BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF029C04

Length=705
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009771440.1|  PREDICTED: uncharacterized protein LOC104221976    242   2e-74   Nicotiana sylvestris
ref|XP_009617293.1|  PREDICTED: uncharacterized protein LOC104109646    237   2e-72   Nicotiana tomentosiformis
ref|XP_006364278.1|  PREDICTED: uncharacterized protein LOC102598357    232   1e-70   Solanum tuberosum [potatoes]
ref|XP_004245192.1|  PREDICTED: uncharacterized protein LOC101262737    232   2e-70   Solanum lycopersicum
emb|CDP04798.1|  unnamed protein product                                232   2e-70   Coffea canephora [robusta coffee]
ref|XP_011085499.1|  PREDICTED: uncharacterized protein LOC105167438    231   2e-70   Sesamum indicum [beniseed]
gb|EYU21948.1|  hypothetical protein MIMGU_mgv1a0096341mg               228   1e-69   Erythranthe guttata [common monkey flower]
ref|XP_011081926.1|  PREDICTED: uncharacterized protein LOC105164832    228   1e-68   Sesamum indicum [beniseed]
ref|XP_002515557.1|  conserved hypothetical protein                     224   8e-68   
ref|XP_006399647.1|  hypothetical protein EUTSA_v10013887mg             223   3e-67   
gb|KDP33619.1|  hypothetical protein JCGZ_07190                         223   3e-67   Jatropha curcas
ref|XP_006399646.1|  hypothetical protein EUTSA_v10013887mg             223   4e-67   Eutrema salsugineum [saltwater cress]
ref|XP_010491872.1|  PREDICTED: uncharacterized protein LOC104769372    223   4e-67   Camelina sativa [gold-of-pleasure]
ref|XP_010453190.1|  PREDICTED: uncharacterized protein LOC104735158    223   5e-67   Camelina sativa [gold-of-pleasure]
dbj|BAH57107.1|  AT5G25460                                              216   6e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010254319.1|  PREDICTED: uncharacterized protein LOC104595325    222   7e-67   Nelumbo nucifera [Indian lotus]
ref|XP_006287989.1|  hypothetical protein CARUB_v10001222mg             221   2e-66   Capsella rubella
ref|XP_004138737.1|  PREDICTED: uncharacterized protein LOC101219952    221   2e-66   Cucumis sativus [cucumbers]
ref|NP_196703.1|  uncharacterized protein                               221   2e-66   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD93856.1|  hypothetical protein                                   216   3e-66   Arabidopsis thaliana [mouse-ear cress]
gb|AAM63507.1|  unknown                                                 220   4e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010541619.1|  PREDICTED: uncharacterized protein LOC104815031    220   4e-66   Tarenaya hassleriana [spider flower]
ref|XP_011019764.1|  PREDICTED: uncharacterized protein LOC105122387    219   4e-66   Populus euphratica
ref|XP_002871473.1|  hypothetical protein ARALYDRAFT_487977             220   4e-66   
ref|XP_010519935.1|  PREDICTED: uncharacterized protein LOC104799224    220   4e-66   Tarenaya hassleriana [spider flower]
ref|XP_010419712.1|  PREDICTED: uncharacterized protein LOC104705408    220   4e-66   Camelina sativa [gold-of-pleasure]
ref|XP_011019761.1|  PREDICTED: uncharacterized protein LOC105122382    220   5e-66   Populus euphratica
gb|AAN31807.1|  unknown protein                                         220   6e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010493802.1|  PREDICTED: uncharacterized protein LOC104771027    219   8e-66   Camelina sativa [gold-of-pleasure]
ref|XP_010454874.1|  PREDICTED: uncharacterized protein LOC104736571    219   8e-66   Camelina sativa [gold-of-pleasure]
ref|XP_010421395.1|  PREDICTED: uncharacterized protein LOC104706866    219   9e-66   Camelina sativa [gold-of-pleasure]
ref|XP_007223355.1|  hypothetical protein PRUPE_ppa007452mg             219   9e-66   Prunus persica
ref|XP_006287976.1|  hypothetical protein CARUB_v10001211mg             219   9e-66   Capsella rubella
ref|XP_008445161.1|  PREDICTED: uncharacterized protein LOC103488281    221   1e-65   
ref|XP_009121952.1|  PREDICTED: uncharacterized protein LOC103846721    219   1e-65   Brassica rapa
ref|XP_010526203.1|  PREDICTED: uncharacterized protein LOC104803829    219   1e-65   Tarenaya hassleriana [spider flower]
emb|CDX85713.1|  BnaA02g01000D                                          218   2e-65   
ref|XP_006483312.1|  PREDICTED: uncharacterized protein LOC102608149    218   2e-65   Citrus sinensis [apfelsine]
ref|XP_009125805.1|  PREDICTED: uncharacterized protein LOC103850771    218   2e-65   Brassica rapa
ref|XP_002324280.2|  hypothetical protein POPTR_0018s01390g             219   2e-65   
ref|XP_008219896.1|  PREDICTED: uncharacterized protein LOC103320060    218   2e-65   Prunus mume [ume]
gb|KFK27809.1|  hypothetical protein AALP_AA8G432300                    218   3e-65   Arabis alpina [alpine rockcress]
emb|CDY19801.1|  BnaA09g04540D                                          218   3e-65   Brassica napus [oilseed rape]
emb|CDX91217.1|  BnaC02g03800D                                          218   4e-65   
ref|XP_010106829.1|  hypothetical protein L484_006602                   213   4e-65   
ref|NP_197928.1|  UF642 l-GalL-responsive protein 1                     218   5e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010048991.1|  PREDICTED: uncharacterized protein LOC104437692    216   5e-65   Eucalyptus grandis [rose gum]
ref|XP_009345289.1|  PREDICTED: uncharacterized protein LOC103937097    217   6e-65   Pyrus x bretschneideri [bai li]
ref|XP_009334778.1|  PREDICTED: uncharacterized protein LOC103927565    217   6e-65   Pyrus x bretschneideri [bai li]
gb|ABK94923.1|  unknown                                                 217   7e-65   Populus trichocarpa [western balsam poplar]
ref|XP_004291483.1|  PREDICTED: uncharacterized protein LOC101294330    217   9e-65   Fragaria vesca subsp. vesca
ref|XP_010249980.1|  PREDICTED: uncharacterized protein LOC104592350    217   9e-65   Nelumbo nucifera [Indian lotus]
ref|XP_006394799.1|  hypothetical protein EUTSA_v10004442mg             217   9e-65   Eutrema salsugineum [saltwater cress]
gb|KHG29602.1|  Allergen Act d 3                                        217   1e-64   Gossypium arboreum [tree cotton]
ref|XP_002284962.1|  PREDICTED: uncharacterized protein LOC100252479    216   1e-64   Vitis vinifera
emb|CDX80516.1|  BnaC07g29280D                                          214   1e-64   
ref|XP_002308647.2|  hypothetical protein POPTR_0006s26630g             218   1e-64   
gb|AAL06839.1|  AT5g25460/F18G18_200                                    216   1e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006450498.1|  hypothetical protein CICLE_v10008711mg             216   1e-64   Citrus clementina [clementine]
ref|XP_008378299.1|  PREDICTED: uncharacterized protein LOC103441403    216   1e-64   
ref|XP_007161233.1|  hypothetical protein PHAVU_001G053100g             216   2e-64   Phaseolus vulgaris [French bean]
gb|KFK25408.1|  hypothetical protein AALP_AA8G110600                    216   2e-64   Arabis alpina [alpine rockcress]
ref|XP_002872166.1|  hypothetical protein ARALYDRAFT_910605             216   2e-64   Arabidopsis lyrata subsp. lyrata
ref|XP_011026488.1|  PREDICTED: uncharacterized protein LOC105127071    216   3e-64   Populus euphratica
gb|AAM61720.1|  unknown                                                 216   3e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006412472.1|  hypothetical protein EUTSA_v10025706mg             214   3e-64   
gb|EPS73289.1|  hypothetical protein M569_01466                         215   3e-64   Genlisea aurea
gb|KHN06654.1|  hypothetical protein glysoja_037506                     215   3e-64   Glycine soja [wild soybean]
ref|XP_006601137.1|  PREDICTED: uncharacterized protein LOC100813...    215   3e-64   
gb|KJB80694.1|  hypothetical protein B456_013G110800                    214   4e-64   Gossypium raimondii
ref|XP_008394047.1|  PREDICTED: uncharacterized protein LOC103456171    215   4e-64   
emb|CAA06490.1|  hypothetical protein                                   209   4e-64   Cicer arietinum [garbanzo]
gb|KJB80693.1|  hypothetical protein B456_013G110800                    215   5e-64   Gossypium raimondii
emb|CDY54909.1|  BnaC02g48660D                                          214   6e-64   Brassica napus [oilseed rape]
ref|XP_009151074.1|  PREDICTED: uncharacterized protein LOC103874406    214   7e-64   Brassica rapa
emb|CAA22573.1|  putative protein                                       213   7e-64   Arabidopsis thaliana [mouse-ear cress]
dbj|BAE98407.1|  hypothetical protein                                   214   9e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009129962.1|  PREDICTED: uncharacterized protein LOC103854751    214   9e-64   Brassica rapa
ref|XP_006285882.1|  hypothetical protein CARUB_v10007385mg             214   9e-64   
emb|CDX97108.1|  BnaC09g45170D                                          214   1e-63   
ref|XP_002867243.1|  hypothetical protein ARALYDRAFT_913203             213   2e-63   Arabidopsis lyrata subsp. lyrata
ref|XP_003544618.1|  PREDICTED: uncharacterized protein LOC100776765    213   2e-63   Glycine max [soybeans]
emb|CDX68849.1|  BnaC01g06040D                                          213   2e-63   
ref|NP_567894.1|  uncharacterized protein                               213   3e-63   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006841925.1|  hypothetical protein AMTR_s00042p00185900          212   3e-63   
ref|XP_010447383.1|  PREDICTED: uncharacterized protein LOC104730027    212   5e-63   Camelina sativa [gold-of-pleasure]
ref|XP_010432718.1|  PREDICTED: uncharacterized protein LOC104716937    212   5e-63   Camelina sativa [gold-of-pleasure]
ref|XP_003588711.1|  hypothetical protein MTR_1g011800                  211   6e-63   
ref|XP_009125963.1|  PREDICTED: uncharacterized protein LOC103850912    211   9e-63   Brassica rapa
gb|AES58962.2|  plant/F18G18-200 protein                                211   2e-62   Medicago truncatula
gb|ACJ84308.1|  unknown                                                 211   2e-62   Medicago truncatula
gb|KJB07801.1|  hypothetical protein B456_001G045200                    211   2e-62   Gossypium raimondii
gb|KJB07802.1|  hypothetical protein B456_001G045200                    211   3e-62   Gossypium raimondii
ref|XP_007013814.1|  Uncharacterized protein isoform 2                  210   3e-62   Theobroma cacao [chocolate]
gb|KHG19965.1|  putative e3 ubiquitin-protein ligase hul4               210   3e-62   Gossypium arboreum [tree cotton]
ref|XP_009407651.1|  PREDICTED: uncharacterized protein LOC103990295    206   5e-62   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007013813.1|  Uncharacterized protein isoform 1                  211   7e-62   
ref|XP_004498654.1|  PREDICTED: uncharacterized protein LOC101508759    209   1e-61   Cicer arietinum [garbanzo]
gb|AAB41813.1|  unknown protein                                         208   2e-61   Medicago sativa [alfalfa]
ref|XP_010110340.1|  GTP-binding nuclear protein                        213   2e-61   
ref|XP_010670694.1|  PREDICTED: uncharacterized protein LOC104887687    207   4e-61   Beta vulgaris subsp. vulgaris [field beet]
emb|CDX69757.1|  BnaA10g21060D                                          218   6e-61   
ref|XP_006341715.1|  PREDICTED: uncharacterized protein LOC102601890    205   3e-60   
ref|XP_009401767.1|  PREDICTED: uncharacterized protein LOC103985700    202   5e-60   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010918669.1|  PREDICTED: uncharacterized protein LOC105042950    204   5e-60   Elaeis guineensis
ref|XP_004235717.1|  PREDICTED: uncharacterized protein LOC101252763    204   5e-60   Solanum lycopersicum
ref|XP_009778816.1|  PREDICTED: uncharacterized protein LOC104228110    204   7e-60   Nicotiana sylvestris
ref|XP_004241713.1|  PREDICTED: uncharacterized protein LOC101268115    204   1e-59   Solanum lycopersicum
ref|XP_006356190.1|  PREDICTED: uncharacterized protein LOC102589576    204   1e-59   Solanum tuberosum [potatoes]
ref|XP_006581022.1|  PREDICTED: uncharacterized protein LOC100802...    202   3e-59   
gb|KHN07099.1|  hypothetical protein glysoja_023282                     202   3e-59   Glycine soja [wild soybean]
ref|XP_009590498.1|  PREDICTED: uncharacterized protein LOC104087663    202   3e-59   Nicotiana tomentosiformis
ref|XP_009591297.1|  PREDICTED: uncharacterized protein LOC104088341    202   3e-59   Nicotiana tomentosiformis
gb|KHG21629.1|  GTPase Der                                              200   5e-59   Gossypium arboreum [tree cotton]
ref|XP_010048243.1|  PREDICTED: uncharacterized protein LOC104437065    202   6e-59   Eucalyptus grandis [rose gum]
ref|XP_009389493.1|  PREDICTED: uncharacterized protein LOC103976040    201   7e-59   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010654739.1|  PREDICTED: uncharacterized protein LOC100261739    197   8e-59   Vitis vinifera
gb|KDO83473.1|  hypothetical protein CISIN_1g017636mg                   199   9e-59   Citrus sinensis [apfelsine]
gb|KJB70569.1|  hypothetical protein B456_011G080100                    200   9e-59   Gossypium raimondii
ref|XP_006346648.1|  PREDICTED: uncharacterized protein LOC102598480    201   2e-58   
gb|KHG06895.1|  Agmatine deiminase                                      200   2e-58   Gossypium arboreum [tree cotton]
gb|KJB70568.1|  hypothetical protein B456_011G080100                    200   2e-58   Gossypium raimondii
ref|XP_009758146.1|  PREDICTED: uncharacterized protein LOC104210873    200   3e-58   Nicotiana sylvestris
ref|XP_007150706.1|  hypothetical protein PHAVU_005G1745000g            197   5e-58   Phaseolus vulgaris [French bean]
ref|XP_006439076.1|  hypothetical protein CICLE_v10031881mg             198   1e-57   Citrus clementina [clementine]
ref|XP_003531698.1|  PREDICTED: uncharacterized protein LOC100779277    198   2e-57   Glycine max [soybeans]
gb|KHN07098.1|  hypothetical protein glysoja_023281                     196   2e-57   Glycine soja [wild soybean]
gb|KHN47787.1|  hypothetical protein glysoja_029205                     197   2e-57   Glycine soja [wild soybean]
gb|AGV54541.1|  hypothetical protein                                    197   3e-57   Phaseolus vulgaris [French bean]
ref|XP_010914930.1|  PREDICTED: uncharacterized protein LOC105040204    197   3e-57   Elaeis guineensis
ref|XP_009598172.1|  PREDICTED: uncharacterized protein LOC104094024    197   3e-57   Nicotiana tomentosiformis
ref|NP_001242447.1|  uncharacterized protein LOC100802444 precursor     197   5e-57   Glycine max [soybeans]
ref|XP_008792101.1|  PREDICTED: uncharacterized protein LOC103708794    197   5e-57   Phoenix dactylifera
ref|XP_008775036.1|  PREDICTED: uncharacterized protein LOC103695476    197   5e-57   Phoenix dactylifera
gb|EMS52012.1|  hypothetical protein TRIUR3_31218                       195   7e-57   Triticum urartu
gb|KHG10708.1|  Allergen Act d 3                                        195   7e-57   Gossypium arboreum [tree cotton]
ref|XP_011072257.1|  PREDICTED: uncharacterized protein LOC105157546    196   7e-57   
ref|XP_003526423.1|  PREDICTED: uncharacterized protein LOC100801917    196   9e-57   
gb|KDP37140.1|  hypothetical protein JCGZ_06196                         189   1e-56   Jatropha curcas
emb|CBI36253.3|  unnamed protein product                                197   1e-56   Vitis vinifera
dbj|BAK03126.1|  predicted protein                                      196   1e-56   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011035644.1|  PREDICTED: uncharacterized protein LOC105133377    196   1e-56   Populus euphratica
ref|XP_002517567.1|  conserved hypothetical protein                     196   1e-56   Ricinus communis
ref|XP_011081171.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    194   2e-56   Sesamum indicum [beniseed]
gb|KJB68131.1|  hypothetical protein B456_010G227400                    194   2e-56   Gossypium raimondii
gb|AFK48067.1|  unknown                                                 190   2e-56   Lotus japonicus
ref|XP_011040006.1|  PREDICTED: uncharacterized protein LOC105136392    192   3e-56   Populus euphratica
ref|XP_007023946.1|  Uncharacterized protein TCM_028364                 195   3e-56   Theobroma cacao [chocolate]
ref|XP_004252488.1|  PREDICTED: uncharacterized protein LOC101250580    195   4e-56   Solanum lycopersicum
ref|XP_009764126.1|  PREDICTED: uncharacterized protein LOC104215887    194   6e-56   Nicotiana sylvestris
ref|XP_004486698.1|  PREDICTED: uncharacterized protein LOC101495368    194   7e-56   Cicer arietinum [garbanzo]
gb|EMT16005.1|  hypothetical protein F775_13621                         193   8e-56   
gb|KHN44154.1|  hypothetical protein glysoja_031815                     193   2e-55   Glycine soja [wild soybean]
ref|XP_002303263.1|  hypothetical protein POPTR_0003s05850g             193   2e-55   
dbj|BAD16016.1|  unknown protein                                        191   2e-55   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009333642.1|  PREDICTED: uncharacterized protein LOC103926567    186   2e-55   Pyrus x bretschneideri [bai li]
ref|XP_007218161.1|  hypothetical protein PRUPE_ppa007461mg             190   3e-55   
ref|XP_002298115.2|  hypothetical protein POPTR_0001s17430g             192   3e-55   Populus trichocarpa [western balsam poplar]
ref|XP_004307221.1|  PREDICTED: uncharacterized protein LOC101292742    192   3e-55   Fragaria vesca subsp. vesca
ref|XP_010534242.1|  PREDICTED: uncharacterized protein LOC104809851    192   4e-55   Tarenaya hassleriana [spider flower]
gb|KJB70570.1|  hypothetical protein B456_011G080200                    186   5e-55   Gossypium raimondii
ref|XP_011466738.1|  PREDICTED: uncharacterized protein LOC101306...    185   6e-55   Fragaria vesca subsp. vesca
ref|XP_011466736.1|  PREDICTED: uncharacterized protein LOC101306...    185   6e-55   Fragaria vesca subsp. vesca
ref|XP_010061944.1|  PREDICTED: uncharacterized protein LOC104449472    191   7e-55   Eucalyptus grandis [rose gum]
ref|XP_008228640.1|  PREDICTED: uncharacterized protein LOC103328032    182   9e-55   Prunus mume [ume]
gb|EYU24667.1|  hypothetical protein MIMGU_mgv1a008541mg                191   1e-54   Erythranthe guttata [common monkey flower]
gb|EEE56530.1|  hypothetical protein OsJ_05823                          191   1e-54   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003597843.1|  hypothetical protein MTR_2g103170                  191   1e-54   Medicago truncatula
ref|XP_008347484.1|  PREDICTED: uncharacterized protein LOC103410579    191   1e-54   Malus domestica [apple tree]
gb|EEC72709.1|  hypothetical protein OsI_06304                          191   2e-54   Oryza sativa Indica Group [Indian rice]
ref|NP_001046247.2|  Os02g0205200                                       190   2e-54   
ref|XP_007218160.1|  hypothetical protein PRUPE_ppa007461mg             190   2e-54   Prunus persica
ref|XP_004149718.1|  PREDICTED: uncharacterized protein LOC101216438    189   3e-54   Cucumis sativus [cucumbers]
ref|XP_010241207.1|  PREDICTED: uncharacterized protein LOC104585883    189   3e-54   Nelumbo nucifera [Indian lotus]
ref|XP_010257157.1|  PREDICTED: uncharacterized protein LOC104597377    189   5e-54   Nelumbo nucifera [Indian lotus]
gb|EYU21602.1|  hypothetical protein MIMGU_mgv1a008411mg                189   5e-54   Erythranthe guttata [common monkey flower]
ref|XP_002453515.1|  hypothetical protein SORBIDRAFT_04g007160          188   1e-53   
gb|KHG21630.1|  Adenosylhomocysteinase                                  186   1e-53   Gossypium arboreum [tree cotton]
ref|XP_009348421.1|  PREDICTED: uncharacterized protein LOC103940075    188   1e-53   Pyrus x bretschneideri [bai li]
ref|XP_007052493.1|  F17A17.37 protein                                  188   1e-53   
ref|XP_010539514.1|  PREDICTED: uncharacterized protein LOC104813570    184   2e-53   Tarenaya hassleriana [spider flower]
gb|ABF99456.1|  expressed protein                                       185   2e-53   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006465391.1|  PREDICTED: uncharacterized protein LOC102618171    178   3e-53   Citrus sinensis [apfelsine]
ref|XP_008377611.1|  PREDICTED: uncharacterized protein LOC103440696    187   3e-53   Malus domestica [apple tree]
emb|CDP07813.1|  unnamed protein product                                187   4e-53   Coffea canephora [robusta coffee]
ref|XP_008231461.1|  PREDICTED: uncharacterized protein LOC103330638    188   5e-53   Prunus mume [ume]
gb|KJB24990.1|  hypothetical protein B456_004G171200                    186   6e-53   Gossypium raimondii
ref|XP_002517797.1|  conserved hypothetical protein                     186   7e-53   Ricinus communis
ref|XP_007217604.1|  hypothetical protein PRUPE_ppa018156mg             186   7e-53   Prunus persica
emb|CDO98109.1|  unnamed protein product                                183   1e-52   Coffea canephora [robusta coffee]
ref|XP_010067858.1|  PREDICTED: uncharacterized protein LOC104454644    186   1e-52   Eucalyptus grandis [rose gum]
gb|KJB24991.1|  hypothetical protein B456_004G171200                    186   1e-52   Gossypium raimondii
gb|KHG12815.1|  DNA-directed RNA polymerase subunit beta''              186   1e-52   Gossypium arboreum [tree cotton]
ref|XP_010088264.1|  hypothetical protein L484_005140                   185   2e-52   Morus notabilis
gb|EAY92272.1|  hypothetical protein OsI_13995                          184   3e-52   Oryza sativa Indica Group [Indian rice]
ref|XP_003564086.1|  PREDICTED: uncharacterized protein LOC100845370    185   3e-52   Brachypodium distachyon [annual false brome]
ref|XP_008461812.1|  PREDICTED: uncharacterized protein LOC103500323    184   4e-52   Cucumis melo [Oriental melon]
ref|XP_008375195.1|  PREDICTED: uncharacterized protein LOC103438421    184   4e-52   Malus domestica [apple tree]
gb|AFK44456.1|  unknown                                                 178   5e-52   Lotus japonicus
ref|XP_004951511.1|  PREDICTED: uncharacterized protein LOC101755979    184   5e-52   Setaria italica
ref|NP_001051644.1|  Os03g0807700                                       184   5e-52   
ref|XP_008245331.1|  PREDICTED: uncharacterized protein LOC103343457    184   6e-52   Prunus mume [ume]
ref|XP_006427179.1|  hypothetical protein CICLE_v10025880mg             174   7e-52   Citrus clementina [clementine]
gb|KFK42429.1|  hypothetical protein AALP_AA2G255100                    183   9e-52   Arabis alpina [alpine rockcress]
ref|XP_009354784.1|  PREDICTED: uncharacterized protein LOC103945912    183   1e-51   Pyrus x bretschneideri [bai li]
ref|XP_008363312.1|  PREDICTED: uncharacterized protein LOC103427013    182   1e-51   
ref|XP_002299934.2|  hypothetical protein POPTR_0001s27110g             182   2e-51   Populus trichocarpa [western balsam poplar]
ref|XP_011047367.1|  PREDICTED: uncharacterized protein LOC105141733    182   2e-51   Populus euphratica
ref|XP_011013325.1|  PREDICTED: uncharacterized protein LOC105117377    182   2e-51   Populus euphratica
ref|XP_006845336.1|  hypothetical protein AMTR_s00141p00085330          182   2e-51   Amborella trichopoda
ref|XP_010057181.1|  PREDICTED: uncharacterized protein LOC104445070    182   3e-51   Eucalyptus grandis [rose gum]
ref|XP_002466246.1|  hypothetical protein SORBIDRAFT_01g004270          182   3e-51   Sorghum bicolor [broomcorn]
ref|XP_007201993.1|  hypothetical protein PRUPE_ppa024647mg             182   4e-51   
gb|KJB36028.1|  hypothetical protein B456_006G137000                    181   4e-51   Gossypium raimondii
gb|EMT25156.1|  hypothetical protein F775_26385                         182   4e-51   
ref|XP_006826721.1|  hypothetical protein AMTR_s00264p00012960          181   4e-51   
gb|KDP26060.1|  hypothetical protein JCGZ_21093                         181   5e-51   Jatropha curcas
gb|KJB19256.1|  hypothetical protein B456_003G091800                    179   7e-51   Gossypium raimondii
dbj|BAJ89665.1|  predicted protein                                      181   7e-51   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008362680.1|  PREDICTED: uncharacterized protein LOC103426358    179   8e-51   
gb|KHG07966.1|  Imidazolonepropionase                                   181   8e-51   Gossypium arboreum [tree cotton]
gb|KDP43556.1|  hypothetical protein JCGZ_16843                         180   9e-51   Jatropha curcas
ref|XP_002276894.1|  PREDICTED: uncharacterized protein LOC100258445    180   1e-50   Vitis vinifera
emb|CDO98108.1|  unnamed protein product                                180   1e-50   Coffea canephora [robusta coffee]
gb|EYU43005.1|  hypothetical protein MIMGU_mgv1a011073mg                178   1e-50   Erythranthe guttata [common monkey flower]
ref|XP_010695068.1|  PREDICTED: uncharacterized protein LOC104907775    180   1e-50   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB19257.1|  hypothetical protein B456_003G091800                    179   2e-50   Gossypium raimondii
ref|XP_011016219.1|  PREDICTED: uncharacterized protein LOC105119742    179   2e-50   Populus euphratica
ref|XP_011025472.1|  PREDICTED: uncharacterized protein LOC105126334    179   3e-50   Populus euphratica
ref|XP_008364711.1|  PREDICTED: uncharacterized protein LOC103428382    179   3e-50   
gb|KHN11697.1|  hypothetical protein glysoja_006150                     179   3e-50   Glycine soja [wild soybean]
ref|XP_004981346.1|  PREDICTED: uncharacterized protein LOC101768647    179   3e-50   Setaria italica
ref|XP_006411450.1|  hypothetical protein EUTSA_v10016825mg             179   3e-50   Eutrema salsugineum [saltwater cress]
ref|XP_011048055.1|  PREDICTED: uncharacterized protein LOC105142230    179   3e-50   Populus euphratica
ref|XP_009104452.1|  PREDICTED: uncharacterized protein LOC103830427    172   5e-50   Brassica rapa
ref|XP_003534397.1|  PREDICTED: uncharacterized protein LOC100812299    178   5e-50   Glycine max [soybeans]
ref|NP_001144239.1|  uncharacterized protein LOC100277106 precursor     179   5e-50   
ref|XP_002887838.1|  hypothetical protein ARALYDRAFT_340195             178   6e-50   Arabidopsis lyrata subsp. lyrata
emb|CDY57694.1|  BnaA07g38340D                                          172   7e-50   Brassica napus [oilseed rape]
gb|AGV54808.1|  hypothetical protein                                    177   1e-49   Phaseolus vulgaris [French bean]
tpg|DAA52069.1|  TPA: hypothetical protein ZEAMMB73_133538              178   1e-49   
ref|XP_002313314.1|  hypothetical protein POPTR_0009s06370g             177   1e-49   Populus trichocarpa [western balsam poplar]
ref|NP_178141.1|  protein DUF642 L-GALL RESPONSIVE GENE 1               177   1e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007148907.1|  hypothetical protein PHAVU_005G024100g             177   1e-49   Phaseolus vulgaris [French bean]
gb|AFK39148.1|  unknown                                                 177   2e-49   Lotus japonicus
ref|NP_001239749.1|  uncharacterized protein LOC100804119 precursor     177   2e-49   Glycine max [soybeans]
ref|NP_001241275.1|  uncharacterized protein LOC100796094 precursor     177   2e-49   Glycine max [soybeans]
ref|XP_002308027.2|  hypothetical protein POPTR_0006s04880g             177   2e-49   
gb|KHN45084.1|  hypothetical protein glysoja_040000                     177   2e-49   Glycine soja [wild soybean]
ref|XP_002308942.2|  hypothetical protein POPTR_0006s04890g             177   2e-49   Populus trichocarpa [western balsam poplar]
gb|EPS66311.1|  hypothetical protein M569_08463                         176   2e-49   Genlisea aurea
ref|XP_009758716.1|  PREDICTED: uncharacterized protein LOC104211372    176   3e-49   Nicotiana sylvestris
ref|XP_010417734.1|  PREDICTED: uncharacterized protein LOC104703420    176   3e-49   Camelina sativa [gold-of-pleasure]
ref|XP_006301335.1|  hypothetical protein CARUB_v10021745mg             176   4e-49   Capsella rubella
ref|XP_010429991.1|  PREDICTED: uncharacterized protein LOC104714356    176   4e-49   Camelina sativa [gold-of-pleasure]
ref|XP_003605795.1|  hypothetical protein MTR_4g039740                  176   5e-49   
dbj|BAD52536.1|  unknown protein                                        174   6e-49   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008392232.1|  PREDICTED: uncharacterized protein LOC103454416    176   6e-49   
ref|XP_006345424.1|  PREDICTED: uncharacterized protein LOC102582371    176   7e-49   Solanum tuberosum [potatoes]
emb|CDY54317.1|  BnaC06g43150D                                          175   7e-49   Brassica napus [oilseed rape]
gb|KHN32410.1|  hypothetical protein glysoja_026304                     174   9e-49   Glycine soja [wild soybean]
ref|NP_001140426.1|  hypothetical protein precursor                     175   9e-49   Zea mays [maize]
ref|XP_010472958.1|  PREDICTED: uncharacterized protein LOC104752499    175   1e-48   Camelina sativa [gold-of-pleasure]
gb|AFK34548.1|  unknown                                                 174   1e-48   Lotus japonicus
ref|XP_007028767.1|  F17A17.37 protein                                  174   1e-48   
ref|XP_004229647.1|  PREDICTED: uncharacterized protein LOC101251618    175   1e-48   
ref|XP_009355525.1|  PREDICTED: uncharacterized protein LOC103946533    174   2e-48   Pyrus x bretschneideri [bai li]
ref|XP_004506314.1|  PREDICTED: uncharacterized protein LOC101488216    174   2e-48   Cicer arietinum [garbanzo]
ref|XP_009630913.1|  PREDICTED: uncharacterized protein LOC104120779    174   2e-48   Nicotiana tomentosiformis
ref|XP_010546243.1|  PREDICTED: uncharacterized protein LOC104818346    174   2e-48   Tarenaya hassleriana [spider flower]
ref|XP_009379646.1|  PREDICTED: uncharacterized protein LOC103968043    178   3e-48   
ref|XP_006296392.1|  hypothetical protein CARUB_v10025565mg             174   3e-48   Capsella rubella
ref|XP_009142779.1|  PREDICTED: uncharacterized protein LOC103866589    174   3e-48   Brassica rapa
dbj|BAB21293.1|  unknown protein                                        173   5e-48   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009355498.1|  PREDICTED: uncharacterized protein LOC103946508    173   7e-48   Pyrus x bretschneideri [bai li]
ref|XP_006489949.1|  PREDICTED: uncharacterized protein LOC102629059    172   8e-48   Citrus sinensis [apfelsine]
ref|XP_010461096.1|  PREDICTED: uncharacterized protein LOC104741840    172   1e-47   Camelina sativa [gold-of-pleasure]
ref|NP_001043549.2|  Os01g0611000                                       173   1e-47   
ref|XP_006489938.1|  PREDICTED: uncharacterized protein LOC102625022    172   1e-47   Citrus sinensis [apfelsine]
gb|KDO53673.1|  hypothetical protein CISIN_1g017355mg                   172   1e-47   
ref|XP_006407770.1|  hypothetical protein EUTSA_v10020990mg             172   1e-47   
gb|EAY74932.1|  hypothetical protein OsI_02826                          172   1e-47   
ref|XP_002322719.1|  hypothetical protein POPTR_0016s05640g             172   1e-47   
ref|XP_002882567.1|  hypothetical protein ARALYDRAFT_478145             171   1e-47   
ref|XP_010486384.1|  PREDICTED: uncharacterized protein LOC104764532    172   2e-47   
ref|NP_974254.1|  germination-related protein                           171   2e-47   
gb|ACL52831.1|  unknown                                                 164   3e-47   
gb|AFK39561.1|  unknown                                                 171   3e-47   
ref|XP_003605793.1|  hypothetical protein MTR_4g039720                  171   3e-47   
ref|XP_010241208.1|  PREDICTED: uncharacterized protein LOC104585885    171   3e-47   
gb|AES87990.2|  DUF642 family protein                                   171   3e-47   
gb|KEH17090.1|  DUF642 family protein                                   171   3e-47   
ref|XP_006297975.1|  hypothetical protein CARUB_v10014019mg             171   3e-47   
ref|XP_010464451.1|  PREDICTED: uncharacterized protein LOC104744998    171   4e-47   
ref|XP_011033339.1|  PREDICTED: uncharacterized protein LOC105131855    171   4e-47   
emb|CDX79912.1|  BnaA05g02440D                                          172   4e-47   
ref|XP_002532070.1|  conserved hypothetical protein                     171   5e-47   
ref|XP_010257158.1|  PREDICTED: uncharacterized protein LOC104597378    170   5e-47   
dbj|BAK03627.1|  predicted protein                                      170   7e-47   
ref|NP_566328.1|  germination-related protein                           170   7e-47   
ref|XP_002283940.2|  PREDICTED: uncharacterized protein LOC100257236    171   7e-47   
ref|XP_011091660.1|  PREDICTED: uncharacterized protein LOC105172024    170   8e-47   
ref|XP_004969140.1|  PREDICTED: uncharacterized protein LOC101755969    170   8e-47   
ref|XP_010554835.1|  PREDICTED: uncharacterized protein LOC104824444    170   8e-47   
ref|XP_011087959.1|  PREDICTED: uncharacterized protein LOC105169285    170   1e-46   
ref|XP_006421407.1|  hypothetical protein CICLE_v10006613mg             169   1e-46   
ref|XP_002881799.1|  hypothetical protein ARALYDRAFT_483261             170   1e-46   
ref|XP_010517673.1|  PREDICTED: uncharacterized protein LOC104793095    169   1e-46   
ref|XP_010508668.1|  PREDICTED: uncharacterized protein LOC104785200    169   1e-46   
gb|EYU20209.1|  hypothetical protein MIMGU_mgv1a008620mg                169   2e-46   
ref|XP_010937268.1|  PREDICTED: uncharacterized protein LOC105056672    169   2e-46   
ref|XP_009418805.1|  PREDICTED: uncharacterized protein LOC103998920    169   2e-46   
ref|XP_006421409.1|  hypothetical protein CICLE_v10005198mg             169   3e-46   
emb|CDY22149.1|  BnaC01g39520D                                          168   3e-46   
ref|XP_009123974.1|  PREDICTED: uncharacterized protein LOC103848900    168   3e-46   
ref|XP_008776092.1|  PREDICTED: uncharacterized protein LOC103696299    168   3e-46   
ref|XP_003605789.1|  hypothetical protein MTR_4g039680                  168   4e-46   
ref|XP_010505974.1|  PREDICTED: uncharacterized protein LOC104782672    168   4e-46   
ref|NP_181712.1|  uncharacterized protein                               168   4e-46   
ref|XP_010097437.1|  hypothetical protein L484_003208                   168   5e-46   
emb|CDY28002.1|  BnaC05g44040D                                          168   5e-46   
ref|XP_010672846.1|  PREDICTED: uncharacterized protein LOC104889...    168   6e-46   
ref|XP_004499913.1|  PREDICTED: uncharacterized protein LOC101495888    167   7e-46   
ref|XP_010672845.1|  PREDICTED: uncharacterized protein LOC104889...    167   8e-46   
emb|CDY48765.1|  BnaC04g02180D                                          169   8e-46   
gb|EMT06486.1|  hypothetical protein F775_26416                         167   1e-45   
ref|XP_006389772.1|  hypothetical protein EUTSA_v10018730mg             167   1e-45   
ref|XP_009142006.1|  PREDICTED: uncharacterized protein LOC103865900    167   2e-45   
ref|XP_009147007.1|  PREDICTED: uncharacterized protein LOC103870618    166   2e-45   
emb|CDY14785.1|  BnaC04g47820D                                          166   2e-45   
ref|XP_003569339.1|  PREDICTED: uncharacterized protein LOC100821501    166   3e-45   
ref|XP_002455939.1|  hypothetical protein SORBIDRAFT_03g027650          166   3e-45   
emb|CAN80832.1|  hypothetical protein VITISV_002505                     170   4e-45   
ref|XP_010673134.1|  PREDICTED: uncharacterized protein LOC104889574    165   5e-45   
ref|XP_006294452.1|  hypothetical protein CARUB_v10023465mg             165   6e-45   
emb|CDX79913.1|  BnaA05g02430D                                          160   6e-45   
ref|XP_008460770.1|  PREDICTED: uncharacterized protein LOC103499530    164   1e-44   
ref|NP_181711.1|  uncharacterized protein                               164   1e-44   
ref|XP_002881800.1|  hypothetical protein ARALYDRAFT_483262             164   2e-44   
ref|XP_010505975.1|  PREDICTED: uncharacterized protein LOC104782673    164   2e-44   
emb|CDY48764.1|  BnaC04g02170D                                          159   2e-44   
ref|XP_010673133.1|  PREDICTED: uncharacterized protein LOC104889573    163   2e-44   
gb|EYU20746.1|  hypothetical protein MIMGU_mgv1a008437mg                163   5e-44   
ref|XP_010517674.1|  PREDICTED: uncharacterized protein LOC104793096    163   5e-44   
gb|KJB36031.1|  hypothetical protein B456_006G137000                    163   6e-44   
ref|XP_006411449.1|  hypothetical protein EUTSA_v10017674mg             162   8e-44   
ref|XP_004149398.1|  PREDICTED: uncharacterized protein LOC101213859    162   1e-43   
ref|XP_004162183.1|  PREDICTED: uncharacterized LOC101213859            162   1e-43   
tpg|DAA58940.1|  TPA: hypothetical protein ZEAMMB73_364218              156   1e-43   
emb|CDY06908.1|  BnaA04g24070D                                          161   1e-43   
gb|KFK37021.1|  hypothetical protein AALP_AA4G201900                    161   2e-43   
ref|XP_010508664.1|  PREDICTED: uncharacterized protein LOC104785...    161   2e-43   
ref|XP_009142778.1|  PREDICTED: uncharacterized protein LOC103866588    160   3e-43   
ref|XP_010673132.1|  PREDICTED: uncharacterized protein LOC104889572    160   4e-43   
emb|CAH67378.1|  OSIGBa0159F11.2                                        149   6e-43   
emb|CDP21696.1|  unnamed protein product                                159   2e-42   
gb|KDO52908.1|  hypothetical protein CISIN_1g0399092mg                  142   2e-42   
ref|XP_006411448.1|  hypothetical protein EUTSA_v10016810mg             158   2e-42   
ref|XP_010691193.1|  PREDICTED: uncharacterized protein LOC104904598    153   6e-42   
ref|XP_010541767.1|  PREDICTED: uncharacterized protein LOC104815148    150   6e-42   
ref|XP_010445004.1|  PREDICTED: uncharacterized protein LOC104727612    156   6e-42   
ref|XP_008672703.1|  PREDICTED: hypothetical protein isoform X1         157   8e-42   
gb|ACG40327.1|  hypothetical protein                                    157   8e-42   
emb|CAE01677.2|  OSJNBb0091E11.19                                       149   8e-42   
ref|XP_006350194.1|  PREDICTED: uncharacterized protein LOC102578783    156   2e-41   
ref|NP_001145978.1|  hypothetical protein                               157   2e-41   
ref|XP_009587019.1|  PREDICTED: uncharacterized protein LOC104084774    155   4e-41   
gb|EMT04285.1|  hypothetical protein F775_14657                         150   8e-41   
ref|XP_004236613.1|  PREDICTED: uncharacterized protein LOC101245049    154   8e-41   
ref|XP_003580051.1|  PREDICTED: uncharacterized protein LOC100841904    149   9e-41   
ref|XP_009775467.1|  PREDICTED: uncharacterized protein LOC104225390    154   1e-40   
gb|EMS63052.1|  hypothetical protein TRIUR3_01733                       149   1e-40   
ref|XP_004978108.1|  PREDICTED: uncharacterized protein LOC101762525    142   2e-40   
ref|XP_006845338.1|  hypothetical protein AMTR_s00141p00087190          147   4e-40   
ref|XP_011078904.1|  PREDICTED: uncharacterized protein LOC105162545    152   6e-40   
gb|EEC81716.1|  hypothetical protein OsI_25327                          151   2e-39   
ref|XP_008669229.1|  PREDICTED: uncharacterized protein LOC103646276    142   2e-39   
ref|XP_002446728.1|  hypothetical protein SORBIDRAFT_06g021320          141   2e-39   
ref|XP_008669227.1|  PREDICTED: uncharacterized protein LOC103646275    142   3e-39   
tpg|DAA37149.1|  TPA: hypothetical protein ZEAMMB73_398073              142   5e-39   
ref|XP_004236614.1|  PREDICTED: uncharacterized protein LOC101245348    149   6e-39   
ref|XP_006350197.1|  PREDICTED: uncharacterized protein LOC102579762    149   7e-39   
gb|AGV54847.1|  hypothetical protein                                    149   1e-38   
ref|XP_007147896.1|  hypothetical protein PHAVU_006G164100g             149   2e-38   
ref|XP_004976082.1|  PREDICTED: uncharacterized protein LOC101765204    135   3e-38   
ref|XP_006652463.1|  PREDICTED: uncharacterized protein LOC102714172    147   3e-38   
tpg|DAA37152.1|  TPA: hypothetical protein ZEAMMB73_071426              147   4e-38   
emb|CAH67292.1|  OSIGBa0103O01.10                                       147   4e-38   
gb|EAY94676.1|  hypothetical protein OsI_16455                          147   5e-38   
ref|XP_002446724.1|  hypothetical protein SORBIDRAFT_06g021280          146   8e-38   
ref|XP_010549485.1|  PREDICTED: uncharacterized protein LOC104820646    146   1e-37   
gb|AGV54803.1|  hypothetical protein                                    146   1e-37   
ref|XP_009396509.1|  PREDICTED: uncharacterized protein LOC103981490    145   2e-37   
ref|NP_001053188.1|  Os04g0494600                                       145   3e-37   
emb|CAE01676.2|  OSJNBb0091E11.17                                       144   3e-37   
ref|XP_006653558.1|  PREDICTED: uncharacterized protein LOC102719203    131   3e-37   
ref|XP_003546086.1|  PREDICTED: uncharacterized protein LOC100807088    145   4e-37   
ref|NP_001053189.1|  Os04g0494800                                       144   4e-37   
ref|XP_010919817.1|  PREDICTED: uncharacterized protein LOC105043799    145   4e-37   
ref|XP_010911072.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    145   4e-37   
ref|XP_008792993.1|  PREDICTED: uncharacterized protein LOC103709448    144   5e-37   
ref|XP_002893594.1|  predicted protein                                  144   7e-37   
gb|AFK48735.1|  unknown                                                 144   9e-37   
emb|CAH67377.1|  OSIGBa0159F11.1                                        143   1e-36   
ref|XP_006415525.1|  hypothetical protein EUTSA_v10007784mg             143   2e-36   
gb|KHN47316.1|  hypothetical protein glysoja_020184                     142   2e-36   
ref|XP_004293568.1|  PREDICTED: uncharacterized protein LOC101302531    143   2e-36   
gb|KDO78161.1|  hypothetical protein CISIN_1g0159862mg                  142   2e-36   
emb|CDX87297.1|  BnaA07g35760D                                          125   2e-36   
ref|NP_973938.1|  uncharacterized protein                               142   2e-36   
ref|XP_010504914.1|  PREDICTED: uncharacterized protein LOC104781...    143   2e-36   
ref|XP_010504912.1|  PREDICTED: uncharacterized protein LOC104781...    143   2e-36   
ref|XP_003542933.1|  PREDICTED: uncharacterized protein LOC100788675    142   2e-36   
ref|XP_002446726.1|  hypothetical protein SORBIDRAFT_06g021300          131   2e-36   
ref|XP_006467477.1|  PREDICTED: uncharacterized protein LOC102617...    142   3e-36   
ref|XP_006467478.1|  PREDICTED: uncharacterized protein LOC102617...    142   3e-36   
ref|NP_564344.1|  uncharacterized protein                               142   3e-36   
ref|XP_006449683.1|  hypothetical protein CICLE_v10015527mg             142   4e-36   
ref|XP_009788467.1|  PREDICTED: uncharacterized protein LOC104236274    142   5e-36   
gb|KHN33140.1|  La-related protein 7                                    145   6e-36   
emb|CAD41548.2|  OSJNBb0091E11.18                                       141   6e-36   
ref|XP_010540565.1|  PREDICTED: uncharacterized protein LOC104814294    141   7e-36   
ref|XP_009603034.1|  PREDICTED: uncharacterized protein LOC104098081    141   7e-36   
ref|XP_006294334.1|  hypothetical protein CARUB_v10023341mg             141   8e-36   
ref|NP_001053190.1|  Os04g0494900                                       141   9e-36   
ref|XP_010516598.1|  PREDICTED: uncharacterized protein LOC104792204    140   2e-35   
dbj|BAJ96954.1|  predicted protein                                      140   2e-35   
ref|XP_002317331.2|  hypothetical protein POPTR_0011s08980g             140   2e-35   
ref|XP_011015145.1|  PREDICTED: uncharacterized protein LOC105118803    140   2e-35   
gb|KHG06200.1|  Periplasmic nitrate reductase                           140   2e-35   
ref|XP_006352963.1|  PREDICTED: uncharacterized protein LOC102582541    140   2e-35   
ref|XP_003593943.1|  hypothetical protein MTR_2g019600                  140   2e-35   
ref|XP_010509742.1|  PREDICTED: uncharacterized protein LOC104786108    140   3e-35   
ref|XP_006653557.1|  PREDICTED: uncharacterized protein LOC102718925    140   3e-35   
ref|XP_010460777.1|  PREDICTED: uncharacterized protein LOC104741589    140   3e-35   
gb|KJB69807.1|  hypothetical protein B456_011G043300                    139   3e-35   
ref|XP_008225474.1|  PREDICTED: uncharacterized protein LOC103325117    140   3e-35   
ref|NP_180998.1|  uncharacterized protein                               140   3e-35   
ref|XP_010478373.1|  PREDICTED: uncharacterized protein LOC104757341    140   3e-35   
ref|XP_007213876.1|  hypothetical protein PRUPE_ppa006814mg             140   3e-35   
gb|EMS63053.1|  hypothetical protein TRIUR3_01734                       139   3e-35   
ref|XP_009143769.1|  PREDICTED: uncharacterized protein LOC103867448    140   3e-35   
ref|XP_004233117.1|  PREDICTED: uncharacterized protein LOC101246207    139   3e-35   
gb|EMT04284.1|  hypothetical protein F775_14656                         139   3e-35   
emb|CDX84311.1|  BnaC04g10730D                                          140   3e-35   
ref|XP_006410597.1|  hypothetical protein EUTSA_v10016749mg             139   3e-35   
gb|KJB69808.1|  hypothetical protein B456_011G043300                    139   4e-35   
ref|XP_002881340.1|  hypothetical protein ARALYDRAFT_902536             139   4e-35   
gb|KDP37968.1|  hypothetical protein JCGZ_04611                         139   4e-35   
ref|XP_008812841.1|  PREDICTED: uncharacterized protein LOC103723648    139   4e-35   
gb|KHG28355.1|  putative metabolite transport                           139   4e-35   
ref|XP_009394197.1|  PREDICTED: uncharacterized protein LOC103979736    140   5e-35   
gb|KJB57253.1|  hypothetical protein B456_009G155400                    139   5e-35   
gb|ACJ84883.1|  unknown                                                 135   5e-35   
gb|EYU43266.1|  hypothetical protein MIMGU_mgv1a007866mg                139   5e-35   
ref|XP_010110985.1|  hypothetical protein L484_021680                   140   5e-35   
gb|KJB57254.1|  hypothetical protein B456_009G155400                    139   5e-35   
ref|XP_002519690.1|  conserved hypothetical protein                     139   5e-35   
ref|XP_007025094.1|  Uncharacterized protein TCM_029497                 140   5e-35   
ref|XP_004486030.1|  PREDICTED: uncharacterized protein LOC101488455    139   5e-35   
ref|XP_006307659.1|  hypothetical protein CARUB_v10009287mg             139   7e-35   
ref|XP_002275370.1|  PREDICTED: uncharacterized protein LOC100253669    139   8e-35   
emb|CDY17255.1|  BnaA05g09330D                                          139   8e-35   
emb|CBI30867.3|  unnamed protein product                                138   8e-35   
gb|AFK49395.1|  unknown                                                 138   9e-35   
ref|XP_008383561.1|  PREDICTED: uncharacterized protein LOC103446251    138   9e-35   
emb|CDP19178.1|  unnamed protein product                                138   1e-34   
ref|XP_008371603.1|  PREDICTED: uncharacterized protein LOC103434995    138   1e-34   
dbj|BAD87481.1|  unknown protein                                        134   1e-34   
ref|XP_003593942.1|  Glutamate-gated kainate-type ion channel rec...    140   1e-34   
ref|NP_001141282.1|  hypothetical protein precursor                     137   1e-34   
ref|XP_004978106.1|  PREDICTED: uncharacterized protein LOC101761311    137   1e-34   
ref|XP_009360881.1|  PREDICTED: uncharacterized protein LOC103951270    138   1e-34   
emb|CDX99870.1|  BnaC05g22920D                                          137   2e-34   
ref|XP_002446725.1|  hypothetical protein SORBIDRAFT_06g021290          137   2e-34   
ref|XP_009115202.1|  PREDICTED: uncharacterized protein LOC103840445    137   2e-34   
emb|CDY26302.1|  BnaA09g26530D                                          137   2e-34   
ref|XP_003581385.1|  PREDICTED: uncharacterized protein LOC100824265    137   2e-34   
gb|EPS66859.1|  hypothetical protein M569_07917                         137   3e-34   
gb|EAY94679.1|  hypothetical protein OsI_16458                          129   3e-34   
gb|KCW59326.1|  hypothetical protein EUGRSUZ_H02015                     131   3e-34   
ref|NP_001053191.2|  Os04g0495000                                       129   3e-34   
ref|XP_010275001.1|  PREDICTED: uncharacterized protein LOC104610185    136   4e-34   
ref|XP_010499517.1|  PREDICTED: uncharacterized protein LOC104777028    137   4e-34   
gb|EEE61252.1|  hypothetical protein OsJ_15312                          129   4e-34   
ref|XP_002446723.1|  hypothetical protein SORBIDRAFT_06g021270          136   6e-34   
dbj|BAJ97095.1|  predicted protein                                      129   6e-34   
ref|XP_011096549.1|  PREDICTED: uncharacterized protein LOC105175704    136   8e-34   
ref|XP_010056890.1|  PREDICTED: uncharacterized protein LOC104444833    135   1e-33   
gb|EEC70811.1|  hypothetical protein OsI_02272                          135   1e-33   
gb|ACN30906.1|  unknown                                                 135   1e-33   
gb|ACF86181.1|  unknown                                                 135   1e-33   
ref|XP_002456374.1|  hypothetical protein SORBIDRAFT_03g034960          135   1e-33   
ref|XP_011085252.1|  PREDICTED: uncharacterized protein LOC105167296    135   2e-33   
ref|XP_006845348.1|  hypothetical protein AMTR_s00141p00103540          135   2e-33   
ref|XP_010279657.1|  PREDICTED: uncharacterized protein LOC104613510    134   2e-33   
ref|XP_002446727.1|  hypothetical protein SORBIDRAFT_06g021310          120   2e-33   
ref|NP_001143445.1|  uncharacterized protein LOC100276100               133   2e-33   
ref|NP_001044289.1|  Os01g0756600                                       134   2e-33   
tpg|DAA57583.1|  TPA: hypothetical protein ZEAMMB73_913803              135   3e-33   



