGKD V LLWDL EGK+LY+LDAG IIH+LCFSPNRYWLCAA
Sbjct  209  GGYVNAVAVSPDGSLCASGGKDHVTLLWDLTEGKRLYALDAGDIIHSLCFSPNRYWLCAA  268

Query  403  TEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSG  224
            T+ SIKIWDLESK +V DL+ ++            ++ K+++++CT LSW+ADGSTL++G
Sbjct  269  TQESIKIWDLESKHVVQDLKPEV------------SSTKDQMLYCTCLSWSADGSTLYAG  316

Query  223  YTDGVIRVWGIGRY  182
            YTDG IR++ I  Y
Sbjct  317  YTDGSIRIYKISAY  330


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 54/197 (27%), Positives = 85/197 (43%), Gaps = 36/197 (18%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSN---------------CKLRSTLAG  587
            GHN  V+ +  +P      IVS S D+++ VW+L N                 LR  L G
Sbjct  16   GHNGVVTAIA-TPIDNSDLIVSSSRDKSLLVWDLRNPVQAAGDGTTTADYGVPLRR-LTG  73

Query  586  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKL--YSLDAGSIIHALCFSPNRYWL  413
            H+ +V  V +S DG    SG  DG + LW+L  G+    +      ++     + NR  +
Sbjct  74   HSHFVQDVVLSSDGQFALSGSWDGDLRLWNLTTGETTCRFVGHEKDVLSVAFSADNRQIV  133

Query  412  CAATEASIKIWDLESK---SIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADG  242
             A+ + +IK+W+   +   +I  DL           AEG+     N  + C   S N   
Sbjct  134  SASRDRTIKLWNTLGECKYTIGGDLG---------GAEGH-----NGWVSCVRFSPNTYQ  179

Query  241  STLFSGYTDGVIRVWGI  191
             T+ SG  D  ++VW +
Sbjct  180  PTIVSGSWDRSVKVWNL  196



>ref|XP_003060952.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH54602.1| predicted protein [Micromonas pusilla CCMP1545]
Length=325

 Score =   270 bits (689),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 129/189 (68%), Positives = 149/189 (79%), Gaps = 10/189 (5%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTIQ+ +GH EWVSCVRFSP T  P IVSG WD+ VKVWNL+NCKLR+ L GHTGY+
Sbjct  137  ECKYTIQEQEGHTEWVSCVRFSPVTSNPIIVSGGWDKLVKVWNLTNCKLRTNLVGHTGYI  196

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTV VSPDGSLCASGGKDGV +LWDLAEGK+LY+LDAG II+ALCFSPNRYWLCAAT++ 
Sbjct  197  NTVTVSPDGSLCASGGKDGVAMLWDLAEGKRLYTLDAGDIIYALCFSPNRYWLCAATQSC  256

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            +KIWDLESKSIV           E+  E      K+   FCTSL+W+ADG TLF+GYTD 
Sbjct  257  VKIWDLESKSIV----------DELHPEFPPVGKKSIPPFCTSLNWSADGGTLFTGYTDC  306

Query  211  VIRVWGIGR  185
            +IRVW + R
Sbjct  307  LIRVWTVNR  315



>ref|XP_002502835.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO64093.1| predicted protein [Micromonas sp. RCC299]
Length=324

 Score =   269 bits (688),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 129/189 (68%), Positives = 148/189 (78%), Gaps = 10/189 (5%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTIQ+ +GH EWVSCVRFSP T  P IVSG WD+ VKVWNL+NCKLR+ L GHTGY+
Sbjct  138  ECKYTIQEQEGHTEWVSCVRFSPVTSNPIIVSGGWDKLVKVWNLTNCKLRTNLVGHTGYI  197

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTV VSPDGSLCASGGKDGV +LWDLAEGK+LYSLDAG II+ALCFSPNRYWLCAAT++ 
Sbjct  198  NTVTVSPDGSLCASGGKDGVAMLWDLAEGKRLYSLDAGDIIYALCFSPNRYWLCAATQSC  257

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            +KIWDLESKSIV           E+  E      K+   FCTSL W++DG+TLF+GYTD 
Sbjct  258  VKIWDLESKSIV----------DELHPEFPPVGKKSIPPFCTSLQWSSDGATLFTGYTDC  307

Query  211  VIRVWGIGR  185
             IRVW + R
Sbjct  308  QIRVWTVSR  316


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 52/208 (25%), Positives = 86/208 (41%), Gaps = 31/208 (15%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  557
            GH  WV+ +          ++S S D+TV +W L+  +      +  L GH+ +V  V +
Sbjct  13   GHEGWVTSLATPLDNNSDMLLSSSRDKTVILWTLTREEGNYGYAQKALRGHSHFVQDVVI  72

Query  556  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  383
            S DG    SG  DG + LWDL  G         S  + ++ FS  NR  +  + + +IK+
Sbjct  73   SSDGQFALSGSWDGTLRLWDLNTGSTTRRFVGHSKDVLSVAFSVDNRQIVSGSRDKTIKL  132

Query  382  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            W+   E K  +        QE E   E          + C   S       + SG  D +
Sbjct  133  WNTLGECKYTI--------QEQEGHTE---------WVSCVRFSPVTSNPIIVSGGWDKL  175

Query  208  IRVWGIGRY*MEEFRRSHMIIGHVCYLS  125
            ++VW      +   +    ++GH  Y++
Sbjct  176  VKVWN-----LTNCKLRTNLVGHTGYIN  198



>gb|EMT00770.1| hypothetical protein F775_19376 [Aegilops tauschii]
Length=599

 Score =   277 bits (709),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 135/191 (71%), Positives = 156/191 (82%), Gaps = 16/191 (8%)
 Frame = -1

Query  751  ECKYTIQDGDG----HNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGH  584
            ECKYTI    G    H  WVSCVRFSP+  QPTIVSGSWD+TVKVWNL+NCKLRSTLAGH
Sbjct  80   ECKYTIGGDMGGGEGHTGWVSCVRFSPNIQQPTIVSGSWDKTVKVWNLTNCKLRSTLAGH  139

Query  583  TGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAA  404
             GYVN VAVSPDGSLCASGGKDGV LLWDL+EGK+LY L+AGSIIHALCFSPNRYWLCAA
Sbjct  140  GGYVNAVAVSPDGSLCASGGKDGVTLLWDLSEGKRLYQLEAGSIIHALCFSPNRYWLCAA  199

Query  403  TEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSG  224
            TE S+KIWDLESK +V DL+ +++             +KN++++CTSLSW+ADGSTL++G
Sbjct  200  TEESVKIWDLESKHVVQDLKPEVQ------------VSKNQMLYCTSLSWSADGSTLYTG  247

Query  223  YTDGVIRVWGI  191
            YTDG IRV+ I
Sbjct  248  YTDGTIRVFKI  258



>ref|XP_010480509.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A, partial [Camelina sativa]
Length=232

 Score =   265 bits (676),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 127/160 (79%), Positives = 140/160 (88%), Gaps = 2/160 (1%)
 Frame = -1

Query  751  ECKYTIQDG--DGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTG  578
            ECKYTI +G  DGH +WVSCVRFSP+TLQPTIVS SWD+TVKVWNLSNCKLRSTLAGHTG
Sbjct  70   ECKYTISEGGGDGHRDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLSNCKLRSTLAGHTG  129

Query  577  YVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATE  398
            YV+TVAVSPDGSLCASGGKDGV+LLWDLAEGKKLYS +A S+IHALCFSPNRYWLCAATE
Sbjct  130  YVSTVAVSPDGSLCASGGKDGVVLLWDLAEGKKLYSFEANSVIHALCFSPNRYWLCAATE  189

Query  397  ASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKI  278
              IKIWDLESK+IV DL+VDLK E+E +      A K K+
Sbjct  190  QGIKIWDLESKTIVEDLKVDLKAEAEKADNSGPAATKRKV  229



>ref|XP_002967499.1| hypothetical protein SELMODRAFT_144795 [Selaginella moellendorffii]
 gb|EFJ32098.1| hypothetical protein SELMODRAFT_144795 [Selaginella moellendorffii]
Length=315

 Score =   266 bits (679),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 125/189 (66%), Positives = 148/189 (78%), Gaps = 13/189 (7%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTIQD D H  WVSCVRFSP T  P IVSG WD+ VKVWNL+NCKLR+ LAGH+GYV
Sbjct  140  ECKYTIQDQDSHTGWVSCVRFSPVTTNPIIVSGGWDKMVKVWNLTNCKLRTNLAGHSGYV  199

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            N+V VSPDGSLCASGGKDGV +LWDLAEGK+LYSLDAG IIH+LCFSPNRYWLCAAT+  
Sbjct  200  NSVTVSPDGSLCASGGKDGVAMLWDLAEGKRLYSLDAGDIIHSLCFSPNRYWLCAATQQC  259

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            +KIWDLESK+IV +++ +               +K +  +CT+L+W+ DGS LF+GYTDG
Sbjct  260  VKIWDLESKNIVEEIKPE-------------QVSKKEPTYCTTLNWSMDGSKLFAGYTDG  306

Query  211  VIRVWGIGR  185
            VIRV  +G 
Sbjct  307  VIRVHSVGH  315


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/126 (29%), Positives = 60/126 (48%), Gaps = 11/126 (9%)
 Frame = -1

Query  724  DGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL--------RSTLAGHTGYVN  569
            +GH +WV+ +  +P      I+S S D++V +WN  +  L        +  L GH  +V 
Sbjct  12   EGHTDWVTAIA-TPVDNSDIILSASRDKSVLLWNTQHKDLTEQDFGLPQRRLTGHAHFVQ  70

Query  568  TVAVSPDGSLCASGGKDGVILLWDLAEGK--KLYSLDAGSIIHALCFSPNRYWLCAATEA  395
             V +S D     SG  DG + LWDLA G   + +      ++     + NR  +  + + 
Sbjct  71   DVVISSDSQFALSGSWDGTLRLWDLANGNTTRRFVGHTKDVLSVAFSADNRQIVSGSRDK  130

Query  394  SIKIWD  377
            SIK+W+
Sbjct  131  SIKLWN  136


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 52/185 (28%), Positives = 78/185 (42%), Gaps = 27/185 (15%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  542
            GH  +V  V  S  +     +SGSWD T+++W+L+N        GHT  V +VA S D  
Sbjct  64   GHAHFVQDVVISSDS--QFALSGSWDGTLRLWDLANGNTTRRFVGHTKDVLSVAFSADNR  121

Query  541  LCASGGKDGVILLWDLAEGKKLYSLDAGSI---IHALCFSP---NRYWLCAATEASIKIW  380
               SG +D  I LW+     K    D  S    +  + FSP   N   +    +  +K+W
Sbjct  122  QIVSGSRDKSIKLWNTLGECKYTIQDQDSHTGWVSCVRFSPVTTNPIIVSGGWDKMVKVW  181

Query  379  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRV  200
            +L +      LR +L   S                +  S++ + DGS   SG  DGV  +
Sbjct  182  NLTN----CKLRTNLAGHSG---------------YVNSVTVSPDGSLCASGGKDGVAML  222

Query  199  WGIGR  185
            W +  
Sbjct  223  WDLAE  227



>ref|XP_005652002.1| WD40 repeat-like protein [Coccomyxa subellipsoidea C-169]
 gb|EIE27458.1| WD40 repeat-like protein [Coccomyxa subellipsoidea C-169]
Length=317

 Score =   265 bits (677),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 125/187 (67%), Positives = 147/187 (79%), Gaps = 10/187 (5%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTI + DGH EWVSCVRFSP T  P IVS  WD+ VKVWNL+NCKLR+ L GH+GY+
Sbjct  138  ECKYTIAEPDGHTEWVSCVRFSPVTNNPIIVSAGWDKLVKVWNLTNCKLRANLQGHSGYI  197

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTV VSPDGSLCASGGKDGV +LWDLAEGK+LY+L+AG IIHALCFSPNRYWLCAAT   
Sbjct  198  NTVTVSPDGSLCASGGKDGVAMLWDLAEGKRLYNLEAGEIIHALCFSPNRYWLCAATTNC  257

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            IKIWDLESKSIV +L+ D  +             K ++ +C SL+W+ADG+TL+SGYT+G
Sbjct  258  IKIWDLESKSIVDELKPDFGE----------LGKKAQVPYCVSLAWSADGATLYSGYTNG  307

Query  211  VIRVWGI  191
             I VWG+
Sbjct  308  KIEVWGV  314


 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 38/123 (31%), Positives = 63/123 (51%), Gaps = 7/123 (6%)
 Frame = -1

Query  724  DGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVA  560
            +GH  WV+ +         TI+S S D+T+ VW L+  +      + +L GH+ +V  V 
Sbjct  12   EGHAGWVTSIATPLDPNSDTILSSSRDKTILVWTLTREEGNYGFAKRSLKGHSHFVEDVV  71

Query  559  VSPDGSLCASGGKDGVILLWDLAEGKKLYS-LDAGSIIHALCFS-PNRYWLCAATEASIK  386
            +S DG    SG  DG + LWDL+ G+     L     + ++ FS  NR  +  + + +IK
Sbjct  72   ISSDGQFALSGSWDGTLRLWDLSTGQTTRRFLGHSKDVLSVAFSMDNRQIVSGSRDKTIK  131

Query  385  IWD  377
            +W+
Sbjct  132  LWN  134


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 52/185 (28%), Positives = 81/185 (44%), Gaps = 27/185 (15%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  542
            GH+ +V  V  S        +SGSWD T+++W+LS  +      GH+  V +VA S D  
Sbjct  62   GHSHFVEDVVISSD--GQFALSGSWDGTLRLWDLSTGQTTRRFLGHSKDVLSVAFSMDNR  119

Query  541  LCASGGKDGVILLWD-LAEGKKLYSLDAGSIIHALC--FSP---NRYWLCAATEASIKIW  380
               SG +D  I LW+ + E K   +   G      C  FSP   N   + A  +  +K+W
Sbjct  120  QIVSGSRDKTIKLWNTIGECKYTIAEPDGHTEWVSCVRFSPVTNNPIIVSAGWDKLVKVW  179

Query  379  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRV  200
            +L +      LR +L+  S                +  +++ + DGS   SG  DGV  +
Sbjct  180  NLTN----CKLRANLQGHSG---------------YINTVTVSPDGSLCASGGKDGVAML  220

Query  199  WGIGR  185
            W +  
Sbjct  221  WDLAE  225



>ref|XP_002960209.1| hypothetical protein SELMODRAFT_266532 [Selaginella moellendorffii]
 gb|EFJ37748.1| hypothetical protein SELMODRAFT_266532 [Selaginella moellendorffii]
Length=310

 Score =   262 bits (670),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 124/189 (66%), Positives = 146/189 (77%), Gaps = 18/189 (10%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTIQD D H  WVSCVRFSP T  P IVSG WD+ VKVWNL+NCKLR+ LAGH+GYV
Sbjct  140  ECKYTIQDQDSHTGWVSCVRFSPVTTNPIIVSGGWDKMVKVWNLTNCKLRTNLAGHSGYV  199

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            N+V VSPDGSLCASGGKDGV +LWDLAEGK+LYSLDAG IIH+LCFSPNRYWLCAAT+  
Sbjct  200  NSVTVSPDGSLCASGGKDGVAMLWDLAEGKRLYSLDAGDIIHSLCFSPNRYWLCAATQQC  259

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            +KIWDLESK+IV +++ +                  +  +CT+L+W+ DGS LF+GYTDG
Sbjct  260  VKIWDLESKNIVEEIKPE------------------QPTYCTTLNWSMDGSKLFAGYTDG  301

Query  211  VIRVWGIGR  185
            VIRV  +G 
Sbjct  302  VIRVHSVGH  310


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/126 (29%), Positives = 60/126 (48%), Gaps = 11/126 (9%)
 Frame = -1

Query  724  DGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL--------RSTLAGHTGYVN  569
            +GH +WV+ +  +P      I+S S D++V +WN  +  L        +  L GH  +V 
Sbjct  12   EGHTDWVTAIA-TPVDNSDIILSASRDKSVLLWNTQHKDLTEQDFGLPQRRLTGHAHFVQ  70

Query  568  TVAVSPDGSLCASGGKDGVILLWDLAEGK--KLYSLDAGSIIHALCFSPNRYWLCAATEA  395
             V +S D     SG  DG + LWDLA G   + +      ++     + NR  +  + + 
Sbjct  71   DVVISSDSQFALSGSWDGTLRLWDLANGNTTRRFVGHTKDVLSVAFSADNRQIVSGSRDK  130

Query  394  SIKIWD  377
            SIK+W+
Sbjct  131  SIKLWN  136


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 52/185 (28%), Positives = 78/185 (42%), Gaps = 27/185 (15%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  542
            GH  +V  V  S  +     +SGSWD T+++W+L+N        GHT  V +VA S D  
Sbjct  64   GHAHFVQDVVISSDS--QFALSGSWDGTLRLWDLANGNTTRRFVGHTKDVLSVAFSADNR  121

Query  541  LCASGGKDGVILLWDLAEGKKLYSLDAGSI---IHALCFSP---NRYWLCAATEASIKIW  380
               SG +D  I LW+     K    D  S    +  + FSP   N   +    +  +K+W
Sbjct  122  QIVSGSRDKSIKLWNTLGECKYTIQDQDSHTGWVSCVRFSPVTTNPIIVSGGWDKMVKVW  181

Query  379  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRV  200
            +L +      LR +L   S                +  S++ + DGS   SG  DGV  +
Sbjct  182  NLTN----CKLRTNLAGHSG---------------YVNSVTVSPDGSLCASGGKDGVAML  222

Query  199  WGIGR  185
            W +  
Sbjct  223  WDLAE  227



>ref|XP_003569582.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Brachypodium distachyon]
Length=331

 Score =   262 bits (670),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 131/194 (68%), Positives = 155/194 (80%), Gaps = 16/194 (8%)
 Frame = -1

Query  751  ECKYTIQDGDGHNE----WVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGH  584
            ECKYTI    G  E    WVSCVRFSP+T  PTIVSGSWDR+VKVWNL+NCK+RSTL GH
Sbjct  146  ECKYTIGGDHGGGEGHTGWVSCVRFSPNTFVPTIVSGSWDRSVKVWNLTNCKIRSTLDGH  205

Query  583  TGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAA  404
             GYV+ VAVSPDGSLCASGGKDGV LLWDLAEGK+LYSLDAG+II++LCFSPNRYWLCAA
Sbjct  206  GGYVSAVAVSPDGSLCASGGKDGVTLLWDLAEGKRLYSLDAGAIINSLCFSPNRYWLCAA  265

Query  403  TEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSG  224
            T+ SIKIWDLESK +V DLR ++              +KN++++CT LSW+ADGSTL++G
Sbjct  266  TQDSIKIWDLESKHVVQDLRPEVP------------VSKNQMLYCTCLSWSADGSTLYAG  313

Query  223  YTDGVIRVWGIGRY  182
            YTDG IR++ I  +
Sbjct  314  YTDGTIRIYKISGF  327


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 65/130 (50%), Gaps = 17/130 (13%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRST-------------LAGHT  581
            GHN+ V+ +  +P    P IVS S D+++ VW+L+N  +++T             L GH 
Sbjct  15   GHNDVVTAIA-TPIDNSPFIVSSSRDKSLLVWDLTN-PIQATQDSSSEYGIPFRRLTGHG  72

Query  580  GYVNTVAVSPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCA  407
             +V  V +S DG    SG  DG + LWDL+ G   + +      ++       NR  + A
Sbjct  73   HFVQDVVLSSDGQFALSGSWDGELRLWDLSTGVTTRRFVGHEKDVLSVAFSVDNRQIVSA  132

Query  406  ATEASIKIWD  377
            + + +IK+W+
Sbjct  133  SRDRTIKLWN  142



>gb|KIY98327.1| Guanine nucleotide-binding protein subunit beta-like protein 
[Monoraphidium neglectum]
Length=319

 Score =   261 bits (666),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 125/185 (68%), Positives = 146/185 (79%), Gaps = 9/185 (5%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTI + +GH+EWVSCVRFSP T  P IVSG WD+ VKV+NLSNCKL+  L GH GY+
Sbjct  138  ECKYTIAEPEGHSEWVSCVRFSPMTNNPIIVSGGWDKLVKVFNLSNCKLKCNLVGHAGYI  197

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTV VSPDGSLCASGGKDGV +LWDLAEGK+LYSLDAG IIH+L FSPNRYWLCAAT+ S
Sbjct  198  NTVTVSPDGSLCASGGKDGVAMLWDLAEGKRLYSLDAGDIIHSLVFSPNRYWLCAATQTS  257

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            IKIWDLESKS+V DLR +  +             K  I +C SL+W+ADGSTL++GY+DG
Sbjct  258  IKIWDLESKSVVDDLRPEFSK---------TFGKKATIPYCVSLAWSADGSTLYAGYSDG  308

Query  211  VIRVW  197
             IRV+
Sbjct  309  DIRVF  313


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 57/122 (47%), Gaps = 7/122 (6%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  557
            GH  WV+ +          I+S S D+TV VW L   +         L GH+ +V  V +
Sbjct  13   GHRGWVTAIATPLDPNADVILSASRDKTVIVWKLDRSETNYGVAHKALKGHSHFVQDVVI  72

Query  556  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  383
            S DG    SG  DG + LWDL +G         +  + ++ FS  NR  +  A + +IK+
Sbjct  73   SSDGQFALSGSWDGTLRLWDLQQGTTTRRFVGHTKDVLSVAFSVDNRQIVSGARDKTIKL  132

Query  382  WD  377
            W+
Sbjct  133  WN  134



>gb|KDD72035.1| hypothetical protein H632_c3969p0, partial [Helicosporidium sp. 
ATCC 50920]
Length=262

 Score =   257 bits (657),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 119/189 (63%), Positives = 149/189 (79%), Gaps = 10/189 (5%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYT+ +  GH  WVSCVR SP    P +VS SWD+TVK+W+L++CKLR+TL+GH GYV
Sbjct  83   ECKYTMAEPSGHTGWVSCVRLSPVGATPVVVSASWDKTVKIWDLASCKLRATLSGHEGYV  142

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            N V +SPDGSLCASGGKDG  +LWDLAEGK+LY+L+AG +IH+L FSPNRYWLCAAT++ 
Sbjct  143  NAVTISPDGSLCASGGKDGSAMLWDLAEGKQLYTLEAGDVIHSLVFSPNRYWLCAATQSG  202

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            IKIWDLE KS+V DLR +L + S          AK ++ +  SL+W+ADGSTL++GYTDG
Sbjct  203  IKIWDLEFKSVVDDLRPELPERS----------AKAQVPYPISLTWSADGSTLYAGYTDG  252

Query  211  VIRVWGIGR  185
            VIRVW +GR
Sbjct  253  VIRVWQVGR  261



>ref|XP_005711409.1| receptor for activated protein kinase C [Chondrus crispus]
 emb|CDF41115.1| receptor for activated protein kinase C [Chondrus crispus]
Length=320

 Score =   259 bits (662),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 127/188 (68%), Positives = 145/188 (77%), Gaps = 10/188 (5%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTIQ+ +GH EWVSCVRFSPST  P IVS  WD+ VKVWNL+NCKLR+ L  H+GY+
Sbjct  140  ECKYTIQE-EGHTEWVSCVRFSPSTQNPLIVSCGWDKLVKVWNLTNCKLRTNLHNHSGYL  198

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            N V VSPDGSLCASGGKDGV +LWDL EGK LYSL+A  IIHALCFSPNRYWLCAAT + 
Sbjct  199  NAVTVSPDGSLCASGGKDGVAMLWDLQEGKHLYSLEANDIIHALCFSPNRYWLCAATNSC  258

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            IKIWDLESK++V +LR D         +  +   K     C SL+W+ADGSTLFSGYTD 
Sbjct  259  IKIWDLESKTVVDELRDD---------QAESIGKKAAQPACISLTWSADGSTLFSGYTDN  309

Query  211  VIRVWGIG  188
            VIRVWG+G
Sbjct  310  VIRVWGVG  317


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 75/182 (41%), Gaps = 26/182 (14%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  542
            GH  +VS V  S        +S SWD T+++W+LS         GH+  V +VA S D  
Sbjct  64   GHGHFVSDVVLSSD--GQFALSSSWDHTLRLWDLSTGVTTRRFVGHSKDVLSVAFSADNR  121

Query  541  LCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALC--FSP---NRYWLCAATEASIKIWD  377
               SG +D  I LW+     K    + G      C  FSP   N   +    +  +K+W+
Sbjct  122  QIVSGSRDRTIKLWNTLGECKYTIQEEGHTEWVSCVRFSPSTQNPLIVSCGWDKLVKVWN  181

Query  376  LESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVW  197
            L +      LR +L   S                +  +++ + DGS   SG  DGV  +W
Sbjct  182  LTN----CKLRTNLHNHSG---------------YLNAVTVSPDGSLCASGGKDGVAMLW  222

Query  196  GI  191
             +
Sbjct  223  DL  224



>dbj|BAF47116.1| G protein beta-subunit-like protein [Nicotiana tabacum]
Length=144

 Score =   253 bits (645),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 132/144 (92%), Gaps = 1/144 (1%)
 Frame = -1

Query  673  QPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDL  494
            Q TIVSGSWDRTVK+WNL+NCKLRSTLAGH GYVNTVAVSPDGSLCASGGKDG ILLWDL
Sbjct  1    QRTIVSGSWDRTVKIWNLTNCKLRSTLAGHGGYVNTVAVSPDGSLCASGGKDGTILLWDL  60

Query  493  AEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMS  314
            AEGKKLYSLDAGSIIHALCFSPNRYWLCAATE SIKIWDLESKS+VVDL+VDLKQESEM+
Sbjct  61   AEGKKLYSLDAGSIIHALCFSPNRYWLCAATETSIKIWDLESKSVVVDLKVDLKQESEMA  120

Query  313  AEGNN-TAAKNKIIFCTSLSWNAD  245
             EG    A KNKI++CT LSW AD
Sbjct  121  TEGTTGPACKNKIMYCTCLSWCAD  144



>emb|CDY59680.1| BnaA05g36460D [Brassica napus]
Length=225

 Score =   255 bits (652),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 132/199 (66%), Positives = 150/199 (75%), Gaps = 21/199 (11%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWD-------------------RTVKVWNLSNCKLRS  599
            GH+ +V  V  S        +SGSWD                    T  VWNL+NCKLR+
Sbjct  29   GHSHFVEDVVLSSD--GQFALSGSWDGELRLWDLATGASTRRFVGHTKDVWNLANCKLRN  86

Query  598  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  419
            TLAGH+GY+NTVAVSPDGSLCASGGKDG ILLWDLAEGKKLYSL+AGSIIH+LCFSPNRY
Sbjct  87   TLAGHSGYLNTVAVSPDGSLCASGGKDGAILLWDLAEGKKLYSLEAGSIIHSLCFSPNRY  146

Query  418  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  239
            WLCAATE SI+IWDLESKS+V DL+VDLK E+E S     T  K K+I+CTSL+W+ADG+
Sbjct  147  WLCAATENSIRIWDLESKSVVEDLKVDLKAEAEKSDVSAATGNKTKVIYCTSLNWSADGN  206

Query  238  TLFSGYTDGVIRVWGIGRY  182
            TLFSGYTDGVIRVWGIG Y
Sbjct  207  TLFSGYTDGVIRVWGIGHY  225



>dbj|BAJ98167.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=332

 Score =   259 bits (662),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 130/194 (67%), Positives = 151/194 (78%), Gaps = 16/194 (8%)
 Frame = -1

Query  751  ECKYTIQDGDG----HNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGH  584
            ECKYTI    G    H  WVSCVRFSP+   PTIVSGSWDR+VKVWNL+NCKLR TL GH
Sbjct  147  ECKYTIGGDLGGGEGHTGWVSCVRFSPNNFAPTIVSGSWDRSVKVWNLTNCKLRCTLDGH  206

Query  583  TGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAA  404
             GYV+ VAVSPDGSLCASGGKDGV LLWDL EGK+LYSLDAGSII++LCFSPNRYWLCAA
Sbjct  207  GGYVSAVAVSPDGSLCASGGKDGVTLLWDLTEGKRLYSLDAGSIINSLCFSPNRYWLCAA  266

Query  403  TEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSG  224
            T+ SIKIWDLESK IV DLR ++   S+            ++++CT LSW+ADGSTL++G
Sbjct  267  TQDSIKIWDLESKHIVQDLRPEVPVSSK------------QMLYCTCLSWSADGSTLYAG  314

Query  223  YTDGVIRVWGIGRY  182
            YTDG IR++ I  +
Sbjct  315  YTDGTIRIYKISGF  328


 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 48/192 (25%), Positives = 83/192 (43%), Gaps = 28/192 (15%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRST-------------LAGHT  581
            GHN+ V+ +  +P    P IVS S D+++ VW+L+N  +++T             L GH 
Sbjct  16   GHNDVVTAIA-TPIDNSPFIVSSSRDKSLLVWDLTN-PIQATQDTSSEYGVPFRRLTGHG  73

Query  580  GYVNTVAVSPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCA  407
             +V  V +S DG    SG  DG + LWDL+ G   + +      ++       NR  + A
Sbjct  74   HFVQDVVLSSDGQFALSGSWDGELRLWDLSTGVTTRRFVGHEKDVLSVAFSIDNRQIVSA  133

Query  406  ATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFS  227
            + + +IK+W+   +            +  +  +          + C   S N    T+ S
Sbjct  134  SRDRTIKLWNTLGEC-----------KYTIGGDLGGGEGHTGWVSCVRFSPNNFAPTIVS  182

Query  226  GYTDGVIRVWGI  191
            G  D  ++VW +
Sbjct  183  GSWDRSVKVWNL  194



>emb|CDM83867.1| unnamed protein product [Triticum aestivum]
Length=332

 Score =   258 bits (659),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 129/194 (66%), Positives = 150/194 (77%), Gaps = 16/194 (8%)
 Frame = -1

Query  751  ECKYTIQDGDG----HNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGH  584
            ECKYTI    G    H  WVSCVRFSP+   PTIVSGSWDR+VKVWNL+NCKLR TL GH
Sbjct  147  ECKYTIGGDLGGGEGHTGWVSCVRFSPNNFAPTIVSGSWDRSVKVWNLTNCKLRCTLDGH  206

Query  583  TGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAA  404
             GYV+ VAVSPDGSLCASGGKDGV LLWDL EGK+LYSLDAGSII++LCFSPNRYWLCAA
Sbjct  207  GGYVSAVAVSPDGSLCASGGKDGVTLLWDLTEGKRLYSLDAGSIINSLCFSPNRYWLCAA  266

Query  403  TEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSG  224
            T+ SIKIWDLESK IV DLR ++              +  ++++CT LSW+ADGSTL++G
Sbjct  267  TQDSIKIWDLESKHIVQDLRPEVP------------VSTKQMLYCTCLSWSADGSTLYAG  314

Query  223  YTDGVIRVWGIGRY  182
            YTDG IR++ I  +
Sbjct  315  YTDGTIRIYKISGF  328


 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 48/192 (25%), Positives = 83/192 (43%), Gaps = 28/192 (15%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRST-------------LAGHT  581
            GHN+ V+ +  +P    P IVS S D+++ VW+L+N  +++T             L GH 
Sbjct  16   GHNDVVTAIA-TPIDNSPFIVSSSRDKSLLVWDLTN-PIQATQDSSSEYGVPFRRLTGHG  73

Query  580  GYVNTVAVSPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCA  407
             +V  V +S DG    SG  DG + LWDL+ G   + +      ++       NR  + A
Sbjct  74   HFVQDVVLSSDGQFALSGSWDGELRLWDLSTGVTTRRFVGHEKDVLSVAFSIDNRQIVSA  133

Query  406  ATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFS  227
            + + +IK+W+   +            +  +  +          + C   S N    T+ S
Sbjct  134  SRDRTIKLWNTLGEC-----------KYTIGGDLGGGEGHTGWVSCVRFSPNNFAPTIVS  182

Query  226  GYTDGVIRVWGI  191
            G  D  ++VW +
Sbjct  183  GSWDRSVKVWNL  194



>ref|XP_007508318.1| predicted protein [Bathycoccus prasinos]
 emb|CCO20422.1| predicted protein [Bathycoccus prasinos]
Length=318

 Score =   256 bits (655),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 121/189 (64%), Positives = 145/189 (77%), Gaps = 10/189 (5%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTIQ+ +GH EWVSCVRFSP+   P IVS  WD+ VKVWNL+NCKLR+ L GHTGY+
Sbjct  136  ECKYTIQEHEGHTEWVSCVRFSPAPSNPIIVSCGWDKLVKVWNLNNCKLRTNLVGHTGYI  195

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTV VSPDGSLCASGGKDGV +LWDLAEGK+LYSLDAG II+++CFSPNRYWLCAAT++ 
Sbjct  196  NTVTVSPDGSLCASGGKDGVAMLWDLAEGKRLYSLDAGDIIYSMCFSPNRYWLCAATQSC  255

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            +KIWDLESKSIV           E+  E      K+    CTSL W+ADG TL++GY+D 
Sbjct  256  VKIWDLESKSIV----------DELHPEFPPVGKKSMPPHCTSLQWSADGQTLYTGYSDN  305

Query  211  VIRVWGIGR  185
             +RV+ + R
Sbjct  306  KVRVYVVSR  314


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 61/123 (50%), Gaps = 8/123 (7%)
 Frame = -1

Query  724  DGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVA  560
            +GH  WV+ +  +P      +++ S D++V +W L+  +      R  L GH+ +V  V 
Sbjct  11   EGHEGWVTSIA-TPLDNSDILLTSSRDKSVILWTLTREEGNYGYPRRRLHGHSHFVQDVV  69

Query  559  VSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIK  386
            +S DG    SG  DG + LWDL  G         S  + ++ FS  NR  +  + + +IK
Sbjct  70   ISSDGQFALSGSWDGTLRLWDLNSGTTTRRFVGHSKDVLSVAFSVDNRQIVSGSRDKTIK  129

Query  385  IWD  377
            +W+
Sbjct  130  LWN  132



>emb|CDY71917.1| BnaCnng75080D [Brassica napus]
Length=244

 Score =   253 bits (646),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 133/199 (67%), Positives = 152/199 (76%), Gaps = 24/199 (12%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWD-------------------RTVKVWNLSNCKLRS  599
            GH+ +V  V  S        +SGSWD                    T  VWNL+NCKLR+
Sbjct  51   GHSHFVEDVVLSSD--GQFALSGSWDGELRLWDLATGASTRRFVGHTKDVWNLANCKLRN  108

Query  598  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  419
            TLAGH+GY+NTVAVSPDGSLCASGGKDG ILLWDLAEGKKLY L+AGSIIH+LCFSPNRY
Sbjct  109  TLAGHSGYLNTVAVSPDGSLCASGGKDGGILLWDLAEGKKLYCLEAGSIIHSLCFSPNRY  168

Query  418  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  239
            WLCAATE SI+IWDLESKS+V DL+VDLK ES++SA    T  K K+I+CTSL+W+ADG+
Sbjct  169  WLCAATENSIRIWDLESKSVVEDLKVDLKAESDVSA---GTGNKTKVIYCTSLNWSADGN  225

Query  238  TLFSGYTDGVIRVWGIGRY  182
            TLFSGYTDGVIRVWGIGRY
Sbjct  226  TLFSGYTDGVIRVWGIGRY  244



>dbj|BAF47119.1| G protein beta-subunit-like protein [Nicotiana tabacum]
Length=144

 Score =   249 bits (637),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 123/144 (85%), Positives = 132/144 (92%), Gaps = 1/144 (1%)
 Frame = -1

Query  673  QPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDL  494
            Q TIVSGSWDRTVK+WNL+NCKLRSTLAGH GYVNTVAVSPDGSLCAS GKDG ILLWDL
Sbjct  1    QRTIVSGSWDRTVKIWNLTNCKLRSTLAGHGGYVNTVAVSPDGSLCASRGKDGTILLWDL  60

Query  493  AEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMS  314
            AEGKKLYSLDAGSIIHALCFSPNRYWLCAATE SIKIWDLESKS+VVDL+VDL+QESEM+
Sbjct  61   AEGKKLYSLDAGSIIHALCFSPNRYWLCAATETSIKIWDLESKSVVVDLKVDLEQESEMA  120

Query  313  AEGNN-TAAKNKIIFCTSLSWNAD  245
             EG   +A KNKI++CT LSW AD
Sbjct  121  TEGTTGSACKNKIMYCTCLSWCAD  144



>ref|XP_011397272.1| Guanine nucleotide-binding protein subunit beta-like protein 
[Auxenochlorella protothecoides]
 gb|KFM24384.1| Guanine nucleotide-binding protein subunit beta-like protein 
[Auxenochlorella protothecoides]
Length=317

 Score =   252 bits (643),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 123/189 (65%), Positives = 146/189 (77%), Gaps = 11/189 (6%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECK+T+ +  GH EWVSCVR SP +  P IVS SWD+TVKVWNL +CKLR TL+GH GY+
Sbjct  139  ECKFTVAEPAGHTEWVSCVRLSPVSKPPLIVSASWDKTVKVWNLQDCKLRDTLSGHRGYI  198

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            N+V VSPDGSLCASGGKDGV +LWDL+ GK LYSLDAG++I+AL FSPNRYWLCAAT+  
Sbjct  199  NSVTVSPDGSLCASGGKDGVAMLWDLSVGKHLYSLDAGNVINALVFSPNRYWLCAATDRG  258

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            IKIWDLE KS+V DL   L        EG   A + K +   SL+W+ADG+TL+SGYTDG
Sbjct  259  IKIWDLEYKSVVDDLDAPL--------EGVEAAKQPKPV---SLAWSADGATLYSGYTDG  307

Query  211  VIRVWGIGR  185
            VIRVW +GR
Sbjct  308  VIRVWAVGR  316


 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 50/209 (24%), Positives = 86/209 (41%), Gaps = 32/209 (15%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK------LRSTLAGHTGYVNTVA  560
            GH  WV+ +          +V+ S D++V VW L+  +       R +L GH+ YV  V 
Sbjct  13   GHRGWVTAIAPPLDPNSDLLVTSSRDKSVIVWTLTRGEKEDYGFARRSLRGHSHYVQDVV  72

Query  559  VSPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIK  386
            +S D     SG  DG + LWDL +G   + +      ++     + NR  L  + + SIK
Sbjct  73   LSSDAQYALSGSWDGTMRLWDLNKGTTTRRFLGHTKDVLSVAISADNRQILSGSRDKSIK  132

Query  385  IWDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            +W+   E K  V +                  A   + + C  LS  +    + S   D 
Sbjct  133  LWNTLAECKFTVAE-----------------PAGHTEWVSCVRLSPVSKPPLIVSASWDK  175

Query  211  VIRVWGIGRY*MEEFRRSHMIIGHVCYLS  125
             ++VW      +++ +    + GH  Y++
Sbjct  176  TVKVWN-----LQDCKLRDTLSGHRGYIN  199


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 52/183 (28%), Positives = 81/183 (44%), Gaps = 27/183 (15%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  542
            GH+ +V  V  S        +SGSWD T+++W+L+         GHT  V +VA+S D  
Sbjct  63   GHSHYVQDVVLSSDAQY--ALSGSWDGTMRLWDLNKGTTTRRFLGHTKDVLSVAISADNR  120

Query  541  LCASGGKDGVILLWD-LAEGKKLYSLDAG-----SIIHALCFSPNRYWLCAATEASIKIW  380
               SG +D  I LW+ LAE K   +  AG     S +     S     + A+ + ++K+W
Sbjct  121  QILSGSRDKSIKLWNTLAECKFTVAEPAGHTEWVSCVRLSPVSKPPLIVSASWDKTVKVW  180

Query  379  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRV  200
            +L+          D K    +S             +  S++ + DGS   SG  DGV  +
Sbjct  181  NLQ----------DCKLRDTLSGHRG---------YINSVTVSPDGSLCASGGKDGVAML  221

Query  199  WGI  191
            W +
Sbjct  222  WDL  224



>ref|XP_002903189.1| guanine nucleotide-binding protein subunit beta-2-like protein 
[Phytophthora infestans T30-4]
 ref|XP_008893306.1| guanine nucleotide-binding protein subunit beta-like protein 
[Phytophthora parasitica INRA-310]
 gb|EEY55613.1| guanine nucleotide-binding protein subunit beta-2-like protein 
[Phytophthora infestans T30-4]
 gb|ETK85071.1| guanine nucleotide-binding protein subunit beta-like protein 
[Phytophthora parasitica]
 gb|ETL38496.1| guanine nucleotide-binding protein subunit beta-like protein 
[Phytophthora parasitica]
 gb|ETL91623.1| guanine nucleotide-binding protein subunit beta-like protein 
[Phytophthora parasitica]
 gb|ETN21521.1| guanine nucleotide-binding protein subunit beta-like protein 
[Phytophthora parasitica INRA-310]
 gb|ETO73708.1| guanine nucleotide-binding protein subunit beta-like protein 
[Phytophthora parasitica P1976]
 gb|ETP14913.1| guanine nucleotide-binding protein subunit beta-like protein 
[Phytophthora parasitica CJ01A1]
Length=317

 Score =   252 bits (643),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 122/188 (65%), Positives = 144/188 (77%), Gaps = 10/188 (5%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTI + DGH EWVSCVRFSPST  P IVS  WD+ VK+WNLSNCKLR+ L GH GY+
Sbjct  139  ECKYTITE-DGHTEWVSCVRFSPSTANPLIVSCGWDKVVKIWNLSNCKLRTNLFGHEGYL  197

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTV VSPDGS+CASGGKDG   LWDL EGK+LYSL AG +IHAL FSPNRYWLCAAT + 
Sbjct  198  NTVTVSPDGSICASGGKDGTANLWDLNEGKRLYSLVAGDVIHALIFSPNRYWLCAATTSG  257

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            IKIWDLESK +V DL+ ++++     A+  +         C SL+W+ADGS LFSGYTDG
Sbjct  258  IKIWDLESKIVVHDLQPEIEEPKGKYAQPPH---------CISLAWSADGSVLFSGYTDG  308

Query  211  VIRVWGIG  188
            ++RVW +G
Sbjct  309  IVRVWAVG  316


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 38/133 (29%), Positives = 63/133 (47%), Gaps = 15/133 (11%)
 Frame = -1

Query  742  YTIQDGDGHN----EWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLA  590
            Y   + DGHN      ++  R +P+ L    ++ S D+++ VW LSN        R  L 
Sbjct  7    YPRAELDGHNGKAVTAIATTRENPNLL----LTASRDKSLLVWQLSNDGEEYGFARRRLQ  62

Query  589  GHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYW  416
            GH+ YV  V +S DG    SG  DG + LWDL  G   + +      ++     + NR  
Sbjct  63   GHSHYVEDVVISSDGQFALSGSWDGTLRLWDLNTGITTRRFVGHTKDVLSVAFSADNRQI  122

Query  415  LCAATEASIKIWD  377
            +  + + ++K+W+
Sbjct  123  VSGSRDKTVKLWN  135


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 55/202 (27%), Positives = 87/202 (43%), Gaps = 30/202 (15%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  542
            GH+ +V  V  S        +SGSWD T+++W+L+         GHT  V +VA S D  
Sbjct  63   GHSHYVEDVVISSD--GQFALSGSWDGTLRLWDLNTGITTRRFVGHTKDVLSVAFSADNR  120