>ref|XP_009771440.1| PREDICTED: uncharacterized protein LOC104221976 [Nicotiana sylvestris]
Length=373

 Score =   242 bits (618),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 121/181 (67%), Positives = 139/181 (77%), Gaps = 1/181 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
             + L+K   F  GP   P       +P        P LPAW VESLKAVKY+D++HFSVP
Sbjct  194  NKNLLKNGDFEEGPYIFPNTSWGVLVPPNIEDDHSP-LPAWMVESLKAVKYLDSDHFSVP  252

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             G+RA+ELVAGKESA+ Q+ART  GK Y+L+F VGDASN CEGSM++EAFAG  TLKVPY
Sbjct  253  QGKRAIELVAGKESAIAQVARTTIGKMYELSFKVGDASNSCEGSMIVEAFAGMDTLKVPY  312

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNPHRR  154
            ESKG+GGYK A LRF+ATANRTR+MF STYYHTRSDDFVSLCGPVVD VKL+SVRNP R 
Sbjct  313  ESKGKGGYKRAVLRFKATANRTRIMFLSTYYHTRSDDFVSLCGPVVDDVKLLSVRNPRRF  372

Query  153  L  151
            L
Sbjct  373  L  373


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR TN NLLKN DFEEGPY+FP    GVL PP  EDDH P
Sbjct  190  PRATNKNLLKNGDFEEGPYIFPNTSWGVLVPPNIEDDHSP  229



>ref|XP_009617293.1| PREDICTED: uncharacterized protein LOC104109646 [Nicotiana tomentosiformis]
Length=373

 Score =   237 bits (604),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 118/181 (65%), Positives = 138/181 (76%), Gaps = 1/181 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
             + L+K   F  GP   P       +P        P LPAW VESLKAVKY+D++HFSVP
Sbjct  194  NKNLLKNGDFEEGPYIFPNTSWGVLVPPNIEDDHSP-LPAWMVESLKAVKYLDSDHFSVP  252

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             G+RA+ELVAGKESA+ Q+ART  GK Y+L+F VGDASN CEGSM++EAFAG  TLKVPY
Sbjct  253  QGKRAIELVAGKESAIAQVARTTIGKMYELSFKVGDASNSCEGSMIVEAFAGRDTLKVPY  312

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNPHRR  154
            ESKG+GG+K A LRF+A ANRTR+MF STYYHTRSDD+VSLCGPVVD VKL+SVRNP R 
Sbjct  313  ESKGKGGFKRAVLRFKANANRTRIMFLSTYYHTRSDDYVSLCGPVVDDVKLLSVRNPRRF  372

Query  153  L  151
            L
Sbjct  373  L  373


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR TN NLLKN DFEEGPY+FP    GVL PP  EDDH P
Sbjct  190  PRATNKNLLKNGDFEEGPYIFPNTSWGVLVPPNIEDDHSP  229