Query  541  LCASGGKDGVILLWD-LAEGKKLYSLDAGSI-IHALCFSP---NRYWLCAATEASIKIWD  377
               SG +D  + LW+ L E K   + D  +  +  + FSP   N   +    +  +KIW+
Sbjct  121  QIVSGSRDKTVKLWNTLGECKYTITEDGHTEWVSCVRFSPSTANPLIVSCGWDKVVKIWN  180

Query  376  LESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVW  197
            L +      LR +L        EG          +  +++ + DGS   SG  DG   +W
Sbjct  181  LSN----CKLRTNL-----FGHEG----------YLNTVTVSPDGSICASGGKDGTANLW  221

Query  196  GIGRY*MEEFRRSHMIIGHVCY  131
             +     E  R   ++ G V +
Sbjct  222  DLN----EGKRLYSLVAGDVIH  239



>ref|XP_009836542.1| guanine nucleotide-binding protein subunit beta-like protein 
[Aphanomyces astaci]
 gb|ETV74029.1| guanine nucleotide-binding protein subunit beta-like protein 
[Aphanomyces astaci]
Length=318

 Score =   252 bits (643),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 123/188 (65%), Positives = 145/188 (77%), Gaps = 11/188 (6%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTI + +GH EWVSCVRFSPS+  P IVS  WDR VKVWNL+NCKLR+ L GHTGY+
Sbjct  140  ECKYTITE-EGHTEWVSCVRFSPSSANPLIVSAGWDRLVKVWNLTNCKLRTNLCGHTGYL  198

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTV VSPDGSLCASGGKDGV +LWDL EGK+LYSL+A  IIHAL FSPNRYWL AAT ++
Sbjct  199  NTVTVSPDGSLCASGGKDGVAMLWDLNEGKRLYSLEANDIIHALVFSPNRYWLVAATSSA  258

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            IKIWDLESK +VVD         E+  E  N   K++     SL+W+ADG TLF+GYTDG
Sbjct  259  IKIWDLESK-VVVD---------ELVPEFENVGKKSQPPHAVSLAWSADGQTLFAGYTDG  308

Query  211  VIRVWGIG  188
            ++RV+ +G
Sbjct  309  IVRVYAVG  316


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/127 (30%), Positives = 62/127 (49%), Gaps = 13/127 (10%)
 Frame = -1

Query  727  GDGHNEWVSCVRFSPSTLQPT-IVSGSWDRTVKVWNLSN-------CKLRSTLAGHTGYV  572
            G G N WV+ +  + S   P  +V+ S D++V VW L++          R  L GH+ +V
Sbjct  13   GHGKN-WVTAI--ATSRENPNLVVTSSRDKSVLVWQLTHDADPDNYGYARRRLTGHSHFV  69

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATE  398
              V +S DG    SG  DG + LWDL  G   + +   +  ++     + NR  +  + +
Sbjct  70   EDVVISSDGQFALSGSWDGTLRLWDLNTGITTRRFVGHSKDVLSVAFSADNRQIVSGSRD  129

Query  397  ASIKIWD  377
             SIK+W+
Sbjct  130  RSIKLWN  136



>ref|XP_010926201.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Elaeis guineensis]
Length=299

 Score =   251 bits (640),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 118/160 (74%), Positives = 133/160 (83%), Gaps = 12/160 (8%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTIQD D H  WVSCVRFSP+T QPTIVSGSWDRTVKVWNL++CKLRSTL GH GYV
Sbjct  151  ECKYTIQDADAHTNWVSCVRFSPNTSQPTIVSGSWDRTVKVWNLTSCKLRSTLTGHGGYV  210

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            N VAVSPDGSLCASGGKDGV LLWDLAEG++LYSLDAG+IIH LCFSP+RYWLCAAT+ S
Sbjct  211  NAVAVSPDGSLCASGGKDGVALLWDLAEGRRLYSLDAGAIIHGLCFSPSRYWLCAATQDS  270

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIF  272
            +KIWDLESKSIV DLR ++              +KN+++F
Sbjct  271  VKIWDLESKSIVQDLRPEMP------------TSKNQVLF  298


 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 51/200 (26%), Positives = 82/200 (41%), Gaps = 41/200 (21%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-------------------RS  599
            GH++ V+ +  +P      IVS S D++V VW+L+                       R 
Sbjct  13   GHSDVVTAIA-TPLDNSDMIVSSSRDKSVLVWHLTKASPVAVAGDSSATSAVPSYGVPRR  71

Query  598  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPN  425
             L GH+ +V  V +S DG    SG  DG + LWDLA G   + +   +  ++  +    N
Sbjct  72   RLTGHSHFVEDVVLSSDGQFALSGSWDGELRLWDLATGTTTRRFVGHSKDVLSVVLSVDN  131

Query  424  RYWLCAATEASIKIWDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWN  251
            R  + A+ + +IK+W+   E K  + D                   A    + C   S N
Sbjct  132  RQIVSASRDRTIKLWNTLGECKYTIQD-----------------ADAHTNWVSCVRFSPN  174

Query  250  ADGSTLFSGYTDGVIRVWGI  191
                T+ SG  D  ++VW +
Sbjct  175  TSQPTIVSGSWDRTVKVWNL  194



>gb|ETM44908.1| guanine nucleotide-binding protein subunit beta-like protein, 
partial [Phytophthora parasitica]
Length=334

 Score =   252 bits (643),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 122/188 (65%), Positives = 144/188 (77%), Gaps = 10/188 (5%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTI + DGH EWVSCVRFSPST  P IVS  WD+ VK+WNLSNCKLR+ L GH GY+
Sbjct  156  ECKYTITE-DGHTEWVSCVRFSPSTANPLIVSCGWDKVVKIWNLSNCKLRTNLFGHEGYL  214

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTV VSPDGS+CASGGKDG   LWDL EGK+LYSL AG +IHAL FSPNRYWLCAAT + 
Sbjct  215  NTVTVSPDGSICASGGKDGTANLWDLNEGKRLYSLVAGDVIHALIFSPNRYWLCAATTSG  274

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            IKIWDLESK +V DL+ ++++     A+  +         C SL+W+ADGS LFSGYTDG
Sbjct  275  IKIWDLESKIVVHDLQPEIEEPKGKYAQPPH---------CISLAWSADGSVLFSGYTDG  325

Query  211  VIRVWGIG  188
            ++RVW +G
Sbjct  326  IVRVWAVG  333


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 38/133 (29%), Positives = 63/133 (47%), Gaps = 15/133 (11%)
 Frame = -1

Query  742  YTIQDGDGHN----EWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLA  590
            Y   + DGHN      ++  R +P+ L    ++ S D+++ VW LSN        R  L 
Sbjct  24   YPRAELDGHNGKAVTAIATTRENPNLL----LTASRDKSLLVWQLSNDGEEYGFARRRLQ  79

Query  589  GHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYW  416
            GH+ YV  V +S DG    SG  DG + LWDL  G   + +      ++     + NR  
Sbjct  80   GHSHYVEDVVISSDGQFALSGSWDGTLRLWDLNTGITTRRFVGHTKDVLSVAFSADNRQI  139

Query  415  LCAATEASIKIWD  377
            +  + + ++K+W+
Sbjct  140  VSGSRDKTVKLWN  152


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 55/202 (27%), Positives = 87/202 (43%), Gaps = 30/202 (15%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  542
            GH+ +V  V  S        +SGSWD T+++W+L+         GHT  V +VA S D  
Sbjct  80   GHSHYVEDVVISSD--GQFALSGSWDGTLRLWDLNTGITTRRFVGHTKDVLSVAFSADNR  137

Query  541  LCASGGKDGVILLWD-LAEGKKLYSLDAGSI-IHALCFSP---NRYWLCAATEASIKIWD  377
               SG +D  + LW+ L E K   + D  +  +  + FSP   N   +    +  +KIW+
Sbjct  138  QIVSGSRDKTVKLWNTLGECKYTITEDGHTEWVSCVRFSPSTANPLIVSCGWDKVVKIWN  197

Query  376  LESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVW  197
            L +      LR +L        EG          +  +++ + DGS   SG  DG   +W
Sbjct  198  LSN----CKLRTNL-----FGHEG----------YLNTVTVSPDGSICASGGKDGTANLW  238

Query  196  GIGRY*MEEFRRSHMIIGHVCY  131
             +     E  R   ++ G V +
Sbjct  239  DLN----EGKRLYSLVAGDVIH  256



>ref|XP_009531042.1| hypothetical protein PHYSODRAFT_355000 [Phytophthora sojae]
 gb|EGZ13613.1| hypothetical protein PHYSODRAFT_355000 [Phytophthora sojae]
Length=317

 Score =   251 bits (640),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 121/188 (64%), Positives = 144/188 (77%), Gaps = 10/188 (5%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTI + DGH EWVSCVRFSPST  P IVS  WD+ VK+WNLSNCKLR+ L GH GY+
Sbjct  139  ECKYTITE-DGHTEWVSCVRFSPSTANPLIVSCGWDKVVKIWNLSNCKLRTNLFGHEGYL  197

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTV VSPDGS+CASGGKDG   LWDL EGK+LYSL AG +IHAL FSPNRYWLCAAT + 
Sbjct  198  NTVTVSPDGSICASGGKDGTANLWDLNEGKRLYSLVAGDVIHALVFSPNRYWLCAATTSG  257

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            IKIWDLESK +V DL+ ++++     A+  +         C SL+W+ADG+ LFSGYTDG
Sbjct  258  IKIWDLESKIVVHDLQPEVEEPKGKYAQPPH---------CISLAWSADGTVLFSGYTDG  308

Query  211  VIRVWGIG  188
            ++RVW +G
Sbjct  309  IVRVWAVG  316


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 38/133 (29%), Positives = 63/133 (47%), Gaps = 15/133 (11%)
 Frame = -1

Query  742  YTIQDGDGHN----EWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSN-----CKLRSTLA  590
            Y   + DGHN      ++  R +P+ L    ++ S D+++ VW LSN        R  L 
Sbjct  7    YPRAELDGHNGKAVTALATTRENPNLL----LTASRDKSLLVWQLSNDGEEYGFARRRLQ  62

Query  589  GHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYW  416
            GH+ YV  V +S DG    SG  DG + LWDL  G   + +      ++     + NR  
Sbjct  63   GHSHYVEDVVISSDGQFALSGSWDGTLRLWDLNTGITTRRFVGHTKDVLSVAFSADNRQI  122

Query  415  LCAATEASIKIWD  377
            +  + + ++K+W+
Sbjct  123  VSGSRDKTVKLWN  135


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 55/202 (27%), Positives = 87/202 (43%), Gaps = 30/202 (15%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  542
            GH+ +V  V  S        +SGSWD T+++W+L+         GHT  V +VA S D  
Sbjct  63   GHSHYVEDVVISSD--GQFALSGSWDGTLRLWDLNTGITTRRFVGHTKDVLSVAFSADNR  120

Query  541  LCASGGKDGVILLWD-LAEGKKLYSLDAGSI-IHALCFSP---NRYWLCAATEASIKIWD  377
               SG +D  + LW+ L E K   + D  +  +  + FSP   N   +    +  +KIW+
Sbjct  121  QIVSGSRDKTVKLWNTLGECKYTITEDGHTEWVSCVRFSPSTANPLIVSCGWDKVVKIWN  180

Query  376  LESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVW  197
            L +      LR +L        EG          +  +++ + DGS   SG  DG   +W
Sbjct  181  LSN----CKLRTNL-----FGHEG----------YLNTVTVSPDGSICASGGKDGTANLW  221

Query  196  GIGRY*MEEFRRSHMIIGHVCY  131
             +     E  R   ++ G V +
Sbjct  222  DLN----EGKRLYSLVAGDVIH  239



>gb|KDO19117.1| guanine nucleotide-binding protein subunit beta-2-like 1 [Saprolegnia 
parasitica CBS 223.65]
Length=326

 Score =   250 bits (639),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 123/188 (65%), Positives = 145/188 (77%), Gaps = 11/188 (6%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTI + +GH EWVSCVRFSPS+  P IVS  WDR VKVWNL+NCKLR+ L GHTGY+
Sbjct  148  ECKYTITE-EGHTEWVSCVRFSPSSANPLIVSCGWDRLVKVWNLTNCKLRTNLCGHTGYL  206

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTV VSPDGSLCASGGKDGV +LWDL EGK+LY+L+AG IIHAL FSPNRYWLCAAT + 
Sbjct  207  NTVTVSPDGSLCASGGKDGVAMLWDLNEGKRLYTLEAGDIIHALVFSPNRYWLCAATSSG  266

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            IKIWDLESK +VVD         E+  E      K+    C SL W+ADG++LF+GYTDG
Sbjct  267  IKIWDLESK-VVVD---------EIVPEFEAVGKKSLPPHCVSLCWSADGASLFAGYTDG  316

Query  211  VIRVWGIG  188
            ++RV+ +G
Sbjct  317  IVRVYAVG  324


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 62/129 (48%), Gaps = 18/129 (14%)
 Frame = -1

Query  721  GHNE-WVSCV---RFSPSTLQPTIVSGSWDRTVKVWNLSNCK--------LRSTLAGHTG  578
            GH + WV+ +   R +PS     IV+ S D+++ VW L+            R  L GH+ 
Sbjct  20   GHGKAWVTAIATSRENPSM----IVTASRDKSILVWQLTGDSSDLENYGFARRRLQGHSH  75

Query  577  YVNTVAVSPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAA  404
            +V  V +S DG    SG  DG + LWDL  G   + +   +  ++     + NR  +  +
Sbjct  76   FVEDVVISSDGQFALSGSWDGTLRLWDLNTGITTRRFVGHSKDVLSVAFSADNRQIVSGS  135

Query  403  TEASIKIWD  377
             + SIK+W+
Sbjct  136  RDRSIKLWN  144



>ref|XP_008608530.1| guanine nucleotide-binding protein subunit beta-2-like 1 [Saprolegnia 
diclina VS20]
 gb|EQC38203.1| guanine nucleotide-binding protein subunit beta-2-like 1 [Saprolegnia 
diclina VS20]
Length=319

 Score =   250 bits (638),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 123/188 (65%), Positives = 145/188 (77%), Gaps = 11/188 (6%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTI + +GH EWVSCVRFSPS+  P IVS  WDR VKVWNL+NCKLR+ L GHTGY+
Sbjct  141  ECKYTITE-EGHTEWVSCVRFSPSSANPLIVSCGWDRLVKVWNLTNCKLRTNLCGHTGYL  199

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTV VSPDGSLCASGGKDGV +LWDL EGK+LY+L+AG IIHAL FSPNRYWLCAAT + 
Sbjct  200  NTVTVSPDGSLCASGGKDGVAMLWDLNEGKRLYTLEAGDIIHALVFSPNRYWLCAATSSG  259

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            IKIWDLESK +VVD         E+  E      K+    C SL W+ADG++LF+GYTDG
Sbjct  260  IKIWDLESK-VVVD---------EIVPEFEAVGKKSLPPHCVSLCWSADGASLFAGYTDG  309

Query  211  VIRVWGIG  188
            ++RV+ +G
Sbjct  310  IVRVYAVG  317


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 62/129 (48%), Gaps = 18/129 (14%)
 Frame = -1

Query  721  GHNE-WVSCV---RFSPSTLQPTIVSGSWDRTVKVWNLSNCK--------LRSTLAGHTG  578
            GH + WV+ +   R +PS     IV+ S D+++ VW L+            R  L GH+ 
Sbjct  13   GHGKAWVTAIATSRENPSM----IVTASRDKSILVWQLTGDSSDLENYGFARRRLQGHSH  68

Query  577  YVNTVAVSPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAA  404
            +V  V +S DG    SG  DG + LWDL  G   + +   +  ++     + NR  +  +
Sbjct  69   FVEDVVISSDGQFALSGSWDGTLRLWDLNTGITTRRFVGHSKDVLSVAFSADNRQIVSGS  128

Query  403  TEASIKIWD  377
             + SIK+W+
Sbjct  129  RDRSIKLWN  137



>ref|XP_004343796.1| guanine nucleotide-binding protein [Capsaspora owczarzaki ATCC 
30864]
 gb|KJE96804.1| guanine nucleotide-binding protein [Capsaspora owczarzaki ATCC 
30864]
Length=316

 Score =   249 bits (636),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 124/190 (65%), Positives = 146/190 (77%), Gaps = 11/190 (6%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECK+ IQ+ DGH+EWVS VRFSP+T  P IVS  WDR VKVWNL+NCKLR+   GHTGYV
Sbjct  137  ECKFVIQE-DGHSEWVSSVRFSPNTSNPNIVSVGWDRVVKVWNLNNCKLRTNHYGHTGYV  195

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTV VSPDGSLCASGGKDGV +LWDL EGK LY+L+AG  I+AL FSPNRYWLCAA+ AS
Sbjct  196  NTVTVSPDGSLCASGGKDGVAMLWDLNEGKHLYTLEAGDEINALVFSPNRYWLCAASGAS  255

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            IKIWDLESK++V DLR           E  +   K+++  C SL+W+ADG TLF+GYTD 
Sbjct  256  IKIWDLESKNLVDDLR----------PEFLSVGKKSQLPQCISLAWSADGQTLFAGYTDN  305

Query  211  VIRVWGIGRY  182
            VIRVW + R+
Sbjct  306  VIRVWQVTRH  315


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 61/122 (50%), Gaps = 8/122 (7%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  557
            GH+ WV+ +  +P  +   +VS S D+++ +WNL+  +      +  L GH  +V+ V +
Sbjct  13   GHSGWVTQIATTPE-VPDLLVSASRDKSLIIWNLTRDETNYGVPKRRLQGHNHFVSDVVI  71

Query  556  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  383
            S DG    SG  D  + LWDL  G   + +      ++     + NR  +  + + SI++
Sbjct  72   SSDGQFALSGSWDHTLRLWDLNSGVTTRRFVGHTSDVLSVAFSADNRQIVSGSRDKSIRL  131

Query  382  WD  377
            W+
Sbjct  132  WN  133


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 51/182 (28%), Positives = 80/182 (44%), Gaps = 26/182 (14%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  542
            GHN +VS V  S        +SGSWD T+++W+L++        GHT  V +VA S D  
Sbjct  61   GHNHFVSDVVISSDG--QFALSGSWDHTLRLWDLNSGVTTRRFVGHTSDVLSVAFSADNR  118

Query  541  LCASGGKDGVILLWD-LAEGKKLYSLDAGSI-IHALCFSPNR---YWLCAATEASIKIWD  377
               SG +D  I LW+ L E K +   D  S  + ++ FSPN      +    +  +K+W+
Sbjct  119  QIVSGSRDKSIRLWNTLGECKFVIQEDGHSEWVSSVRFSPNTSNPNIVSVGWDRVVKVWN  178

Query  376  LESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVW  197
            L +  +                    T       +  +++ + DGS   SG  DGV  +W
Sbjct  179  LNNCKL-------------------RTNHYGHTGYVNTVTVSPDGSLCASGGKDGVAMLW  219

Query  196  GI  191
             +
Sbjct  220  DL  221



>gb|ACQ83470.1| receptor of activated protein kinase C [Platynereis dumerilii]
Length=318

 Score =   248 bits (632),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 120/186 (65%), Positives = 141/186 (76%), Gaps = 10/186 (5%)
 Frame = -1

Query  748  CKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVN  569
            CKYTIQ  DGH++WVSCVRFSP+T  P IVS  WD+TVKVWNL+NCKL++   GHTGY+N
Sbjct  138  CKYTIQQEDGHSDWVSCVRFSPNTQNPIIVSCGWDKTVKVWNLTNCKLKTNHIGHTGYLN  197

Query  568  TVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASI  389
             V VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II++LCFSPNRYWLCAAT  SI
Sbjct  198  VVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINSLCFSPNRYWLCAATGPSI  257

Query  388  KIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            KIWDLE K +V +LR           E  +T+ K +   C SL+W+ADG TLF+GYTD V
Sbjct  258  KIWDLEGKVVVDELR----------PEVISTSPKAQPPQCISLAWSADGQTLFAGYTDNV  307

Query  208  IRVWGI  191
            IRVW +
Sbjct  308  IRVWQV  313


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 50/206 (24%), Positives = 88/206 (43%), Gaps = 28/206 (14%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  557
            GH  WV+ +  +P      I+S S D+++ +W L+  +      +  L GH  +V+ V +
Sbjct  13   GHGNWVTQIATTPQ-YPDMILSASRDKSLIMWKLTRDETNYGIPQKALRGHGHFVSDVVM  71

Query  556  SPDGSLCASGGKDGVILLWDLAEGKKLYSL--DAGSIIHALCFSPNRYWLCAATEASIKI  383
            S DG    SG  DG + LWDL+ G    +       ++     + NR  +  + + SIK+
Sbjct  72   SSDGQFALSGSWDGTLRLWDLSAGTTTRNFVGHTKDVLSVAFSADNRQIVSGSRDKSIKL  131

Query  382  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  203
            W+      +   +  ++QE   S            + C   S N     + S   D  ++
Sbjct  132  WN-----TLGVCKYTIQQEDGHS----------DWVSCVRFSPNTQNPIIVSCGWDKTVK  176

Query  202  VWGIGRY*MEEFRRSHMIIGHVCYLS  125
            VW +      + + +H  IGH  YL+
Sbjct  177  VWNLTNC---KLKTNH--IGHTGYLN  197



>emb|CCI48432.1| unnamed protein product [Albugo candida]
Length=318

 Score =   247 bits (631),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 119/188 (63%), Positives = 144/188 (77%), Gaps = 10/188 (5%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTI + +GH+EWVSCVRFSPS+  P IVS  WD+ VK+WNL+NCKL + L GHTGY+
Sbjct  140  ECKYTITE-NGHSEWVSCVRFSPSSSNPLIVSCGWDKAVKIWNLTNCKLHTNLLGHTGYL  198

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            N+V VSPDGS+CASGGKDG   LWDL EGK+LYSL AG +IHAL FSPNRYWLCAAT + 
Sbjct  199  NSVTVSPDGSICASGGKDGTANLWDLNEGKRLYSLVAGDVIHALVFSPNRYWLCAATSSG  258

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            IKIWDLESK++V +L  DL+      A         ++  C SL+W+ADGS LFSGYTDG
Sbjct  259  IKIWDLESKAVVHELNPDLEPPKGKYA---------RVPHCVSLAWSADGSILFSGYTDG  309

Query  211  VIRVWGIG  188
            ++RVW +G
Sbjct  310  IVRVWAVG  317


 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 64/133 (48%), Gaps = 15/133 (11%)
 Frame = -1

Query  742  YTIQDGDGHN----EWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLS----NCKL-RSTLA  590
            Y   + DGHN      ++  R +P+ L    ++ S D++V VW L+    NC   R  L 
Sbjct  8    YLRGELDGHNGKCVSSIATSRENPNML----LTASHDKSVLVWQLTSDGENCGFPRRRLL  63

Query  589  GHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGK--KLYSLDAGSIIHALCFSPNRYW  416
            GH  YV  V +S DG    SG  D  + LWDL  G   + +   +  ++     + NR  
Sbjct  64   GHAHYVQDVVISSDGQFALSGSWDSTLRLWDLNTGNTTRRFVGHSKDVLSVAFSADNRQI  123

Query  415  LCAATEASIKIWD  377
            + A+ + +IK+W+
Sbjct  124  VSASRDKTIKLWN  136



>emb|CCA26420.1| guanine nucleotidebinding protein subunit beta2like protein putative 
[Albugo laibachii Nc14]
Length=318

 Score =   247 bits (631),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 119/188 (63%), Positives = 144/188 (77%), Gaps = 10/188 (5%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTI + +GH+EWVSCVRFSPS+  P IVS  WD+ VK+WNL+NCKL + L GHTGY+
Sbjct  140  ECKYTITE-NGHSEWVSCVRFSPSSSNPLIVSCGWDKAVKIWNLTNCKLHTNLLGHTGYL  198

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            N+V VSPDGS+CASGGKDG   LWDL EGK+LYSL AG +IHAL FSPNRYWLCAAT + 
Sbjct  199  NSVTVSPDGSICASGGKDGTANLWDLNEGKRLYSLVAGDVIHALVFSPNRYWLCAATSSG  258

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            IKIWDLESK++V +L  DL+      A         ++  C SL+W+ADGS LFSGYTDG
Sbjct  259  IKIWDLESKAVVHELNPDLEPPKGKYA---------RVPHCVSLAWSADGSILFSGYTDG  309

Query  211  VIRVWGIG  188
            ++RVW +G
Sbjct  310  IVRVWAVG  317


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 40/131 (31%), Positives = 62/131 (47%), Gaps = 11/131 (8%)
 Frame = -1

Query  742  YTIQDGDGHNEWVSCVR-FSPSTLQPTIV-SGSWDRTVKVWNLSN----CKL-RSTLAGH  584
            Y   + DGHN    CV   + S   P ++ + S D++V VW L++    C   R  L GH
Sbjct  8    YLRGELDGHNG--KCVSSIATSRENPNLLLTASHDKSVLVWQLTSDGESCGFPRRRLLGH  65

Query  583  TGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGK--KLYSLDAGSIIHALCFSPNRYWLC  410
              YV  V +S DG    SG  D  + LWDL  G   + +      ++     + NR  + 
Sbjct  66   AHYVQDVVISSDGQFALSGSWDSTLRLWDLNTGNTTRRFVGHTKDVLSVAFSADNRQIVS  125

Query  409  AATEASIKIWD  377
            A+ + +IK+W+
Sbjct  126  ASRDKTIKLWN  136



>ref|XP_009037831.1| hypothetical protein AURANDRAFT_37768 [Aureococcus anophagefferens]
 gb|EGB07194.1| hypothetical protein AURANDRAFT_37768 [Aureococcus anophagefferens]
Length=319

 Score =   247 bits (631),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 120/188 (64%), Positives = 140/188 (74%), Gaps = 11/188 (6%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTI D +GH EWVSCVRFSPS   P IVS  WD+ VKVW+L+NCKLR+ L GH GY+
Sbjct  142  ECKYTISD-EGHTEWVSCVRFSPSVQAPVIVSCGWDKLVKVWSLTNCKLRTNLYGHNGYL  200

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTV VSPDGSLCASGGKDG  +LWDL EGK+LYSLDAG +IH+L FSPNRYWLCAAT   
Sbjct  201  NTVTVSPDGSLCASGGKDGTAMLWDLNEGKRLYSLDAGDVIHSLVFSPNRYWLCAATTLG  260

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            +KIWDLESK +V +L+       E  A G N        +CT + W+ADG+ LFSGYTDG
Sbjct  261  VKIWDLESKVVVDELK------PEFPAMGKNATPP----YCTCICWSADGAVLFSGYTDG  310

Query  211  VIRVWGIG  188
            +IR W +G
Sbjct  311  LIRAWHVG  318


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 63/127 (50%), Gaps = 13/127 (10%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNC----------KLRSTLAGHTGYV  572
            GH++WV+ +  + S     I+S S D+TV +W L+              R  L GH+ +V
Sbjct  13   GHSDWVTSIA-TTSEDPSMILSSSRDKTVLLWALTAGGGSAEGEAYGYPRRALKGHSHFV  71

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGK--KLYSLDAGSIIHALCFSPNRYWLCAATE  398
            + V +S DG    SG  DG + LW+LA GK  + +      ++     + NR  +  + +
Sbjct  72   SDVVISSDGQFALSGSWDGTLRLWELATGKTTRRFVGHTKDVLSVAFSTDNRQIVSGSRD  131

Query  397  ASIKIWD  377
             ++K+W+
Sbjct  132  KTVKLWN  138



>gb|ETI45096.1| guanine nucleotide-binding protein subunit beta-like protein 
[Phytophthora parasitica P1569]
Length=431

 Score =   250 bits (639),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 142/186 (76%), Gaps = 10/186 (5%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTI + DGH EWVSCVRFSPST  P IVS  WD+ VK+WNLSNCKLR+ L GH GY+
Sbjct  139  ECKYTITE-DGHTEWVSCVRFSPSTANPLIVSCGWDKVVKIWNLSNCKLRTNLFGHEGYL  197

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTV VSPDGS+CASGGKDG   LWDL EGK+LYSL AG +IHAL FSPNRYWLCAAT + 
Sbjct  198  NTVTVSPDGSICASGGKDGTANLWDLNEGKRLYSLVAGDVIHALIFSPNRYWLCAATTSG  257

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            IKIWDLESK +V DL+ ++++     A+  +         C SL+W+ADGS LFSGYTDG
Sbjct  258  IKIWDLESKIVVHDLQPEIEEPKGKYAQPPH---------CISLAWSADGSVLFSGYTDG  308

Query  211  VIRVWG  194
            ++RVW 
Sbjct  309  IVRVWA  314


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/133 (29%), Positives = 63/133 (47%), Gaps = 15/133 (11%)
 Frame = -1

Query  742  YTIQDGDGHN----EWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLA  590
            Y   + DGHN      ++  R +P+ L    ++ S D+++ VW LSN        R  L 
Sbjct  7    YPRAELDGHNGKAVTAIATTRENPNLL----LTASRDKSLLVWQLSNDGEEYGFARRRLQ  62

Query  589  GHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYW  416
            GH+ YV  V +S DG    SG  DG + LWDL  G   + +      ++     + NR  
Sbjct  63   GHSHYVEDVVISSDGQFALSGSWDGTLRLWDLNTGITTRRFVGHTKDVLSVAFSADNRQI  122

Query  415  LCAATEASIKIWD  377
            +  + + ++K+W+
Sbjct  123  VSGSRDKTVKLWN  135


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 51/182 (28%), Positives = 80/182 (44%), Gaps = 26/182 (14%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  542
            GH+ +V  V  S        +SGSWD T+++W+L+         GHT  V +VA S D  
Sbjct  63   GHSHYVEDVVISSD--GQFALSGSWDGTLRLWDLNTGITTRRFVGHTKDVLSVAFSADNR  120

Query  541  LCASGGKDGVILLWD-LAEGKKLYSLDAGSI-IHALCFSP---NRYWLCAATEASIKIWD  377
               SG +D  + LW+ L E K   + D  +  +  + FSP   N   +    +  +KIW+
Sbjct  121  QIVSGSRDKTVKLWNTLGECKYTITEDGHTEWVSCVRFSPSTANPLIVSCGWDKVVKIWN  180

Query  376  LESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVW  197
            L +      LR +L        EG          +  +++ + DGS   SG  DG   +W
Sbjct  181  LSN----CKLRTNL-----FGHEG----------YLNTVTVSPDGSICASGGKDGTANLW  221

Query  196  GI  191
             +
Sbjct  222  DL  223



>emb|CEG76293.1| Putative Guanine nucleotide-binding protein subunit beta-2-like 
1 [Rhizopus microsporus]
Length=278

 Score =   245 bits (625),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 117/189 (62%), Positives = 140/189 (74%), Gaps = 10/189 (5%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKY I + DGH EWVSCVRFSP+   P IVSG WD+ VKVW+L+  KLR+   GH GYV
Sbjct  98   ECKYNITE-DGHTEWVSCVRFSPNPATPLIVSGGWDKLVKVWDLTKLKLRTNFIGHNGYV  156

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTV +SPDGSLCAS GKDGV++LWDL + K LYSLDAGS++HAL FSPNRYWLCAAT   
Sbjct  157  NTVTISPDGSLCASAGKDGVVMLWDLNDAKHLYSLDAGSVVHALTFSPNRYWLCAATANG  216

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            IKIWDLE+KSIV +LR +  Q  +          KN    C S++W+ADG+TLFSGY+D 
Sbjct  217  IKIWDLETKSIVDELRPEFAQLGKR---------KNPDPECLSVAWSADGATLFSGYSDN  267

Query  211  VIRVWGIGR  185
            +IRVW + R
Sbjct  268  IIRVWQVTR  276



>ref|XP_002286095.1| guanine nucleotide binding protein beta subunit-like protein 
[Thalassiosira pseudonana CCMP1335]
 gb|EED95736.1| guanine nucleotide binding protein beta subunit-like protein 
[Thalassiosira pseudonana CCMP1335]
Length=326

 Score =   246 bits (629),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 125/186 (67%), Positives = 143/186 (77%), Gaps = 6/186 (3%)
 Frame = -1

Query  751  ECKYTI-QDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  575
            ECKYTI  D  GH+EWVSCVRFSPS   P IVS  WDR VKVW L+NCKLR+ L GHTGY
Sbjct  141  ECKYTIGTDAQGHSEWVSCVRFSPSQSVPLIVSCGWDRLVKVWALTNCKLRNDLIGHTGY  200

Query  574  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  395
            +NTV VSPDGSLCASGGKDG  +LWDL EGK+LYSLDAG IIH+L FSPNRYWLCAAT+ 
Sbjct  201  LNTVCVSPDGSLCASGGKDGTAMLWDLNEGKRLYSLDAGEIIHSLVFSPNRYWLCAATDE  260

Query  394  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  215
             IKIWDLESK +V  LR    +E ++  E     A+     CTSL+W+ADGSTLF+GY+D
Sbjct  261  CIKIWDLESKVVVDTLR---PEEFDLGNEEGTGHARAP--HCTSLAWSADGSTLFAGYSD  315

Query  214  GVIRVW  197
             VIRV+
Sbjct  316  KVIRVY  321


 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 51/213 (24%), Positives = 94/213 (44%), Gaps = 37/213 (17%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPT-IVSGSWDRTVKVWNLSNCKL---------RSTLAGHTGYV  572
            GH +WV+ +  + ++  P  I+S S D++V VW L++            +  L GH+ +V
Sbjct  13   GHRDWVTSI--ATTSEDPNLILSASRDKSVMVWRLTHSNTGEDDSYGYAQRALRGHSHFV  70

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATE  398
            + V +S DG    SG  DG + LW++  G+        S  + ++ FS  NR  +  + +
Sbjct  71   SDVVISSDGQFALSGSWDGTLRLWEINSGRTTRRFVGHSKDVLSVAFSVDNRQIVSGSRD  130

Query  397  ASIKIWDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSG  224
             SIK+W+   E K  +                G +    ++ + C   S +     + S 
Sbjct  131  KSIKLWNTLGECKYTI----------------GTDAQGHSEWVSCVRFSPSQSVPLIVSC  174

Query  223  YTDGVIRVWGIGRY*MEEFRRSHMIIGHVCYLS  125
              D +++VW      +   +  + +IGH  YL+
Sbjct  175  GWDRLVKVWA-----LTNCKLRNDLIGHTGYLN  202



>ref|XP_005795376.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1-like [Xiphophorus maculatus]
Length=317

 Score =   246 bits (627),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 122/186 (66%), Positives = 143/186 (77%), Gaps = 11/186 (6%)
 Frame = -1

Query  748  CKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVN  569
            CKYTIQD +GH EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++   GHTGY+N
Sbjct  138  CKYTIQD-EGHTEWVSCVRFSPNSSNPIIVSCGWDKMVKVWNLANCKLKTNHIGHTGYLN  196

Query  568  TVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASI  389
            TV VSPDGSLCASGGKDG  +LWDL EGK LY+LD+G II+ALCFSPNRYWLCAAT  SI
Sbjct  197  TVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDSGDIINALCFSPNRYWLCAATGPSI  256

Query  388  KIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            KIWDLE K IV +LR           E  +T +K +   CTSL+W+ADG TLF+GYTD +
Sbjct  257  KIWDLEGKIIVDELR----------QEVISTNSKAEPPQCTSLAWSADGQTLFAGYTDNL  306

Query  208  IRVWGI  191
            IRVW +
Sbjct  307  IRVWQV  312


 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 48/206 (23%), Positives = 92/206 (45%), Gaps = 29/206 (14%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  557
            GH+ WV+ +  +P      I+S S D+++ +W L+  +      + +L GH+ +V+ V +
Sbjct  13   GHSGWVTQIATTPQ-YPDMILSASRDKSIIMWKLTRDETNYGIPQRSLRGHSHFVSDVVI  71

Query  556  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  383
            S DG    SG  DG + LWDL  G   + +      ++     + NR  +  + + +IK+
Sbjct  72   SSDGQFALSGAWDGTLRLWDLTTGATTRQFVGHNKDVLSVAFSADNRQIVSGSRDKTIKL  131

Query  382  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  203
            W+                +  +  EG+      + + C   S N+    + S   D +++
Sbjct  132  WNTLGVC-----------KYTIQDEGH-----TEWVSCVRFSPNSSNPIIVSCGWDKMVK  175

Query  202  VWGIGRY*MEEFRRSHMIIGHVCYLS  125
            VW +      + + +H  IGH  YL+
Sbjct  176  VWNLANC---KLKTNH--IGHTGYLN  196



>ref|XP_004696065.1| PREDICTED: LOW QUALITY PROTEIN: guanine nucleotide binding protein 
(G protein), beta polypeptide 2-like 1 [Condylura cristata]
Length=271

 Score =   243 bits (621),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 146/186 (78%), Gaps = 11/186 (6%)
 Frame = -1

Query  748  CKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVN  569
            CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++   GHTGY+N
Sbjct  92   CKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGYLN  150

Query  568  TVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASI  389
            TV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  SI
Sbjct  151  TVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSI  210

Query  388  KIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            KIWDLE K I+VD   +LKQE        +T++K +   CTSL+W+ADG TLF+GYTD +
Sbjct  211  KIWDLEGK-IIVD---ELKQEVI------STSSKAEPPQCTSLAWSADGQTLFAGYTDNL  260

Query  208  IRVWGI  191
            +RVW +
Sbjct  261  VRVWQV  266



>ref|XP_004073369.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 [Oryzias latipes]
Length=317

 Score =   245 bits (625),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 143/186 (77%), Gaps = 11/186 (6%)
 Frame = -1

Query  748  CKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVN  569
            CKYTIQD +GH EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++   GHTGY+N
Sbjct  138  CKYTIQD-EGHTEWVSCVRFSPNSSNPIIVSCGWDKMVKVWNLANCKLKTNHIGHTGYLN  196

Query  568  TVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASI  389
            TV VSPDGSLCASGGKDG  +LWDL EGK LY+LD+G +I+ALCFSPNRYWLCAAT  SI
Sbjct  197  TVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDSGDVINALCFSPNRYWLCAATGPSI  256

Query  388  KIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            KIWDLE K IV +LR           E  +T +K +   CTSL+W+ADG TLF+GYTD +
Sbjct  257  KIWDLEGKIIVDELR----------QEVISTNSKAEPPQCTSLAWSADGQTLFAGYTDNL  306

Query  208  IRVWGI  191
            IRVW +
Sbjct  307  IRVWQV  312


 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 48/206 (23%), Positives = 92/206 (45%), Gaps = 29/206 (14%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  557
            GH+ WV+ +  +P      I+S S D+++ +W L+  +      + +L GH+ +V+ V +
Sbjct  13   GHSGWVTQIATTPQ-YPDMILSASRDKSIIMWKLTRDETNYGIPQRSLKGHSHFVSDVVI  71

Query  556  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  383
            S DG    SG  DG + LWDL  G   + +      ++     + NR  +  + + +IK+
Sbjct  72   SSDGQFALSGAWDGTLRLWDLTTGLTTRQFVGHTKDVLSVAFSADNRQIVSGSRDKTIKL  131

Query  382  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  203
            W+                +  +  EG+      + + C   S N+    + S   D +++
Sbjct  132  WNTLGVC-----------KYTIQDEGH-----TEWVSCVRFSPNSSNPIIVSCGWDKMVK  175

Query  202  VWGIGRY*MEEFRRSHMIIGHVCYLS  125
            VW +      + + +H  IGH  YL+
Sbjct  176  VWNLANC---KLKTNH--IGHTGYLN  196



>ref|XP_004540947.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1-like [Maylandia zebra]
 ref|XP_005719882.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1-like [Pundamilia nyererei]
 ref|XP_005921230.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1-like [Haplochromis burtoni]
 ref|XP_006781554.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1-like [Neolamprologus brichardi]
 gb|AAQ91574.1| receptor for activated protein kinase C [Oreochromis mossambicus]
Length=317

 Score =   245 bits (625),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 143/186 (77%), Gaps = 11/186 (6%)
 Frame = -1

Query  748  CKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVN  569
            CKYTIQD +GH EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++   GHTGY+N
Sbjct  138  CKYTIQD-EGHTEWVSCVRFSPNSSNPIIVSCGWDKMVKVWNLANCKLKTNHIGHTGYLN  196

Query  568  TVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASI  389
            TV VSPDGSLCASGGKDG  +LWDL EGK LY+LD+G +I+ALCFSPNRYWLCAAT  SI
Sbjct  197  TVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDSGDVINALCFSPNRYWLCAATGPSI  256

Query  388  KIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            KIWDLE K IV +LR           E  +T +K +   CTSL+W+ADG TLF+GYTD +
Sbjct  257  KIWDLEGKIIVDELR----------QEVISTNSKAEPPQCTSLAWSADGQTLFAGYTDNL  306

Query  208  IRVWGI  191
            IRVW +
Sbjct  307  IRVWQV  312


 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 48/206 (23%), Positives = 92/206 (45%), Gaps = 29/206 (14%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  557
            GH+ WV+ +  +P      I+S S D+++ +W L+  +      + +L GH+ +V+ V +
Sbjct  13   GHSGWVTQIATTPQ-YPDMILSASRDKSIIMWKLTRDETNYGIPQRSLKGHSHFVSDVVI  71

Query  556  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  383
            S DG    SG  DG + LWDL  G   + +      ++     + NR  +  + + +IK+
Sbjct  72   SSDGQFALSGAWDGTLRLWDLTTGLTTRRFVGHTKDVLSVAFSADNRQIVSGSRDKTIKL  131

Query  382  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  203
            W+                +  +  EG+      + + C   S N+    + S   D +++
Sbjct  132  WNTLGVC-----------KYTIQDEGH-----TEWVSCVRFSPNSSNPIIVSCGWDKMVK  175

Query  202  VWGIGRY*MEEFRRSHMIIGHVCYLS  125
            VW +      + + +H  IGH  YL+
Sbjct  176  VWNLANC---KLKTNH--IGHTGYLN  196



>ref|NP_001266445.1| guanine nucleotide-binding protein subunit beta-2-like 1 [Oreochromis 
niloticus]
 sp|O42249.1|GBLP_ORENI RecName: Full=Guanine nucleotide-binding protein subunit beta-2-like 
1; AltName: Full=Receptor of activated protein kinase 
C; Short=RACK [Oreochromis niloticus]
 gb|AAB81618.1| receptor for activated protein kinase C [Oreochromis niloticus]
Length=317

 Score =   245 bits (625),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 143/186 (77%), Gaps = 11/186 (6%)
 Frame = -1

Query  748  CKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVN  569
            CKYTIQD +GH EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++   GHTGY+N
Sbjct  138  CKYTIQD-EGHTEWVSCVRFSPNSSNPIIVSCGWDKMVKVWNLANCKLKTNHIGHTGYLN  196

Query  568  TVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASI  389
            TV VSPDGSLCASGGKDG  +LWDL EGK LY+LD+G +I+ALCFSPNRYWLCAAT  SI
Sbjct  197  TVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDSGDVINALCFSPNRYWLCAATGPSI  256