>ref|XP_006364278.1| PREDICTED: uncharacterized protein LOC102598357 [Solanum tuberosum]
Length=371

 Score =   232 bits (592),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 110/144 (76%), Positives = 126/144 (88%), Gaps = 1/144 (1%)
 Frame = -1

Query  582  LPAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDA  403
            LPAW VESLKAVKY+D++HFSVPHG+RA+ELVAGKESA+ Q+ART  GK Y L+F VGDA
Sbjct  228  LPAWMVESLKAVKYLDSDHFSVPHGKRAIELVAGKESAIAQVARTTIGKMYQLSFKVGDA  287

Query  402  SNKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDD  223
            SN CEGSM++EAFAG  TLKVPYES G+GGYK A LRF+ATA+RTR+MF STYYHTRSDD
Sbjct  288  SNACEGSMIVEAFAGRDTLKVPYESMGKGGYKRAILRFKATASRTRIMFLSTYYHTRSDD  347

Query  222  FVSLCGPVVDFVKLVSVRNPHRRL  151
            FVSLCGPVVD V L+SVR  HRR+
Sbjct  348  FVSLCGPVVDDVTLLSVRT-HRRV  370


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR TN NLLKN DFEEGPY+FP    GVL PP  EDDH P
Sbjct  188  PRATNQNLLKNGDFEEGPYIFPNTSWGVLVPPNIEDDHSP  227



>ref|XP_004245192.1| PREDICTED: uncharacterized protein LOC101262737 [Solanum lycopersicum]
Length=371

 Score =   232 bits (591),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 110/144 (76%), Positives = 126/144 (88%), Gaps = 1/144 (1%)
 Frame = -1

Query  582  LPAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDA  403
            LPAW VESLKAVKY+D++HFSVPHG+RA+ELVAGKESA+ Q+ART  GK Y L+F VGDA
Sbjct  228  LPAWMVESLKAVKYLDSDHFSVPHGKRAIELVAGKESAIAQVARTTIGKMYQLSFKVGDA  287

Query  402  SNKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDD  223
            SN CEGSM++EAFAG  TLKVPYES G+GGYK A LRF+ATA+RTR+MF STYYHTRSDD
Sbjct  288  SNACEGSMIVEAFAGRDTLKVPYESMGKGGYKRAILRFKATASRTRIMFLSTYYHTRSDD  347

Query  222  FVSLCGPVVDFVKLVSVRNPHRRL  151
            FVSLCGPVVD V L+SVR  HRR+
Sbjct  348  FVSLCGPVVDDVTLLSVRT-HRRV  370


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR TN NLLKN DFEEGPYVFP    GVL PP  EDDH P
Sbjct  188  PRATNQNLLKNGDFEEGPYVFPNTSWGVLVPPNIEDDHSP  227



>emb|CDP04798.1| unnamed protein product [Coffea canephora]
Length=371

 Score =   232 bits (591),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 115/180 (64%), Positives = 132/180 (73%), Gaps = 1/180 (1%)
 Frame = -1

Query  690  RELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVPH  511
              LVK   F  GP   P       +P        P LP W +ESLKAVKYIDA HFSVPH
Sbjct  193  ENLVKNGDFEEGPYIFPNTSWGVLIPPNIEDDHSP-LPGWMIESLKAVKYIDAAHFSVPH  251

Query  510  GRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPYE  331
              RAVELVAGKESA+ Q+ART+ GK Y LTFLVGDASN CEGSM++EA+AG  T+K+PY 
Sbjct  252  NSRAVELVAGKESAIAQVARTIIGKTYTLTFLVGDASNSCEGSMIVEAYAGIVTVKIPYT  311

Query  330  SKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNPHRRL  151
            S+G+GGYKPA L F AT NRTR+MFFSTYYHTRSDD  SLCGPV+D VKL+SVRNP + +
Sbjct  312  SQGKGGYKPAVLHFVATTNRTRIMFFSTYYHTRSDDNASLCGPVIDDVKLLSVRNPRKLM  371


 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            P+ T+ NL+KN DFEEGPY+FP    GVL PP  EDDH P
Sbjct  188  PKATSENLVKNGDFEEGPYIFPNTSWGVLIPPNIEDDHSP  227



>ref|XP_011085499.1| PREDICTED: uncharacterized protein LOC105167438 [Sesamum indicum]
Length=369

 Score =   231 bits (590),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = -1

Query  582  LPAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDA  403
            LPAW VESLKAVKYIDA HFSVPHG+RA+ELV GKESA+ Q+ART+ GK Y+LTF +GDA
Sbjct  226  LPAWIVESLKAVKYIDAAHFSVPHGQRAIELVGGKESAIAQVARTIIGKTYELTFAIGDA  285

Query  402  SNKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDD  223
            SN CEGSM++EAFAG  T+KVPYESKG+GGYK A LRF ATA RTR+MFFSTYYH RSDD
Sbjct  286  SNSCEGSMIVEAFAGRDTVKVPYESKGKGGYKRAVLRFAATAARTRIMFFSTYYHMRSDD  345

Query  222  FVSLCGPVVDFVKLVSVRNPHR  157
            F SLCGPVVD VKL+SV  P R
Sbjct  346  FASLCGPVVDDVKLLSVHKPRR  367


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            P+ T  NLLKN DFEEGPYVFP    GVL PP  EDDH P
Sbjct  186  PKATRDNLLKNGDFEEGPYVFPNTSWGVLVPPNIEDDHSP  225



>gb|EYU21948.1| hypothetical protein MIMGU_mgv1a0096341mg [Erythranthe guttata]
Length=336

 Score =   228 bits (582),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/142 (75%), Positives = 120/142 (85%), Gaps = 0/142 (0%)
 Frame = -1

Query  582  LPAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDA  403
            LPAW VESLKAVKYID  HFSVPHG RA+ELV GKESA+ Q+ART+AGK Y LTF VGDA
Sbjct  193  LPAWMVESLKAVKYIDRAHFSVPHGERAIELVGGKESAIAQVARTIAGKTYQLTFAVGDA  252

Query  402  SNKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDD  223
            SN CEGSM++EAFAG  T+KVPYES+G+GGYK A LRF A  NRTR+MF STYYH RSDD
Sbjct  253  SNSCEGSMIVEAFAGRDTVKVPYESRGKGGYKRAVLRFVAPTNRTRIMFLSTYYHMRSDD  312

Query  222  FVSLCGPVVDFVKLVSVRNPHR  157
            + SLCGPVVD VKL+SVRNP +
Sbjct  313  YASLCGPVVDDVKLLSVRNPRK  334


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR T  NLLKN DFEEG Y+ PK   GVL PP  EDD+ P
Sbjct  153  PRPTRDNLLKNGDFEEGAYILPKTSWGVLIPPNIEDDNSP  192



>ref|XP_011081926.1| PREDICTED: uncharacterized protein LOC105164832 [Sesamum indicum]
Length=405

 Score =   228 bits (580),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 107/142 (75%), Positives = 120/142 (85%), Gaps = 0/142 (0%)
 Frame = -1

Query  582  LPAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDA  403
            LPAW VESLKAVKYIDA HFSVPHG+RA+ELV GKESA+ Q+ART+ GK Y LTF VGDA
Sbjct  262  LPAWMVESLKAVKYIDAAHFSVPHGQRAIELVGGKESAIAQVARTIVGKTYQLTFAVGDA  321

Query  402  SNKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDD  223
            SN CEGSM++EAFAG  T+KVPYESKG+GGYK A LRF AT  RTR+MF ST+YH RSDD
Sbjct  322  SNSCEGSMIVEAFAGRDTVKVPYESKGKGGYKRAVLRFVATTTRTRIMFLSTFYHMRSDD  381

Query  222  FVSLCGPVVDFVKLVSVRNPHR  157
            + SLCGPVVD VKL+SVR P R
Sbjct  382  YASLCGPVVDDVKLLSVRKPRR  403


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            P+ TN NLLKN DFEEG Y+FP    GVL PP  EDD+ P
Sbjct  222  PKPTNQNLLKNGDFEEGAYIFPNTSWGVLIPPNIEDDNSP  261



>ref|XP_002515557.1| conserved hypothetical protein [Ricinus communis]
 emb|CAB02653.1| unknown [Ricinus communis]
 gb|EEF47006.1| conserved hypothetical protein [Ricinus communis]
Length=364

 Score =   224 bits (572),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 114/177 (64%), Positives = 131/177 (74%), Gaps = 1/177 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
             + ++K  GF  GP   P       +P        P LP W VESLKAVKYID +HFSVP
Sbjct  189  NKNILKNGGFEEGPYVFPNTSWGVLIPPNIEDDHSP-LPGWMVESLKAVKYIDVDHFSVP  247

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             GRRA+ELVAGKESA+ Q+ARTV GK Y L+F VGDASN CEGSMV+EAFAG  TLKVPY
Sbjct  248  QGRRAIELVAGKESAIAQVARTVIGKTYTLSFAVGDASNSCEGSMVVEAFAGKDTLKVPY  307

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  163
            ESKG+GG+K A LRF A ANRTR+MF+ST+Y  RSDDF SLCGPV+D VKL+SVR P
Sbjct  308  ESKGKGGFKRAVLRFVAVANRTRIMFYSTFYTMRSDDFSSLCGPVLDDVKLLSVRKP  364


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR TN N+LKN  FEEGPYVFP    GVL PP  EDDH P
Sbjct  185  PRPTNKNILKNGGFEEGPYVFPNTSWGVLIPPNIEDDHSP  224



>ref|XP_006399647.1| hypothetical protein EUTSA_v10013887mg [Eutrema salsugineum]
 gb|ESQ41100.1| hypothetical protein EUTSA_v10013887mg [Eutrema salsugineum]
Length=340

 Score =   223 bits (567),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 108/177 (61%), Positives = 133/177 (75%), Gaps = 1/177 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
             + ++K  GF  GP  +P       +P        P LPAW +ESLKA+KY+D EHFSVP
Sbjct  165  NKNILKNGGFEEGPYVLPNATTGVLIPPFIEDDHSP-LPAWMIESLKAIKYVDVEHFSVP  223

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             GRRAVELVAGKESA+ Q+ART+ GK Y L+F VGDA+N C+GSM++EAFAG  TLKVPY
Sbjct  224  QGRRAVELVAGKESAIAQVARTIIGKTYVLSFAVGDANNACQGSMIVEAFAGKDTLKVPY  283

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  163
            ES+G+GG+K A +RF A +NRTRVMF+ST+Y  RSDDF SLCGPV+D VKL+SVR P
Sbjct  284  ESRGKGGFKRASMRFVAVSNRTRVMFYSTFYAMRSDDFSSLCGPVIDDVKLLSVRKP  340


 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR TN N+LKN  FEEGPYV P   TGVL PPF EDDH P
Sbjct  161  PRPTNKNILKNGGFEEGPYVLPNATTGVLIPPFIEDDHSP  200



>gb|KDP33619.1| hypothetical protein JCGZ_07190 [Jatropha curcas]
Length=364

 Score =   223 bits (568),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 112/177 (63%), Positives = 131/177 (74%), Gaps = 1/177 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
             + ++K  GF  GP   P       +P        P LP W +ESLKAVKYID++HFSVP
Sbjct  189  NKNILKNGGFEEGPYIFPNTSWGVLIPPNIEDDHSP-LPGWMIESLKAVKYIDSDHFSVP  247

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
              RRAVELVAGKESA+ Q+ARTV GK Y L+F VGDASN CEGSMV+EAFAG  TLKVPY
Sbjct  248  QARRAVELVAGKESAIAQVARTVVGKTYTLSFAVGDASNSCEGSMVVEAFAGKDTLKVPY  307

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  163
            ESKG+GG+K A LRF A +NRTR+MF+ST+Y  RSDDF SLCGPV+D VKL+SVR P
Sbjct  308  ESKGKGGFKRAVLRFVAASNRTRIMFYSTFYTMRSDDFSSLCGPVIDDVKLLSVRKP  364


 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR TN N+LKN  FEEGPY+FP    GVL PP  EDDH P
Sbjct  185  PRPTNKNILKNGGFEEGPYIFPNTSWGVLIPPNIEDDHSP  224



>ref|XP_006399646.1| hypothetical protein EUTSA_v10013887mg [Eutrema salsugineum]
 gb|ESQ41099.1| hypothetical protein EUTSA_v10013887mg [Eutrema salsugineum]
Length=366

 Score =   223 bits (567),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 108/177 (61%), Positives = 133/177 (75%), Gaps = 1/177 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
             + ++K  GF  GP  +P       +P        P LPAW +ESLKA+KY+D EHFSVP
Sbjct  191  NKNILKNGGFEEGPYVLPNATTGVLIPPFIEDDHSP-LPAWMIESLKAIKYVDVEHFSVP  249

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             GRRAVELVAGKESA+ Q+ART+ GK Y L+F VGDA+N C+GSM++EAFAG  TLKVPY
Sbjct  250  QGRRAVELVAGKESAIAQVARTIIGKTYVLSFAVGDANNACQGSMIVEAFAGKDTLKVPY  309

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  163
            ES+G+GG+K A +RF A +NRTRVMF+ST+Y  RSDDF SLCGPV+D VKL+SVR P
Sbjct  310  ESRGKGGFKRASMRFVAVSNRTRVMFYSTFYAMRSDDFSSLCGPVIDDVKLLSVRKP  366


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR TN N+LKN  FEEGPYV P   TGVL PPF EDDH P
Sbjct  187  PRPTNKNILKNGGFEEGPYVLPNATTGVLIPPFIEDDHSP  226



>ref|XP_010491872.1| PREDICTED: uncharacterized protein LOC104769372 [Camelina sativa]
Length=367

 Score =   223 bits (567),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 109/177 (62%), Positives = 133/177 (75%), Gaps = 1/177 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
             + ++K  GF  GP  +P       +P        P LPAW +ESLKAVKY+D EHFSVP
Sbjct  192  NKNILKNGGFEEGPYILPNATTGVLIPPYIEDDHSP-LPAWMIESLKAVKYVDVEHFSVP  250

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             GRRAVELVAGKESA+ Q+ART+ GK Y L+F VGDA+N C+GSMV+EAFAG  TLKVPY
Sbjct  251  QGRRAVELVAGKESAIAQVARTIVGKTYVLSFAVGDANNACQGSMVVEAFAGRDTLKVPY  310

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  163
            ES+G+GG+K A +RF A +NRTR+MF+ST+Y  RSDDF SLCGPV+D VKL+SVR P
Sbjct  311  ESRGKGGFKRASMRFVAVSNRTRIMFYSTFYAMRSDDFSSLCGPVIDDVKLLSVRKP  367


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR TN N+LKN  FEEGPY+ P   TGVL PP+ EDDH P
Sbjct  188  PRPTNKNILKNGGFEEGPYILPNATTGVLIPPYIEDDHSP  227



>ref|XP_010453190.1| PREDICTED: uncharacterized protein LOC104735158 [Camelina sativa]
Length=367

 Score =   223 bits (567),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 109/177 (62%), Positives = 133/177 (75%), Gaps = 1/177 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
             + ++K  GF  GP  +P       +P        P LPAW +ESLKAVKY+D EHFSVP
Sbjct  192  NKNILKNGGFEEGPYILPNATTGVLVPPFIEDDHSP-LPAWMIESLKAVKYVDVEHFSVP  250

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             GRRAVELVAGKESA+ Q+ART+ GK Y L+F VGDA+N C+GSMV+EAFAG  TLKVPY
Sbjct  251  QGRRAVELVAGKESAIAQVARTIVGKTYVLSFAVGDANNACQGSMVVEAFAGRDTLKVPY  310

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  163
            ES+G+GG+K A +RF A +NRTR+MF+ST+Y  RSDDF SLCGPV+D VKL+SVR P
Sbjct  311  ESRGKGGFKRASMRFVAVSNRTRIMFYSTFYAMRSDDFSSLCGPVIDDVKLLSVRKP  367


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR TN N+LKN  FEEGPY+ P   TGVL PPF EDDH P
Sbjct  188  PRPTNKNILKNGGFEEGPYILPNATTGVLVPPFIEDDHSP  227



>dbj|BAH57107.1| AT5G25460 [Arabidopsis thaliana]
Length=186

 Score =   216 bits (551),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 107/177 (60%), Positives = 130/177 (73%), Gaps = 1/177 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
             + ++K  GF  GP+ +P       +P        P LP W VESLKAVKY+D EHFSVP
Sbjct  11   NKNILKNGGFEEGPLVLPGSTTGVLIPPFIEDDHSP-LPGWMVESLKAVKYVDVEHFSVP  69

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             GRRA+ELVAGKESA+ Q+ RTV GK Y L+F VGDA+N C+GSMV+EAFAG  TLKVPY
Sbjct  70   QGRRAIELVAGKESAIAQVVRTVIGKTYVLSFAVGDANNACKGSMVVEAFAGKDTLKVPY  129

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  163
            ESKG GG+K A +RF A + R+R+MF+ST+Y  RSDDF SLCGPV+D VKL+SVR P
Sbjct  130  ESKGTGGFKRASIRFVAVSTRSRIMFYSTFYAMRSDDFSSLCGPVIDDVKLISVRKP  186


 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR TN N+LKN  FEEGP V P   TGVL PPF EDDH P
Sbjct  7    PRPTNKNILKNGGFEEGPLVLPGSTTGVLIPPFIEDDHSP  46



>ref|XP_010254319.1| PREDICTED: uncharacterized protein LOC104595325 [Nelumbo nucifera]
 ref|XP_010254320.1| PREDICTED: uncharacterized protein LOC104595325 [Nelumbo nucifera]
Length=370

 Score =   222 bits (566),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 119/142 (84%), Gaps = 0/142 (0%)
 Frame = -1

Query  582  LPAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDA  403
            LP W +ESLKAVKYIDAEHFSVP GRRAVELVAGKESA+ QIART+ GK Y LTF VGDA
Sbjct  228  LPGWMIESLKAVKYIDAEHFSVPQGRRAVELVAGKESAIAQIARTIPGKVYTLTFAVGDA  287

Query  402  SNKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDD  223
            +NKCEGSMV+EAFA  +T+KVPYESKG GG+K A LRF A + RTR+MF ST+Y  RSDD
Sbjct  288  NNKCEGSMVVEAFADRNTVKVPYESKGTGGFKRAVLRFTAVSTRTRIMFLSTFYTMRSDD  347

Query  222  FVSLCGPVVDFVKLVSVRNPHR  157
              SLCGPVVD VKL+S+RNP R
Sbjct  348  MASLCGPVVDDVKLLSIRNPRR  369


 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR TN NLLKN DFEEGPY+FP    GVL PP  EDDH P
Sbjct  188  PRPTNKNLLKNGDFEEGPYIFPNTSWGVLVPPNIEDDHSP  227



>ref|XP_006287989.1| hypothetical protein CARUB_v10001222mg [Capsella rubella]
 gb|EOA20887.1| hypothetical protein CARUB_v10001222mg [Capsella rubella]
Length=367

 Score =   221 bits (562),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 109/177 (62%), Positives = 132/177 (75%), Gaps = 1/177 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
             + ++K  GF  GP  +P       +P        P LPAW +ESLKAVKY+D EHFSVP
Sbjct  192  NKNILKNGGFEEGPYILPNSTTGVLIPPFIEDDHSP-LPAWMIESLKAVKYVDVEHFSVP  250

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             GRRAVELVAGKESA+ Q+ARTV GK Y L+F VGDA+N C+GSMV+EAFAG  TLKVPY
Sbjct  251  QGRRAVELVAGKESAIAQVARTVVGKTYVLSFSVGDANNACQGSMVVEAFAGRDTLKVPY  310

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  163
            ES+G+GG+K A +RF A +NRTR+MF+ST+Y  RSDDF SLCGPV+D VKL+ VR P
Sbjct  311  ESRGKGGFKRATMRFVAVSNRTRIMFYSTFYAMRSDDFSSLCGPVIDDVKLLGVRKP  367


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR TN N+LKN  FEEGPY+ P   TGVL PPF EDDH P
Sbjct  188  PRPTNKNILKNGGFEEGPYILPNSTTGVLIPPFIEDDHSP  227



>ref|XP_004138737.1| PREDICTED: uncharacterized protein LOC101219952 [Cucumis sativus]
 ref|XP_004164530.1| PREDICTED: uncharacterized protein LOC101227825 [Cucumis sativus]
 gb|KGN62919.1| hypothetical protein Csa_2G379990 [Cucumis sativus]
Length=368

 Score =   221 bits (562),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 110/177 (62%), Positives = 130/177 (73%), Gaps = 1/177 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
               LVK   F  GP   P       +P        P +P W VESLKAVKYID++HFSVP
Sbjct  191  NDNLVKNGDFESGPYVFPNASSGVLVPPNIEDDHSP-IPGWMVESLKAVKYIDSDHFSVP  249

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             G+RAVELVAGKESA+ QI RT+ GK Y L+F+VGDASN CEGSMV+EAFAG +TLKVPY
Sbjct  250  SGKRAVELVAGKESAIAQIVRTIPGKTYILSFVVGDASNSCEGSMVVEAFAGKNTLKVPY  309

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  163
            +SKG GG KPA L+F+A + RTR+MF ST+Y  RSDDF SLCGPV+D V+L+SVRNP
Sbjct  310  QSKGNGGSKPAALKFKAESTRTRIMFLSTFYTMRSDDFSSLCGPVLDKVRLLSVRNP  366


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            P+ +N NL+KN DFE GPYVFP   +GVL PP  EDDH P
Sbjct  187  PKASNDNLVKNGDFESGPYVFPNASSGVLVPPNIEDDHSP  226



>ref|NP_196703.1| uncharacterized protein [Arabidopsis thaliana]
 emb|CAB87702.1| putative protein [Arabidopsis thaliana]
 gb|AAK76721.1| unknown protein [Arabidopsis thaliana]
 gb|AAM20000.1| unknown protein [Arabidopsis thaliana]
 gb|AED91677.1| uncharacterized protein AT5G11420 [Arabidopsis thaliana]
Length=366

 Score =   221 bits (562),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 110/177 (62%), Positives = 131/177 (74%), Gaps = 1/177 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
             + ++K  GF  GP  +P       +P        P LPAW VESLKA+KY+D EHFSVP
Sbjct  191  NKNILKNGGFEEGPYVLPNATTGVLVPPFIEDDHSP-LPAWMVESLKAIKYVDVEHFSVP  249

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             GRRAVELVAGKESA+ Q+ARTV GK Y L+F VGDA+N C+GSMV+EAFAG  TLKVPY
Sbjct  250  QGRRAVELVAGKESAIAQVARTVVGKTYVLSFAVGDANNACQGSMVVEAFAGKDTLKVPY  309

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  163
            ES+G+GG+K A LRF A + RTRVMF+ST+Y  RSDDF SLCGPV+D VKL+S R P
Sbjct  310  ESRGKGGFKRASLRFVAVSTRTRVMFYSTFYSMRSDDFSSLCGPVIDDVKLLSARKP  366


 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR TN N+LKN  FEEGPYV P   TGVL PPF EDDH P
Sbjct  187  PRPTNKNILKNGGFEEGPYVLPNATTGVLVPPFIEDDHSP  226



>dbj|BAD93856.1| hypothetical protein [Arabidopsis thaliana]
Length=224

 Score =   216 bits (550),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 107/177 (60%), Positives = 130/177 (73%), Gaps = 1/177 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
             + ++K  GF  GP+ +P       +P        P LP W VESLKAVKY+D EHFSVP
Sbjct  49   NKNILKNGGFEEGPLVLPGSTTGVLIPPFIEDDHSP-LPGWMVESLKAVKYVDVEHFSVP  107

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             GRRA+ELVAGKESA+ Q+ RTV GK Y L+F VGDA+N C+GSMV+EAFAG  TLKVPY
Sbjct  108  QGRRAIELVAGKESAIAQVVRTVIGKTYVLSFAVGDANNACKGSMVVEAFAGKDTLKVPY  167

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  163
            ESKG GG+K A +RF A + R+R+MF+ST+Y  RSDDF SLCGPV+D VKL+SVR P
Sbjct  168  ESKGTGGFKRASIRFVAVSTRSRIMFYSTFYAMRSDDFSSLCGPVIDDVKLISVRKP  224


 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR TN N+LKN  FEEGP V P   TGVL PPF EDDH P
Sbjct  45   PRPTNKNILKNGGFEEGPLVLPGSTTGVLIPPFIEDDHSP  84



>gb|AAM63507.1| unknown [Arabidopsis thaliana]
Length=366

 Score =   220 bits (561),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 110/177 (62%), Positives = 131/177 (74%), Gaps = 1/177 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
             + ++K  GF  GP  +P       +P        P LPAW VESLKA+KY+D EHFSVP
Sbjct  191  SKNILKNGGFEEGPYVLPNATTGVLVPPFIEDDHSP-LPAWMVESLKAIKYVDVEHFSVP  249

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             GRRAVELVAGKESA+ Q+ARTV GK Y L+F VGDA+N C+GSMV+EAFAG  TLKVPY
Sbjct  250  QGRRAVELVAGKESAIAQVARTVVGKTYVLSFAVGDANNACQGSMVVEAFAGKDTLKVPY  309

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  163
            ES+G+GG+K A LRF A + RTRVMF+ST+Y  RSDDF SLCGPV+D VKL+S R P
Sbjct  310  ESRGKGGFKRASLRFVAVSTRTRVMFYSTFYSMRSDDFSSLCGPVIDDVKLLSARKP  366


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR T+ N+LKN  FEEGPYV P   TGVL PPF EDDH P
Sbjct  187  PRPTSKNILKNGGFEEGPYVLPNATTGVLVPPFIEDDHSP  226



>ref|XP_010541619.1| PREDICTED: uncharacterized protein LOC104815031 [Tarenaya hassleriana]
Length=364

 Score =   220 bits (561),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 110/177 (62%), Positives = 132/177 (75%), Gaps = 1/177 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
             + ++K  GF  GP+ +P       +P        P LP W VESLKAVKYID EHFSVP
Sbjct  189  NKNVLKNGGFEEGPLVLPNSTTGVLIPPFIEDDHSP-LPGWMVESLKAVKYIDIEHFSVP  247

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             GRRA+ELVAGKESA+ Q+A  +AGK Y L+F VGDASN C+GSM++EAFAG  TLKVPY
Sbjct  248  QGRRAIELVAGKESAIAQVAPAIAGKTYVLSFAVGDASNACKGSMIVEAFAGRDTLKVPY  307

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  163
            ES+G GG+K A +RF AT+NRTRVMF+ST+Y  RSDDF SLCGPV+D VKL+SVR P
Sbjct  308  ESRGTGGFKRAAMRFVATSNRTRVMFYSTFYAMRSDDFSSLCGPVIDDVKLLSVRKP  364


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR TN N+LKN  FEEGP V P   TGVL PPF EDDH P
Sbjct  185  PRPTNKNVLKNGGFEEGPLVLPNSTTGVLIPPFIEDDHSP  224



>ref|XP_011019764.1| PREDICTED: uncharacterized protein LOC105122387 [Populus euphratica]
Length=343

 Score =   219 bits (559),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 110/175 (63%), Positives = 131/175 (75%), Gaps = 1/175 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
             + L+K  GF  GP  +P       +P     +  P LP W VESLKAVK+ID EHFSVP
Sbjct  168  NKNLIKNGGFEEGPYLLPNTSWGVLIPPNIEDKHSP-LPGWMVESLKAVKFIDIEHFSVP  226

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             GRRA+ELVAGKESA+ Q+ RT+ GK Y L+F VGDASN CEGSMV+EAFAG  TLKVPY
Sbjct  227  QGRRAIELVAGKESAIAQVVRTIIGKTYSLSFAVGDASNSCEGSMVVEAFAGKDTLKVPY  286