Query  388  KIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            KIWDLE K IV +LR           E  +T +K +   CTSL+W+ADG TLF+GYTD +
Sbjct  257  KIWDLEGKIIVDELR----------QEVISTNSKAEPPQCTSLAWSADGQTLFAGYTDNL  306

Query  208  IRVWGI  191
            IRVW +
Sbjct  307  IRVWQV  312


 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 48/206 (23%), Positives = 92/206 (45%), Gaps = 29/206 (14%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  557
            GH+ WV+ +  +P      I+S S D+++ +W L+  +      + +L GH+ +V+ V +
Sbjct  13   GHSGWVTQIATTPK-YPDMILSASRDKSIIMWKLTRDETNYGIPQRSLKGHSHFVSDVVI  71

Query  556  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  383
            S DG    SG  DG + LWDL  G   + +      ++     + NR  +  + + +IK+
Sbjct  72   SSDGQFALSGAWDGTLRLWDLTTGLTTRRFVGHTKDVLSVAFSADNRQIVSGSRDKTIKL  131

Query  382  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  203
            W+                +  +  EG+      + + C   S N+    + S   D +++
Sbjct  132  WNTLGVC-----------KYTIQDEGH-----TEWVSCVRFSPNSSNPIIVSCGWDKMVK  175

Query  202  VWGIGRY*MEEFRRSHMIIGHVCYLS  125
            VW +      + + +H  IGH  YL+
Sbjct  176  VWNLANC---KLKTNH--IGHTGYLN  196



>gb|EDL33790.1| guanine nucleotide binding protein (G protein), beta polypeptide 
2 like 1, isoform CRA_a [Mus musculus]
 gb|EDM04194.1| rCG34190, isoform CRA_b [Rattus norvegicus]
Length=228

 Score =   241 bits (616),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 146/186 (78%), Gaps = 11/186 (6%)
 Frame = -1

Query  748  CKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVN  569
            CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++   GHTGY+N
Sbjct  49   CKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGYLN  107

Query  568  TVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASI  389
            TV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  SI
Sbjct  108  TVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSI  167

Query  388  KIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            KIWDLE K I+VD   +LKQE        +T++K +   CTSL+W+ADG TLF+GYTD +
Sbjct  168  KIWDLEGK-IIVD---ELKQEVI------STSSKAEPPQCTSLAWSADGQTLFAGYTDNL  217

Query  208  IRVWGI  191
            +RVW +
Sbjct  218  VRVWQV  223



>gb|KFM07186.1| Guanine nucleotide-binding protein subunit beta-2-like 1, partial 
[Aptenodytes forsteri]
 gb|KFW05064.1| Guanine nucleotide-binding protein subunit beta-2-like 1, partial 
[Fulmarus glacialis]
Length=224

 Score =   241 bits (616),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 119/186 (64%), Positives = 144/186 (77%), Gaps = 11/186 (6%)
 Frame = -1

Query  748  CKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVN  569
            CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++   GHTGY+N
Sbjct  45   CKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGYLN  103

Query  568  TVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASI  389
            TV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  SI
Sbjct  104  TVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSI  163

Query  388  KIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            KIWDLE K I+VD         E+  E  +T++K +   CTSL+W+ADG TLF+GYTD +
Sbjct  164  KIWDLEGK-IIVD---------ELKQEVISTSSKAEPPQCTSLAWSADGQTLFAGYTDNL  213

Query  208  IRVWGI  191
            +RVW +
Sbjct  214  VRVWQV  219



>ref|XP_007527211.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 isoform X2 [Erinaceus europaeus]
Length=271

 Score =   243 bits (620),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 146/186 (78%), Gaps = 11/186 (6%)
 Frame = -1

Query  748  CKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVN  569
            CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++   GHTGY+N
Sbjct  92   CKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGYLN  150

Query  568  TVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASI  389
            TV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  SI
Sbjct  151  TVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSI  210

Query  388  KIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            KIWDLE K I+VD   +LKQE        +T++K +   CTSL+W+ADG TLF+GYTD +
Sbjct  211  KIWDLEGK-IIVD---ELKQEVI------STSSKAEPPQCTSLAWSADGQTLFAGYTDNL  260

Query  208  IRVWGI  191
            +RVW +
Sbjct  261  VRVWQV  266



>gb|ERE68979.1| guanine nucleotide-binding protein subunit beta-2-like 1-like 
protein [Cricetulus griseus]
Length=235

 Score =   241 bits (616),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 119/186 (64%), Positives = 144/186 (77%), Gaps = 11/186 (6%)
 Frame = -1

Query  748  CKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVN  569
            CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++   GHTGY+N
Sbjct  56   CKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGYLN  114

Query  568  TVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASI  389
            TV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  SI
Sbjct  115  TVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSI  174

Query  388  KIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            KIWDLE K I+VD         E+  E  +T++K +   CTSL+W+ADG TLF+GYTD +
Sbjct  175  KIWDLEGK-IIVD---------ELKQEVISTSSKAEPPQCTSLAWSADGQTLFAGYTDNL  224

Query  208  IRVWGI  191
            +RVW +
Sbjct  225  VRVWQV  230



>gb|EIE78732.1| guanine nucleotide-binding protein subunit beta-2-like 1 [Rhizopus 
delemar RA 99-880]
Length=311

 Score =   244 bits (623),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 117/189 (62%), Positives = 141/189 (75%), Gaps = 10/189 (5%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKY I + DGH+EWVSCVRFSP+   P IVSG WD+ VKVW+L+  KLR+   GH GYV
Sbjct  131  ECKYNITE-DGHSEWVSCVRFSPNPANPLIVSGGWDKLVKVWDLTKLKLRTNFIGHNGYV  189

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTV +SPDGSLCAS GKDGV++LWDL + K LYSLDAGS++HAL FSPNRYWLCAAT   
Sbjct  190  NTVTISPDGSLCASAGKDGVVMLWDLNDAKHLYSLDAGSVVHALTFSPNRYWLCAATANG  249

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            IKIWDLE+KSIV +LR +  Q  +          KN    C S++W+ADG+TLFSGY+D 
Sbjct  250  IKIWDLETKSIVDELRPEFAQLGKR---------KNPDPECLSVAWSADGATLFSGYSDN  300

Query  211  VIRVWGIGR  185
            +IRVW + R
Sbjct  301  IIRVWQVTR  309


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 46/162 (28%), Positives = 74/162 (46%), Gaps = 24/162 (15%)
 Frame = -1

Query  661  VSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWD-LAEG  485
            +S SWD T+++W+L+N        GHT  V +V+ S D     SG +D  I LW+ L E 
Sbjct  73   LSASWDHTLRLWDLNNGTTTCRFVGHTNDVLSVSFSADNRQIVSGSRDKSIKLWNTLGEC  132

Query  484  KKLYSLDAGSI-IHALCFSP---NRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEM  317
            K   + D  S  +  + FSP   N   +    +  +K+WDL      + LR +       
Sbjct  133  KYNITEDGHSEWVSCVRFSPNPANPLIVSGGWDKLVKVWDLTK----LKLRTNFI-----  183

Query  316  SAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGI  191
               G+N        +  +++ + DGS   S   DGV+ +W +
Sbjct  184  ---GHNG-------YVNTVTISPDGSLCASAGKDGVVMLWDL  215


 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 41/187 (22%), Positives = 83/187 (44%), Gaps = 28/187 (15%)
 Frame = -1

Query  664  IVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAVSPDGSLCASGGKDGVILLW  500
            ++S S D+++ VW+L+  ++     R +L GH+ +V  +A+S DG    S   D  + LW
Sbjct  25   VLSASRDKSIIVWHLTRDEVNYGVPRKSLVGHSHFVEDLAISSDGQFALSASWDHTLRLW  84

Query  499  DLAEGKKL--YSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQE  326
            DL  G     +      ++     + NR  +  + + SIK+W+   +            +
Sbjct  85   DLNNGTTTCRFVGHTNDVLSVSFSADNRQIVSGSRDKSIKLWNTLGEC-----------K  133

Query  325  SEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY*MEEFRRSHMII  146
              ++ +G+     ++ + C   S N     + SG  D +++VW      + + +     I
Sbjct  134  YNITEDGH-----SEWVSCVRFSPNPANPLIVSGGWDKLVKVWD-----LTKLKLRTNFI  183

Query  145  GHVCYLS  125
            GH  Y++
Sbjct  184  GHNGYVN  190



>ref|XP_009277073.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 [Aptenodytes forsteri]
Length=240

 Score =   242 bits (617),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 146/186 (78%), Gaps = 11/186 (6%)
 Frame = -1

Query  748  CKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVN  569
            CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++   GHTGY+N
Sbjct  61   CKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGYLN  119

Query  568  TVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASI  389
            TV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  SI
Sbjct  120  TVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSI  179

Query  388  KIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            KIWDLE K I+VD   +LKQE        +T++K +   CTSL+W+ADG TLF+GYTD +
Sbjct  180  KIWDLEGK-IIVD---ELKQEVI------STSSKAEPPQCTSLAWSADGQTLFAGYTDNL  229

Query  208  IRVWGI  191
            +RVW +
Sbjct  230  VRVWQV  235



>ref|XP_002181732.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC46946.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=316

 Score =   244 bits (623),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 125/188 (66%), Positives = 142/188 (76%), Gaps = 14/188 (7%)
 Frame = -1

Query  751  ECKYTIQ-DGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  575
            ECKYTI  D +GH+EWVSCVRFSPS   P IVS  WDR VKVWNL+NCKLR+ L GHTGY
Sbjct  142  ECKYTISGDSEGHSEWVSCVRFSPSQSVPLIVSAGWDRLVKVWNLTNCKLRNDLVGHTGY  201

Query  574  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  395
            +NTV VSPDGSL ASGGKD   +LWDL EGK+LYSLDAG II+ L FSPNRYWLCAAT+ 
Sbjct  202  LNTVCVSPDGSLAASGGKDSTAMLWDLNEGKRLYSLDAGEIINGLVFSPNRYWLCAATDD  261

Query  394  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  215
            SIKIWDLESK +V  LR    +ESE            KI  CT L+W+ADGSTLF+G+TD
Sbjct  262  SIKIWDLESKIVVDTLR---PEESE----------SGKIPSCTCLAWSADGSTLFAGFTD  308

Query  214  GVIRVWGI  191
             VIRV+ +
Sbjct  309  NVIRVYAV  316


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 46/210 (22%), Positives = 94/210 (45%), Gaps = 31/210 (15%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK---------LRSTLAGHTGYVN  569
            GH +W++ +  +P      ++S S D++V  W+L++            R  L GH+ +V+
Sbjct  14   GHGDWITSLATTPEDPN-LLLSSSRDKSVIAWHLTHSSSGEDDSYGYARRALRGHSHFVS  72

Query  568  TVAVSPDGSLCASGGKDGVILLWDLAEGK--KLYSLDAGSIIHALCFSPNRYWLCAATEA  395
             V +S DG+   S   D  + LWD+A GK  + +      ++     + NR  +  + +A
Sbjct  73   DVVISSDGAFALSASWDSELRLWDIATGKTTRRFVGHEKDVLSVAFSADNRQIVSGSRDA  132

Query  394  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  215
            SI++W+      + + +  +  +SE  +E          + C   S +     + S   D
Sbjct  133  SIRLWN-----TLGECKYTISGDSEGHSE---------WVSCVRFSPSQSVPLIVSAGWD  178

Query  214  GVIRVWGIGRY*MEEFRRSHMIIGHVCYLS  125
             +++VW      +   +  + ++GH  YL+
Sbjct  179  RLVKVWN-----LTNCKLRNDLVGHTGYLN  203



>gb|ABY75292.1| putative guanine nucleotide binding protein beta polypeptide 
2-like 1 protein [Ovis aries]
Length=227

 Score =   241 bits (615),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 119/186 (64%), Positives = 144/186 (77%), Gaps = 11/186 (6%)
 Frame = -1

Query  748  CKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVN  569
            CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++   GHTGY+N
Sbjct  48   CKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGYLN  106

Query  568  TVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASI  389
            TV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  SI
Sbjct  107  TVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSI  166

Query  388  KIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            KIWDLE K I+VD         E+  E  +T++K +   CTSL+W+ADG TLF+GYTD +
Sbjct  167  KIWDLEGK-IIVD---------ELKQEVISTSSKAEPPQCTSLAWSADGQTLFAGYTDNL  216

Query  208  IRVWGI  191
            +RVW +
Sbjct  217  VRVWQV  222



>ref|XP_005891160.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 isoform X2 [Bos mutus]
Length=271

 Score =   243 bits (619),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 146/186 (78%), Gaps = 11/186 (6%)
 Frame = -1

Query  748  CKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVN  569
            CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++   GHTGY+N
Sbjct  92   CKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGYLN  150

Query  568  TVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASI  389
            TV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  SI
Sbjct  151  TVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSI  210

Query  388  KIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            KIWDLE K I+VD   +LKQE        +T++K +   CTSL+W+ADG TLF+GYTD +
Sbjct  211  KIWDLEGK-IIVD---ELKQEVI------STSSKAEPPQCTSLAWSADGQTLFAGYTDNL  260

Query  208  IRVWGI  191
            +RVW +
Sbjct  261  VRVWQV  266



>ref|XP_005977784.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1-like isoform X2 [Pantholops hodgsonii]
Length=271

 Score =   243 bits (619),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 146/186 (78%), Gaps = 11/186 (6%)
 Frame = -1

Query  748  CKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVN  569
            CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++   GHTGY+N
Sbjct  92   CKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGYLN  150

Query  568  TVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASI  389
            TV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  SI
Sbjct  151  TVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSI  210

Query  388  KIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            KIWDLE K I+VD   +LKQE        +T++K +   CTSL+W+ADG TLF+GYTD +
Sbjct  211  KIWDLEGK-IIVD---ELKQEVI------STSSKAEPPQCTSLAWSADGQTLFAGYTDNL  260

Query  208  IRVWGI  191
            +RVW +
Sbjct  261  VRVWQV  266



>ref|XP_009576203.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1, partial [Fulmarus glacialis]
Length=223

 Score =   241 bits (615),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 119/186 (64%), Positives = 144/186 (77%), Gaps = 11/186 (6%)
 Frame = -1

Query  748  CKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVN  569
            CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++   GHTGY+N
Sbjct  44   CKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGYLN  102

Query  568  TVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASI  389
            TV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  SI
Sbjct  103  TVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSI  162

Query  388  KIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            KIWDLE K I+VD         E+  E  +T++K +   CTSL+W+ADG TLF+GYTD +
Sbjct  163  KIWDLEGK-IIVD---------ELKQEVISTSSKAEPPQCTSLAWSADGQTLFAGYTDNL  212

Query  208  IRVWGI  191
            +RVW +
Sbjct  213  VRVWQV  218



>gb|AAR24619.1| proliferation-inducing gene 21 [Homo sapiens]
Length=271

 Score =   243 bits (619),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 146/186 (78%), Gaps = 11/186 (6%)
 Frame = -1

Query  748  CKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVN  569
            CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++   GHTGY+N
Sbjct  92   CKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGYLN  150

Query  568  TVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASI  389
            TV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  SI
Sbjct  151  TVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSI  210

Query  388  KIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            KIWDLE K I+VD   +LKQE        +T++K +   CTSL+W+ADG TLF+GYTD +
Sbjct  211  KIWDLEGK-IIVD---ELKQEVI------STSSKAEPPQCTSLAWSADGQTLFAGYTDNL  260

Query  208  IRVWGI  191
            +RVW +
Sbjct  261  VRVWQV  266



>gb|ELK03178.1| Guanine nucleotide-binding protein subunit beta-2-like 1 [Pteropus 
alecto]
Length=251

 Score =   242 bits (617),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 146/186 (78%), Gaps = 11/186 (6%)
 Frame = -1

Query  748  CKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVN  569
            CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++   GHTGY+N
Sbjct  72   CKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGYLN  130

Query  568  TVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASI  389
            TV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  SI
Sbjct  131  TVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSI  190

Query  388  KIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            KIWDLE K I+VD   +LKQE        +T++K +   CTSL+W+ADG TLF+GYTD +
Sbjct  191  KIWDLEGK-IIVD---ELKQEVI------STSSKAEPPQCTSLAWSADGQTLFAGYTDNL  240

Query  208  IRVWGI  191
            +RVW +
Sbjct  241  VRVWQV  246



>ref|XP_006746631.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 isoform X2 [Leptonychotes weddellii]
Length=271

 Score =   243 bits (619),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 146/186 (78%), Gaps = 11/186 (6%)
 Frame = -1

Query  748  CKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVN  569
            CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++   GHTGY+N
Sbjct  92   CKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGYLN  150

Query  568  TVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASI  389
            TV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  SI
Sbjct  151  TVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSI  210

Query  388  KIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            KIWDLE K I+VD   +LKQE        +T++K +   CTSL+W+ADG TLF+GYTD +
Sbjct  211  KIWDLEGK-IIVD---ELKQEVI------STSSKAEPPQCTSLAWSADGQTLFAGYTDNL  260

Query  208  IRVWGI  191
            +RVW +
Sbjct  261  VRVWQV  266



>gb|EPQ05298.1| Guanine nucleotide-binding protein subunit beta-2-like 1 [Myotis 
brandtii]
Length=256

 Score =   242 bits (617),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 119/186 (64%), Positives = 144/186 (77%), Gaps = 11/186 (6%)
 Frame = -1

Query  748  CKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVN  569
            CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++   GHTGY+N
Sbjct  77   CKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGYLN  135

Query  568  TVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASI  389
            TV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  SI
Sbjct  136  TVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSI  195

Query  388  KIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            KIWDLE K I+VD         E+  E  +T++K +   CTSL+W+ADG TLF+GYTD +
Sbjct  196  KIWDLEGK-IIVD---------ELKQEVISTSSKAEPPQCTSLAWSADGQTLFAGYTDNL  245

Query  208  IRVWGI  191
            +RVW +
Sbjct  246  VRVWQV  251



>gb|EAW53697.1| guanine nucleotide binding protein (G protein), beta polypeptide 
2-like 1, isoform CRA_f [Homo sapiens]
Length=228

 Score =   241 bits (615),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 146/186 (78%), Gaps = 11/186 (6%)
 Frame = -1

Query  748  CKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVN  569
            CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++   GHTGY+N
Sbjct  49   CKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGYLN  107

Query  568  TVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASI  389
            TV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  SI
Sbjct  108  TVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSI  167

Query  388  KIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            KIWDLE K I+VD   +LKQE        +T++K +   CTSL+W+ADG TLF+GYTD +
Sbjct  168  KIWDLEGK-IIVD---ELKQEVI------STSSKAEPPQCTSLAWSADGQTLFAGYTDNL  217

Query  208  IRVWGI  191
            +RVW +
Sbjct  218  VRVWQV  223



>ref|XP_004657524.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 isoform X2 [Jaculus jaculus]
Length=267

 Score =   242 bits (618),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 146/186 (78%), Gaps = 11/186 (6%)
 Frame = -1

Query  748  CKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVN  569
            CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++   GHTGY+N
Sbjct  88   CKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGYLN  146

Query  568  TVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASI  389
            TV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  SI
Sbjct  147  TVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSI  206

Query  388  KIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            KIWDLE K I+VD   +LKQE        +T++K +   CTSL+W+ADG TLF+GYTD +
Sbjct  207  KIWDLEGK-IIVD---ELKQEVI------STSSKAEPPQCTSLAWSADGQTLFAGYTDNL  256

Query  208  IRVWGI  191
            +RVW +
Sbjct  257  VRVWQV  262



>dbj|BAE39095.1| unnamed protein product [Mus musculus]
Length=232

 Score =   241 bits (615),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 119/186 (64%), Positives = 144/186 (77%), Gaps = 11/186 (6%)
 Frame = -1

Query  748  CKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVN  569
            CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++   GHTGY+N
Sbjct  53   CKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGYLN  111

Query  568  TVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASI  389
            TV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  SI
Sbjct  112  TVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSI  171

Query  388  KIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            KIWDLE K I+VD         E+  E  +T++K +   CTSL+W+ADG TLF+GYTD +
Sbjct  172  KIWDLEGK-IIVD---------ELKQEVISTSSKAEPPQCTSLAWSADGQTLFAGYTDNL  221

Query  208  IRVWGI  191
            +RVW +
Sbjct  222  VRVWQV  227



>ref|XP_008063710.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1, partial [Tarsius syrichta]
Length=262

 Score =   242 bits (618),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 119/186 (64%), Positives = 144/186 (77%), Gaps = 11/186 (6%)
 Frame = -1

Query  748  CKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVN  569
            CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++   GHTGY+N
Sbjct  83   CKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGYLN  141

Query  568  TVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASI  389
            TV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  SI
Sbjct  142  TVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSI  201

Query  388  KIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            KIWDLE K I+VD         E+  E  +T++K +   CTSL+W+ADG TLF+GYTD +
Sbjct  202  KIWDLEGK-IIVD---------ELKQEVISTSSKAEPPQCTSLAWSADGQTLFAGYTDNL  251

Query  208  IRVWGI  191
            +RVW +
Sbjct  252  VRVWQV  257



>ref|NP_571519.1| guanine nucleotide-binding protein subunit beta-2-like 1 [Danio 
rerio]
 sp|O42248.1|GBLP_DANRE RecName: Full=Guanine nucleotide-binding protein subunit beta-2-like 
1; AltName: Full=Receptor of activated protein kinase 
C; Short=RACK [Danio rerio]
 gb|AAB81617.1| receptor for activated protein kinase C [Danio rerio]
 gb|AAH49459.1| Guanine nucleotide binding protein (G protein), beta polypeptide 
2-like 1 [Danio rerio]
 gb|AAQ98014.1| guanine nucleotide binding protein beta polypeptide 2-like 1 
[Danio rerio]
Length=317