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  169
            ESKG+GG+K A L+F A ++RTRVMF+ST+Y  RSDDF SLCGPVVD VKL+S+R
Sbjct  287  ESKGKGGFKRAVLKFVAVSSRTRVMFYSTFYTMRSDDFSSLCGPVVDDVKLLSLR  341


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 26/40 (65%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR TN NL+KN  FEEGPY+ P    GVL PP  ED H P
Sbjct  164  PRPTNKNLIKNGGFEEGPYLLPNTSWGVLIPPNIEDKHSP  203



>ref|XP_002871473.1| hypothetical protein ARALYDRAFT_487977 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47732.1| hypothetical protein ARALYDRAFT_487977 [Arabidopsis lyrata subsp. 
lyrata]
Length=366

 Score =   220 bits (561),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 108/177 (61%), Positives = 131/177 (74%), Gaps = 1/177 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
             + ++K  GF  GP  +P       +P        P LPAW +ESLKA+KY+D EHFSVP
Sbjct  191  NKNILKNGGFEEGPYVLPNATTGVLVPPFIEDDHSP-LPAWMIESLKAIKYVDVEHFSVP  249

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             GRRAVELVAGKESA+ Q+ARTV GK Y L+F VGDA+N C+GSM++EAFAG  TLKVPY
Sbjct  250  QGRRAVELVAGKESAIAQVARTVVGKTYVLSFAVGDANNACQGSMIVEAFAGKDTLKVPY  309

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  163
            ES+G+GG+K A LRF A + RTRVMF+ST+Y  RSDDF SLCGPV+D VKL+S R P
Sbjct  310  ESRGKGGFKRASLRFVAVSTRTRVMFYSTFYSMRSDDFSSLCGPVIDDVKLLSARKP  366


 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR TN N+LKN  FEEGPYV P   TGVL PPF EDDH P
Sbjct  187  PRPTNKNILKNGGFEEGPYVLPNATTGVLVPPFIEDDHSP  226



>ref|XP_010519935.1| PREDICTED: uncharacterized protein LOC104799224 [Tarenaya hassleriana]
Length=365

 Score =   220 bits (561),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 110/177 (62%), Positives = 132/177 (75%), Gaps = 1/177 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
             + ++K  GF  GP+ +P       +P        P LP W VESLKAVKYID EHFSVP
Sbjct  190  NKNILKNGGFEEGPLVLPNATTGVLIPPFIEDDHSP-LPGWMVESLKAVKYIDVEHFSVP  248

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             GRRAVELVAGKESA+ Q+ARTV GK Y L+F VGDA+N C+GSM++EAFAG  T+KVPY
Sbjct  249  QGRRAVELVAGKESAIAQVARTVVGKTYVLSFAVGDANNACKGSMIVEAFAGRDTIKVPY  308

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  163
            ES+G GG+K A LRF A ++RTR+MF+ST+Y  RSDDF SLCGPVVD VKL+SVR P
Sbjct  309  ESRGTGGFKRAALRFVAASDRTRIMFYSTFYSMRSDDFSSLCGPVVDDVKLLSVRKP  365


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR TN N+LKN  FEEGP V P   TGVL PPF EDDH P
Sbjct  186  PRPTNKNILKNGGFEEGPLVLPNATTGVLIPPFIEDDHSP  225



>ref|XP_010419712.1| PREDICTED: uncharacterized protein LOC104705408 [Camelina sativa]
Length=367

 Score =   220 bits (561),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 109/177 (62%), Positives = 132/177 (75%), Gaps = 1/177 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
             + ++K  GF  GP  +        +P        P LPAW +ESLKAVKY+D EHFSVP
Sbjct  192  NKNILKNGGFEEGPYILSNATTGVLIPPFIEDDHSP-LPAWMIESLKAVKYVDVEHFSVP  250

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             GRRAVELVAGKESA+ Q+ARTV GK Y L+F VGDA+N C+GSMV+EAFAG  TLKVPY
Sbjct  251  QGRRAVELVAGKESAIAQVARTVVGKTYVLSFAVGDANNACQGSMVVEAFAGRDTLKVPY  310

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  163
            ES+G+GG+K A +RF A +NRTR+MF+ST+Y  RSDDF SLCGPV+D VKL+SVR P
Sbjct  311  ESRGKGGFKRASMRFVAVSNRTRIMFYSTFYAMRSDDFSSLCGPVIDDVKLLSVRKP  367


 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR TN N+LKN  FEEGPY+     TGVL PPF EDDH P
Sbjct  188  PRPTNKNILKNGGFEEGPYILSNATTGVLIPPFIEDDHSP  227



>ref|XP_011019761.1| PREDICTED: uncharacterized protein LOC105122382 [Populus euphratica]
Length=365

 Score =   220 bits (560),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 110/175 (63%), Positives = 131/175 (75%), Gaps = 1/175 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
             + L+K  GF  GP  +P       +P     +  P LP W VESLKAVK+ID EHFSVP
Sbjct  190  NKNLIKNGGFEEGPYLLPNTSWGVLIPPNIEDKHSP-LPGWMVESLKAVKFIDIEHFSVP  248

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             GRRA+ELVAGKESA+ Q+ RT+ GK Y L+F VGDASN CEGSMV+EAFAG  TLKVPY
Sbjct  249  QGRRAIELVAGKESAIAQVVRTIIGKTYSLSFAVGDASNSCEGSMVVEAFAGKDTLKVPY  308

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  169
            ESKG+GG+K A L+F A ++RTRVMF+ST+Y  RSDDF SLCGPVVD VKL+S+R
Sbjct  309  ESKGKGGFKRAVLKFVAVSSRTRVMFYSTFYTMRSDDFSSLCGPVVDDVKLLSLR  363


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 26/40 (65%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR TN NL+KN  FEEGPY+ P    GVL PP  ED H P
Sbjct  186  PRPTNKNLIKNGGFEEGPYLLPNTSWGVLIPPNIEDKHSP  225



>gb|AAN31807.1| unknown protein [Arabidopsis thaliana]
Length=366

 Score =   220 bits (560),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 109/177 (62%), Positives = 131/177 (74%), Gaps = 1/177 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
             + ++K  GF  GP  +P       +P        P LPAW VESLKA+KY+D EHFSVP
Sbjct  191  NKNILKNGGFEEGPYVLPNATTGVLVPPFIEDDHSP-LPAWMVESLKAIKYVDVEHFSVP  249

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             GRRAVELVAGKESA+ Q+A+TV GK Y L+F VGDA+N C+GSMV+EAFAG  TLKVPY
Sbjct  250  QGRRAVELVAGKESAIAQVAKTVVGKTYVLSFAVGDANNACQGSMVVEAFAGKDTLKVPY  309

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  163
            ES+G+GG+K A LRF A + RTRVMF+ST+Y  RSDDF SLCGPV+D VKL+S R P
Sbjct  310  ESRGKGGFKRASLRFVAVSTRTRVMFYSTFYSMRSDDFSSLCGPVIDDVKLLSARKP  366


 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR TN N+LKN  FEEGPYV P   TGVL PPF EDDH P
Sbjct  187  PRPTNKNILKNGGFEEGPYVLPNATTGVLVPPFIEDDHSP  226



>ref|XP_010493802.1| PREDICTED: uncharacterized protein LOC104771027 [Camelina sativa]
Length=370

 Score =   219 bits (559),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 109/177 (62%), Positives = 131/177 (74%), Gaps = 1/177 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
             + ++K  GF  GP+ +P       +P        P LP W VESLKAVKY+D EHFSVP
Sbjct  195  NKNILKNGGFEEGPLVLPGATTGVLIPPFIEDDHSP-LPGWMVESLKAVKYVDVEHFSVP  253

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             GRRA+ELVAGKESA+ QI RTV GK Y L+F VGDA+N C+GSMV+EAFAG  TLKVPY
Sbjct  254  QGRRAIELVAGKESAIAQIVRTVIGKTYVLSFAVGDANNACKGSMVVEAFAGKETLKVPY  313

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  163
            ES+G GG+K A +RF A +NR+RVMF+ST+Y  RSDDF SLCGPV+D VKL+SVR P
Sbjct  314  ESRGTGGFKRASIRFVAVSNRSRVMFYSTFYSMRSDDFSSLCGPVIDDVKLISVRKP  370


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR TN N+LKN  FEEGP V P   TGVL PPF EDDH P
Sbjct  191  PRPTNKNILKNGGFEEGPLVLPGATTGVLIPPFIEDDHSP  230



>ref|XP_010454874.1| PREDICTED: uncharacterized protein LOC104736571 [Camelina sativa]
Length=369

 Score =   219 bits (559),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 109/177 (62%), Positives = 131/177 (74%), Gaps = 1/177 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
             + ++K  GF  GP+ +P       +P        P LP W VESLKAVKY+D EHFSVP
Sbjct  194  NKNILKNGGFEEGPLVLPGATTGVLIPPFIEDDHSP-LPGWMVESLKAVKYVDVEHFSVP  252

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             GRRA+ELVAGKESA+ QI RTV GK Y L+F VGDA+N C+GSMV+EAFAG  TLKVPY
Sbjct  253  QGRRAIELVAGKESAIAQIVRTVIGKTYVLSFAVGDANNACKGSMVVEAFAGKETLKVPY  312

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  163
            ES+G GG+K A +RF A +NR+RVMF+ST+Y  RSDDF SLCGPV+D VKL+SVR P
Sbjct  313  ESRGTGGFKRASIRFVAVSNRSRVMFYSTFYSMRSDDFSSLCGPVIDDVKLISVRKP  369


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR TN N+LKN  FEEGP V P   TGVL PPF EDDH P
Sbjct  190  PRPTNKNILKNGGFEEGPLVLPGATTGVLIPPFIEDDHSP  229



>ref|XP_010421395.1| PREDICTED: uncharacterized protein LOC104706866 [Camelina sativa]
Length=369

 Score =   219 bits (559),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 109/177 (62%), Positives = 131/177 (74%), Gaps = 1/177 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
             + ++K  GF  GP+ +P       +P        P LP W VESLKAVKY+D EHFSVP
Sbjct  194  NKNILKNGGFEEGPLVLPGATTGVLIPPFIEDDHSP-LPGWMVESLKAVKYVDVEHFSVP  252

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             GRRA+ELVAGKESA+ QI RTV GK Y L+F VGDA+N C+GSMV+EAFAG  TLKVPY
Sbjct  253  QGRRAIELVAGKESAIAQIVRTVIGKTYVLSFAVGDANNACKGSMVVEAFAGKETLKVPY  312

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  163
            ES+G GG+K A +RF A +NR+RVMF+ST+Y  RSDDF SLCGPV+D VKL+SVR P
Sbjct  313  ESRGTGGFKRASIRFVAVSNRSRVMFYSTFYSMRSDDFSSLCGPVIDDVKLISVRKP  369


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR TN N+LKN  FEEGP V P   TGVL PPF EDDH P
Sbjct  190  PRPTNKNILKNGGFEEGPLVLPGATTGVLIPPFIEDDHSP  229



>ref|XP_007223355.1| hypothetical protein PRUPE_ppa007452mg [Prunus persica]
 gb|EMJ24554.1| hypothetical protein PRUPE_ppa007452mg [Prunus persica]
Length=367

 Score =   219 bits (558),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 110/179 (61%), Positives = 131/179 (73%), Gaps = 1/179 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
             + L+K  GF  GP   P       +P        P LP W VESLKAVKYID+ HFSVP
Sbjct  190  NKNLLKNAGFEEGPYMFPNASWGVLIPPNIEDDHSP-LPGWMVESLKAVKYIDSNHFSVP  248

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             G+RAVELVAGKESA+ Q+ART+ GK Y L+F VGDASN CEGSM++EAFAG  T+KVPY
Sbjct  249  EGKRAVELVAGKESAIAQVARTIPGKTYVLSFSVGDASNSCEGSMIVEAFAGRDTVKVPY  308

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNPHR  157
            ESKG+GG+K A L+F A + RTRVMF STYY  RSDDF SLCGPV+D VKL+S++NP +
Sbjct  309  ESKGKGGFKRAVLKFVAVSTRTRVMFLSTYYTMRSDDFSSLCGPVLDDVKLLSLKNPRQ  367


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR TN NLLKN  FEEGPY+FP    GVL PP  EDDH P
Sbjct  186  PRATNKNLLKNAGFEEGPYMFPNASWGVLIPPNIEDDHSP  225



>ref|XP_006287976.1| hypothetical protein CARUB_v10001211mg [Capsella rubella]
 gb|EOA20874.1| hypothetical protein CARUB_v10001211mg [Capsella rubella]
Length=370

 Score =   219 bits (559),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 108/177 (61%), Positives = 131/177 (74%), Gaps = 1/177 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
             + ++K  GF  GP+ +P       +P        P LP W VESLKAVKY+D EHFSVP
Sbjct  195  NKNILKNGGFEEGPLVLPGATTGVLIPPFIEDDHSP-LPGWMVESLKAVKYVDVEHFSVP  253

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             GRRA+ELVAGKESA+ QI RTV GK Y L+F VGDA+N C+GSMV+EAFAG  TLKVPY
Sbjct  254  QGRRAIELVAGKESAIAQIVRTVIGKTYVLSFAVGDANNACKGSMVVEAFAGKETLKVPY  313

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  163
            ES+G GG+K A +RF A +NR+R+MF+ST+Y  RSDDF SLCGPV+D VKL+SVR P
Sbjct  314  ESRGTGGFKRASIRFVAVSNRSRIMFYSTFYSMRSDDFSSLCGPVIDDVKLISVRKP  370


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR TN N+LKN  FEEGP V P   TGVL PPF EDDH P
Sbjct  191  PRPTNKNILKNGGFEEGPLVLPGATTGVLIPPFIEDDHSP  230



>ref|XP_008445161.1| PREDICTED: uncharacterized protein LOC103488281 [Cucumis melo]
Length=422

 Score =   221 bits (562),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 110/177 (62%), Positives = 130/177 (73%), Gaps = 1/177 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
               LVK   F  GP   P       +P        P +P W VESLKAVKYID++HFSVP
Sbjct  245  NDNLVKNGDFESGPYVFPNASSGVLVPPNIEDDHSP-IPGWMVESLKAVKYIDSDHFSVP  303

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             G+RAVELVAGKESA+ QI RT+ GK Y L+F+VGDASN CEGSMV+EAFAG +TLKVPY
Sbjct  304  SGKRAVELVAGKESAIAQIVRTIPGKTYILSFVVGDASNSCEGSMVVEAFAGKNTLKVPY  363

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  163
            +SKG GG KPA L+F+A + RTR+MF ST+Y  RSDDF SLCGPV+D V+L+SVRNP
Sbjct  364  QSKGNGGSKPAALKFKAESTRTRIMFLSTFYTMRSDDFSSLCGPVLDKVRLLSVRNP  420


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            P+ +N NL+KN DFE GPYVFP   +GVL PP  EDDH P
Sbjct  241  PKASNDNLVKNGDFESGPYVFPNASSGVLVPPNIEDDHSP  280



>ref|XP_009121952.1| PREDICTED: uncharacterized protein LOC103846721 [Brassica rapa]
Length=366

 Score =   219 bits (558),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 109/177 (62%), Positives = 131/177 (74%), Gaps = 1/177 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
             + ++K  GF  GP  +P       +P        P LPAW +ESLKAVKY+D EHFSVP
Sbjct  191  NKNILKNGGFEEGPYIIPNATTGVLIPPFIEDDHSP-LPAWIIESLKAVKYVDVEHFSVP  249

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             GRRAVELVAGKESA+ Q+ART+ GK Y L+F VGDA+N C+GSM++EAFAG  TLKV Y
Sbjct  250  QGRRAVELVAGKESAIAQVARTIVGKSYVLSFAVGDANNACKGSMIVEAFAGKDTLKVAY  309

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  163
            ESKG+GG+K A LRF A +NRTRVMF+ST+Y  RSDDF SLCGPV+D VKL+SV  P
Sbjct  310  ESKGKGGFKRAALRFVAVSNRTRVMFYSTFYAMRSDDFSSLCGPVIDDVKLLSVGKP  366


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR TN N+LKN  FEEGPY+ P   TGVL PPF EDDH P
Sbjct  187  PRPTNKNILKNGGFEEGPYIIPNATTGVLIPPFIEDDHSP  226



>ref|XP_010526203.1| PREDICTED: uncharacterized protein LOC104803829 [Tarenaya hassleriana]
Length=363

 Score =   219 bits (557),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 109/177 (62%), Positives = 130/177 (73%), Gaps = 1/177 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
             + ++K  GF  GP  +P       +P        P LP W VESLKAVK+ID++HFSVP
Sbjct  188  NKNILKNGGFEEGPWVLPNASSGVLIPPNIEDDHSP-LPGWIVESLKAVKFIDSDHFSVP  246

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             GRRAVELVAGKESA+ Q+ RT+ GK Y L+F VGDASN C GSMV+EAFAG  T+KVPY
Sbjct  247  QGRRAVELVAGKESAIAQVVRTIPGKTYVLSFAVGDASNACSGSMVVEAFAGKDTVKVPY  306

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  163
            ESKG+GG+K A LRF A +NRTR+MFFST+Y  RSDDF SLCGPV+D VKL+S R P
Sbjct  307  ESKGKGGFKRASLRFVAISNRTRIMFFSTFYSMRSDDFSSLCGPVIDDVKLLSARKP  363


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR TN N+LKN  FEEGP+V P   +GVL PP  EDDH P
Sbjct  184  PRPTNKNILKNGGFEEGPWVLPNASSGVLIPPNIEDDHSP  223



>emb|CDX85713.1| BnaA02g01000D [Brassica napus]
Length=366

 Score =   218 bits (556),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 109/174 (63%), Positives = 130/174 (75%), Gaps = 1/174 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
             + ++K  GF  GP  +P       +P        P LPAW +ESLKAVKY+D EHFSVP
Sbjct  191  NKNILKNGGFEEGPYLLPNSTTGVLIPPFIEDDHSP-LPAWMIESLKAVKYVDVEHFSVP  249

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             GRRAVELVAGKESA+ Q+ART+ GK Y L+F VGDA+N CEGSM++EAFAG  TLKVPY
Sbjct  250  QGRRAVELVAGKESAIAQVARTIIGKTYVLSFAVGDANNACEGSMIVEAFAGRDTLKVPY  309

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  172
            ESKG+GG+K A LRF A + RTRVMF+ST+Y  RSDDF SLCGPV+D VKL+SV
Sbjct  310  ESKGKGGFKRATLRFVAVSTRTRVMFYSTFYAMRSDDFSSLCGPVIDDVKLLSV  363


 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR TN N+LKN  FEEGPY+ P   TGVL PPF EDDH P
Sbjct  187  PRPTNKNILKNGGFEEGPYLLPNSTTGVLIPPFIEDDHSP  226



>ref|XP_006483312.1| PREDICTED: uncharacterized protein LOC102608149 [Citrus sinensis]
Length=366

 Score =   218 bits (556),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 109/176 (62%), Positives = 130/176 (74%), Gaps = 1/176 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
             + ++K  GF  GP   P       +P        P LP W +ESLKAVKYID++HFSVP
Sbjct  190  NKNILKNGGFEEGPYVFPNTSWGVLIPPNIEDDHSP-LPGWMIESLKAVKYIDSDHFSVP  248

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             G+RA+ELVAGKESA+ QIART+ GK Y LTF VGDA+N C GSMV+EAFAG  T+KVPY
Sbjct  249  QGKRAIELVAGKESAIAQIARTIPGKTYTLTFTVGDANNACAGSMVVEAFAGKGTIKVPY  308

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRN  166
            ESKG+GG+K A LRF A +NRTR+MF ST+Y  RSDDF SLCGPV+D VKL+SVRN
Sbjct  309  ESKGKGGFKRAVLRFVAVSNRTRIMFLSTFYTMRSDDFSSLCGPVIDDVKLLSVRN  364


 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR +N N+LKN  FEEGPYVFP    GVL PP  EDDH P
Sbjct  186  PRASNKNILKNGGFEEGPYVFPNTSWGVLIPPNIEDDHSP  225



>ref|XP_009125805.1| PREDICTED: uncharacterized protein LOC103850771 [Brassica rapa]
Length=366

 Score =   218 bits (556),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 109/174 (63%), Positives = 130/174 (75%), Gaps = 1/174 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
             + ++K  GF  GP  +P       +P        P LPAW +ESLKAVKY+D EHFSVP
Sbjct  191  NKNILKNGGFEEGPYLLPNSTTGVLIPPFIEDDHSP-LPAWMIESLKAVKYVDVEHFSVP  249

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             GRRAVELVAGKESA+ Q+ART+ GK Y L+F VGDA+N CEGSM++EAFAG  TLKVPY
Sbjct  250  QGRRAVELVAGKESAIAQVARTIIGKTYVLSFAVGDANNACEGSMIVEAFAGRDTLKVPY  309

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  172
            ESKG+GG+K A LRF A + RTRVMF+ST+Y  RSDDF SLCGPV+D VKL+SV
Sbjct  310  ESKGKGGFKRATLRFVAVSTRTRVMFYSTFYAMRSDDFSSLCGPVIDDVKLLSV  363


 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR TN N+LKN  FEEGPY+ P   TGVL PPF EDDH P
Sbjct  187  PRPTNKNILKNGGFEEGPYLLPNSTTGVLIPPFIEDDHSP  226



>ref|XP_002324280.2| hypothetical protein POPTR_0018s01390g [Populus trichocarpa]
 gb|EEF02845.2| hypothetical protein POPTR_0018s01390g [Populus trichocarpa]
Length=398

 Score =   219 bits (559),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 110/175 (63%), Positives = 130/175 (74%), Gaps = 1/175 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
             + ++K  GF  GP   P       +P     +  P LP W VESLKAVKYID EHFSVP
Sbjct  223  NKNILKNGGFEEGPYVFPNTTWGVLIPPNIEDKHSP-LPGWMVESLKAVKYIDVEHFSVP  281

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             GRRAVELVAGKESA+ Q+ARTV GK Y L+F VGDASN CEGSMV+EAFAG  TLKVPY
Sbjct  282  QGRRAVELVAGKESAIAQVARTVIGKTYTLSFAVGDASNSCEGSMVVEAFAGKDTLKVPY  341

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  169
            ESKG+GG+K A L+F A + RTR+MF+ST+Y  RSDDF SLCGPV+D +KL+S+R
Sbjct  342  ESKGKGGFKRAVLKFVAVSTRTRIMFYSTFYTMRSDDFSSLCGPVIDDIKLLSLR  396


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR TN N+LKN  FEEGPYVFP    GVL PP  ED H P
Sbjct  219  PRPTNKNILKNGGFEEGPYVFPNTTWGVLIPPNIEDKHSP  258



>ref|XP_008219896.1| PREDICTED: uncharacterized protein LOC103320060 [Prunus mume]
Length=367

 Score =   218 bits (556),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 110/179 (61%), Positives = 131/179 (73%), Gaps = 1/179 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
             + L+K  GF  GP   P       +P        P LP W VESLKAVKYID+ HFSVP
Sbjct  190  NKNLLKNAGFEEGPYVFPNASWGVLIPPNIEDDHSP-LPGWMVESLKAVKYIDSNHFSVP  248

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             G+RAVELVAGKESA+ Q+ART+ GK Y L+F VGDASN CEGSM++EAFAG  T+KVPY
Sbjct  249  EGKRAVELVAGKESAIAQVARTIPGKTYVLSFSVGDASNSCEGSMIVEAFAGRDTVKVPY  308

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNPHR  157
            ESKG+GG+K A L+F A + RTRVMF STYY  RSDDF SLCGPV+D VKL+S++NP +
Sbjct  309  ESKGKGGFKRAVLKFVAVSTRTRVMFLSTYYTMRSDDFSSLCGPVLDDVKLLSLKNPRQ  367


 Score = 58.9 bits (141),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR TN NLLKN  FEEGPYVFP    GVL PP  EDDH P
Sbjct  186  PRATNKNLLKNAGFEEGPYVFPNASWGVLIPPNIEDDHSP  225



>gb|KFK27809.1| hypothetical protein AALP_AA8G432300 [Arabis alpina]
Length=370

 Score =   218 bits (556),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 108/177 (61%), Positives = 131/177 (74%), Gaps = 1/177 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
             + ++K  GF  GP+ +P       +P        P LP W VESLKAVKY+D EHFSVP
Sbjct  195  NKNILKNGGFEEGPLVLPGATTGVLIPPFIEDDHSP-LPGWMVESLKAVKYVDTEHFSVP  253

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             GRRA+ELVAGKESA+ Q+ART+ GK Y L+F VGDA+N C+GSMV+EAFAG  TLKVPY
Sbjct  254  QGRRAIELVAGKESAIAQVARTIIGKTYVLSFAVGDANNACKGSMVVEAFAGKETLKVPY  313

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  163
            ES+G GG+K A +RF A + RTRVMF+ST+Y  RSDDF SLCGPV+D VKL+SVR P
Sbjct  314  ESRGTGGFKRASVRFVAVSTRTRVMFYSTFYAMRSDDFSSLCGPVIDDVKLLSVRKP  370


 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR TN N+LKN  FEEGP V P   TGVL PPF EDDH P
Sbjct  191  PRPTNKNILKNGGFEEGPLVLPGATTGVLIPPFIEDDHSP  230



>emb|CDY19801.1| BnaA09g04540D [Brassica napus]
Length=370

 Score =   218 bits (555),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 108/177 (61%), Positives = 131/177 (74%), Gaps = 1/177 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
             + ++K  GF  GP+ +P       +P        P LP W VESLKAVKY+D EHFS+P
Sbjct  195  NKNILKNGGFEEGPLVLPGATTGVLIPPFIEDDHSP-LPGWMVESLKAVKYVDTEHFSIP  253

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             GRRA+ELVAGKESA+ Q+ARTV GK Y L+F VGDA+N C+GSMV+EAFAG  TLKVPY
Sbjct  254  QGRRAIELVAGKESAIAQVARTVIGKTYVLSFAVGDANNACKGSMVVEAFAGRDTLKVPY  313

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  163
            ES+G GG+K A +RF A + RTRVMF+ST+Y  RSDDF SLCGPV+D VKL+SVR P
Sbjct  314  ESRGTGGFKRASIRFVAVSTRTRVMFYSTFYAMRSDDFSSLCGPVIDDVKLLSVRKP  370


 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR TN N+LKN  FEEGP V P   TGVL PPF EDDH P
Sbjct  191  PRPTNKNILKNGGFEEGPLVLPGATTGVLIPPFIEDDHSP  230



>emb|CDX91217.1| BnaC02g03800D [Brassica napus]
Length=366

 Score =   218 bits (554),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 109/174 (63%), Positives = 130/174 (75%), Gaps = 1/174 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
             + ++K  GF  GP  +P       +P        P LPAW VESLKAVKY+D EHFSVP
Sbjct  191  NKNILKNGGFEEGPYLLPNSTTGVLIPPFIEDDHSP-LPAWMVESLKAVKYVDVEHFSVP  249

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             GRRAVELVAGKESA+ Q+ART+ GK Y L+F VGDA+N CEGSM++EAFAG  TLKVPY
Sbjct  250  QGRRAVELVAGKESAIAQVARTIIGKTYVLSFAVGDANNACEGSMIVEAFAGRDTLKVPY  309

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  172
            +SKG+GG+K A LRF A + RTRVMF+ST+Y  RSDDF SLCGPV+D VKL+SV
Sbjct  310  QSKGKGGFKRATLRFVAVSTRTRVMFYSTFYAMRSDDFSSLCGPVIDDVKLLSV  363


 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR TN N+LKN  FEEGPY+ P   TGVL PPF EDDH P
Sbjct  187  PRPTNKNILKNGGFEEGPYLLPNSTTGVLIPPFIEDDHSP  226



>ref|XP_010106829.1| hypothetical protein L484_006602 [Morus notabilis]
 gb|EXC12058.1| hypothetical protein L484_006602 [Morus notabilis]
Length=217