 Score =   244 bits (622),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 140/186 (75%), Gaps = 11/186 (6%)
 Frame = -1

Query  748  CKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVN  569
            CKYTIQD D H EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++   GHTGY+N
Sbjct  138  CKYTIQD-DSHTEWVSCVRFSPNSSNPIIVSCGWDKMVKVWNLANCKLKTNHIGHTGYLN  196

Query  568  TVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASI  389
            TV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G  I+ALCFSPNRYWLCAAT  SI
Sbjct  197  TVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDTINALCFSPNRYWLCAATGPSI  256

Query  388  KIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            KIWDLE K IV +LR D+            T +K +   CTSL+W+ADG TLF+GYTD +
Sbjct  257  KIWDLEGKIIVDELRQDII----------TTNSKAEPPQCTSLAWSADGQTLFAGYTDNL  306

Query  208  IRVWGI  191
            IRVW +
Sbjct  307  IRVWQV  312


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 49/206 (24%), Positives = 89/206 (43%), Gaps = 29/206 (14%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  557
            GH+ WV+ +  +P      I+S S D+T+ +W L+  +      +  L GH+ +V+ V +
Sbjct  13   GHSGWVTQIATTPQ-FPDMILSASRDKTIIMWKLTRDETNYGIPQRALRGHSHFVSDVVI  71

Query  556  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  383
            S DG    SG  DG + LWDL  G   + +      ++     + NR  +  + + +IK+
Sbjct  72   SSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSADNRQIVSGSRDKTIKL  131

Query  382  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  203
            W+      V    +     +E              + C   S N+    + S   D +++
Sbjct  132  WNTLG---VCKYTIQDDSHTEW-------------VSCVRFSPNSSNPIIVSCGWDKMVK  175

Query  202  VWGIGRY*MEEFRRSHMIIGHVCYLS  125
            VW +      + + +H  IGH  YL+
Sbjct  176  VWNLANC---KLKTNH--IGHTGYLN  196



>ref|XP_005703361.1| hypothetical protein Gasu_55280 [Galdieria sulphuraria]
 gb|EME26841.1| hypothetical protein Gasu_55280 [Galdieria sulphuraria]
Length=315

 Score =   244 bits (622),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 122/187 (65%), Positives = 145/187 (78%), Gaps = 12/187 (6%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYT+ + DGH++WVSCVRFSPST  P IVS  WD+ VKVWNLSNCK+RS LA HTGY+
Sbjct  137  ECKYTLTE-DGHSDWVSCVRFSPSTATPLIVSCGWDKMVKVWNLSNCKIRSNLASHTGYL  195

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTV+VSPDGSLCASGGKDGV +LW+L EGK LYSL+A  II+ALCFSP RYWLCAAT  +
Sbjct  196  NTVSVSPDGSLCASGGKDGVAMLWELQEGKHLYSLNANDIINALCFSPVRYWLCAATNTA  255

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            IKIWDLE K+IV +L      E E+S        K ++  CT L+W+ADGSTL++GYTD 
Sbjct  256  IKIWDLEKKNIVAELLY----EEEVS-------KKAQVPACTCLAWSADGSTLYAGYTDN  304

Query  211  VIRVWGI  191
             IRVW +
Sbjct  305  SIRVWTV  311


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/122 (28%), Positives = 60/122 (49%), Gaps = 8/122 (7%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  557
            GH  WV+ +  +P      IVS S DR + +W ++  +      R +L GH+ +++ + +
Sbjct  13   GHGNWVTSI-CTPLDNSDFIVSCSRDRKIMIWQITREEGAFGVPRKSLTGHSHFISDIVL  71

Query  556  SPDGSLCASGGKDGVILLWDLAEGKKLYSL-DAGSIIHALCFSP-NRYWLCAATEASIKI  383
            S DG    S   D  + LWDL +G       D    + ++ FS  NR  +  + + +IK+
Sbjct  72   SSDGQFALSSSWDHTLRLWDLTQGVSTRRFVDHTKDVLSVAFSADNRQIVSGSRDRTIKL  131

Query  382  WD  377
            W+
Sbjct  132  WN  133



>gb|ETP42980.1| guanine nucleotide-binding protein subunit beta-like protein 
[Phytophthora parasitica P10297]
Length=429

 Score =   247 bits (631),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 120/184 (65%), Positives = 141/184 (77%), Gaps = 10/184 (5%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKYTI + DGH EWVSCVRFSPST  P IVS  WD+ VK+WNLSNCKLR+ L GH GY+
Sbjct  139  ECKYTITE-DGHTEWVSCVRFSPSTANPLIVSCGWDKVVKIWNLSNCKLRTNLFGHEGYL  197

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTV VSPDGS+CASGGKDG   LWDL EGK+LYSL AG +IHAL FSPNRYWLCAAT + 
Sbjct  198  NTVTVSPDGSICASGGKDGTANLWDLNEGKRLYSLVAGDVIHALIFSPNRYWLCAATTSG  257

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            IKIWDLESK +V DL+ ++++     A+  +         C SL+W+ADGS LFSGYTDG
Sbjct  258  IKIWDLESKIVVHDLQPEIEEPKGKYAQPPH---------CISLAWSADGSVLFSGYTDG  308

Query  211  VIRV  200
            ++RV
Sbjct  309  IVRV  312


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/133 (29%), Positives = 63/133 (47%), Gaps = 15/133 (11%)
 Frame = -1

Query  742  YTIQDGDGHN----EWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLA  590
            Y   + DGHN      ++  R +P+ L    ++ S D+++ VW LSN        R  L 
Sbjct  7    YPRAELDGHNGKAVTAIATTRENPNLL----LTASRDKSLLVWQLSNDGEEYGFARRRLQ  62

Query  589  GHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYW  416
            GH+ YV  V +S DG    SG  DG + LWDL  G   + +      ++     + NR  
Sbjct  63   GHSHYVEDVVISSDGQFALSGSWDGTLRLWDLNTGITTRRFVGHTKDVLSVAFSADNRQI  122

Query  415  LCAATEASIKIWD  377
            +  + + ++K+W+
Sbjct  123  VSGSRDKTVKLWN  135


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 51/182 (28%), Positives = 80/182 (44%), Gaps = 26/182 (14%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  542
            GH+ +V  V  S        +SGSWD T+++W+L+         GHT  V +VA S D  
Sbjct  63   GHSHYVEDVVISSD--GQFALSGSWDGTLRLWDLNTGITTRRFVGHTKDVLSVAFSADNR  120

Query  541  LCASGGKDGVILLWD-LAEGKKLYSLDAGSI-IHALCFSP---NRYWLCAATEASIKIWD  377
               SG +D  + LW+ L E K   + D  +  +  + FSP   N   +    +  +KIW+
Sbjct  121  QIVSGSRDKTVKLWNTLGECKYTITEDGHTEWVSCVRFSPSTANPLIVSCGWDKVVKIWN  180

Query  376  LESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVW  197
            L +      LR +L        EG          +  +++ + DGS   SG  DG   +W
Sbjct  181  LSN----CKLRTNL-----FGHEG----------YLNTVTVSPDGSICASGGKDGTANLW  221

Query  196  GI  191
             +
Sbjct  222  DL  223



>gb|EWM27643.1| guanine nucleotide binding protein [Nannochloropsis gaditana]
Length=314

 Score =   244 bits (622),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 119/187 (64%), Positives = 141/187 (75%), Gaps = 9/187 (5%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECK+TI +G GH+EWVSCVRFSPS   P IVS  WD+ VKVWNL++CKL+  L GHTGY+
Sbjct  136  ECKFTITEG-GHSEWVSCVRFSPSPTAPVIVSCGWDKRVKVWNLADCKLKQNLIGHTGYL  194

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            N V VSPDGSLCASGGKDG  +LWDL EGK+LYSLDAG IIH+L FSPNRYWLCAAT   
Sbjct  195  NVVTVSPDGSLCASGGKDGTAMLWDLNEGKRLYSLDAGDIIHSLVFSPNRYWLCAATSQG  254

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            IKIWDLESK +V  L      + +   +G ++ +     +CTSL+W+ADG TLFSGYTDG
Sbjct  255  IKIWDLESKDMVDHL------QPKWPVQGKHSLSPQP--YCTSLAWSADGQTLFSGYTDG  306

Query  211  VIRVWGI  191
             IR W +
Sbjct  307  KIRCWSV  313


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 53/206 (26%), Positives = 91/206 (44%), Gaps = 30/206 (15%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIV-SGSWDRTVKVWNLSNCK----LRSTLAGHTGYVNTVAV  557
            GH  WV+ +  +     P +V S S D+TV VWNL+  +     +  L GH  +V+ V +
Sbjct  13   GHAGWVTSI--ATHADNPNLVLSSSRDKTVMVWNLTGGEDYGYPQRALRGHGHFVSDVII  70

Query  556  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  383
            S DG    SG  DG + LW++  GK   +    S  + ++ FS  NR  +  + + +IK+
Sbjct  71   SSDGQFALSGSWDGTLRLWEIKTGKSTRTFVGHSKDVLSVSFSHDNRQIVSGSRDKTIKL  130

Query  382  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  203
            W+             L +      EG ++    + + C   S +     + S   D  ++
Sbjct  131  WNT------------LGECKFTITEGGHS----EWVSCVRFSPSPTAPVIVSCGWDKRVK  174

Query  202  VWGIGRY*MEEFRRSHMIIGHVCYLS  125
            VW +      + +    +IGH  YL+
Sbjct  175  VWNLA-----DCKLKQNLIGHTGYLN  195



>emb|CEG67117.1| Putative Guanine nucleotide-binding protein subunit beta-2-like 
1 [Rhizopus microsporus]
 emb|CEI95133.1| Putative Guanine nucleotide-binding protein subunit beta-2-like 
1 [Rhizopus microsporus]
 emb|CEI93908.1| Putative Guanine nucleotide-binding protein subunit beta-2-like 
1 [Rhizopus microsporus]
Length=316

 Score =   244 bits (622),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 117/189 (62%), Positives = 140/189 (74%), Gaps = 10/189 (5%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKY I + DGH EWVSCVRFSP+   P IVSG WD+ VKVW+L+  KLR+   GH GYV
Sbjct  136  ECKYNITE-DGHTEWVSCVRFSPNPATPLIVSGGWDKLVKVWDLTKLKLRTNFIGHNGYV  194

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTV +SPDGSLCAS GKDGV++LWDL + K LYSLDAGS++HAL FSPNRYWLCAAT   
Sbjct  195  NTVTISPDGSLCASAGKDGVVMLWDLNDAKHLYSLDAGSVVHALTFSPNRYWLCAATANG  254

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            IKIWDLE+KSIV +LR +  Q  +          KN    C S++W+ADG+TLFSGY+D 
Sbjct  255  IKIWDLETKSIVDELRPEFAQLGKR---------KNPDPECLSVAWSADGATLFSGYSDN  305

Query  211  VIRVWGIGR  185
            +IRVW + R
Sbjct  306  IIRVWQVTR  314


 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 48/207 (23%), Positives = 92/207 (44%), Gaps = 29/207 (14%)
 Frame = -1

Query  724  DGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVA  560
            +GH  WV+ +  + S     ++S S D+T+ VWNL+  ++     R +L GH+ +V  +A
Sbjct  11   EGHGNWVTAIA-TTSEAPDMVLSASRDKTIIVWNLTRDEVNYGVPRKSLVGHSHFVEDIA  69

Query  559  VSPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIK  386
            +S DG    S   D  + LWDL  G   + +      ++     + NR  +  + + SIK
Sbjct  70   ISSDGQFALSASWDHTLRLWDLNNGTTTRRFVGHTNDVLSVSFSADNRQIVSGSRDKSIK  129

Query  385  IWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVI  206
            +W+   +            +  ++ +G+      + + C   S N     + SG  D ++
Sbjct  130  LWNTLGEC-----------KYNITEDGH-----TEWVSCVRFSPNPATPLIVSGGWDKLV  173

Query  205  RVWGIGRY*MEEFRRSHMIIGHVCYLS  125
            +VW      + + +     IGH  Y++
Sbjct  174  KVWD-----LTKLKLRTNFIGHNGYVN  195


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 49/182 (27%), Positives = 81/182 (45%), Gaps = 26/182 (14%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  542
            GH+ +V  +  S        +S SWD T+++W+L+N        GHT  V +V+ S D  
Sbjct  60   GHSHFVEDIAISSD--GQFALSASWDHTLRLWDLNNGTTTRRFVGHTNDVLSVSFSADNR  117

Query  541  LCASGGKDGVILLWD-LAEGKKLYSLDAGSI-IHALCFSPN---RYWLCAATEASIKIWD  377
               SG +D  I LW+ L E K   + D  +  +  + FSPN      +    +  +K+WD
Sbjct  118  QIVSGSRDKSIKLWNTLGECKYNITEDGHTEWVSCVRFSPNPATPLIVSGGWDKLVKVWD  177

Query  376  LESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVW  197
            L      + LR +          G+N        +  +++ + DGS   S   DGV+ +W
Sbjct  178  LTK----LKLRTNFI--------GHNG-------YVNTVTISPDGSLCASAGKDGVVMLW  218

Query  196  GI  191
             +
Sbjct  219  DL  220



>ref|XP_007548404.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 [Poecilia formosa]
 ref|XP_008418331.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 [Poecilia reticulata]
Length=317

 Score =   244 bits (622),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 142/186 (76%), Gaps = 11/186 (6%)
 Frame = -1

Query  748  CKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVN  569
            CKYTIQD +GH EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++   GHTGY+N
Sbjct  138  CKYTIQD-EGHTEWVSCVRFSPNSSNPIIVSCGWDKMVKVWNLANCKLKTNHIGHTGYLN  196

Query  568  TVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASI  389
            TV VSPDGSLCASGGKDG  +LWDL EGK LY+LD+G  I+ALCFSPNRYWLCAAT  SI
Sbjct  197  TVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDSGDTINALCFSPNRYWLCAATGPSI  256

Query  388  KIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            KIWDLE K IV +LR           E  +T +K +   CTSL+W+ADG TLF+GYTD +
Sbjct  257  KIWDLEGKIIVDELR----------QEVISTNSKAEPPQCTSLAWSADGQTLFAGYTDNL  306

Query  208  IRVWGI  191
            IRVW +
Sbjct  307  IRVWQV  312


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 53/208 (25%), Positives = 94/208 (45%), Gaps = 33/208 (16%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  557
            GH+ WV+ +  +P      I+S S D+++ +W L+  +      + +L GH+ +V+ V +
Sbjct  13   GHSGWVTQIATTPQ-YPDMILSASRDKSIIMWKLTRDETNYGIPQRSLRGHSHFVSDVVI  71

Query  556  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFSP-NRYWLCAATEASIKI  383
            S DG    SG  DG + LWDL  G         S  + ++ FS  NR  +  + + +IK+
Sbjct  72   SSDGQFALSGAWDGTLRLWDLTTGATTRQFVGHSKDVLSVAFSADNRQIVSGSRDKTIKL  131

Query  382  WDLES--KSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            W+     K  + D             EG+      + + C   S N+    + S   D +
Sbjct  132  WNTLGVCKYTIQD-------------EGH-----TEWVSCVRFSPNSSNPIIVSCGWDKM  173

Query  208  IRVWGIGRY*MEEFRRSHMIIGHVCYLS  125
            ++VW +      + + +H  IGH  YL+
Sbjct  174  VKVWNLANC---KLKTNH--IGHTGYLN  196



>dbj|BAG53102.1| unnamed protein product [Homo sapiens]
Length=275

 Score =   242 bits (618),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 119/186 (64%), Positives = 144/186 (77%), Gaps = 11/186 (6%)
 Frame = -1

Query  748  CKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVN  569
            CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++   GHTGY+N
Sbjct  96   CKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGYLN  154

Query  568  TVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASI  389
            TV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  SI
Sbjct  155  TVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSI  214

Query  388  KIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            KIWDLE K I+VD         E+  E  +T++K +   CTSL+W+ADG TLF+GYTD +
Sbjct  215  KIWDLEGK-IIVD---------ELKQEVISTSSKAEPPQCTSLAWSADGQTLFAGYTDNL  264

Query  208  IRVWGI  191
            +RVW +
Sbjct  265  VRVWQV  270



>gb|AAX94566.1| Gpa1 interacting G protein subunit [Cryptococcus neoformans var. 
grubii]
Length=227

 Score =   241 bits (614),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 117/187 (63%), Positives = 144/187 (77%), Gaps = 11/187 (6%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECK+ I + DGH EWVSCVRFSP+   P I+S  WD+TVKVW LSNCKL++T  GHTGY+
Sbjct  50   ECKFDIVE-DGHTEWVSCVRFSPNPALPVIISAGWDKTVKVWELSNCKLKTTHHGHTGYL  108

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NT+AVSPDGSL ASGGKDG+ +LWDL EGK LYSLDAG +I+AL FSPNRYWLCAAT +S
Sbjct  109  NTLAVSPDGSLAASGGKDGITMLWDLNEGKHLYSLDAGDVINALVFSPNRYWLCAATASS  168

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            IKI+DLESKS+V DL+ D    S+          K +   CTSL+W+ADG TLF+G++D 
Sbjct  169  IKIFDLESKSLVDDLQPDFDGLSD----------KARKPECTSLAWSADGQTLFAGFSDN  218

Query  211  VIRVWGI  191
            ++RVW +
Sbjct  219  LVRVWAV  225



>ref|XP_005989393.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1-like [Latimeria chalumnae]
Length=317

 Score =   243 bits (621),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 141/186 (76%), Gaps = 11/186 (6%)
 Frame = -1

Query  748  CKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVN  569
            CKYTIQD +GH EW SCVRFSP++  P IVS  WDR VKVWNL+NCKL++   GH GY+N
Sbjct  138  CKYTIQD-EGHTEWASCVRFSPNSNNPIIVSCGWDRLVKVWNLANCKLKTNHIGHVGYLN  196

Query  568  TVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASI  389
            TV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  SI
Sbjct  197  TVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSI  256

Query  388  KIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            KIWDLE K IV +LR           E  +T++K +   CTSL+W+ADG TLF+GYTD +
Sbjct  257  KIWDLEGKIIVDELR----------QEVISTSSKAEPPQCTSLAWSADGQTLFAGYTDNL  306

Query  208  IRVWGI  191
            IRVW +
Sbjct  307  IRVWQV  312


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 50/206 (24%), Positives = 91/206 (44%), Gaps = 29/206 (14%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  557
            GHN WV+ +  +P      I+S S D+++ +W L+  +      +  L GH  +V+ V +
Sbjct  13   GHNGWVTQIATTPQ-FPDMILSASRDKSIIMWKLTRDETNYGIPQRALRGHAHFVSDVVI  71

Query  556  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  383
            S DG    SG  D  + LWDL  G   + +   +  ++     + NR  +  + + +IK+
Sbjct  72   SSDGQFALSGSWDSNLRLWDLTLGITTRQFVGHSKDVLSVAFSADNRQIVSGSRDKTIKL  131

Query  382  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  203
            W+                +  +  EG+   A      C   S N++   + S   D +++
Sbjct  132  WNTLGVC-----------KYTIQDEGHTEWAS-----CVRFSPNSNNPIIVSCGWDRLVK  175

Query  202  VWGIGRY*MEEFRRSHMIIGHVCYLS  125
            VW +      + + +H  IGHV YL+
Sbjct  176  VWNLANC---KLKTNH--IGHVGYLN  196



>gb|EJT47727.1| G protein beta subunit-like protein Rkp1 [Trichosporon asahii 
var. asahii CBS 2479]
 gb|EKD01510.1| G protein beta subunit-like protein Rkp1 [Trichosporon asahii 
var. asahii CBS 8904]
Length=314

 Score =   243 bits (621),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 117/187 (63%), Positives = 143/187 (76%), Gaps = 11/187 (6%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECK+ I D DGH+EWVSCVRFSP+ + P IVS  WD+ VKVW LS CKL++   GHTGY+
Sbjct  137  ECKFNIVD-DGHSEWVSCVRFSPNPVIPVIVSAGWDKVVKVWELSKCKLKTNHYGHTGYI  195

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NT+AVSPDGSL ASGGKDG+++LWDL EGK LYSL+AG I+++L FSPNRYWLCAAT +S
Sbjct  196  NTLAVSPDGSLAASGGKDGIVMLWDLNEGKHLYSLEAGDIVNSLVFSPNRYWLCAATASS  255

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            IKI+DLESKSIV DL+ D  + SE + +            C SL+W+ADG TLF GYTD 
Sbjct  256  IKIFDLESKSIVDDLKPDFNELSEKARKPE----------CASLAWSADGQTLFGGYTDN  305

Query  211  VIRVWGI  191
            +IRVW +
Sbjct  306  LIRVWAV  312


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 51/182 (28%), Positives = 78/182 (43%), Gaps = 26/182 (14%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  542
            GHN +VS V  S        +S SWD+T+++W+L+         GHTG V +V+ S D  
Sbjct  61   GHNHFVSDVVISSD--GQFALSSSWDKTLRLWDLNTGLTTRKFVGHTGDVLSVSFSADNR  118

Query  541  LCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALC--FSPN---RYWLCAATEASIKIWD  377
               S  +D  I LW+     K   +D G      C  FSPN      + A  +  +K+W+
Sbjct  119  QIVSASRDRTIKLWNTLGECKFNIVDDGHSEWVSCVRFSPNPVIPVIVSAGWDKVVKVWE  178

Query  376  LESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVW  197
            L         +  LK           T       +  +L+ + DGS   SG  DG++ +W
Sbjct  179  LS--------KCKLK-----------TNHYGHTGYINTLAVSPDGSLAASGGKDGIVMLW  219