 Score =   213 bits (541),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 100/140 (71%), Positives = 117/140 (84%), Gaps = 0/140 (0%)
 Frame = -1

Query  582  LPAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDA  403
            LP W VESLKAVKYID++HFSVPHG+RAVELVAGKESA+ Q+ RT+ GK Y LTF VGDA
Sbjct  77   LPYWMVESLKAVKYIDSDHFSVPHGKRAVELVAGKESAIAQVVRTIVGKTYRLTFSVGDA  136

Query  402  SNKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDD  223
            SN CEGSM++EAFAG +T+KVPYESKG+GG+K   L F AT  RTR+MF ST+Y  RSDD
Sbjct  137  SNSCEGSMIVEAFAGRATVKVPYESKGKGGFKRGVLTFVATETRTRIMFLSTFYSMRSDD  196

Query  222  FVSLCGPVVDFVKLVSVRNP  163
            F SLCGPV+D +KL+SVR P
Sbjct  197  FSSLCGPVLDDIKLLSVRKP  216



>ref|NP_197928.1| UF642 l-GalL-responsive protein 1 [Arabidopsis thaliana]
 gb|AAK62407.1|AF386962_1 Unknown protein [Arabidopsis thaliana]
 gb|AAP37805.1| At5g25460 [Arabidopsis thaliana]
 gb|AED93446.1| uncharacterized protein AT5G25460 [Arabidopsis thaliana]
Length=369

 Score =   218 bits (554),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 107/177 (60%), Positives = 130/177 (73%), Gaps = 1/177 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
             + ++K  GF  GP+ +P       +P        P LP W VESLKAVKY+D EHFSVP
Sbjct  194  NKNILKNGGFEEGPLVLPGSTTGVLIPPFIEDDHSP-LPGWMVESLKAVKYVDVEHFSVP  252

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             GRRA+ELVAGKESA+ Q+ RTV GK Y L+F VGDA+N C+GSMV+EAFAG  TLKVPY
Sbjct  253  QGRRAIELVAGKESAIAQVVRTVIGKTYVLSFAVGDANNACKGSMVVEAFAGKDTLKVPY  312

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  163
            ESKG GG+K A +RF A + R+R+MF+ST+Y  RSDDF SLCGPV+D VKL+SVR P
Sbjct  313  ESKGTGGFKRASIRFVAVSTRSRIMFYSTFYAMRSDDFSSLCGPVIDDVKLISVRKP  369


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR TN N+LKN  FEEGP V P   TGVL PPF EDDH P
Sbjct  190  PRPTNKNILKNGGFEEGPLVLPGSTTGVLIPPFIEDDHSP  229



>ref|XP_010048991.1| PREDICTED: uncharacterized protein LOC104437692 [Eucalyptus grandis]
 gb|KCW81432.1| hypothetical protein EUGRSUZ_C02812 [Eucalyptus grandis]
Length=325

 Score =   216 bits (550),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 112/177 (63%), Positives = 130/177 (73%), Gaps = 1/177 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
             R L+K   F  GP   P       +P        P LP W VESLKAVKYID+ HFSVP
Sbjct  150  NRNLLKNGDFEEGPYVFPNTSWGVLIPPNIEDDHSP-LPGWMVESLKAVKYIDSGHFSVP  208

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             G+RAVELVAGKESA+ Q+ART+ GK Y L+F VGDASN CEGSMV+EAFAG  T+KVPY
Sbjct  209  EGKRAVELVAGKESAIAQVARTIPGKTYVLSFAVGDASNSCEGSMVVEAFAGKDTVKVPY  268

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  163
            ESKG+GGYK A LRF+A + RTR+MF+ST+Y  RSDDF SLCGPV+D VKL+SVR P
Sbjct  269  ESKGKGGYKRAVLRFKAVSVRTRIMFYSTFYTMRSDDFSSLCGPVLDDVKLLSVRFP  325


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            P+ +N NLLKN DFEEGPYVFP    GVL PP  EDDH P
Sbjct  146  PKASNRNLLKNGDFEEGPYVFPNTSWGVLIPPNIEDDHSP  185



>ref|XP_009345289.1| PREDICTED: uncharacterized protein LOC103937097 [Pyrus x bretschneideri]
Length=369

 Score =   217 bits (553),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 110/177 (62%), Positives = 129/177 (73%), Gaps = 1/177 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
             + L+K  GF  GP   P       +P        P LP W VESLKAVKYID++HFSVP
Sbjct  194  NKNLLKNAGFEEGPYVFPNASWGVLIPPNIEDDHSP-LPGWMVESLKAVKYIDSDHFSVP  252

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             G+RAVELVAGKESA+ Q+ RT+ GK Y L+F VGDASN CEGSM++EAFA  +T+KVPY
Sbjct  253  EGKRAVELVAGKESAIAQVVRTIPGKTYVLSFSVGDASNSCEGSMIVEAFADKNTVKVPY  312

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  163
            ESKG+GGYK A L+F A + RTRVMF STYY  RSDDF SLCGPVVD VKL+S+R P
Sbjct  313  ESKGKGGYKRAVLKFVAASTRTRVMFLSTYYTMRSDDFSSLCGPVVDDVKLLSLRKP  369


 Score = 58.9 bits (141),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR TN NLLKN  FEEGPYVFP    GVL PP  EDDH P
Sbjct  190  PRATNKNLLKNAGFEEGPYVFPNASWGVLIPPNIEDDHSP  229



>ref|XP_009334778.1| PREDICTED: uncharacterized protein LOC103927565 [Pyrus x bretschneideri]
Length=365

 Score =   217 bits (553),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 110/177 (62%), Positives = 129/177 (73%), Gaps = 1/177 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
             + L+K  GF  GP   P       +P        P LP W VESLKAVKYID++HFSVP
Sbjct  190  NKNLLKNAGFEEGPYVFPNASWGVLIPPNIEDDHSP-LPGWMVESLKAVKYIDSDHFSVP  248

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             G+RAVELVAGKESA+ Q+ RT+ GK Y L+F VGDASN CEGSM++EAFA  +T+KVPY
Sbjct  249  EGKRAVELVAGKESAIAQVVRTIPGKTYVLSFSVGDASNSCEGSMIVEAFADKNTVKVPY  308

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  163
            ESKG+GGYK A L+F A + RTRVMF STYY  RSDDF SLCGPVVD VKL+S+R P
Sbjct  309  ESKGKGGYKRAVLKFVAASTRTRVMFLSTYYTMRSDDFSSLCGPVVDDVKLLSLRKP  365


 Score = 58.9 bits (141),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR TN NLLKN  FEEGPYVFP    GVL PP  EDDH P
Sbjct  186  PRATNKNLLKNAGFEEGPYVFPNASWGVLIPPNIEDDHSP  225



>gb|ABK94923.1| unknown [Populus trichocarpa]
Length=365

 Score =   217 bits (553),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 108/175 (62%), Positives = 131/175 (75%), Gaps = 1/175 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
             + LVK  GF  GP  +P       +P     +  P LP W VESLKAVK+ID EHFSVP
Sbjct  190  NKNLVKNGGFEEGPYLLPNTSWGVLIPPNIEDKHSP-LPGWMVESLKAVKFIDVEHFSVP  248

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             GRRA+ELVAGKESA+ Q+ RT+ GK Y L+F VGDASN C+GSMV+EAFAG  T+KVPY
Sbjct  249  QGRRAIELVAGKESAIAQVVRTIIGKTYTLSFAVGDASNSCQGSMVVEAFAGKDTVKVPY  308

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  169
            ESKG+GG+K A L+F A ++RTR+MF+ST+Y  RSDDF SLCGPVVD VKL+S+R
Sbjct  309  ESKGKGGFKRAVLKFVAASSRTRIMFYSTFYTMRSDDFSSLCGPVVDDVKLLSLR  363


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 26/40 (65%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR TN NL+KN  FEEGPY+ P    GVL PP  ED H P
Sbjct  186  PRPTNKNLVKNGGFEEGPYLLPNTSWGVLIPPNIEDKHSP  225



>ref|XP_004291483.1| PREDICTED: uncharacterized protein LOC101294330 [Fragaria vesca 
subsp. vesca]
Length=368

 Score =   217 bits (552),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 110/179 (61%), Positives = 130/179 (73%), Gaps = 1/179 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
             + L+K  GF  GP   P       +P        P LP W VESLKAVKYID++HFSVP
Sbjct  191  NKNLLKNAGFEEGPYVFPNTSWGVLIPPNIEDDHSP-LPGWMVESLKAVKYIDSDHFSVP  249

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             G+RAVELVAGKESA+ QI RT+ GK Y LTF VGDASN CEGSM++EAFAG  T+KVPY
Sbjct  250  EGKRAVELVAGKESAIAQIVRTIPGKTYMLTFSVGDASNSCEGSMIVEAFAGRDTIKVPY  309

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNPHR  157
            ESKG+GG+K A L+FRA   RTR+MF ST+Y  RSDDF SLCGPV+D VKL+S+R P +
Sbjct  310  ESKGKGGFKRAVLKFRAVGPRTRIMFLSTFYTMRSDDFSSLCGPVLDDVKLLSLRRPRQ  368


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR TN NLLKN  FEEGPYVFP    GVL PP  EDDH P
Sbjct  187  PRATNKNLLKNAGFEEGPYVFPNTSWGVLIPPNIEDDHSP  226



>ref|XP_010249980.1| PREDICTED: uncharacterized protein LOC104592350 [Nelumbo nucifera]
Length=369

 Score =   217 bits (552),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = -1

Query  582  LPAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDA  403
            LP W +ESLKAVKYIDAEHFSVP G+RAVELVAGKESA+ Q+ARTV GK Y L F VGDA
Sbjct  227  LPGWMIESLKAVKYIDAEHFSVPEGKRAVELVAGKESAIAQVARTVPGKAYALMFAVGDA  286

Query  402  SNKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDD  223
            +N+CEGSMV+EAFAG  T+KVPYESKG GG+K A L+F A + RTR+MF ST+Y  RSDD
Sbjct  287  NNRCEGSMVVEAFAGRDTVKVPYESKGTGGFKRAVLKFTAASPRTRIMFLSTFYTMRSDD  346

Query  222  FVSLCGPVVDFVKLVSVRNPHR  157
              SLCGPVVD VKL+S+RNP R
Sbjct  347  MASLCGPVVDDVKLLSIRNPRR  368


 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR T  NLLKN +FEEGPYVFP    GVL PP  EDDH P
Sbjct  187  PRPTGKNLLKNGNFEEGPYVFPNTSWGVLVPPNIEDDHSP  226



>ref|XP_006394799.1| hypothetical protein EUTSA_v10004442mg [Eutrema salsugineum]
 gb|ESQ32085.1| hypothetical protein EUTSA_v10004442mg [Eutrema salsugineum]
Length=367

 Score =   217 bits (552),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 108/175 (62%), Positives = 130/175 (74%), Gaps = 1/175 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
             + ++K  GF  GP+ +P       +P        P LP W VESLKAVKY+D EHFSVP
Sbjct  192  NKNILKNGGFEEGPLVLPGATTGVLIPPFIEDDHSP-LPGWMVESLKAVKYVDTEHFSVP  250

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             GRRA+ELVAGKESA+ Q+ARTV GK Y L+F VGDA+N C+GSMV+EAFAG  TLKVPY
Sbjct  251  QGRRAIELVAGKESAIAQVARTVVGKTYVLSFAVGDANNACKGSMVVEAFAGKDTLKVPY  310

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  169
            ES+G GG+K A +RF A + RTRVMF+ST+Y  RSDDF SLCGPV+D VKL+SVR
Sbjct  311  ESRGTGGFKRASIRFVAVSTRTRVMFYSTFYAMRSDDFSSLCGPVIDDVKLLSVR  365


 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR TN N+LKN  FEEGP V P   TGVL PPF EDDH P
Sbjct  188  PRPTNKNILKNGGFEEGPLVLPGATTGVLIPPFIEDDHSP  227



>gb|KHG29602.1| Allergen Act d 3 [Gossypium arboreum]
Length=369

 Score =   217 bits (552),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 109/177 (62%), Positives = 128/177 (72%), Gaps = 1/177 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
             + ++K  GF  GP   P       +P        P LPAW VESLKAVKYID+ H+ VP
Sbjct  194  NKNIIKNGGFEEGPYIFPNTPWGVLIPPNIEDDNSP-LPAWVVESLKAVKYIDSAHYFVP  252

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             GRRAVELV GKESA+ QI RT+ GK Y L+F VGDA+N C GS+V+EAFAG +TLKVPY
Sbjct  253  QGRRAVELVGGKESAIAQITRTIVGKTYRLSFSVGDANNSCAGSLVVEAFAGKATLKVPY  312

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  163
            ESKG GG+K A LRF A +NRTR+MF ST+Y  RSDDF SLCGPVVD VKL+S+RNP
Sbjct  313  ESKGTGGFKRAALRFVAVSNRTRIMFLSTFYTMRSDDFSSLCGPVVDDVKLLSIRNP  369


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR TN N++KN  FEEGPY+FP    GVL PP  EDD+ P
Sbjct  190  PRPTNKNIIKNGGFEEGPYIFPNTPWGVLIPPNIEDDNSP  229



>ref|XP_002284962.1| PREDICTED: uncharacterized protein LOC100252479 [Vitis vinifera]
Length=368

 Score =   216 bits (551),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 110/181 (61%), Positives = 132/181 (73%), Gaps = 1/181 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
             + L+K  GF  GP   P       +P        P LP W VESLKAVKYID++HFSVP
Sbjct  189  SKNLLKNGGFEEGPYVFPNTSWGVLIPPNIEDDHSP-LPGWMVESLKAVKYIDSDHFSVP  247

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
              +RAVELVAGKESA+ Q+ART+ GK Y L+F VGDASN CEGSMV+EAFAG  T+KVPY
Sbjct  248  QEKRAVELVAGKESAIAQVARTIPGKTYALSFSVGDASNSCEGSMVVEAFAGRDTIKVPY  307

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNPHRR  154
            ESKG+GG+K A LRF A +NRTR+MF ST+Y  RSDD+ SLCGPV+D VKL+S+R P R 
Sbjct  308  ESKGKGGFKRAVLRFVAVSNRTRIMFLSTFYTMRSDDYASLCGPVLDDVKLLSLRTPPRH  367

Query  153  L  151
            +
Sbjct  368  I  368


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR ++ NLLKN  FEEGPYVFP    GVL PP  EDDH P
Sbjct  185  PRPSSKNLLKNGGFEEGPYVFPNTSWGVLIPPNIEDDHSP  224



>emb|CDX80516.1| BnaC07g29280D [Brassica napus]
Length=306

 Score =   214 bits (546),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/175 (60%), Positives = 130/175 (74%), Gaps = 1/175 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
             + ++K  GF  GP+ +P    R  +P        P LP W VESLKAVKY+D EHFS+P
Sbjct  131  NKNILKNGGFEEGPLVLPGSTTRVLIPPFIEDDHSP-LPGWMVESLKAVKYVDTEHFSIP  189

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             GRRA+ELV GKESA+ Q+ART+ GK Y L+F VGDA+N C+GSMV+EAFAG  TLKVPY
Sbjct  190  QGRRAIELVVGKESAIAQVARTIIGKTYVLSFAVGDANNACKGSMVVEAFAGRDTLKVPY  249

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  169
            ES+G GG+K A +RF A + RT+VMF+ST+Y  RSDDF SLCGPV+D VKL+SVR
Sbjct  250  ESRGTGGFKRASIRFVAVSTRTKVMFYSTFYAMRSDDFSSLCGPVIDDVKLLSVR  304


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR TN N+LKN  FEEGP V P   T VL PPF EDDH P
Sbjct  127  PRPTNKNILKNGGFEEGPLVLPGSTTRVLIPPFIEDDHSP  166



>ref|XP_002308647.2| hypothetical protein POPTR_0006s26630g [Populus trichocarpa]
 gb|EEE92170.2| hypothetical protein POPTR_0006s26630g [Populus trichocarpa]
Length=415

 Score =   218 bits (555),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 109/175 (62%), Positives = 131/175 (75%), Gaps = 1/175 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
             + LVK  GF  GP  +P       +P     +  P LP W VESLKAVK+ID EHFSVP
Sbjct  240  NKNLVKNGGFEEGPYLLPNTSWGVLIPPNIEDKHSP-LPGWMVESLKAVKFIDVEHFSVP  298

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             GRRA+ELVAGKESA+ Q+ RT+ GK Y L+F VGDASN CEGSMV+EAFAG  T+KVPY
Sbjct  299  QGRRAIELVAGKESAIAQVVRTIIGKTYTLSFAVGDASNSCEGSMVVEAFAGKDTVKVPY  358

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  169
            ESKG+GG+K A L+F A ++RTR+MF+ST+Y  RSDDF SLCGPVVD VKL+S+R
Sbjct  359  ESKGKGGFKRAVLKFVAASSRTRIMFYSTFYTMRSDDFSSLCGPVVDDVKLLSLR  413


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 26/40 (65%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR TN NL+KN  FEEGPY+ P    GVL PP  ED H P
Sbjct  236  PRPTNKNLVKNGGFEEGPYLLPNTSWGVLIPPNIEDKHSP  275



>gb|AAL06839.1| AT5g25460/F18G18_200 [Arabidopsis thaliana]
Length=369

 Score =   216 bits (551),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 107/177 (60%), Positives = 129/177 (73%), Gaps = 1/177 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
             + ++K  GF  GP+ +P       +P        P LP W VESLKAVKY+D EHFSVP
Sbjct  194  NKNILKNGGFEEGPLVLPGSTTGVLIPPFIEDDHSP-LPGWMVESLKAVKYVDVEHFSVP  252

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             GRRA+ELVAGKESA+ Q+ RTV GK Y L+F VGDA+N C+GSMV+EAFAG  TLKVPY
Sbjct  253  QGRRAIELVAGKESAIAQVVRTVIGKTYVLSFAVGDANNACKGSMVVEAFAGKDTLKVPY  312

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  163
            ESKG GG+K A +RF A   R+R+MF+ST+Y  RSDDF SLCGPV+D VKL+SVR P
Sbjct  313  ESKGTGGFKRASIRFVAVLTRSRIMFYSTFYAMRSDDFSSLCGPVIDDVKLISVRKP  369


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR TN N+LKN  FEEGP V P   TGVL PPF EDDH P
Sbjct  190  PRPTNKNILKNGGFEEGPLVLPGSTTGVLIPPFIEDDHSP  229



>ref|XP_006450498.1| hypothetical protein CICLE_v10008711mg [Citrus clementina]
 gb|ESR63738.1| hypothetical protein CICLE_v10008711mg [Citrus clementina]
 gb|KDO61660.1| hypothetical protein CISIN_1g017767mg [Citrus sinensis]
Length=366

 Score =   216 bits (550),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 108/176 (61%), Positives = 130/176 (74%), Gaps = 1/176 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
             + ++K  GF  GP   P       +P        P LP W +ESLKAVKYID++HFSVP
Sbjct  190  NKNILKNGGFEEGPYVFPNTSWGVLIPPNIEDDHSP-LPGWMIESLKAVKYIDSDHFSVP  248

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             G+RA+ELVAGKESA+ QIART+ GK Y LTF VGDA+N C GSMV+EAFAG  T+KVPY
Sbjct  249  QGKRAIELVAGKESAIAQIARTIPGKTYTLTFTVGDANNACAGSMVVEAFAGKGTIKVPY  308

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRN  166
            ESKG+GG+K A LRF A +NRTR+MF ST+Y  RSDDF SLCGPV+D VKL+SVR+
Sbjct  309  ESKGKGGFKRAVLRFVAVSNRTRIMFLSTFYTMRSDDFSSLCGPVIDDVKLLSVRS  364


 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR +N N+LKN  FEEGPYVFP    GVL PP  EDDH P
Sbjct  186  PRASNKNILKNGGFEEGPYVFPNTSWGVLIPPNIEDDHSP  225



>ref|XP_008378299.1| PREDICTED: uncharacterized protein LOC103441403, partial [Malus 
domestica]
Length=345

 Score =   216 bits (549),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 108/177 (61%), Positives = 130/177 (73%), Gaps = 1/177 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
             + L+K  GF  GP   P       +P        P LP W VESLKAVKYID++HFSVP
Sbjct  170  NKNLIKNAGFEEGPYVFPNTSWGVLIPPNIEDDHSP-LPGWMVESLKAVKYIDSDHFSVP  228

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             G+RAVELVAGKESA+ Q+ RT+ GK Y L+F VGDASN CEGS+++EAFAG +T+KVPY
Sbjct  229  EGKRAVELVAGKESAIAQVVRTIPGKTYVLSFSVGDASNSCEGSLIVEAFAGKNTVKVPY  288

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  163
            ESKG+GG+K A L+F A + RTRVMF STYY  RSDDF SLCGPV+D VKL+S+R P
Sbjct  289  ESKGKGGFKRAVLKFVAVSTRTRVMFLSTYYTMRSDDFSSLCGPVLDDVKLLSLRKP  345


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR TN NL+KN  FEEGPYVFP    GVL PP  EDDH P
Sbjct  166  PRATNKNLIKNAGFEEGPYVFPNTSWGVLIPPNIEDDHSP  205



>ref|XP_007161233.1| hypothetical protein PHAVU_001G053100g [Phaseolus vulgaris]
 gb|ESW33227.1| hypothetical protein PHAVU_001G053100g [Phaseolus vulgaris]
Length=366

 Score =   216 bits (550),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 110/177 (62%), Positives = 129/177 (73%), Gaps = 1/177 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
             + L+K  GF  GP   P       +P        P LP W VESLKAVKYID++HFSVP
Sbjct  191  NQNLLKNGGFEEGPYVFPNSSWGVIIPPNIEDDHSP-LPGWMVESLKAVKYIDSDHFSVP  249

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             G+RAVEL+AGKESA+ Q+ART+ GK Y L+F VGDASN CEGSM++EAFAG  T+KVPY
Sbjct  250  QGKRAVELIAGKESAIAQVARTIPGKTYVLSFSVGDASNYCEGSMIVEAFAGKDTIKVPY  309

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  163
            ESKG+GG+K A L+F A   RTRVMF ST+Y  RSDDF SLCGPVVD VKLVS+R P
Sbjct  310  ESKGKGGFKRAALKFVAVGPRTRVMFLSTFYTMRSDDFSSLCGPVVDDVKLVSLRKP  366


 Score = 55.8 bits (133),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            P+ TN NLLKN  FEEGPYVFP    GV+ PP  EDDH P
Sbjct  187  PKATNQNLLKNGGFEEGPYVFPNSSWGVIIPPNIEDDHSP  226



>gb|KFK25408.1| hypothetical protein AALP_AA8G110600 [Arabis alpina]
Length=367

 Score =   216 bits (549),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 105/177 (59%), Positives = 130/177 (73%), Gaps = 1/177 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
             + ++K  GF  GP  +P       +P        P LPAW +ESLKA+KY+D EHFSVP
Sbjct  192  NKNILKNGGFEEGPYVLPNATTGVLIPPFIEDDHSP-LPAWMIESLKAIKYVDVEHFSVP  250

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             GRRAVELVAGKESA+ Q+ART+ GK Y L+F VGDA+N CEGSM++EAFAG  TLKVPY
Sbjct  251  QGRRAVELVAGKESAIAQVARTIVGKTYVLSFAVGDANNACEGSMIVEAFAGRDTLKVPY  310

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  163
            +S G+GG+K A LRF A + RTR+MF+ST+Y  RSDDF SLCGPV+D VKL++ R P
Sbjct  311  KSLGKGGFKRASLRFIAVSTRTRIMFYSTFYAMRSDDFSSLCGPVIDDVKLLTARKP  367


 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR TN N+LKN  FEEGPYV P   TGVL PPF EDDH P
Sbjct  188  PRPTNKNILKNGGFEEGPYVLPNATTGVLIPPFIEDDHSP  227



>ref|XP_002872166.1| hypothetical protein ARALYDRAFT_910605 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48425.1| hypothetical protein ARALYDRAFT_910605 [Arabidopsis lyrata subsp. 
lyrata]
Length=369

 Score =   216 bits (549),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 105/177 (59%), Positives = 131/177 (74%), Gaps = 1/177 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
             + ++K  GF  GP+ +P       +P        P LP W VESLKAVKY+D EHFSVP
Sbjct  194  NKNILKNGGFEEGPLVLPGATTGVLIPPFIEDDHSP-LPGWMVESLKAVKYVDIEHFSVP  252

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             GRRA+ELVAGKESA+ Q+ RT+ GK Y L+F VGDA+N C+GSMV+EAFAG  TLKVPY
Sbjct  253  QGRRAIELVAGKESAIAQVVRTIIGKTYVLSFAVGDANNACKGSMVVEAFAGKETLKVPY  312

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  163
            ES+G GG+K A +RF A ++R+R+MF+ST+Y  RSDDF SLCGPV+D VKL+SVR P
Sbjct  313  ESQGTGGFKRASIRFVAVSSRSRIMFYSTFYAMRSDDFSSLCGPVIDDVKLISVRKP  369


 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR TN N+LKN  FEEGP V P   TGVL PPF EDDH P
Sbjct  190  PRPTNKNILKNGGFEEGPLVLPGATTGVLIPPFIEDDHSP  229



>ref|XP_011026488.1| PREDICTED: uncharacterized protein LOC105127071 [Populus euphratica]
Length=366

 Score =   216 bits (549),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 108/175 (62%), Positives = 128/175 (73%), Gaps = 1/175 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
             + ++K  GF  GP   P       +P     +    LP W VESLKAVKYID EHFSVP
Sbjct  191  NKNILKNGGFEEGPYVFPNTTWGVLIPPNIEDKH-STLPGWMVESLKAVKYIDVEHFSVP  249

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             GRRAVELVAGKES + Q+ARTV GK Y L+F VGDASN CEGSMV+EAFAG  TLKVPY
Sbjct  250  QGRRAVELVAGKESTIAQVARTVIGKTYTLSFAVGDASNSCEGSMVVEAFAGKDTLKVPY  309

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  169
            ESKG+GG+K A L+F A + RTR+MF+ST+Y  RSDDF SLCGPV+D +KL+S+R
Sbjct  310  ESKGKGGFKRAVLKFVAVSTRTRIMFYSTFYTMRSDDFSSLCGPVIDDIKLLSLR  364


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 29/44 (66%), Gaps = 2/44 (5%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDH--FPGF  579
            PR TN N+LKN  FEEGPYVFP    GVL PP  ED H   PG+
Sbjct  187  PRLTNKNILKNGGFEEGPYVFPNTTWGVLIPPNIEDKHSTLPGW  230



>gb|AAM61720.1| unknown [Arabidopsis thaliana]
Length=369

 Score =   216 bits (549),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 106/177 (60%), Positives = 130/177 (73%), Gaps = 1/177 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
             + ++K  GF  GP+ +P       +P        P LP W VESLKAVKY+D EHFSVP
Sbjct  194  NKNILKNGGFEEGPLVLPGSTTGVLIPPFIEDDHSP-LPGWMVESLKAVKYVDVEHFSVP  252

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             GRRA+ELVAGKESA+ Q+ RTV GK Y L+F VGDA+N C+GSMV+E+FAG  TLKVPY
Sbjct  253  QGRRAIELVAGKESAIAQVVRTVIGKTYVLSFAVGDANNACKGSMVVESFAGKDTLKVPY  312

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  163
            ESKG GG+K A +RF A + R+R+MF+ST+Y  RSDDF SLCGPV+D VKL+SVR P
Sbjct  313  ESKGTGGFKRASIRFVAVSTRSRMMFYSTFYAMRSDDFSSLCGPVIDDVKLISVRKP  369


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR TN N+LKN  FEEGP V P   TGVL PPF EDDH P
Sbjct  190  PRPTNKNILKNGGFEEGPLVLPGSTTGVLIPPFIEDDHSP  229