Query  196  GI  191
             +
Sbjct  220  DL  221


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 52/210 (25%), Positives = 90/210 (43%), Gaps = 33/210 (16%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  557
            GH  WV+ +  S S     I++ S D+T+ VW L+  +      +  L GH  +V+ V +
Sbjct  13   GHAGWVTAIATS-SENPDMILTASRDKTIIVWQLTRDESSFGFPKKILHGHNHFVSDVVI  71

Query  556  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  383
            S DG    S   D  + LWDL  G   + +    G ++     + NR  + A+ + +IK+
Sbjct  72   SSDGQFALSSSWDKTLRLWDLNTGLTTRKFVGHTGDVLSVSFSADNRQIVSASRDRTIKL  131

Query  382  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            W+   E K  +VD                     ++ + C   S N     + S   D V
Sbjct  132  WNTLGECKFNIVD------------------DGHSEWVSCVRFSPNPVIPVIVSAGWDKV  173

Query  208  IRVWGIGRY*MEEFRRSHMIIGHVCYLSHL  119
            ++VW + +    + + +H   GH  Y++ L
Sbjct  174  VKVWELSKC---KLKTNHY--GHTGYINTL  198



>ref|XP_002804718.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1-like [Macaca mulatta]
Length=279

 Score =   242 bits (617),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 119/186 (64%), Positives = 144/186 (77%), Gaps = 11/186 (6%)
 Frame = -1

Query  748  CKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVN  569
            CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++   GHTGY+N
Sbjct  100  CKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGYLN  158

Query  568  TVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASI  389
            TV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  SI
Sbjct  159  TVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSI  218

Query  388  KIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            KIWDLE K I+VD         E+  E  +T++K +   CTSL+W+ADG TLF+GYTD +
Sbjct  219  KIWDLEGK-IIVD---------ELKQEVISTSSKAEPPQCTSLAWSADGQTLFAGYTDNL  268

Query  208  IRVWGI  191
            +RVW +
Sbjct  269  VRVWQV  274



>gb|AAI50408.1| Guanine nucleotide binding protein (G protein), beta polypeptide 
2-like 1 [Danio rerio]
Length=317

 Score =   243 bits (621),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 120/186 (65%), Positives = 140/186 (75%), Gaps = 11/186 (6%)
 Frame = -1

Query  748  CKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVN  569
            CKYTIQD D H EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++   GHTGY+N
Sbjct  138  CKYTIQD-DSHTEWVSCVRFSPNSSNPIIVSCGWDKMVKVWNLANCKLKTNHIGHTGYLN  196

Query  568  TVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASI  389
            TV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G  I+ALCFSPNRYWLCAAT  SI
Sbjct  197  TVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDTINALCFSPNRYWLCAATGPSI  256

Query  388  KIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            +IWDLE K IV +LR D+            T +K +   CTSL+W+ADG TLF+GYTD +
Sbjct  257  RIWDLEGKIIVDELRQDII----------TTNSKAEPPQCTSLAWSADGQTLFAGYTDNL  306

Query  208  IRVWGI  191
            IRVW +
Sbjct  307  IRVWQV  312


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 49/206 (24%), Positives = 89/206 (43%), Gaps = 29/206 (14%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  557
            GH+ WV+ +  +P      I+S S D+T+ +W L+  +      +  L GH+ +V+ V +
Sbjct  13   GHSGWVTQIATTPQ-FPDMILSASRDKTIIMWKLTRDETNYGIPQRALRGHSHFVSDVVI  71

Query  556  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  383
            S DG    SG  DG + LWDL  G   + +      ++     + NR  +  + + +IK+
Sbjct  72   SSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSADNRQIVSGSRDKTIKL  131

Query  382  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  203
            W+      V    +     +E              + C   S N+    + S   D +++
Sbjct  132  WNTLG---VCKYTIQDDSHTEW-------------VSCVRFSPNSSNPIIVSCGWDKMVK  175

Query  202  VWGIGRY*MEEFRRSHMIIGHVCYLS  125
            VW +      + + +H  IGH  YL+
Sbjct  176  VWNLANC---KLKTNH--IGHTGYLN  196



>ref|XP_007244608.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1-like [Astyanax mexicanus]
Length=317

 Score =   243 bits (621),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 120/186 (65%), Positives = 143/186 (77%), Gaps = 11/186 (6%)
 Frame = -1

Query  748  CKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVN  569
            CKYTIQD +GH+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++   GHTG++N
Sbjct  138  CKYTIQD-EGHSEWVSCVRFSPNSSNPIIVSCGWDKMVKVWNLANCKLKTNHIGHTGFLN  196

Query  568  TVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASI  389
            TV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G  I+ALCFSPNRYWLCAAT  SI
Sbjct  197  TVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDTINALCFSPNRYWLCAATGPSI  256

Query  388  KIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            KIWDLE K IV +LR           E  +T++K +   CTSL+W+ADG TLF+GYTD +
Sbjct  257  KIWDLEGKIIVDELR----------QEVISTSSKAEPPQCTSLAWSADGQTLFAGYTDNL  306

Query  208  IRVWGI  191
            IRVW +
Sbjct  307  IRVWQV  312


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 49/206 (24%), Positives = 90/206 (44%), Gaps = 29/206 (14%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  557
            GH+ WV+ +  +P      I+S S D+T+ +W L+  +      +  L GH+ +V+ V +
Sbjct  13   GHSGWVTQIATTPQ-FPDMILSASRDKTIVMWKLTRDETNYGVPQRALRGHSHFVSDVVI  71

Query  556  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  383
            S DG    SG  DG + LWDL  G   + +      ++     + NR  +  + + +IK+
Sbjct  72   SSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSADNRQIVSGSRDKTIKL  131

Query  382  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  203
            W+      V    +  +  SE              + C   S N+    + S   D +++
Sbjct  132  WNTLG---VCKYTIQDEGHSEW-------------VSCVRFSPNSSNPIIVSCGWDKMVK  175

Query  202  VWGIGRY*MEEFRRSHMIIGHVCYLS  125
            VW +      + + +H  IGH  +L+
Sbjct  176  VWNLANC---KLKTNH--IGHTGFLN  196



>ref|XP_006147504.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1, partial [Tupaia chinensis]
Length=262

 Score =   241 bits (615),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 119/186 (64%), Positives = 144/186 (77%), Gaps = 11/186 (6%)
 Frame = -1

Query  748  CKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVN  569
            CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++   GHTGY+N
Sbjct  83   CKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGYLN  141

Query  568  TVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASI  389
            TV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  SI
Sbjct  142  TVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSI  201

Query  388  KIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            KIWDLE K I+VD         E+  E  +T++K +   CTSL+W+ADG TLF+GYTD +
Sbjct  202  KIWDLEGK-IIVD---------ELKQEVISTSSKAEPPQCTSLAWSADGQTLFAGYTDNL  251

Query  208  IRVWGI  191
            +RVW +
Sbjct  252  VRVWQV  257



>gb|EPB90862.1| guanine nucleotide-binding protein subunit beta-2-like 1 [Mucor 
circinelloides f. circinelloides 1006PhL]
Length=311

 Score =   243 bits (619),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 118/189 (62%), Positives = 140/189 (74%), Gaps = 10/189 (5%)
 Frame = -1

Query  751  ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYV  572
            ECKY I + DGH+EWVSCVRFSP+   P IVSG WD+ VKVW+L+  KLR+   GH GYV
Sbjct  131  ECKYNITE-DGHSEWVSCVRFSPNPANPLIVSGGWDKLVKVWDLTKMKLRTNFIGHNGYV  189

Query  571  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEAS  392
            NTV +SPDGSLCAS GKDGV++LWDL + K LYSL+AGS++HAL FSPNRYWLCAAT   
Sbjct  190  NTVTISPDGSLCASAGKDGVVMLWDLNDAKHLYSLEAGSLVHALTFSPNRYWLCAATANG  249

Query  391  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  212
            IKIWDLESKSIV +LR +  Q  +          KN    C S+ W+ADG+TLFSGY+D 
Sbjct  250  IKIWDLESKSIVDELRPEFAQLGKR---------KNPDPDCLSVCWSADGATLFSGYSDN  300

Query  211  VIRVWGIGR  185
            VIRVW + R
Sbjct  301  VIRVWQVTR  309


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 43/187 (23%), Positives = 83/187 (44%), Gaps = 28/187 (15%)
 Frame = -1

Query  664  IVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAVSPDGSLCASGGKDGVILLW  500
            ++S S D+T+ VWNL   ++     R +L GH+ +V  +A+S DG    S   D  + LW
Sbjct  25   VLSASRDKTIIVWNLIRDEMNYGVPRKSLVGHSHFVEDLAISSDGQFALSASWDQTLRLW  84

Query  499  DLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQE  326
            DL  G   + +      ++     + NR  +  + + SIK+W+   +            +
Sbjct  85   DLNSGTTTRRFVGHTNDVLSVSFSADNRQIVSGSRDKSIKLWNTLGEC-----------K  133

Query  325  SEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY*MEEFRRSHMII  146
              ++ +G+     ++ + C   S N     + SG  D +++VW + +      +     I
Sbjct  134  YNITEDGH-----SEWVSCVRFSPNPANPLIVSGGWDKLVKVWDLTK-----MKLRTNFI  183

Query  145  GHVCYLS  125
            GH  Y++
Sbjct  184  GHNGYVN  190


 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 44/162 (27%), Positives = 74/162 (46%), Gaps = 24/162 (15%)
 Frame = -1

Query  661  VSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWD-LAEG  485
            +S SWD+T+++W+L++        GHT  V +V+ S D     SG +D  I LW+ L E 
Sbjct  73   LSASWDQTLRLWDLNSGTTTRRFVGHTNDVLSVSFSADNRQIVSGSRDKSIKLWNTLGEC  132

Query  484  KKLYSLDAGSI-IHALCFSP---NRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEM  317
            K   + D  S  +  + FSP   N   +    +  +K+WDL             K +   
Sbjct  133  KYNITEDGHSEWVSCVRFSPNPANPLIVSGGWDKLVKVWDLT------------KMKLRT  180

Query  316  SAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGI  191
            +  G+N        +  +++ + DGS   S   DGV+ +W +
Sbjct  181  NFIGHNG-------YVNTVTISPDGSLCASAGKDGVVMLWDL  215



>emb|CCQ18636.1| G protein beta subunit-like protein [Sycon ciliatum]
Length=321

 Score =   243 bits (620),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 115/188 (61%), Positives = 142/188 (76%), Gaps = 11/188 (6%)
 Frame = -1

Query  748  CKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVN  569
            CKYTIQD +GH+EWVSCVRFSP+   P IVS  WDR VKVWNL+NC+L++   GHTGY+N
Sbjct  142  CKYTIQD-EGHSEWVSCVRFSPNNQNPIIVSAGWDRLVKVWNLTNCRLKTNHIGHTGYLN  200

Query  568  TVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASI  389
            TV VSPDGSLCASGGKDG+ +LWDL EGK LY+L+ G +I+AL FSPNRYWLCAA   +I
Sbjct  201  TVTVSPDGSLCASGGKDGLAMLWDLNEGKHLYTLEGGDVINALTFSPNRYWLCAACGPTI  260

Query  388  KIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            K+WDLE+KS+V           E + +    ++  +   CTSL+W+ADG TLFSGYTDG+
Sbjct  261  KVWDLETKSVV----------DECTIQDPTQSSSQEAATCTSLAWSADGQTLFSGYTDGL  310

Query  208  IRVWGIGR  185
            IRVW + R
Sbjct  311  IRVWQVTR  318


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 52/208 (25%), Positives = 90/208 (43%), Gaps = 31/208 (15%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-------LRSTLAGHTGYVNTV  563
            GH +WV+ +  +P  +   I+S S D+++ VWNL+  +        +  L GH+ +V+ V
Sbjct  15   GHKDWVTQIATTPQ-VPDMILSSSRDKSIIVWNLNREEGTGNVGVPKRRLTGHSHFVSDV  73

Query  562  AVSPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASI  389
             +S DG    SG  D  + LWDL  G   + +      ++     + NR  + A+ + SI
Sbjct  74   VISSDGQFALSGSWDHTLRLWDLQRGVTTRRFVGHTKDVLSVAFSADNRQIVSASRDRSI  133

Query  388  KIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            K+W+      V    +  +  SE              + C   S N     + S   D +
Sbjct  134  KLWNTLG---VCKYTIQDEGHSEW-------------VSCVRFSPNNQNPIIVSAGWDRL  177

Query  208  IRVWGIGRY*MEEFRRSHMIIGHVCYLS  125
            ++VW +        + +H  IGH  YL+
Sbjct  178  VKVWNLTNC---RLKTNH--IGHTGYLN  200



>ref|XP_009080129.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1, partial [Acanthisitta chloris]
Length=236

 Score =   240 bits (612),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 119/186 (64%), Positives = 144/186 (77%), Gaps = 11/186 (6%)
 Frame = -1

Query  748  CKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVN  569
            CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++   GHTGY+N
Sbjct  57   CKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGYLN  115

Query  568  TVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASI  389
            TV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  SI
Sbjct  116  TVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSI  175

Query  388  KIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            KIWDLE K I+VD         E+  E  +T++K +   CTSL+W+ADG TLF+GYTD +
Sbjct  176  KIWDLEGK-IIVD---------ELKQEVISTSSKAEPPQCTSLAWSADGQTLFAGYTDNL  225

Query  208  IRVWGI  191
            +RVW +
Sbjct  226  VRVWQV  231



>gb|ADO27998.1| guanine nucleotide-binding protein subunit beta-2-like 1 [Ictalurus 
furcatus]
Length=317

 Score =   243 bits (619),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 120/186 (65%), Positives = 143/186 (77%), Gaps = 11/186 (6%)
 Frame = -1

Query  748  CKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVN  569
            CKYTIQD +GH+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++   GHTG++N
Sbjct  138  CKYTIQD-EGHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLTNCKLKTNHIGHTGFLN  196

Query  568  TVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASI  389
            TV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G  I+ALCFSPNRYWLCAAT  SI
Sbjct  197  TVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDTINALCFSPNRYWLCAATGPSI  256

Query  388  KIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            KIWDLE K IV +LR           E  +T++K +   CTSL+W+ADG TLF+GYTD +
Sbjct  257  KIWDLEGKIIVDELR----------QEVISTSSKAEPPQCTSLAWSADGQTLFAGYTDNL  306

Query  208  IRVWGI  191
            IRVW +
Sbjct  307  IRVWQV  312


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 61/122 (50%), Gaps = 8/122 (7%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  557
            GH+ WV+ +  +P      I+S S D+++ +W L+  +      +  L GH+ +V+ V +
Sbjct  13   GHSGWVTQIATTPQ-FPDMILSASRDKSIIMWKLTRDETNYGVPQRALRGHSHFVSDVVI  71

Query  556  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  383
            S DG    SG  DG + LWDL  G   + +      ++     + NR  +  + + +IK+
Sbjct  72   SSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVASSADNRQIVSGSRDKTIKL  131

Query  382  WD  377
            W+
Sbjct  132  WN  133



>ref|NP_001187435.1| guanine nucleotide-binding protein subunit beta-2-like 1 [Ictalurus 
punctatus]
 gb|ADO28638.1| guanine nucleotide-binding protein subunit beta-2-like 1 [Ictalurus 
punctatus]
Length=317

 Score =   243 bits (619),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 120/186 (65%), Positives = 143/186 (77%), Gaps = 11/186 (6%)
 Frame = -1

Query  748  CKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVN  569
            CKYTIQD +GH+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++   GHTG++N
Sbjct  138  CKYTIQD-EGHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGFLN  196

Query  568  TVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASI  389
            TV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G  I+ALCFSPNRYWLCAAT  SI
Sbjct  197  TVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDTINALCFSPNRYWLCAATGPSI  256

Query  388  KIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            KIWDLE K IV +LR           E  +T++K +   CTSL+W+ADG TLF+GYTD +
Sbjct  257  KIWDLEGKIIVDELR----------QEVISTSSKAEPPQCTSLAWSADGQTLFAGYTDNL  306

Query  208  IRVWGI  191
            IRVW +
Sbjct  307  IRVWQV  312


 Score = 55.8 bits (133),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 48/206 (23%), Positives = 90/206 (44%), Gaps = 29/206 (14%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  557
            GH+ WV+ +  +P      I+S S D+++ +W L+  +      +  L GH+ +V+ V +
Sbjct  13   GHSGWVTQIATTPQ-FPDMILSASRDKSIIMWKLTRDETNYGVPQRALRGHSHFVSDVVI  71

Query  556  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  383
            S DG    SG  DG + LWDL  G   + +      ++     + NR  +  + + +IK+
Sbjct  72   SSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSADNRQIVSGSRDKTIKL  131

Query  382  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  203
            W+      V    +  +  SE              + C   S N+    + S   D +++
Sbjct  132  WNTLG---VCKYTIQDEGHSEW-------------VSCVRFSPNSSNPIIVSCGWDKLVK  175

Query  202  VWGIGRY*MEEFRRSHMIIGHVCYLS  125
            VW +      + + +H  IGH  +L+
Sbjct  176  VWNLANC---KLKTNH--IGHTGFLN  196



>ref|XP_009922131.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1, partial [Haliaeetus albicilla]
Length=291

 Score =   242 bits (617),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 119/186 (64%), Positives = 144/186 (77%), Gaps = 11/186 (6%)
 Frame = -1

Query  748  CKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVN  569
            CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++   GHTGY+N
Sbjct  112  CKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGYLN  170

Query  568  TVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASI  389
            TV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  SI
Sbjct  171  TVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSI  230

Query  388  KIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            KIWDLE K I+VD         E+  E  +T++K +   CTSL+W+ADG TLF+GYTD +
Sbjct  231  KIWDLEGK-IIVD---------ELKQEVISTSSKAEPPQCTSLAWSADGQTLFAGYTDNL  280

Query  208  IRVWGI  191
            +RVW +
Sbjct  281  VRVWQV  286


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 44/181 (24%), Positives = 77/181 (43%), Gaps = 28/181 (15%)
 Frame = -1

Query  646  DRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEG-  485
            D+T+ +W L+  +      +  L GH+ +V+ V +S DG    SG  DG + LWDL  G 
Sbjct  11   DKTIIMWKLTRDETNYGIPQRALRGHSHFVSDVVISSDGQFALSGSGDGTLRLWDLTTGT  70

Query  484  -KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAE  308
              + +      ++     S NR  +  + + +IK+W+      V    V  +  SE    
Sbjct  71   TTRRFVGHTKDVLSVAFSSDNRQIVSGSRDKTIKLWNTLG---VCKYTVQDESHSEW---  124

Query  307  GNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY*MEEFRRSHMIIGHVCYL  128
                      + C   S N+    + S   D +++VW +      + + +H  IGH  YL
Sbjct  125  ----------VSCVRFSPNSSNPIIVSCGWDKLVKVWNLANC---KLKTNH--IGHTGYL  169

Query  127  S  125
            +
Sbjct  170  N  170



>gb|KFP61115.1| Guanine nucleotide-binding protein subunit beta-2-like 1, partial 
[Cariama cristata]
Length=300

 Score =   242 bits (617),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 119/186 (64%), Positives = 144/186 (77%), Gaps = 11/186 (6%)
 Frame = -1

Query  748  CKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVN  569
            CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++   GHTGY+N
Sbjct  121  CKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGYLN  179

Query  568  TVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASI  389
            TV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  SI
Sbjct  180  TVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSI  239

Query  388  KIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            KIWDLE K I+VD         E+  E  +T++K +   CTSL+W+ADG TLF+GYTD +
Sbjct  240  KIWDLEGK-IIVD---------ELKQEVISTSSKAEPPQCTSLAWSADGQTLFAGYTDNL  289

Query  208  IRVWGI  191
            +RVW +
Sbjct  290  VRVWQV  295


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 47/194 (24%), Positives = 81/194 (42%), Gaps = 34/194 (18%)
 Frame = -1

Query  685  PSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAVSPDGSLCASGGK  521
            P +  PT      D+T+ +W L+  +      +  L GH+ +V+ V +S DG    SG  
Sbjct  13   PRSASPT------DKTIIMWKLTRDETNYGIPQRALRGHSHFVSDVVISSDGQFALSGSW  66

Query  520  DGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDL  347
            DG + LWDL  G   + +      ++     S NR  +  + + +IK+W+      V   
Sbjct  67   DGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSSDNRQIVSGSRDKTIKLWNTLG---VCKY  123

Query  346  RVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY*MEEF  167
             V  +  SE              + C   S N+    + S   D +++VW +      + 
Sbjct  124  TVQDESHSEW-------------VSCVRFSPNSSNPIIVSCGWDKLVKVWNLANC---KL  167

Query  166  RRSHMIIGHVCYLS  125
            + +H  IGH  YL+
Sbjct  168  KTNH--IGHTGYLN  179



>gb|KFP96911.1| Guanine nucleotide-binding protein subunit beta-2-like 1, partial 
[Haliaeetus albicilla]
Length=287

 Score =   241 bits (616),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 119/186 (64%), Positives = 144/186 (77%), Gaps = 11/186 (6%)
 Frame = -1

Query  748  CKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVN  569
            CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++   GHTGY+N
Sbjct  108  CKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGYLN  166

Query  568  TVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASI  389
            TV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  SI
Sbjct  167  TVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSI  226

Query  388  KIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            KIWDLE K I+VD         E+  E  +T++K +   CTSL+W+ADG TLF+GYTD +
Sbjct  227  KIWDLEGK-IIVD---------ELKQEVISTSSKAEPPQCTSLAWSADGQTLFAGYTDNL  276

Query  208  IRVWGI  191
            +RVW +
Sbjct  277  VRVWQV  282


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 44/181 (24%), Positives = 77/181 (43%), Gaps = 28/181 (15%)
 Frame = -1