>ref|XP_006412472.1| hypothetical protein EUTSA_v10025706mg [Eutrema salsugineum]
 gb|ESQ53925.1| hypothetical protein EUTSA_v10025706mg [Eutrema salsugineum]
Length=325

 Score =   214 bits (545),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 108/179 (60%), Positives = 130/179 (73%), Gaps = 5/179 (3%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLP--AVHGGRPLPRLPAWTVESLKAVKYIDAEHFS  520
             + ++K  GF  GP  +P       +P  ++    PLP    W VESLKAVKYID++HFS
Sbjct  150  NKNILKNGGFEEGPWVLPNSSSGVLIPPNSIDDHSPLP---GWMVESLKAVKYIDSDHFS  206

Query  519  VPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKV  340
            VP GRRAVELVAGKESAV Q+ RT+ GK Y L+F VGDASN C GSM++EAFAG  T+KV
Sbjct  207  VPQGRRAVELVAGKESAVAQVVRTIPGKTYVLSFAVGDASNACAGSMIVEAFAGKDTIKV  266

Query  339  PYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  163
            PYESKG+GG+K A LRF A + RTRVMF+ST+Y  R DDF SLCGPV+D VKL+S R P
Sbjct  267  PYESKGKGGFKRASLRFVAVSARTRVMFYSTFYAMREDDFSSLCGPVIDDVKLLSARRP  325


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR TN N+LKN  FEEGP+V P   +GVL PP + DDH P
Sbjct  146  PRPTNKNILKNGGFEEGPWVLPNSSSGVLIPPNSIDDHSP  185



>gb|EPS73289.1| hypothetical protein M569_01466, partial [Genlisea aurea]
Length=348

 Score =   215 bits (547),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 120/142 (85%), Gaps = 0/142 (0%)
 Frame = -1

Query  582  LPAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDA  403
            LPAW VESLKAV+YID+ HFSVP GRRA+ELV G+ESA+ Q+ART AGKFY LTF VGDA
Sbjct  206  LPAWMVESLKAVRYIDSAHFSVPRGRRAIELVGGRESAIAQVARTAAGKFYRLTFAVGDA  265

Query  402  SNKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDD  223
            SN CEGSMV+EAFAG S++++PYES G+GGYK A L+F A ++RTR+MF STYYH RSDD
Sbjct  266  SNSCEGSMVVEAFAGGSSVRIPYESSGRGGYKRAILQFVAASDRTRIMFTSTYYHMRSDD  325

Query  222  FVSLCGPVVDFVKLVSVRNPHR  157
            + SLCGPVVD V+L+SVR   R
Sbjct  326  YASLCGPVVDDVELLSVRETPR  347


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            P+ TN N+LKN DFEEG Y+FP    GVL PP  EDD+ P
Sbjct  166  PKPTNQNILKNGDFEEGAYIFPNTSWGVLIPPNIEDDNSP  205



>gb|KHN06654.1| hypothetical protein glysoja_037506 [Glycine soja]
Length=366

 Score =   215 bits (548),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 108/177 (61%), Positives = 128/177 (72%), Gaps = 1/177 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
             + ++K  GF  GP   P       +P        P LP W VESLKAVKYID++HFSVP
Sbjct  191  NQNILKNGGFEEGPYVFPNSSWGVIIPPNIEDDHSP-LPGWMVESLKAVKYIDSDHFSVP  249

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             G+RAVEL+AGKESA+ Q+ART+ GK Y L+F VGDASN CEGSM++EAFAG  T+KVPY
Sbjct  250  QGKRAVELIAGKESAIAQVARTIPGKTYVLSFSVGDASNSCEGSMIVEAFAGKDTIKVPY  309

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  163
            ESKG GG+K A L+F A   RTRVMF ST+Y  RSDDF SLCGPV+D VKLVS+R P
Sbjct  310  ESKGNGGFKRAALKFVAVTPRTRVMFLSTFYTMRSDDFSSLCGPVIDDVKLVSLRKP  366


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            P+ TN N+LKN  FEEGPYVFP    GV+ PP  EDDH P
Sbjct  187  PKATNQNILKNGGFEEGPYVFPNSSWGVIIPPNIEDDHSP  226



>ref|XP_006601137.1| PREDICTED: uncharacterized protein LOC100813910 isoform X1 [Glycine 
max]
 ref|XP_006601138.1| PREDICTED: uncharacterized protein LOC100813910 isoform X2 [Glycine 
max]
Length=366

 Score =   215 bits (548),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 108/177 (61%), Positives = 128/177 (72%), Gaps = 1/177 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
             + ++K  GF  GP   P       +P        P LP W VESLKAVKYID++HFSVP
Sbjct  191  NQNILKNGGFEEGPYVFPNSSWGVIIPPNIEDDHSP-LPGWMVESLKAVKYIDSDHFSVP  249

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             G+RAVEL+AGKESA+ Q+ART+ GK Y L+F VGDASN CEGSM++EAFAG  T+KVPY
Sbjct  250  QGKRAVELIAGKESAIAQVARTIPGKTYVLSFSVGDASNSCEGSMIVEAFAGKDTIKVPY  309

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  163
            ESKG GG+K A L+F A   RTRVMF ST+Y  RSDDF SLCGPV+D VKLVS+R P
Sbjct  310  ESKGNGGFKRAALKFVAVTPRTRVMFLSTFYTMRSDDFSSLCGPVIDDVKLVSLRKP  366


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            P+ TN N+LKN  FEEGPYVFP    GV+ PP  EDDH P
Sbjct  187  PKATNQNILKNGGFEEGPYVFPNSSWGVIIPPNIEDDHSP  226



>gb|KJB80694.1| hypothetical protein B456_013G110800 [Gossypium raimondii]
Length=325

 Score =   214 bits (545),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 108/177 (61%), Positives = 128/177 (72%), Gaps = 1/177 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
             + ++K  GF  GP   P       +P        P LPAW VESLKAVKYID+ H+ +P
Sbjct  150  NKNIMKNGGFEEGPYIFPNTPWGVLIPPNIEDDNSP-LPAWVVESLKAVKYIDSAHYFMP  208

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             GRRAVELV GKESA+ QI RT+ GK Y L+F VGDA+N C GS+V+EAFAG +TLKVPY
Sbjct  209  QGRRAVELVGGKESAIAQITRTIVGKTYRLSFSVGDANNSCAGSLVVEAFAGKATLKVPY  268

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  163
            ESKG GG+K A LRF A +NRTR+MF ST+Y  RSDDF SLCGPVVD VKL+S+RNP
Sbjct  269  ESKGTGGFKRAALRFVAVSNRTRIMFLSTFYTMRSDDFSSLCGPVVDDVKLLSIRNP  325


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR TN N++KN  FEEGPY+FP    GVL PP  EDD+ P
Sbjct  146  PRPTNKNIMKNGGFEEGPYIFPNTPWGVLIPPNIEDDNSP  185



>ref|XP_008394047.1| PREDICTED: uncharacterized protein LOC103456171 [Malus domestica]
Length=365

 Score =   215 bits (547),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 109/177 (62%), Positives = 129/177 (73%), Gaps = 1/177 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
             + L+K  GF  GP   P       +P        P LP W VESLKAVKYID++HFSVP
Sbjct  190  NKNLLKNAGFEEGPYVFPNTSWGVLIPPNIEDDHSP-LPGWMVESLKAVKYIDSDHFSVP  248

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             G+RAVELVAGKESA+ Q+ RT+ GK Y L+F VGDASN CEGSM++EAFA  +T+KVPY
Sbjct  249  EGKRAVELVAGKESAIAQVVRTIPGKTYVLSFSVGDASNSCEGSMIVEAFADKNTVKVPY  308

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  163
            ESKG+GG+K A L+F A + RTRVMF STYY  RSDDF SLCGPVVD VKL+S+R P
Sbjct  309  ESKGKGGFKRAVLKFVAASTRTRVMFLSTYYTMRSDDFSSLCGPVVDDVKLLSLRKP  365


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR TN NLLKN  FEEGPYVFP    GVL PP  EDDH P
Sbjct  186  PRATNKNLLKNAGFEEGPYVFPNTSWGVLIPPNIEDDHSP  225



>emb|CAA06490.1| hypothetical protein [Cicer arietinum]
Length=180

 Score =   209 bits (531),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 103/177 (58%), Positives = 128/177 (72%), Gaps = 1/177 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
             + L+K  GF  GP   P   +   +P        P LP W VESLKAVKY+D+ HFSVP
Sbjct  5    NKNLLKNGGFEEGPYIFPNTSYGVIIPPNIEDNHSP-LPGWMVESLKAVKYLDSSHFSVP  63

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             G RA+ELVAGKESA+ Q+ART+ GK Y L+F VGDASN CEGSM++EAFAG  T+KVPY
Sbjct  64   EGTRAIELVAGKESAIAQVARTIPGKTYVLSFSVGDASNSCEGSMIVEAFAGRDTVKVPY  123

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  163
            +SKG+GG+K A L+F A  +RTR+MF ST+Y  R+DD  SLCGPV+D VKL+S+R P
Sbjct  124  QSKGKGGFKRAVLKFVAVGSRTRIMFLSTFYSMRTDDLSSLCGPVIDDVKLLSLRKP  180


 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            P+ TN NLLKN  FEEGPY+FP    GV+ PP  ED+H P
Sbjct  1    PKATNKNLLKNGGFEEGPYIFPNTSYGVIIPPNIEDNHSP  40



>gb|KJB80693.1| hypothetical protein B456_013G110800 [Gossypium raimondii]
Length=369

 Score =   215 bits (547),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 108/177 (61%), Positives = 128/177 (72%), Gaps = 1/177 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
             + ++K  GF  GP   P       +P        P LPAW VESLKAVKYID+ H+ +P
Sbjct  194  NKNIMKNGGFEEGPYIFPNTPWGVLIPPNIEDDNSP-LPAWVVESLKAVKYIDSAHYFMP  252

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             GRRAVELV GKESA+ QI RT+ GK Y L+F VGDA+N C GS+V+EAFAG +TLKVPY
Sbjct  253  QGRRAVELVGGKESAIAQITRTIVGKTYRLSFSVGDANNSCAGSLVVEAFAGKATLKVPY  312

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  163
            ESKG GG+K A LRF A +NRTR+MF ST+Y  RSDDF SLCGPVVD VKL+S+RNP
Sbjct  313  ESKGTGGFKRAALRFVAVSNRTRIMFLSTFYTMRSDDFSSLCGPVVDDVKLLSIRNP  369


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR TN N++KN  FEEGPY+FP    GVL PP  EDD+ P
Sbjct  190  PRPTNKNIMKNGGFEEGPYIFPNTPWGVLIPPNIEDDNSP  229



>emb|CDY54909.1| BnaC02g48660D [Brassica napus]
Length=339

 Score =   214 bits (544),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 105/175 (60%), Positives = 129/175 (74%), Gaps = 1/175 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
             + ++K  GF  GP+ +P       +P        P LP W VESLKAVKY+D EHFS+P
Sbjct  165  NKNILKNGGFEEGPLVLPGSTTGVLIPPFIEDDHSP-LPGWMVESLKAVKYVDTEHFSIP  223

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             GRRA+ELVAGKESA+ Q+ART+ GK Y L+F VGDA+N C+GSMV+EAFAG  TLKVPY
Sbjct  224  QGRRAIELVAGKESAIAQVARTIIGKTYVLSFAVGDANNACKGSMVVEAFAGRDTLKVPY  283

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  169
            ES+G GG+K A +RF A + RTRVMF+ST+Y  RSDDF SLCGPV+D VKL+S R
Sbjct  284  ESRGTGGFKRASIRFVAVSTRTRVMFYSTFYAMRSDDFSSLCGPVIDDVKLISAR  338


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR TN N+LKN  FEEGP V P   TGVL PPF EDDH P
Sbjct  161  PRPTNKNILKNGGFEEGPLVLPGSTTGVLIPPFIEDDHSP  200



>ref|XP_009151074.1| PREDICTED: uncharacterized protein LOC103874406 [Brassica rapa]
 emb|CDX88180.1| BnaA06g27710D [Brassica napus]
 emb|CDX80511.1| BnaC07g29330D [Brassica napus]
Length=367

 Score =   214 bits (546),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 106/175 (61%), Positives = 130/175 (74%), Gaps = 1/175 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
             + ++K  GF  GP+ +P       +P        P LP W VESLKAVKY+D EHFS+P
Sbjct  192  NKNILKNGGFEEGPLVLPGSTTGVLIPPFIEDDHSP-LPGWMVESLKAVKYVDTEHFSIP  250

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             GRRA+ELVAGKESA+ Q+ART+ GK Y L+F VGDA+N C+GSMV+EAFAG  TLKVPY
Sbjct  251  QGRRAIELVAGKESAIAQVARTIIGKTYVLSFAVGDANNACKGSMVVEAFAGRDTLKVPY  310

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  169
            ES+G GG+K A +RF A + RTRVMF+ST+Y  RSDDF SLCGPV+D VKL+SVR
Sbjct  311  ESRGTGGFKRASIRFVAVSTRTRVMFYSTFYAMRSDDFSSLCGPVIDDVKLLSVR  365


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR TN N+LKN  FEEGP V P   TGVL PPF EDDH P
Sbjct  188  PRPTNKNILKNGGFEEGPLVLPGSTTGVLIPPFIEDDHSP  227



>emb|CAA22573.1| putative protein [Arabidopsis thaliana]
 emb|CAB79963.1| putative protein [Arabidopsis thaliana]
Length=325

 Score =   213 bits (542),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 107/179 (60%), Positives = 132/179 (74%), Gaps = 5/179 (3%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLP--AVHGGRPLPRLPAWTVESLKAVKYIDAEHFS  520
             + ++K  GF  GP  +P       +P  ++    PLP    W VESLKAVKYID++HFS
Sbjct  150  NKNILKNGGFEEGPWVLPNISSGVLIPPNSIDDHSPLP---GWMVESLKAVKYIDSDHFS  206

Query  519  VPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKV  340
            VP GRRAVELVAGKESAV Q+ RT+ GK Y L+F VGDASN C GSM++EAFAG  T+KV
Sbjct  207  VPQGRRAVELVAGKESAVAQVVRTIPGKTYVLSFSVGDASNACAGSMIVEAFAGKDTIKV  266

Query  339  PYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  163
            PYESKG+GG+K + LRF A ++RTRVMF+ST+Y  R+DDF SLCGPV+D VKL+S R P
Sbjct  267  PYESKGKGGFKRSSLRFVAVSSRTRVMFYSTFYAMRNDDFSSLCGPVIDDVKLLSARRP  325


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR TN N+LKN  FEEGP+V P + +GVL PP + DDH P
Sbjct  146  PRPTNKNILKNGGFEEGPWVLPNISSGVLIPPNSIDDHSP  185



>dbj|BAE98407.1| hypothetical protein [Arabidopsis thaliana]
Length=365

 Score =   214 bits (545),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 108/182 (59%), Positives = 134/182 (74%), Gaps = 5/182 (3%)
 Frame = -1

Query  702  QTYQRELVKKLGF*GGPIRVPQGRHRRSLP--AVHGGRPLPRLPAWTVESLKAVKYIDAE  529
            +T  + ++K  GF  GP  +P       +P  ++    PLP    W VESLKAVKYID++
Sbjct  187  RTTNKNILKNGGFEEGPWVLPNISSGVLIPPNSIDDHSPLP---GWMVESLKAVKYIDSD  243

Query  528  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  349
            HFSVP GRRAVELVAGKESAV Q+ RT+ GK Y L+F VGDASN C GSM++EAFAG  T
Sbjct  244  HFSVPQGRRAVELVAGKESAVAQVVRTIPGKTYVLSFSVGDASNACAGSMIVEAFAGKDT  303

Query  348  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  169
            +KVPYESKG+GG+K + LRF A ++RTRVMF+ST+Y  R+DDF SLCGPV+D VKL+S R
Sbjct  304  IKVPYESKGKGGFKRSSLRFVAVSSRTRVMFYSTFYAMRNDDFSSLCGPVIDDVKLLSAR  363

Query  168  NP  163
             P
Sbjct  364  RP  365


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR TN N+LKN  FEEGP+V P + +GVL PP + DDH P
Sbjct  186  PRTTNKNILKNGGFEEGPWVLPNISSGVLIPPNSIDDHSP  225



>ref|XP_009129962.1| PREDICTED: uncharacterized protein LOC103854751 [Brassica rapa]
 emb|CDY05493.1| BnaA02g31980D [Brassica napus]
Length=366

 Score =   214 bits (545),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 105/175 (60%), Positives = 129/175 (74%), Gaps = 1/175 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
             + ++K  GF  GP+ +P       +P        P LP W VESLKAVKY+D EHFS+P
Sbjct  192  NKNILKNGGFEEGPLVLPGSTTGVLIPPFIEDDHSP-LPGWMVESLKAVKYVDTEHFSIP  250

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             GRRA+ELVAGKESA+ Q+ART+ GK Y L+F VGDA+N C+GSMV+EAFAG  TLKVPY
Sbjct  251  QGRRAIELVAGKESAIAQVARTIIGKTYVLSFAVGDANNACKGSMVVEAFAGRDTLKVPY  310

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  169
            ES+G GG+K A +RF A + RTRVMF+ST+Y  RSDDF SLCGPV+D VKL+S R
Sbjct  311  ESRGTGGFKRASIRFVAVSTRTRVMFYSTFYAMRSDDFSSLCGPVIDDVKLISAR  365


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR TN N+LKN  FEEGP V P   TGVL PPF EDDH P
Sbjct  188  PRPTNKNILKNGGFEEGPLVLPGSTTGVLIPPFIEDDHSP  227



>ref|XP_006285882.1| hypothetical protein CARUB_v10007385mg [Capsella rubella]
 gb|EOA18780.1| hypothetical protein CARUB_v10007385mg [Capsella rubella]
Length=354

 Score =   214 bits (544),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 108/179 (60%), Positives = 131/179 (73%), Gaps = 5/179 (3%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLP--AVHGGRPLPRLPAWTVESLKAVKYIDAEHFS  520
             + ++K  GF  GP  +P       +P  ++    PLP    W VESLKAVKYID++HFS
Sbjct  179  NKNILKNGGFEEGPWVLPNTTSGVLIPPNSIDDHSPLP---GWMVESLKAVKYIDSDHFS  235

Query  519  VPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKV  340
            VP GRRAVELVAGKESAV Q+ RT+ GK Y L+F VGDASN C GSM++EAFAG  T+KV
Sbjct  236  VPQGRRAVELVAGKESAVAQVVRTIPGKTYVLSFAVGDASNACAGSMIVEAFAGKDTIKV  295

Query  339  PYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  163
            PYESKG+GG+K A LRF A + RTRVMF+ST+Y  R+DDF SLCGPV+D VKL+S R P
Sbjct  296  PYESKGKGGFKRASLRFVAASGRTRVMFYSTFYAMRNDDFSSLCGPVIDDVKLLSARRP  354


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR TN N+LKN  FEEGP+V P   +GVL PP + DDH P
Sbjct  175  PRPTNKNILKNGGFEEGPWVLPNTTSGVLIPPNSIDDHSP  214



>emb|CDX97108.1| BnaC09g45170D [Brassica napus]
Length=366

 Score =   214 bits (545),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 106/174 (61%), Positives = 129/174 (74%), Gaps = 1/174 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
             + ++K  GF  GP  +P       +P        P LPAW +ESLKAVKY+D EHFSVP
Sbjct  191  NKNILKNGGFEEGPYIIPNATTGVLIPPFIEDDHSP-LPAWIIESLKAVKYVDVEHFSVP  249

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             GRRAVELVAGKESA+ Q+ART+ GK Y L+F VGDA+N C+GSM++EAFAG  TLKV Y
Sbjct  250  QGRRAVELVAGKESAIAQVARTIVGKSYVLSFAVGDANNACKGSMIVEAFAGKDTLKVAY  309

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  172
            ES G+GG+K A LRF A ++RTRVMF+ST+Y  RSDDF SLCGPV+D VKL+SV
Sbjct  310  ESNGKGGFKRAALRFVAVSSRTRVMFYSTFYAMRSDDFSSLCGPVIDDVKLLSV  363


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR TN N+LKN  FEEGPY+ P   TGVL PPF EDDH P
Sbjct  187  PRPTNKNILKNGGFEEGPYIIPNATTGVLIPPFIEDDHSP  226



>ref|XP_002867243.1| hypothetical protein ARALYDRAFT_913203 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43502.1| hypothetical protein ARALYDRAFT_913203 [Arabidopsis lyrata subsp. 
lyrata]
Length=365

 Score =   213 bits (543),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 107/179 (60%), Positives = 132/179 (74%), Gaps = 5/179 (3%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLP--AVHGGRPLPRLPAWTVESLKAVKYIDAEHFS  520
             + ++K  GF  GP  +P       +P  ++    PLP    W VESLKAVKYID++HFS
Sbjct  190  NKNILKNGGFEEGPWVLPNISSGVLIPPNSIDDHSPLP---GWMVESLKAVKYIDSDHFS  246

Query  519  VPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKV  340
            VP GRRAVELVAGKESAV Q+ RT+ GK Y L+F VGDASN C GSM++EAFAG  T+KV
Sbjct  247  VPQGRRAVELVAGKESAVAQVVRTIPGKTYVLSFAVGDASNACAGSMIVEAFAGKDTIKV  306

Query  339  PYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  163
            PYESKG+GG+K + LRF A ++RTRVMF+ST+Y  R+DDF SLCGPV+D VKL+S R P
Sbjct  307  PYESKGKGGFKRSSLRFVAVSDRTRVMFYSTFYAMRNDDFSSLCGPVIDDVKLLSARRP  365


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR TN N+LKN  FEEGP+V P + +GVL PP + DDH P
Sbjct  186  PRPTNKNILKNGGFEEGPWVLPNISSGVLIPPNSIDDHSP  225



>ref|XP_003544618.1| PREDICTED: uncharacterized protein LOC100776765 [Glycine max]
 gb|KHN05403.1| hypothetical protein glysoja_046455 [Glycine soja]
Length=366

 Score =   213 bits (543),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 107/177 (60%), Positives = 128/177 (72%), Gaps = 1/177 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
             + ++K  GF  GP   P       +P        P LP W VESLKAVKYID+ HFSVP
Sbjct  191  NQNILKNGGFEEGPYVFPNSSWGVIIPPNIEDDHSP-LPGWMVESLKAVKYIDSGHFSVP  249

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             G+RAVEL+AGKESA+ Q+ART+ GK Y L+F VGDASN CEGSM++EAFAG  T+KVPY
Sbjct  250  QGKRAVELIAGKESAIAQVARTIPGKTYVLSFSVGDASNSCEGSMIVEAFAGKDTIKVPY  309

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  163
            ESKG+GG+K A L+F A   RTR+MF ST+Y  RSDDF SLCGPV+D VKLVS+R P
Sbjct  310  ESKGKGGFKRAALKFVAVTPRTRIMFLSTFYTMRSDDFSSLCGPVIDDVKLVSLRKP  366


 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR TN N+LKN  FEEGPYVFP    GV+ PP  EDDH P
Sbjct  187  PRATNQNILKNGGFEEGPYVFPNSSWGVIIPPNIEDDHSP  226



>emb|CDX68849.1| BnaC01g06040D [Brassica napus]
Length=365

 Score =   213 bits (542),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 107/177 (60%), Positives = 130/177 (73%), Gaps = 5/177 (3%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLP--AVHGGRPLPRLPAWTVESLKAVKYIDAEHFS  520
             + ++K  GF  GP  +P       +P  AV    PLP    W VESLKAVKYID++HFS
Sbjct  190  NKNILKNGGFEEGPWVLPNTSSGVLIPPNAVDDHSPLP---GWMVESLKAVKYIDSDHFS  246

Query  519  VPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKV  340
            VP GRRAVEL+AGKESAV Q+ RT  GK Y L+F VGDASN C GSM++EAFAG  TLKV
Sbjct  247  VPQGRRAVELIAGKESAVAQVVRTTPGKIYVLSFAVGDASNACAGSMIVEAFAGKDTLKV  306

Query  339  PYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  169
            PYESKG+GG+K A L+F A ++RTR+MF+ST+Y  R+DDF SLCGPV+D VKL+S R
Sbjct  307  PYESKGKGGFKRASLKFVAVSDRTRIMFYSTFYAMRNDDFSSLCGPVIDDVKLLSAR  363


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR TN N+LKN  FEEGP+V P   +GVL PP   DDH P
Sbjct  186  PRPTNKNILKNGGFEEGPWVLPNTSSGVLIPPNAVDDHSP  225



>ref|NP_567894.1| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_974661.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAM65206.1| unknown [Arabidopsis thaliana]
 gb|ABF19001.1| At4g32460 [Arabidopsis thaliana]
 gb|AEE86063.1| uncharacterized protein AT4G32460 [Arabidopsis thaliana]
 gb|AEE86064.1| uncharacterized protein AT4G32460 [Arabidopsis thaliana]
Length=365

 Score =   213 bits (541),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 107/179 (60%), Positives = 132/179 (74%), Gaps = 5/179 (3%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLP--AVHGGRPLPRLPAWTVESLKAVKYIDAEHFS  520
             + ++K  GF  GP  +P       +P  ++    PLP    W VESLKAVKYID++HFS
Sbjct  190  NKNILKNGGFEEGPWVLPNISSGVLIPPNSIDDHSPLP---GWMVESLKAVKYIDSDHFS  246

Query  519  VPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKV  340
            VP GRRAVELVAGKESAV Q+ RT+ GK Y L+F VGDASN C GSM++EAFAG  T+KV
Sbjct  247  VPQGRRAVELVAGKESAVAQVVRTIPGKTYVLSFSVGDASNACAGSMIVEAFAGKDTIKV  306

Query  339  PYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  163
            PYESKG+GG+K + LRF A ++RTRVMF+ST+Y  R+DDF SLCGPV+D VKL+S R P
Sbjct  307  PYESKGKGGFKRSSLRFVAVSSRTRVMFYSTFYAMRNDDFSSLCGPVIDDVKLLSARRP  365


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR TN N+LKN  FEEGP+V P + +GVL PP + DDH P
Sbjct  186  PRPTNKNILKNGGFEEGPWVLPNISSGVLIPPNSIDDHSP  225



>ref|XP_006841925.1| hypothetical protein AMTR_s00042p00185900 [Amborella trichopoda]
 gb|ERN03600.1| hypothetical protein AMTR_s00042p00185900 [Amborella trichopoda]
Length=332

 Score =   212 bits (539),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 110/179 (61%), Positives = 125/179 (70%), Gaps = 1/179 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
             + L+K   F  GP   P       +P        P LP W VESLKAVKYID+ HFSVP
Sbjct  150  NKNLLKNGNFEEGPYIFPNASWGVLVPPNIEDENSP-LPGWMVESLKAVKYIDSNHFSVP  208

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             G+RAVELVAGKESA+ Q+ART+ GK Y LTF VGDASN C GSMV+EAFAG  TLKVPY
Sbjct  209  EGKRAVELVAGKESAIAQVARTIPGKLYALTFAVGDASNACTGSMVVEAFAGRDTLKVPY  268

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNPHR  157
            ESKG GG+K A LRF A + RTRV+F ST+Y  RSDDF SLCGPV+D VKL+SV    R
Sbjct  269  ESKGTGGFKRAVLRFTAVSERTRVVFLSTFYSMRSDDFSSLCGPVIDDVKLLSVHGAPR  327


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR TN NLLKN +FEEGPY+FP    GVL PP  ED++ P
Sbjct  146  PRATNKNLLKNGNFEEGPYIFPNASWGVLVPPNIEDENSP  185



>ref|XP_010447383.1| PREDICTED: uncharacterized protein LOC104730027 [Camelina sativa]
Length=365

 Score =   212 bits (540),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 107/179 (60%), Positives = 131/179 (73%), Gaps = 5/179 (3%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLP--AVHGGRPLPRLPAWTVESLKAVKYIDAEHFS  520
             + ++K  GF  GP  +P       +P  ++    PLP    W VESLKAVKY+D++HFS
Sbjct  190  NKNILKNGGFEEGPWVLPNTTSGVLIPPNSIDDHSPLP---GWMVESLKAVKYLDSDHFS  246

Query  519  VPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKV  340
            VP GRRAVELVAGKESAV Q+ RT+ GK Y L+F VGDASN C GSM++EAFAG  T+KV
Sbjct  247  VPQGRRAVELVAGKESAVAQVVRTIPGKTYVLSFAVGDASNACAGSMIVEAFAGKDTIKV  306

Query  339  PYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  163
            PYESKG+GG+K A LRF A + RTRVMF+ST+Y  R+DDF SLCGPV+D VKL+S R P
Sbjct  307  PYESKGKGGFKRASLRFVAVSVRTRVMFYSTFYAMRNDDFSSLCGPVIDDVKLLSARRP  365


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR TN N+LKN  FEEGP+V P   +GVL PP + DDH P
Sbjct  186  PRPTNKNILKNGGFEEGPWVLPNTTSGVLIPPNSIDDHSP  225



>ref|XP_010432718.1| PREDICTED: uncharacterized protein LOC104716937 [Camelina sativa]
Length=365

 Score =   212 bits (540),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 107/179 (60%), Positives = 131/179 (73%), Gaps = 5/179 (3%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLP--AVHGGRPLPRLPAWTVESLKAVKYIDAEHFS  520
             + ++K  GF  GP  +P       +P  ++    PLP    W VESLKAVKYID++HFS
Sbjct  190  NKNILKNGGFEEGPWVLPNTTSGVLIPPNSIDDHSPLP---GWMVESLKAVKYIDSDHFS  246

Query  519  VPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKV  340
            VP GRRAVELVAGKESAV Q+ RT+ GK Y L+F VGDASN C GSM++EAFAG  T+KV
Sbjct  247  VPQGRRAVELVAGKESAVAQVVRTIPGKTYVLSFAVGDASNACAGSMIVEAFAGKDTIKV  306

Query  339  PYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  163
            PYESKG+GG++ A LRF A + RTRVMF+ST+Y  R+DDF SLCGPV+D VKL+S R P
Sbjct  307  PYESKGKGGFRRASLRFVAVSVRTRVMFYSTFYAMRNDDFSSLCGPVIDDVKLLSARRP  365


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR TN N+LKN  FEEGP+V P   +GVL PP + DDH P
Sbjct  186  PRPTNKNILKNGGFEEGPWVLPNTTSGVLIPPNSIDDHSP  225



>ref|XP_003588711.1| hypothetical protein MTR_1g011800 [Medicago truncatula]
Length=326

 Score =   211 bits (536),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 106/177 (60%), Positives = 126/177 (71%), Gaps = 1/177 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
             + ++K  GF  GP   P   +   +P        P LP W VESLKAVKY+D+ HFSVP
Sbjct  151  NKNILKNGGFEEGPYIFPNTSYGVIIPPNIEDDHSP-LPGWMVESLKAVKYLDSAHFSVP  209

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             G RAVELVAGKESA+ Q+ART+ GK Y L+F VGDASN CEGSM++EAFAG  T+KVPY
Sbjct  210  QGTRAVELVAGKESAIAQVARTIPGKTYVLSFSVGDASNSCEGSMIVEAFAGKDTIKVPY  269

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  163
             SKG+GG+K A L+F A   RTRVMF ST+Y  RSDD  SLCGPV+D VKL+SVR P
Sbjct  270  TSKGKGGFKRAALKFVAVGTRTRVMFLSTFYSMRSDDLSSLCGPVIDDVKLLSVRKP  326


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            P+ +N N+LKN  FEEGPY+FP    GV+ PP  EDDH P
Sbjct  147  PKASNKNILKNGGFEEGPYIFPNTSYGVIIPPNIEDDHSP  186



>ref|XP_009125963.1| PREDICTED: uncharacterized protein LOC103850912 [Brassica rapa]
 emb|CDX75247.1| BnaA01g04550D [Brassica napus]
Length=365

 Score =   211 bits (538),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 107/177 (60%), Positives = 130/177 (73%), Gaps = 5/177 (3%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLP--AVHGGRPLPRLPAWTVESLKAVKYIDAEHFS  520
             + ++K  GF  GP  +P       +P  AV    PLP    W VESLKAVKYID++HFS
Sbjct  190  NKNILKNGGFEEGPWVLPNTSSGVLIPPNAVDDHSPLP---GWMVESLKAVKYIDSDHFS  246

Query  519  VPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKV  340
            VP GRRAVELVAGKESAV Q+ RT  GK Y L+F VGDASN C GSM++EAFAG  TLKV
Sbjct  247  VPQGRRAVELVAGKESAVAQVVRTTPGKIYVLSFAVGDASNACAGSMIVEAFAGKDTLKV  306

Query  339  PYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  169
            P+ESKG+GG+K A L+F A ++RTR+MF+ST+Y  R+DDF SLCGPV+D VKL+S R
Sbjct  307  PHESKGKGGFKRASLKFVAVSDRTRIMFYSTFYAMRNDDFSSLCGPVIDDVKLLSAR  363


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR TN N+LKN  FEEGP+V P   +GVL PP   DDH P
Sbjct  186  PRPTNKNILKNGGFEEGPWVLPNTSSGVLIPPNAVDDHSP  225



>gb|AES58962.2| plant/F18G18-200 protein [Medicago truncatula]
Length=376

 Score =   211 bits (537),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 106/177 (60%), Positives = 126/177 (71%), Gaps = 1/177 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
             + ++K  GF  GP   P   +   +P        P LP W VESLKAVKY+D+ HFSVP
Sbjct  201  NKNILKNGGFEEGPYIFPNTSYGVIIPPNIEDDHSP-LPGWMVESLKAVKYLDSAHFSVP  259

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             G RAVELVAGKESA+ Q+ART+ GK Y L+F VGDASN CEGSM++EAFAG  T+KVPY
Sbjct  260  QGTRAVELVAGKESAIAQVARTIPGKTYVLSFSVGDASNSCEGSMIVEAFAGKDTIKVPY  319

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  163
             SKG+GG+K A L+F A   RTRVMF ST+Y  RSDD  SLCGPV+D VKL+SVR P
Sbjct  320  TSKGKGGFKRAALKFVAVGTRTRVMFLSTFYSMRSDDLSSLCGPVIDDVKLLSVRKP  376


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            P+ +N N+LKN  FEEGPY+FP    GV+ PP  EDDH P
Sbjct  197  PKASNKNILKNGGFEEGPYIFPNTSYGVIIPPNIEDDHSP  236



>gb|ACJ84308.1| unknown [Medicago truncatula]
Length=376

 Score =   211 bits (537),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 106/177 (60%), Positives = 126/177 (71%), Gaps = 1/177 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
             + ++K  GF  GP   P   +   +P        P LP W VESLKAVKY+D+ HFSVP
Sbjct  201  NKNILKNGGFEEGPYIFPNTSYGVIIPPNIEDDHSP-LPGWMVESLKAVKYLDSAHFSVP  259

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             G RAVELVAGKESA+ Q+ART+ GK Y L+F VGDASN CEGSM++EAFAG  T+KVPY
Sbjct  260  QGTRAVELVAGKESAIAQVARTIPGKTYVLSFSVGDASNSCEGSMIVEAFAGKDTIKVPY  319

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  163
             SKG+GG+K A L+F A   RTRVMF ST+Y  RSDD  SLCGPV+D VKL+SVR P
Sbjct  320  TSKGKGGFKRAALKFVAVGTRTRVMFLSTFYSMRSDDLSSLCGPVIDDVKLLSVRKP  376


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            P+ +N N+LKN  FEEGPY+FP    GV+ PP  EDDH P
Sbjct  197  PKASNKNILKNGGFEEGPYIFPNTSYGVIIPPNIEDDHSP  236



>gb|KJB07801.1| hypothetical protein B456_001G045200 [Gossypium raimondii]
Length=372

 Score =   211 bits (536),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 106/175 (61%), Positives = 128/175 (73%), Gaps = 1/175 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
             +  VK  GF  GP   P       +P        P LPAW VESLKAVKYID+ H+ VP
Sbjct  194  NKNSVKNGGFEEGPYVFPNTPWGVLIPPNIEDDHSP-LPAWIVESLKAVKYIDSAHYFVP  252

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             GRRAVELVAGKESA+ QI RT+ GK Y L+F VGDA+N C GS+V+EAFAG  TLKVPY
Sbjct  253  QGRRAVELVAGKESAIAQIVRTIVGKMYRLSFAVGDANNSCVGSLVVEAFAGKDTLKVPY  312

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  169
            ESKG+GG+K A+L+F+A +NRTR+MF ST+Y  RSDDF SLCGPV+D VKL+S++
Sbjct  313  ESKGKGGFKRAELKFKAVSNRTRIMFLSTFYTMRSDDFSSLCGPVLDDVKLLSIQ  367


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR TN N +KN  FEEGPYVFP    GVL PP  EDDH P
Sbjct  190  PRPTNKNSVKNGGFEEGPYVFPNTPWGVLIPPNIEDDHSP  229



>gb|KJB07802.1| hypothetical protein B456_001G045200 [Gossypium raimondii]
Length=377

 Score =   211 bits (536),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 106/175 (61%), Positives = 128/175 (73%), Gaps = 1/175 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
             +  VK  GF  GP   P       +P        P LPAW VESLKAVKYID+ H+ VP
Sbjct  199  NKNSVKNGGFEEGPYVFPNTPWGVLIPPNIEDDHSP-LPAWIVESLKAVKYIDSAHYFVP  257

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             GRRAVELVAGKESA+ QI RT+ GK Y L+F VGDA+N C GS+V+EAFAG  TLKVPY
Sbjct  258  QGRRAVELVAGKESAIAQIVRTIVGKMYRLSFAVGDANNSCVGSLVVEAFAGKDTLKVPY  317

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  169
            ESKG+GG+K A+L+F+A +NRTR+MF ST+Y  RSDDF SLCGPV+D VKL+S++
Sbjct  318  ESKGKGGFKRAELKFKAVSNRTRIMFLSTFYTMRSDDFSSLCGPVLDDVKLLSIQ  372


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR TN N +KN  FEEGPYVFP    GVL PP  EDDH P
Sbjct  195  PRPTNKNSVKNGGFEEGPYVFPNTPWGVLIPPNIEDDHSP  234



>ref|XP_007013814.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOY31433.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=375

 Score =   210 bits (535),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 100/140 (71%), Positives = 115/140 (82%), Gaps = 0/140 (0%)
 Frame = -1

Query  582  LPAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDA  403
            LP W VESLKAVKYID++H+ VP GRRAVELVAGKESA+ Q+ART+ GK Y L+F VGDA
Sbjct  236  LPGWMVESLKAVKYIDSDHYFVPQGRRAVELVAGKESAIAQVARTIIGKTYTLSFSVGDA  295

Query  402  SNKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDD  223
            +N C GSMV+EAFAG  TLKVPYESKG GG+K A L F+A + RTR+MF ST+Y  RSDD
Sbjct  296  NNSCAGSMVVEAFAGKDTLKVPYESKGTGGFKRAVLTFKAVSTRTRIMFLSTFYTMRSDD  355

Query  222  FVSLCGPVVDFVKLVSVRNP  163
            F SLCGPVVD VKL+SVR P
Sbjct  356  FSSLCGPVVDDVKLLSVRKP  375


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR TN N+LKN  FEEG Y+FP    GVL PP  EDDH P
Sbjct  196  PRATNKNILKNAGFEEGAYIFPNTPWGVLIPPNIEDDHSP  235



>gb|KHG19965.1| putative e3 ubiquitin-protein ligase hul4 [Gossypium arboreum]
Length=377

 Score =   210 bits (535),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 106/175 (61%), Positives = 128/175 (73%), Gaps = 1/175 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
             +  VK  GF  GP   P       +P        P LPAW VESLKAVKYID+ H+ VP
Sbjct  199  NKNSVKNGGFEEGPYVFPNTPWGVLIPPNIEDDHSP-LPAWIVESLKAVKYIDSAHYFVP  257

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             GRRAVELVAGKESA+ QI RT+ GK Y L+F VGDA+N C GS+V+EAFAG  TLKVPY
Sbjct  258  QGRRAVELVAGKESAIAQIVRTIVGKMYRLSFAVGDANNSCVGSLVVEAFAGKDTLKVPY  317

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  169
            ESKG+GG+K A+L+F+A +NRTR+MF ST+Y  RSDDF SLCGPV+D VKL+S++
Sbjct  318  ESKGKGGFKRAELKFKAVSNRTRIMFLSTFYTMRSDDFSSLCGPVLDDVKLLSIQ  372


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR TN N +KN  FEEGPYVFP    GVL PP  EDDH P
Sbjct  195  PRPTNKNSVKNGGFEEGPYVFPNTPWGVLIPPNIEDDHSP  234



>ref|XP_009407651.1| PREDICTED: uncharacterized protein LOC103990295 [Musa acuminata 
subsp. malaccensis]
Length=367

 Score =   206 bits (525),  Expect(2) = 5e-62, Method: Compositional matrix adjust.
 Identities = 100/140 (71%), Positives = 117/140 (84%), Gaps = 0/140 (0%)
 Frame = -1

Query  582  LPAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDA  403
            LP W VESLKAVKY+DAEHFSVP GRRAVEL+AGKESA+ Q+ RTV G+ Y L+F VGDA
Sbjct  225  LPGWMVESLKAVKYLDAEHFSVPRGRRAVELLAGKESAIAQVVRTVPGRRYALSFAVGDA  284

Query  402  SNKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDD  223
            SN CEGS+++EAFAG  T+KVPYESKG+GG K A L+F AT  RTRV+F+S+YY+TRSDD
Sbjct  285  SNACEGSLLVEAFAGEHTIKVPYESKGRGGSKRAVLQFTATTARTRVVFWSSYYNTRSDD  344

Query  222  FVSLCGPVVDFVKLVSVRNP  163
              SLCGPV+D V LVSVR P
Sbjct  345  LSSLCGPVLDDVALVSVRYP  364


 Score = 58.9 bits (141),  Expect(2) = 5e-62, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR TN NLLKN DFEEGPY+ P    GVL PP  EDDH P
Sbjct  185  PRRTNTNLLKNGDFEEGPYILPNTTWGVLIPPQIEDDHSP  224



>ref|XP_007013813.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY31432.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=412

 Score =   211 bits (536),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 100/140 (71%), Positives = 115/140 (82%), Gaps = 0/140 (0%)
 Frame = -1

Query  582  LPAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDA  403
            LP W VESLKAVKYID++H+ VP GRRAVELVAGKESA+ Q+ART+ GK Y L+F VGDA
Sbjct  273  LPGWMVESLKAVKYIDSDHYFVPQGRRAVELVAGKESAIAQVARTIIGKTYTLSFSVGDA  332

Query  402  SNKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDD  223
            +N C GSMV+EAFAG  TLKVPYESKG GG+K A L F+A + RTR+MF ST+Y  RSDD
Sbjct  333  NNSCAGSMVVEAFAGKDTLKVPYESKGTGGFKRAVLTFKAVSTRTRIMFLSTFYTMRSDD  392

Query  222  FVSLCGPVVDFVKLVSVRNP  163
            F SLCGPVVD VKL+SVR P
Sbjct  393  FSSLCGPVVDDVKLLSVRKP  412


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR TN N+LKN  FEEG Y+FP    GVL PP  EDDH P
Sbjct  233  PRATNKNILKNAGFEEGAYIFPNTPWGVLIPPNIEDDHSP  272



>ref|XP_004498654.1| PREDICTED: uncharacterized protein LOC101508759 [Cicer arietinum]
Length=366

 Score =   209 bits (531),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 103/177 (58%), Positives = 128/177 (72%), Gaps = 1/177 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
             + L+K  GF  GP   P   +   +P        P LP W VESLKAVKY+D+ HFSVP
Sbjct  191  NKNLLKNGGFEEGPYIFPNTSYGVIIPPNIEDNHSP-LPGWMVESLKAVKYLDSSHFSVP  249

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             G RA+ELVAGKESA+ Q+ART+ GK Y L+F VGDASN CEGSM++EAFAG  T+KVPY
Sbjct  250  EGTRAIELVAGKESAIAQVARTIPGKTYVLSFSVGDASNSCEGSMIVEAFAGRDTVKVPY  309

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  163
            +SKG+GG+K A L+F A  +RTR+MF ST+Y  R+DD  SLCGPV+D VKL+S+R P
Sbjct  310  QSKGKGGFKRAVLKFVAVGSRTRIMFLSTFYSMRTDDLSSLCGPVIDDVKLLSLRKP  366


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            P+ TN NLLKN  FEEGPY+FP    GV+ PP  ED+H P
Sbjct  187  PKATNKNLLKNGGFEEGPYIFPNTSYGVIIPPNIEDNHSP  226



>gb|AAB41813.1| unknown protein [Medicago sativa]
Length=375

 Score =   208 bits (530),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 105/175 (60%), Positives = 125/175 (71%), Gaps = 1/175 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
             + ++K  GF  GP   P   +   +P        P LP W VESLKAVKY+D+ HFSVP
Sbjct  200  NKNILKNGGFEEGPYIFPNTSYGVIIPPNIEDDHSP-LPGWMVESLKAVKYLDSGHFSVP  258

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             G RAVELVAGKESA+ Q+ART+ GK Y L+F VGDASN CEGSM++EAFAG  T+KVPY
Sbjct  259  QGTRAVELVAGKESAIAQVARTIPGKTYVLSFSVGDASNSCEGSMIVEAFAGKDTIKVPY  318

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  169
             SKG+GG+K A L+F A   RTRVMF ST+Y  RSDD  SLCGPV+D VKL+SVR
Sbjct  319  SSKGKGGFKRAALKFVAVGTRTRVMFLSTFYSMRSDDLSSLCGPVIDDVKLLSVR  373


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            P+ +N N+LKN  FEEGPY+FP    GV+ PP  EDDH P
Sbjct  196  PKASNKNILKNGGFEEGPYIFPNTSYGVIIPPNIEDDHSP  235



>ref|XP_010110340.1| GTP-binding nuclear protein [Morus notabilis]
 gb|EXC26027.1| GTP-binding nuclear protein [Morus notabilis]
Length=573

 Score =   213 bits (542),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 119/142 (84%), Gaps = 0/142 (0%)
 Frame = -1

Query  582  LPAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDA  403
            LP W VESLKAVKYID++HFSVPHG+RAVELVAGKESA+ Q+ RT+ GK Y LTF VGDA
Sbjct  224  LPYWMVESLKAVKYIDSDHFSVPHGKRAVELVAGKESAIAQVVRTIVGKTYRLTFSVGDA  283

Query  402  SNKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDD  223
            SN CEGSM++EAFAG +T+KVPYESKG+GG+K   L F AT  RTR+MF ST+Y  RSDD
Sbjct  284  SNSCEGSMIVEAFAGRATVKVPYESKGKGGFKRGVLTFVATETRTRIMFLSTFYSMRSDD  343

Query  222  FVSLCGPVVDFVKLVSVRNPHR  157
            F SLCGPV+D +KL+SVR P++
Sbjct  344  FSSLCGPVLDDIKLLSVRKPNQ  365



>ref|XP_010670694.1| PREDICTED: uncharacterized protein LOC104887687 [Beta vulgaris 
subsp. vulgaris]
Length=367

 Score =   207 bits (527),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 97/140 (69%), Positives = 114/140 (81%), Gaps = 0/140 (0%)
 Frame = -1

Query  582  LPAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDA  403
            LP W +ESLKAVKY+D++HF VP G+RA+ELVAGKESA+ Q+ RTV GK Y LTF VGDA
Sbjct  228  LPGWMIESLKAVKYLDSDHFFVPSGKRAIELVAGKESAIAQVVRTVPGKLYALTFTVGDA  287

Query  402  SNKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDD  223
            +N C GSMV+EAFAG  T KVPY SKG+GG+K A LRF AT  RTR+MF+ST+Y  RSDD
Sbjct  288  NNACSGSMVVEAFAGKDTAKVPYNSKGKGGFKRAVLRFVATQTRTRIMFYSTFYSMRSDD  347

Query  222  FVSLCGPVVDFVKLVSVRNP  163
            F SLCGPV+D V+LVSVR P
Sbjct  348  FSSLCGPVIDDVRLVSVRRP  367



>emb|CDX69757.1| BnaA10g21060D [Brassica napus]
Length=1312

 Score =   218 bits (555),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 108/174 (62%), Positives = 130/174 (75%), Gaps = 1/174 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
             + ++K  GF  GP  +P       +P        P LPAW +ESLKAVKY+D EHFSVP
Sbjct  191  NKNILKNGGFEEGPYIIPNATTGVLIPPFIEDDHSP-LPAWIIESLKAVKYVDVEHFSVP  249

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             GRRAVELVAGKESA+ Q+ART+ GK Y L+F VGDA+N C+GSM++EAFAG  TLKV Y
Sbjct  250  QGRRAVELVAGKESAIAQVARTIVGKSYVLSFAVGDANNACKGSMIVEAFAGKDTLKVAY  309

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  172
            ESKG+GG+K A LRF A +NRTRVMF+ST+Y  RSDDF SLCGPV+D VKL+SV
Sbjct  310  ESKGKGGFKRAALRFVAVSNRTRVMFYSTFYAMRSDDFSSLCGPVIDDVKLLSV  363


 Score = 62.0 bits (149),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 27/40 (68%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR TN N+LKN  FEEGPY+ P   TGVL PPF EDDH P
Sbjct  187  PRPTNKNILKNGGFEEGPYIIPNATTGVLIPPFIEDDHSP  226



>ref|XP_006341715.1| PREDICTED: uncharacterized protein LOC102601890 [Solanum tuberosum]
Length=368

 Score =   205 bits (521),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 98/140 (70%), Positives = 112/140 (80%), Gaps = 0/140 (0%)
 Frame = -1

Query  582  LPAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDA  403
            LP W +ESLKAVKYIDAEHF+VP G+RA+ELVAG+ESA+ QI RT  GK YDL F VGDA
Sbjct  229  LPGWMIESLKAVKYIDAEHFTVPEGKRAIELVAGRESAIAQIVRTQKGKVYDLMFSVGDA  288

Query  402  SNKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDD  223
            SN C+GSM++EAFAG  TL+VPYES G+GG+K AKLRF A   RTRV F STYYH +SD 
Sbjct  289  SNSCQGSMLIEAFAGNITLRVPYESAGKGGFKRAKLRFTAVTERTRVRFLSTYYHMKSDH  348

Query  222  FVSLCGPVVDFVKLVSVRNP  163
              SLCGPVVD V+LV VR P
Sbjct  349  SGSLCGPVVDDVRLVGVRYP  368


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -2

Query  686  NLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            N+LKN +FEEGPY+FP    GVL PP  EDDH P
Sbjct  195  NMLKNGNFEEGPYIFPNTSWGVLIPPNIEDDHSP  228



>ref|XP_009401767.1| PREDICTED: uncharacterized protein LOC103985700 [Musa acuminata 
subsp. malaccensis]
Length=368

 Score =   202 bits (513),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 99/140 (71%), Positives = 114/140 (81%), Gaps = 2/140 (1%)
 Frame = -1

Query  582  LPAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDA  403
            LP W VESLKAVKYID++HFSVPHG+RAVELVAGKESA+ Q+ART+ GK Y LTF VGDA
Sbjct  226  LPGWMVESLKAVKYIDSDHFSVPHGKRAVELVAGKESALAQVARTIPGKVYTLTFSVGDA  285

Query  402  SNKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDD  223
             N C GSMV+EAFA   T+K+PYESKG GGYK A LRF A   RTRV+F ST+YHT++D 
Sbjct  286  GNGCVGSMVVEAFASRGTVKIPYESKGTGGYKRAVLRFTAAVERTRVVFLSTFYHTKTDG  345

Query  222  FVSLCGPVVDFVKLVSVRNP  163
              SLCGPVVD V L+SVR+P
Sbjct  346  --SLCGPVVDDVSLLSVRSP  363


 Score = 57.0 bits (136),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR T  NLLKN DFEEGPYVFP    GVL PP  EDDH P
Sbjct  186  PRLTRDNLLKNRDFEEGPYVFPNTTWGVLIPPNIEDDHSP  225



>ref|XP_010918669.1| PREDICTED: uncharacterized protein LOC105042950 [Elaeis guineensis]
Length=370

 Score =   204 bits (520),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 108/181 (60%), Positives = 126/181 (70%), Gaps = 3/181 (2%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
             + L+K   F  GP  +P       +P        P LP W VESLKAV YID+ HF VP
Sbjct  190  NKNLLKNADFEEGPYILPNTTWGALVPPNIEDDHSP-LPGWMVESLKAVNYIDSAHFKVP  248

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             G+RAVELV GKESA+ Q+ARTV G+ Y L+FLVGDA N C G MV+EAFA  ST+KVPY
Sbjct  249  QGKRAVELVGGKESALAQVARTVVGRVYTLSFLVGDAGNACTGPMVVEAFAARSTVKVPY  308

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNPHRR  154
            +SKG GG+K A LRF A A RTRV+F STYY+TR+D   SLCGPVVD V L+SVRNP RR
Sbjct  309  DSKGTGGFKRAVLRFTAVAERTRVVFLSTYYNTRTDG--SLCGPVVDDVTLLSVRNPSRR  366

Query  153  L  151
            L
Sbjct  367  L  367


 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR TN NLLKN DFEEGPY+ P    G L PP  EDDH P
Sbjct  186  PRLTNKNLLKNADFEEGPYILPNTTWGALVPPNIEDDHSP  225



>ref|XP_004235717.1| PREDICTED: uncharacterized protein LOC101252763 [Solanum lycopersicum]
Length=373

 Score =   204 bits (520),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 96/140 (69%), Positives = 113/140 (81%), Gaps = 0/140 (0%)
 Frame = -1

Query  582  LPAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDA  403
            LP W +ESLKAVKYIDAEHF+VP G+RA+ELVAG+ESA+ QI RT  GK YDL F VGDA
Sbjct  234  LPGWMIESLKAVKYIDAEHFTVPEGKRAIELVAGRESAIAQIVRTQKGKVYDLMFSVGDA  293

Query  402  SNKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDD  223
            SN C+GSM++EAFAG  TL+VPYES G+GG+K AKLRF A   RTRV F STYYH ++D 
Sbjct  294  SNSCQGSMLIEAFAGKITLRVPYESAGKGGFKRAKLRFTAVTERTRVRFLSTYYHMKNDH  353

Query  222  FVSLCGPVVDFVKLVSVRNP  163
              SLCGPVVD ++LV VR+P
Sbjct  354  SGSLCGPVVDDMRLVGVRHP  373


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 26/40 (65%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            P     N+LKN +FEEGPY+FP    GVL PP  EDDH P
Sbjct  194  PHRQRGNMLKNGNFEEGPYIFPNTSWGVLIPPNIEDDHSP  233


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 41/159 (26%), Positives = 69/159 (43%), Gaps = 31/159 (19%)
 Frame = -1

Query  582  LPAWTVESLKAVKYIDAEH------FSVPHGRRAVELVAGKESAV-TQIARTVAGKFYDL  424
            +P W +     V+YI +          VP G  AV L  G+++++ T++    +G FY L
Sbjct  54   IPHWEISGY--VEYIRSGQTQGDMLLPVPEGAFAVRL--GEDASIKTRVTNVTSGSFYSL  109

Query  423  TFLVGDASNKCEGSMVLEAFAGPST---------LKVPYESKGQGGYKPAKLRFRATANR  271
            +F   + +  C     L     P+T         ++  Y S G   Y      F A AN 
Sbjct  110  SF---NFARTCAQEEKLNVSVSPNTEPNDWGMLPMQTMYSSDGWDSYS---WGFLAQANE  163