Query  646  DRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEG-  485
            D+T+ +W L+  +      +  L GH+ +V+ V +S DG    SG  DG + LWDL  G 
Sbjct  7    DKTIIMWKLTRDETNYGIPQRALRGHSHFVSDVVISSDGQFALSGSGDGTLRLWDLTTGT  66

Query  484  -KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAE  308
              + +      ++     S NR  +  + + +IK+W+      V    V  +  SE    
Sbjct  67   TTRRFVGHTKDVLSVAFSSDNRQIVSGSRDKTIKLWNTLG---VCKYTVQDESHSEW---  120

Query  307  GNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY*MEEFRRSHMIIGHVCYL  128
                      + C   S N+    + S   D +++VW +      + + +H  IGH  YL
Sbjct  121  ----------VSCVRFSPNSSNPIIVSCGWDKLVKVWNLANC---KLKTNH--IGHTGYL  165

Query  127  S  125
            +
Sbjct  166  N  166



>ref|XP_009489930.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1, partial [Pelecanus crispus]
Length=289

 Score =   241 bits (616),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 119/186 (64%), Positives = 144/186 (77%), Gaps = 11/186 (6%)
 Frame = -1

Query  748  CKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVN  569
            CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++   GHTGY+N
Sbjct  110  CKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGYLN  168

Query  568  TVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASI  389
            TV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  SI
Sbjct  169  TVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSI  228

Query  388  KIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            KIWDLE K I+VD         E+  E  +T++K +   CTSL+W+ADG TLF+GYTD +
Sbjct  229  KIWDLEGK-IIVD---------ELKQEVISTSSKAEPPQCTSLAWSADGQTLFAGYTDNL  278

Query  208  IRVWGI  191
            +RVW +
Sbjct  279  VRVWQV  284


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 44/181 (24%), Positives = 77/181 (43%), Gaps = 28/181 (15%)
 Frame = -1

Query  646  DRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEG-  485
            D+T+ +W L+  +      +  L GH+ +V+ V +S DG    SG  DG + LWDL  G 
Sbjct  9    DKTIIMWKLTRDETNYGIPQRALRGHSHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGT  68

Query  484  -KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAE  308
              + +      ++     S NR  +  + + +IK+W+      V    V  +  SE    
Sbjct  69   TTRRFVGHTKDVLSVAFSSDNRQIVSGSRDKTIKLWNTLG---VCKYTVQDESHSEW---  122

Query  307  GNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY*MEEFRRSHMIIGHVCYL  128
                      + C   S N+    + S   D +++VW +      + + +H  IGH  YL
Sbjct  123  ----------VSCVRFSPNSSNPIIVSCGWDKLVKVWNLANC---KLKTNH--IGHTGYL  167

Query  127  S  125
            +
Sbjct  168  N  168



>ref|XP_007070338.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1, partial [Chelonia mydas]
Length=282

 Score =   241 bits (616),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 119/186 (64%), Positives = 144/186 (77%), Gaps = 11/186 (6%)
 Frame = -1

Query  748  CKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVN  569
            CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++   GHTGY+N
Sbjct  103  CKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGYLN  161

Query  568  TVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASI  389
            TV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  SI
Sbjct  162  TVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSI  221

Query  388  KIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            KIWDLE K I+VD         E+  E  +T++K +   CTSL+W+ADG TLF+GYTD +
Sbjct  222  KIWDLEGK-IIVD---------ELKQEVISTSSKAEPPQCTSLAWSADGQTLFAGYTDNL  271

Query  208  IRVWGI  191
            +RVW +
Sbjct  272  VRVWQV  277



>gb|EDL33792.1| guanine nucleotide binding protein (G protein), beta polypeptide 
2 like 1, isoform CRA_c [Mus musculus]
Length=264

 Score =   241 bits (614),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 119/186 (64%), Positives = 144/186 (77%), Gaps = 11/186 (6%)
 Frame = -1

Query  748  CKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVN  569
            CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++   GHTGY+N
Sbjct  85   CKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGYLN  143

Query  568  TVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASI  389
            TV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  SI
Sbjct  144  TVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSI  203

Query  388  KIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            KIWDLE K I+VD         E+  E  +T++K +   CTSL+W+ADG TLF+GYTD +
Sbjct  204  KIWDLEGK-IIVD---------ELKQEVISTSSKAEPPQCTSLAWSADGQTLFAGYTDNL  253

Query  208  IRVWGI  191
            +RVW +
Sbjct  254  VRVWQV  259



>dbj|BAB28114.1| unnamed protein product [Mus musculus]
Length=280

 Score =   241 bits (615),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 119/186 (64%), Positives = 144/186 (77%), Gaps = 11/186 (6%)
 Frame = -1

Query  748  CKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVN  569
            CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++   GHTGY+N
Sbjct  101  CKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGYLN  159

Query  568  TVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASI  389
            TV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  SI
Sbjct  160  TVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSI  219

Query  388  KIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            KIWDLE K I+VD         E+  E  +T++K +   CTSL+W+ADG TLF+GYTD +
Sbjct  220  KIWDLEGK-IIVD---------ELKQEVISTSSKAEPPQCTSLAWSADGQTLFAGYTDNL  269

Query  208  IRVWGI  191
            +RVW +
Sbjct  270  VRVWQV  275



>ref|XP_009462428.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 [Nipponia nippon]
Length=307

 Score =   242 bits (618),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 119/186 (64%), Positives = 144/186 (77%), Gaps = 11/186 (6%)
 Frame = -1

Query  748  CKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVN  569
            CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++   GHTGY+N
Sbjct  128  CKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGYLN  186

Query  568  TVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASI  389
            TV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  SI
Sbjct  187  TVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSI  246

Query  388  KIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            KIWDLE K I+VD         E+  E  +T++K +   CTSL+W+ADG TLF+GYTD +
Sbjct  247  KIWDLEGK-IIVD---------ELKQEVISTSSKAEPPQCTSLAWSADGQTLFAGYTDNL  296

Query  208  IRVWGI  191
            +RVW +
Sbjct  297  VRVWQV  302


 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 44/181 (24%), Positives = 77/181 (43%), Gaps = 28/181 (15%)
 Frame = -1

Query  646  DRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEG-  485
            D+T+ +W L+  +      +  L GH+ +V+ V +S DG    SG  DG + LWDL  G 
Sbjct  27   DKTIIMWKLTRDETNYGIPQRALRGHSHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGT  86

Query  484  -KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAE  308
              + +      ++     S NR  +  + + +IK+W+      V    V  +  SE    
Sbjct  87   TTRRFVGHTKDVLSVAFSSDNRQIVSGSRDKTIKLWNTLG---VCKYTVQDESHSEW---  140

Query  307  GNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY*MEEFRRSHMIIGHVCYL  128
                      + C   S N+    + S   D +++VW +      + + +H  IGH  YL
Sbjct  141  ----------VSCVRFSPNSSNPIIVSCGWDKLVKVWNLANC---KLKTNH--IGHTGYL  185

Query  127  S  125
            +
Sbjct  186  N  186



>gb|KFQ96249.1| Guanine nucleotide-binding protein subunit beta-2-like 1, partial 
[Nipponia nippon]
Length=291

 Score =   241 bits (616),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 119/186 (64%), Positives = 144/186 (77%), Gaps = 11/186 (6%)
 Frame = -1

Query  748  CKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVN  569
            CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++   GHTGY+N
Sbjct  112  CKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGYLN  170

Query  568  TVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASI  389
            TV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  SI
Sbjct  171  TVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSI  230

Query  388  KIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            KIWDLE K I+VD         E+  E  +T++K +   CTSL+W+ADG TLF+GYTD +
Sbjct  231  KIWDLEGK-IIVD---------ELKQEVISTSSKAEPPQCTSLAWSADGQTLFAGYTDNL  280

Query  208  IRVWGI  191
            +RVW +
Sbjct  281  VRVWQV  286


 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 44/181 (24%), Positives = 77/181 (43%), Gaps = 28/181 (15%)
 Frame = -1

Query  646  DRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEG-  485
            D+T+ +W L+  +      +  L GH+ +V+ V +S DG    SG  DG + LWDL  G 
Sbjct  11   DKTIIMWKLTRDETNYGIPQRALRGHSHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGT  70

Query  484  -KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAE  308
              + +      ++     S NR  +  + + +IK+W+      V    V  +  SE    
Sbjct  71   TTRRFVGHTKDVLSVAFSSDNRQIVSGSRDKTIKLWNTLG---VCKYTVQDESHSEW---  124

Query  307  GNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY*MEEFRRSHMIIGHVCYL  128
                      + C   S N+    + S   D +++VW +      + + +H  IGH  YL
Sbjct  125  ----------VSCVRFSPNSSNPIIVSCGWDKLVKVWNLANC---KLKTNH--IGHTGYL  169

Query  127  S  125
            +
Sbjct  170  N  170



>gb|AEW43729.1| activated protein kinase C receptor, partial [Epinephelus coioides]
Length=302

 Score =   242 bits (617),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 119/186 (64%), Positives = 143/186 (77%), Gaps = 11/186 (6%)
 Frame = -1

Query  748  CKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVN  569
            CKYTIQD +GH+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++   GHTG++N
Sbjct  123  CKYTIQD-EGHSEWVSCVRFSPNSQNPIIVSCGWDKMVKVWNLTNCKLKTNHIGHTGFLN  181

Query  568  TVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASI  389
            TV VSPDGSLCASGG+DG  +LWDL EGK LY+LD+G  I+ALCFSPNRYWLCAAT  SI
Sbjct  182  TVTVSPDGSLCASGGRDGQAMLWDLNEGKHLYTLDSGDTINALCFSPNRYWLCAATGPSI  241

Query  388  KIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            KIWDLE K IV +LR           E  +T +K +   CTSL+W+ADG TLF+GYTD +
Sbjct  242  KIWDLEGKVIVDELR----------QEVISTNSKAEPPQCTSLAWSADGQTLFAGYTDNL  291

Query  208  IRVWGI  191
            IRVW +
Sbjct  292  IRVWQV  297



>ref|XP_010296751.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1, partial [Balearica regulorum gibbericeps]
Length=286

 Score =   241 bits (616),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 119/186 (64%), Positives = 144/186 (77%), Gaps = 11/186 (6%)
 Frame = -1

Query  748  CKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVN  569
            CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++   GHTGY+N
Sbjct  107  CKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGYLN  165

Query  568  TVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASI  389
            TV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  SI
Sbjct  166  TVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSI  225

Query  388  KIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            KIWDLE K I+VD         E+  E  +T++K +   CTSL+W+ADG TLF+GYTD +
Sbjct  226  KIWDLEGK-IIVD---------ELKQEVISTSSKAEPPQCTSLAWSADGQTLFAGYTDNL  275

Query  208  IRVWGI  191
            +RVW +
Sbjct  276  VRVWQV  281



>gb|KFQ99079.1| Guanine nucleotide-binding protein subunit beta-2-like 1, partial 
[Opisthocomus hoazin]
Length=281

 Score =   241 bits (615),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 119/186 (64%), Positives = 144/186 (77%), Gaps = 11/186 (6%)
 Frame = -1

Query  748  CKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVN  569
            CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++   GHTGY+N
Sbjct  102  CKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGYLN  160

Query  568  TVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASI  389
            TV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  SI
Sbjct  161  TVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSI  220

Query  388  KIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            KIWDLE K I+VD         E+  E  +T++K +   CTSL+W+ADG TLF+GYTD +
Sbjct  221  KIWDLEGK-IIVD---------ELKQEVISTSSKAEPPQCTSLAWSADGQTLFAGYTDNL  270

Query  208  IRVWGI  191
            +RVW +
Sbjct  271  VRVWQV  276


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 44/181 (24%), Positives = 77/181 (43%), Gaps = 28/181 (15%)
 Frame = -1

Query  646  DRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEG-  485
            D+T+ +W L+  +      +  L GH+ +V+ V +S DG    SG  DG + LWDL  G 
Sbjct  1    DKTIIMWKLTRDETNYGIPQRALRGHSHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGT  60

Query  484  -KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAE  308
              + +      ++     S NR  +  + + +IK+W+      V    V  +  SE    
Sbjct  61   TTRRFVGHTKDVLSVAFSSDNRQIVSGSRDKTIKLWNTLG---VCKYTVQDESHSEW---  114

Query  307  GNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY*MEEFRRSHMIIGHVCYL  128
                      + C   S N+    + S   D +++VW +      + + +H  IGH  YL
Sbjct  115  ----------VSCVRFSPNSSNPIIVSCGWDKLVKVWNLANC---KLKTNH--IGHTGYL  159

Query  127  S  125
            +
Sbjct  160  N  160



>gb|KFQ66729.1| Guanine nucleotide-binding protein subunit beta-2-like 1, partial 
[Pelecanus crispus]
Length=291

 Score =   241 bits (616),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 119/186 (64%), Positives = 144/186 (77%), Gaps = 11/186 (6%)
 Frame = -1

Query  748  CKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVN  569
            CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++   GHTGY+N
Sbjct  112  CKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGYLN  170

Query  568  TVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASI  389
            TV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  SI
Sbjct  171  TVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSI  230

Query  388  KIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            KIWDLE K I+VD         E+  E  +T++K +   CTSL+W+ADG TLF+GYTD +
Sbjct  231  KIWDLEGK-IIVD---------ELKQEVISTSSKAEPPQCTSLAWSADGQTLFAGYTDNL  280

Query  208  IRVWGI  191
            +RVW +
Sbjct  281  VRVWQV  286


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 44/181 (24%), Positives = 77/181 (43%), Gaps = 28/181 (15%)
 Frame = -1

Query  646  DRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEG-  485
            D+T+ +W L+  +      +  L GH+ +V+ V +S DG    SG  DG + LWDL  G 
Sbjct  11   DKTIIMWKLTRDETNYGIPQRALRGHSHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGT  70

Query  484  -KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAE  308
              + +      ++     S NR  +  + + +IK+W+      V    V  +  SE    
Sbjct  71   TTRRFVGHTKDVLSVAFSSDNRQIVSGSRDKTIKLWNTLG---VCKYTVQDESHSEW---  124

Query  307  GNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY*MEEFRRSHMIIGHVCYL  128
                      + C   S N+    + S   D +++VW +      + + +H  IGH  YL
Sbjct  125  ----------VSCVRFSPNSSNPIIVSCGWDKLVKVWNLANC---KLKTNH--IGHTGYL  169

Query  127  S  125
            +
Sbjct  170  N  170



>gb|KFQ89059.1| Guanine nucleotide-binding protein subunit beta-2-like 1, partial 
[Phoenicopterus ruber ruber]
Length=290

 Score =   241 bits (616),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 119/186 (64%), Positives = 144/186 (77%), Gaps = 11/186 (6%)
 Frame = -1

Query  748  CKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVN  569
            CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++   GHTGY+N
Sbjct  111  CKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGYLN  169

Query  568  TVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASI  389
            TV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  SI
Sbjct  170  TVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSI  229

Query  388  KIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            KIWDLE K I+VD         E+  E  +T++K +   CTSL+W+ADG TLF+GYTD +
Sbjct  230  KIWDLEGK-IIVD---------ELKQEVISTSSKAEPPQCTSLAWSADGQTLFAGYTDNL  279

Query  208  IRVWGI  191
            +RVW +
Sbjct  280  VRVWQV  285


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 47/190 (25%), Positives = 81/190 (43%), Gaps = 29/190 (15%)
 Frame = -1

Query  670  PTIVSGS-WDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAVSPDGSLCASGGKDGVI  509
            P + S S  D+T+ +W L+  +      +  L GH+ +V+ V +S DG    SG  DG +
Sbjct  1    PNLTSASPTDKTIIMWKLTRDETNYGIPQRALRGHSHFVSDVVISSDGQFALSGSWDGTL  60

Query  508  LLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDL  335
             LWDL  G   + +      ++     S NR  +  + + +IK+W+      V    V  
Sbjct  61   RLWDLTTGTTTRRFVGHTKDVLSVAFSSDNRQIVSGSRDKTIKLWNTLG---VCKYTVQD  117

Query  334  KQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY*MEEFRRSH  155
            +  SE              + C   S N+    + S   D +++VW +      + + +H
Sbjct  118  ESHSEW-------------VSCVRFSPNSSNPIIVSCGWDKLVKVWNLANC---KLKTNH  161

Query  154  MIIGHVCYLS  125
              IGH  YL+
Sbjct  162  --IGHTGYLN  169



>ref|XP_006037851.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 [Alligator sinensis]
Length=306

 Score =   242 bits (617),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 146/186 (78%), Gaps = 11/186 (6%)
 Frame = -1

Query  748  CKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVN  569
            CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++   GHTGY+N
Sbjct  127  CKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGYLN  185

Query  568  TVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASI  389
            TV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  SI
Sbjct  186  TVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSI  245

Query  388  KIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            KIWDLE K I+VD   +LKQE        +T++K +   CTSL+W+ADG TLF+GYTD +
Sbjct  246  KIWDLEGK-IIVD---ELKQEVI------STSSKAEPPQCTSLAWSADGQTLFAGYTDNL  295

Query  208  IRVWGI  191
            +RVW +
Sbjct  296  VRVWQV  301


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 44/181 (24%), Positives = 77/181 (43%), Gaps = 28/181 (15%)
 Frame = -1

Query  646  DRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEG-  485
            D+T+ +W L+  +      +  L GH+ +V+ V +S DG    SG  DG + LWDL  G 
Sbjct  26   DKTIIMWKLTRDETNYGIPQRALRGHSHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGT  85

Query  484  -KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAE  308
              + +      ++     S NR  +  + + +IK+W+      V    V  +  SE    
Sbjct  86   TTRRFVGHTKDVLSVAFSSDNRQIVSGSRDKTIKLWNTLG---VCKYTVQDESHSEW---  139

Query  307  GNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY*MEEFRRSHMIIGHVCYL  128
                      + C   S N+    + S   D +++VW +      + + +H  IGH  YL
Sbjct  140  ----------VSCVRFSPNSSNPIIVSCGWDKLVKVWNLANC---KLKTNH--IGHTGYL  184

Query  127  S  125
            +
Sbjct  185  N  185



>ref|XP_009701898.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1, partial [Cariama cristata]
Length=301

 Score =   242 bits (617),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 119/186 (64%), Positives = 144/186 (77%), Gaps = 11/186 (6%)
 Frame = -1

Query  748  CKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVN  569
            CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++   GHTGY+N
Sbjct  122  CKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGYLN  180

Query  568  TVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASI  389
            TV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  SI
Sbjct  181  TVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSI  240

Query  388  KIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            KIWDLE K I+VD         E+  E  +T++K +   CTSL+W+ADG TLF+GYTD +
Sbjct  241  KIWDLEGK-IIVD---------ELKQEVISTSSKAEPPQCTSLAWSADGQTLFAGYTDNL  290

Query  208  IRVWGI  191
            +RVW +
Sbjct  291  VRVWQV  296


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 47/194 (24%), Positives = 81/194 (42%), Gaps = 34/194 (18%)
 Frame = -1

Query  685  PSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAVSPDGSLCASGGK  521
            P +  PT      D+T+ +W L+  +      +  L GH+ +V+ V +S DG    SG  
Sbjct  14   PRSASPT------DKTIIMWKLTRDETNYGIPQRALRGHSHFVSDVVISSDGQFALSGSW  67

Query  520  DGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDL  347
            DG + LWDL  G   + +      ++     S NR  +  + + +IK+W+      V   
Sbjct  68   DGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSSDNRQIVSGSRDKTIKLWNTLG---VCKY  124

Query  346  RVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY*MEEF  167
             V  +  SE              + C   S N+    + S   D +++VW +      + 
Sbjct  125  TVQDESHSEW-------------VSCVRFSPNSSNPIIVSCGWDKLVKVWNLANC---KL  168

Query  166  RRSHMIIGHVCYLS  125
            + +H  IGH  YL+
Sbjct  169  KTNH--IGHTGYLN  180



>dbj|BAE40068.1| unnamed protein product [Mus musculus]
 dbj|BAE40156.1| unnamed protein product [Mus musculus]
Length=317

 Score =   242 bits (618),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 119/186 (64%), Positives = 144/186 (77%), Gaps = 11/186 (6%)
 Frame = -1

Query  748  CKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVN  569
            CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++   GHTGY+N
Sbjct  138  CKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGYLN  196

Query  568  TVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASI  389
            TV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  SI
Sbjct  197  TVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSI  256

Query  388  KIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  209
            KIWDLE K I+VD         E+  E  +T++K +   CTSL+W+ADG TLF+GYTD +
Sbjct  257  KIWDLEGK-IIVD---------ELKQEVISTSSKAEPPQCTSLAWSADGQTLFAGYTDNL  306

Query  208  IRVWGI  191
            +RVW +
Sbjct  307  VRVWQV  312


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 53/206 (26%), Positives = 90/206 (44%), Gaps = 29/206 (14%)
 Frame = -1

Query  721  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  557
            GHN WV+ +  +P      I+S S D+T+ +W L+  +      +  L GH+ +V+ V +
Sbjct  13   GHNGWVTQIATTPQ-FPDMILSASRDKTIIMWKLTRDETNYGIPQRALRGHSHFVSDVVI  71

Query  556  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  383
            S DG    SG  DG + LWDL  G   + +      ++     S NR  +  + + +IK+
Sbjct  72   SSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSSDNRQIVSGSQDKTIKL  131

Query  382  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  203
            W+      V    V  +  SE              + C   S N+    + S   D +++
Sbjct  132  WNTLG---VCKYTVQDESHSEW-------------VSCVRFSPNSSNPIIVSCGWDKLVK  175

Query  202  VWGIGRY*MEEFRRSHMIIGHVCYLS  125
            VW +      + + +H  IGH  YL+
Sbjct  176  VWNLANC---KLKTNH--IGHTGYLN  196



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1387667965840