Query  270  TRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNPHRR  154
              +       H  + +    CGP++DF+ L +++NPHR+
Sbjct  164  IEITL-----HNPAVEKDPACGPLIDFIALKALKNPHRQ  197



>ref|XP_009778816.1| PREDICTED: uncharacterized protein LOC104228110 [Nicotiana sylvestris]
Length=372

 Score =   204 bits (519),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 96/140 (69%), Positives = 113/140 (81%), Gaps = 0/140 (0%)
 Frame = -1

Query  582  LPAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDA  403
            LP W +ESLKAVKYIDA HF+VP G+RA+ELVAG+ESA+ Q+  T  GK YDL F VGDA
Sbjct  233  LPGWMIESLKAVKYIDAAHFTVPEGKRAIELVAGRESAIAQVVITTKGKVYDLMFSVGDA  292

Query  402  SNKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDD  223
            SN C+GSM++EAFAG  TL+VPYESKG GG+K AKLRF+A + RTRV F STYYH +SD 
Sbjct  293  SNSCQGSMLIEAFAGQITLRVPYESKGSGGFKRAKLRFKAVSERTRVRFLSTYYHMKSDH  352

Query  222  FVSLCGPVVDFVKLVSVRNP  163
              SLCGPVVD V+LV VR+P
Sbjct  353  SGSLCGPVVDDVRLVGVRHP  372


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -2

Query  686  NLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            N+LKN +FEEGPY+FP    GVL PP  EDDH P
Sbjct  199  NMLKNGNFEEGPYIFPNTSWGVLIPPNIEDDHSP  232



>ref|XP_004241713.1| PREDICTED: uncharacterized protein LOC101268115 [Solanum lycopersicum]
Length=372

 Score =   204 bits (518),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 114/141 (81%), Gaps = 0/141 (0%)
 Frame = -1

Query  582  LPAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDA  403
            L  W +ESLKAVKYID+EHF VP G+RAVELVAG+ESA+ Q+ RT  GK YDL F +GDA
Sbjct  230  LLGWMIESLKAVKYIDSEHFHVPQGKRAVELVAGRESAIAQVVRTRPGKIYDLLFSIGDA  289

Query  402  SNKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDD  223
            SN CEGSM++EAFAG  T++ PYESKG+GG+K A+LRF A + RTRV F STYYH +SD+
Sbjct  290  SNSCEGSMLVEAFAGKITMQFPYESKGKGGFKRARLRFTAISPRTRVRFLSTYYHMKSDN  349

Query  222  FVSLCGPVVDFVKLVSVRNPH  160
              SLCGPVVD V+LV +RNPH
Sbjct  350  SGSLCGPVVDDVRLVGLRNPH  370


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            P+    N+LKN +FEEGPY+FP    GVL PP  EDDH P
Sbjct  190  PKRPRGNMLKNGNFEEGPYIFPNTTWGVLIPPNIEDDHSP  229



>ref|XP_006356190.1| PREDICTED: uncharacterized protein LOC102589576 [Solanum tuberosum]
Length=371

 Score =   204 bits (518),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 96/141 (68%), Positives = 114/141 (81%), Gaps = 0/141 (0%)
 Frame = -1

Query  582  LPAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDA  403
            L  W +ESLKAVKYID+EHF VP G+RAVELVAG+ESA+ Q+ RT  GK YDL F +GDA
Sbjct  229  LLGWMIESLKAVKYIDSEHFHVPEGKRAVELVAGRESALAQVVRTRPGKIYDLLFSIGDA  288

Query  402  SNKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDD  223
            SN CEGSM++EAFAG  T++ PYESKG+GG+K A+LRF A + RTRV F STYYH +SD+
Sbjct  289  SNSCEGSMLVEAFAGKITMQFPYESKGKGGFKRARLRFTAISPRTRVRFLSTYYHMKSDN  348

Query  222  FVSLCGPVVDFVKLVSVRNPH  160
              SLCGPVVD V+LV VRNPH
Sbjct  349  SGSLCGPVVDDVRLVGVRNPH  369



>ref|XP_006581022.1| PREDICTED: uncharacterized protein LOC100802444 isoform X1 [Glycine 
max]
Length=372

 Score =   202 bits (515),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 91/144 (63%), Positives = 115/144 (80%), Gaps = 0/144 (0%)
 Frame = -1

Query  582  LPAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDA  403
            LP W VESLKAV+YID++HFSVP G+RAVEL+ GKESA+ Q+ART+ GK Y L F VGDA
Sbjct  227  LPGWMVESLKAVRYIDSDHFSVPKGKRAVELIGGKESAIAQVARTIPGKTYTLFFAVGDA  286

Query  402  SNKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDD  223
             N CEGS+ +EA+ G  ++KVPYESKG+GG+K A L+F A + RTR++F ST+Y+ RSDD
Sbjct  287  GNSCEGSLSVEAYVGKESVKVPYESKGKGGFKRATLKFVAVSTRTRILFLSTFYNMRSDD  346

Query  222  FVSLCGPVVDFVKLVSVRNPHRRL  151
              SLCGPV+D V L+S+R PHRR 
Sbjct  347  LASLCGPVIDDVTLISLRKPHRRF  370



>gb|KHN07099.1| hypothetical protein glysoja_023282 [Glycine soja]
Length=359

 Score =   202 bits (514),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 91/144 (63%), Positives = 115/144 (80%), Gaps = 0/144 (0%)
 Frame = -1

Query  582  LPAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDA  403
            LP W VESLKAV+YID++HFSVP G+RAVEL+ GKESA+ Q+ART+ GK Y L F VGDA
Sbjct  214  LPGWMVESLKAVRYIDSDHFSVPKGKRAVELIGGKESAIAQVARTIPGKTYTLFFAVGDA  273

Query  402  SNKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDD  223
             N CEGS+ +EA+ G  ++KVPYESKG+GG+K A L+F A + RTR++F ST+Y+ RSDD
Sbjct  274  GNSCEGSLSVEAYVGKESVKVPYESKGKGGFKRATLKFVAVSTRTRILFLSTFYNMRSDD  333

Query  222  FVSLCGPVVDFVKLVSVRNPHRRL  151
              SLCGPV+D V L+S+R PHRR 
Sbjct  334  LASLCGPVIDDVTLISLRKPHRRF  357



>ref|XP_009590498.1| PREDICTED: uncharacterized protein LOC104087663 [Nicotiana tomentosiformis]
Length=372

 Score =   202 bits (515),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 96/140 (69%), Positives = 114/140 (81%), Gaps = 0/140 (0%)
 Frame = -1

Query  582  LPAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDA  403
            L  W +ESLKAVKYIDAEHF+VP G+RAVELVAG+ESA+ Q+ RT  GK YDL F +GDA
Sbjct  230  LLGWMIESLKAVKYIDAEHFTVPEGKRAVELVAGRESAIAQVVRTRPGKVYDLIFSIGDA  289

Query  402  SNKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDD  223
            SN CEGSM++EAFAG  T++ PYESKG+GG+K A+LRF A + RTRV F STYYH +SD+
Sbjct  290  SNSCEGSMLVEAFAGKITMQFPYESKGKGGFKRARLRFTAISPRTRVRFLSTYYHMKSDN  349

Query  222  FVSLCGPVVDFVKLVSVRNP  163
              SLCGPVVD V+LV VRNP
Sbjct  350  SGSLCGPVVDDVRLVGVRNP  369


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            P+    N+LKN +FEEGPY+FP    GVL PP  EDDH P
Sbjct  190  PKRPKGNMLKNGNFEEGPYIFPNTTWGVLIPPNIEDDHSP  229



>ref|XP_009591297.1| PREDICTED: uncharacterized protein LOC104088341 [Nicotiana tomentosiformis]
Length=372

 Score =   202 bits (515),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 96/140 (69%), Positives = 112/140 (80%), Gaps = 0/140 (0%)
 Frame = -1

Query  582  LPAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDA  403
            LP W +ESLKAVKYIDA HF+VP G+RA+ELVAG+ESA+ Q   T  GK YDL F VGDA
Sbjct  233  LPGWMIESLKAVKYIDAAHFAVPEGKRAIELVAGRESAIAQQVITTKGKVYDLMFSVGDA  292

Query  402  SNKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDD  223
            SN C+GSM++EAFAG  TL+VPYESKG GG+K AKLRF+A + RTRV F STYYH +SD 
Sbjct  293  SNSCQGSMLIEAFAGQITLRVPYESKGNGGFKRAKLRFKAVSERTRVRFLSTYYHMKSDH  352

Query  222  FVSLCGPVVDFVKLVSVRNP  163
              SLCGPVVD V+LV VR+P
Sbjct  353  SGSLCGPVVDDVRLVGVRHP  372


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -2

Query  686  NLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            N+LKN +FEEGPY+FP    GVL PP  EDDH P
Sbjct  199  NMLKNGNFEEGPYIFPNTSWGVLIPPNIEDDHSP  232



>gb|KHG21629.1| GTPase Der [Gossypium arboreum]
Length=302

 Score =   200 bits (508),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 99/176 (56%), Positives = 126/176 (72%), Gaps = 0/176 (0%)
 Frame = -1

Query  687  ELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVPHG  508
             L+K   F  GP   P+      +   H       LP W +ESLKA+KYID+EHFSVP G
Sbjct  125  NLLKNGNFEEGPYIFPRPTSEGVIIPPHIEDDHSPLPGWIIESLKAIKYIDSEHFSVPKG  184

Query  507  RRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPYES  328
            +RA+EL+AGKESAV QI +T  G+ Y L+FLVGDA+N CEG MV+EAFAG +T+KV Y S
Sbjct  185  KRAIELIAGKESAVAQIVKTTIGRNYVLSFLVGDANNGCEGPMVVEAFAGKNTVKVSYNS  244

Query  327  KGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNPH  160
            KG+GG+K A+L FRA + RTR+MF+ST+Y  +SD+  SLCGPV+D VKL+SVR  H
Sbjct  245  KGKGGFKAARLAFRAESTRTRIMFYSTFYAMKSDNSGSLCGPVLDDVKLLSVRKLH  300


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 29/41 (71%), Gaps = 1/41 (2%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPK-VDTGVLCPPFTEDDHFP  585
            P+ T  NLLKN +FEEGPY+FP+    GV+ PP  EDDH P
Sbjct  119  PKRTRANLLKNGNFEEGPYIFPRPTSEGVIIPPHIEDDHSP  159



>ref|XP_010048243.1| PREDICTED: uncharacterized protein LOC104437065 [Eucalyptus grandis]
 gb|KCW80448.1| hypothetical protein EUGRSUZ_C01791 [Eucalyptus grandis]
Length=369

 Score =   202 bits (513),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 110/177 (62%), Positives = 129/177 (73%), Gaps = 1/177 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
             + L+K  GF  GP   P       +P        P LP W VESLKAVKYID+ HFSVP
Sbjct  191  NKNLLKNGGFEEGPYIFPNTSWGVLIPPNIEDDHSP-LPGWMVESLKAVKYIDSAHFSVP  249

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             G RA+ELVAGKESA+ Q+ART+ GK Y L F VGDASN CEGSM++EAFAG  T+KVPY
Sbjct  250  GGYRAIELVAGKESAIAQVARTIPGKTYTLFFAVGDASNSCEGSMIVEAFAGRDTIKVPY  309

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  163
            ESKG+GG+K A LRF+A + RTR+MF+ST+Y  RSDDF SLCGPVVD V L+SVRNP
Sbjct  310  ESKGKGGFKRAVLRFKAVSTRTRIMFYSTFYTMRSDDFSSLCGPVVDDVVLLSVRNP  366


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR TN NLLKN  FEEGPY+FP    GVL PP  EDDH P
Sbjct  187  PRATNKNLLKNGGFEEGPYIFPNTSWGVLIPPNIEDDHSP  226



>ref|XP_009389493.1| PREDICTED: uncharacterized protein LOC103976040 [Musa acuminata 
subsp. malaccensis]
Length=369

 Score =   201 bits (511),  Expect(2) = 7e-59, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 114/143 (80%), Gaps = 2/143 (1%)
 Frame = -1

Query  582  LPAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDA  403
            LP WTVESLKAVKYID++HFSVP G+RAVELVAGKESA+ Q+ARTV GK Y L F +GDA
Sbjct  228  LPGWTVESLKAVKYIDSDHFSVPRGKRAVELVAGKESALAQVARTVPGKVYALAFSIGDA  287

Query  402  SNKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDD  223
             N C GSMV+EAFAG  T K+PYESKG GGYK   LRF A A RTRV+FFST+YHT+ D 
Sbjct  288  GNGCVGSMVVEAFAGRGTAKIPYESKGTGGYKRGVLRFTAVAERTRVVFFSTFYHTKVDG  347

Query  222  FVSLCGPVVDFVKLVSVRNPHRR  154
              SLCGP +D V L+SVR+P RR
Sbjct  348  --SLCGPSLDDVSLLSVRSPVRR  368


 Score = 53.9 bits (128),  Expect(2) = 7e-59, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            P+ T  NLLKN DFEEGPYV P    GVL PP  EDDH P
Sbjct  188  PKLTGDNLLKNRDFEEGPYVLPNTTWGVLIPPNIEDDHSP  227



>ref|XP_010654739.1| PREDICTED: uncharacterized protein LOC100261739 [Vitis vinifera]
Length=372

 Score =   197 bits (500),  Expect(2) = 8e-59, Method: Compositional matrix adjust.
 Identities = 92/138 (67%), Positives = 115/138 (83%), Gaps = 0/138 (0%)
 Frame = -1

Query  582  LPAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDA  403
            LP W +ESLKAVKYID++HF+VP G+R VELVAGKESA++Q+  T+  + Y L+F VGDA
Sbjct  231  LPGWMIESLKAVKYIDSDHFAVPEGKRGVELVAGKESALSQVVFTIPNRVYVLSFSVGDA  290

Query  402  SNKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDD  223
            +N CEGSMV+EAFAG  T+KVPYESKG+GG+K AKLRF+A + RTRVMF STYY  ++D+
Sbjct  291  NNSCEGSMVVEAFAGLDTVKVPYESKGKGGFKRAKLRFKAISKRTRVMFLSTYYTMKNDN  350

Query  222  FVSLCGPVVDFVKLVSVR  169
              SLCGPV+D VKL+SVR
Sbjct  351  SGSLCGPVLDDVKLLSVR  368


 Score = 58.2 bits (139),  Expect(2) = 8e-59, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR T  NLLKN +FEEGPYVFP    GVL PP  EDDH P
Sbjct  191  PRRTRANLLKNGNFEEGPYVFPTASWGVLIPPNIEDDHSP  230



>gb|KDO83473.1| hypothetical protein CISIN_1g017636mg [Citrus sinensis]
Length=291

 Score =   199 bits (506),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 100/173 (58%), Positives = 126/173 (73%), Gaps = 1/173 (1%)
 Frame = -1

Query  687  ELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVPHG  508
             LVK  GF  GP R+    +   LP        P LP W +ESLKAVK+IDA+HF+VP+G
Sbjct  119  NLVKNPGFEEGPHRLVNTTNGVLLPPRQEDLTSP-LPGWIIESLKAVKFIDAKHFNVPYG  177

Query  507  RRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPYES  328
              AVELVAG+ESA+ QI RTV  K Y+LTF +GDA N C GSM +EAFAG  T+ VP+ES
Sbjct  178  HAAVELVAGRESAIAQILRTVPNKEYNLTFTIGDAKNGCHGSMRVEAFAGKDTVAVPFES  237

Query  327  KGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  169
            KG+GG+K A L+F+A A RTR+ FFSTYYHT+ +DF SLCGPV+D V+++S+R
Sbjct  238  KGKGGFKSASLKFKAIAARTRITFFSTYYHTKINDFGSLCGPVLDEVRVLSIR  290



>gb|KJB70569.1| hypothetical protein B456_011G080100 [Gossypium raimondii]
Length=328

 Score =   200 bits (508),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 99/176 (56%), Positives = 126/176 (72%), Gaps = 0/176 (0%)
 Frame = -1

Query  687  ELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVPHG  508
             L+K   F  GP   P+      +   H       LP W +ESLKA+KYID+EHFSVP G
Sbjct  151  NLLKNGNFEEGPYIFPRPTSEGVIIPPHIEDDHSPLPGWIIESLKAIKYIDSEHFSVPKG  210

Query  507  RRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPYES  328
            +RA+EL+AGKESAV QI +T  G+ Y L+FLVGDA+N CEG MV+EAFAG +T+KV Y S
Sbjct  211  KRAIELIAGKESAVAQIVKTAIGRNYVLSFLVGDANNGCEGPMVVEAFAGKNTVKVSYNS  270

Query  327  KGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNPH  160
            KG+GG+K A+L FRA + RTR+MF+ST+Y  +SD+  SLCGPV+D VKL+SVR  H
Sbjct  271  KGKGGFKAARLAFRAESTRTRIMFYSTFYAMKSDNSGSLCGPVLDDVKLLSVRKLH  326


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 29/41 (71%), Gaps = 1/41 (2%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPK-VDTGVLCPPFTEDDHFP  585
            P+ T  NLLKN +FEEGPY+FP+    GV+ PP  EDDH P
Sbjct  145  PKRTRANLLKNGNFEEGPYIFPRPTSEGVIIPPHIEDDHSP  185



>ref|XP_006346648.1| PREDICTED: uncharacterized protein LOC102598480 [Solanum tuberosum]
Length=380

 Score =   201 bits (510),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 96/140 (69%), Positives = 114/140 (81%), Gaps = 0/140 (0%)
 Frame = -1

Query  582  LPAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDA  403
            LP W VESLKAVKY+DA+HF+VP G+RA+ELVAG+ESA+ Q   T AG+ YDLTF VGDA
Sbjct  238  LPGWIVESLKAVKYVDADHFTVPEGKRAIELVAGRESAIAQQVITKAGRIYDLTFSVGDA  297

Query  402  SNKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDD  223
            +N CEGSMV+EAFAG   L+  Y SKG+GG+K AKLRF AT+ RTRV F S+YYH +SD+
Sbjct  298  NNSCEGSMVVEAFAGNVALQFKYVSKGKGGFKRAKLRFTATSQRTRVRFLSSYYHMKSDN  357

Query  222  FVSLCGPVVDFVKLVSVRNP  163
              SLCGPVVD V+LVSVRNP
Sbjct  358  SGSLCGPVVDDVRLVSVRNP  377


 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -2

Query  686  NLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            N+LKN +FEEGPY+FP    GVL PP  EDDH P
Sbjct  204  NMLKNGNFEEGPYIFPNTTWGVLIPPNIEDDHCP  237



>gb|KHG06895.1| Agmatine deiminase [Gossypium arboreum]
Length=374

 Score =   200 bits (509),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 99/176 (56%), Positives = 126/176 (72%), Gaps = 0/176 (0%)
 Frame = -1

Query  687  ELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVPHG  508
             L+K   F  GP   P+      +   H       LP W +ESLKA+KYID+EHFSVP G
Sbjct  197  NLLKNGNFEEGPYIFPRPTSEGVIIPPHIEDDHSPLPGWIIESLKAIKYIDSEHFSVPKG  256

Query  507  RRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPYES  328
            +RA+EL+AGKESAV QI +T  G+ Y L+FLVGDA+N CEG MV+EAFAG +T+KV Y S
Sbjct  257  KRAIELIAGKESAVAQIVKTTIGRNYVLSFLVGDANNGCEGPMVVEAFAGKNTVKVSYNS  316

Query  327  KGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNPH  160
            KG+GG+K A+L FRA + RTR+MF+ST+Y  +SD+  SLCGPV+D VKL+SVR  H
Sbjct  317  KGKGGFKAARLAFRAESTRTRIMFYSTFYAMKSDNSGSLCGPVLDDVKLLSVRKLH  372


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 29/41 (71%), Gaps = 1/41 (2%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPK-VDTGVLCPPFTEDDHFP  585
            P+ T  NLLKN +FEEGPY+FP+    GV+ PP  EDDH P
Sbjct  191  PKRTRANLLKNGNFEEGPYIFPRPTSEGVIIPPHIEDDHSP  231



>gb|KJB70568.1| hypothetical protein B456_011G080100 [Gossypium raimondii]
Length=374

 Score =   200 bits (509),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 99/176 (56%), Positives = 126/176 (72%), Gaps = 0/176 (0%)
 Frame = -1

Query  687  ELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVPHG  508
             L+K   F  GP   P+      +   H       LP W +ESLKA+KYID+EHFSVP G
Sbjct  197  NLLKNGNFEEGPYIFPRPTSEGVIIPPHIEDDHSPLPGWIIESLKAIKYIDSEHFSVPKG  256

Query  507  RRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPYES  328
            +RA+EL+AGKESAV QI +T  G+ Y L+FLVGDA+N CEG MV+EAFAG +T+KV Y S
Sbjct  257  KRAIELIAGKESAVAQIVKTAIGRNYVLSFLVGDANNGCEGPMVVEAFAGKNTVKVSYNS  316

Query  327  KGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNPH  160
            KG+GG+K A+L FRA + RTR+MF+ST+Y  +SD+  SLCGPV+D VKL+SVR  H
Sbjct  317  KGKGGFKAARLAFRAESTRTRIMFYSTFYAMKSDNSGSLCGPVLDDVKLLSVRKLH  372


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 29/41 (71%), Gaps = 1/41 (2%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPK-VDTGVLCPPFTEDDHFP  585
            P+ T  NLLKN +FEEGPY+FP+    GV+ PP  EDDH P
Sbjct  191  PKRTRANLLKNGNFEEGPYIFPRPTSEGVIIPPHIEDDHSP  231



>ref|XP_009758146.1| PREDICTED: uncharacterized protein LOC104210873 [Nicotiana sylvestris]
Length=372

 Score =   200 bits (509),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 95/140 (68%), Positives = 113/140 (81%), Gaps = 0/140 (0%)
 Frame = -1

Query  582  LPAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDA  403
            L  W +ESLKAVKYIDAEHF+VP G+RAVELVAG+ESA+ Q+ RT  GK YDL F +GDA
Sbjct  230  LLGWMIESLKAVKYIDAEHFTVPEGKRAVELVAGRESAIAQVVRTRPGKVYDLIFSIGDA  289

Query  402  SNKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDD  223
            SN CEGSM++EAFAG  T++ PYESKG+GG K ++LRF A + RTRV F STYYH +SD+
Sbjct  290  SNSCEGSMLVEAFAGKITMQFPYESKGKGGVKRSRLRFTAISPRTRVRFLSTYYHMKSDN  349

Query  222  FVSLCGPVVDFVKLVSVRNP  163
              SLCGPVVD V+LV VRNP
Sbjct  350  SGSLCGPVVDDVRLVGVRNP  369


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            P+    N+LKN +FEEGPY+FP    GVL PP  EDDH P
Sbjct  190  PKRPKGNMLKNGNFEEGPYIFPNTTWGVLIPPNIEDDHSP  229



>ref|XP_007150706.1| hypothetical protein PHAVU_005G1745000g, partial [Phaseolus vulgaris]
 gb|ESW22700.1| hypothetical protein PHAVU_005G1745000g, partial [Phaseolus vulgaris]
Length=294

 Score =   197 bits (501),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 99/177 (56%), Positives = 124/177 (70%), Gaps = 1/177 (1%)
 Frame = -1

Query  687  ELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVPHG  508
             L+K   F  GP   P       +P  H       LP W VESLKAVKYID++HF+VP G
Sbjct  118  NLLKNGNFEEGPYLFPNSSWGALIPP-HIEDAHSPLPGWIVESLKAVKYIDSDHFAVPEG  176

Query  507  RRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPYES  328
            +RA+ELVAGKESA+ Q+  T  G+ YDLTF VGDA+N CEGSM++EAFAG  T+++PY+S
Sbjct  177  KRAIELVAGKESALAQVVITTIGRVYDLTFAVGDANNACEGSMIVEAFAGAETVQIPYQS  236

Query  327  KGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNPHR  157
            KG+GG    KLRF+A A RTR+ F ST+Y  +SD+  SLCGPV+D VKL+SVR P R
Sbjct  237  KGKGGSVRGKLRFKAVATRTRLRFLSTFYTMKSDNSGSLCGPVIDDVKLLSVRYPRR  293


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 26/40 (65%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            P+ T  NLLKN +FEEGPY+FP    G L PP  ED H P
Sbjct  112  PKRTRANLLKNGNFEEGPYLFPNSSWGALIPPHIEDAHSP  151



>ref|XP_006439076.1| hypothetical protein CICLE_v10031881mg [Citrus clementina]
 ref|XP_006482850.1| PREDICTED: uncharacterized protein LOC102610407 [Citrus sinensis]
 gb|ESR52316.1| hypothetical protein CICLE_v10031881mg [Citrus clementina]
 gb|KDO83472.1| hypothetical protein CISIN_1g017636mg [Citrus sinensis]
Length=368

 Score =   198 bits (504),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 100/173 (58%), Positives = 126/173 (73%), Gaps = 1/173 (1%)
 Frame = -1

Query  687  ELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVPHG  508
             LVK  GF  GP R+    +   LP        P LP W +ESLKAVK+IDA+HF+VP+G
Sbjct  196  NLVKNPGFEEGPHRLVNTTNGVLLPPRQEDLTSP-LPGWIIESLKAVKFIDAKHFNVPYG  254

Query  507  RRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPYES  328
              AVELVAG+ESA+ QI RTV  K Y+LTF +GDA N C GSM +EAFAG  T+ VP+ES
Sbjct  255  HAAVELVAGRESAIAQILRTVPNKEYNLTFTIGDAKNGCHGSMRVEAFAGKDTVAVPFES  314

Query  327  KGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  169
            KG+GG+K A L+F+A A RTR+ FFSTYYHT+ +DF SLCGPV+D V+++S+R
Sbjct  315  KGKGGFKSASLKFKAIAARTRITFFSTYYHTKINDFGSLCGPVLDEVRVLSIR  367



>ref|XP_003531698.1| PREDICTED: uncharacterized protein LOC100779277 [Glycine max]
Length=371

 Score =   198 bits (503),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 96/173 (55%), Positives = 126/173 (73%), Gaps = 1/173 (1%)
 Frame = -1

Query  687  ELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVPHG  508
             L+K   F  GP   P+      +P  H       LP W VESLKAVKYID++HF+VP G
Sbjct  198  NLLKNGNFEEGPYVFPKESWGVLIPP-HIEDAYSPLPGWMVESLKAVKYIDSDHFAVPEG  256

Query  507  RRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPYES  328
            +RA+ELVAGKESA+ Q+  T+ GK YDLTF+VGDA+N CEGSMV+EAFAG  T++V Y+S
Sbjct  257  KRAIELVAGKESAIAQVVITIIGKVYDLTFVVGDANNSCEGSMVVEAFAGKDTIQVQYQS  316

Query  327  KGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  169
            KG+GG+   KLRF+A + RTR+ F ST+Y T+SD+  SLCGP++D ++L+SVR
Sbjct  317  KGKGGFIRGKLRFKAMSTRTRIRFLSTFYTTKSDNTGSLCGPIIDDIRLLSVR  369


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 47/154 (31%), Positives = 64/154 (42%), Gaps = 24/154 (16%)
 Frame = -1

Query  582  LPAWTVESLKAVKYIDAEH------FSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLT  421
            +P WT+  +  V+YI +          VPHG  AV L  G E+++ Q  + V G FY LT
Sbjct  53   IPHWTISGM--VEYIKSGQKQGDMVLVVPHGTYAVRL--GNEASIKQKIQVVKGMFYSLT  108

Query  420  FLVGDASNKCEGSMVLEAFAGPSTLK-----VPYESK-GQGGYKPAKLRFRATANRTRVM  259
            F    AS  C     L     PS  K      P ++  G  G       FRA   R  ++
Sbjct  109  F---SASRTCAQEEKLNVSVVPSNEKSDWGVFPIQTMYGSNGCDSYACGFRADYPRVEIV  165

Query  258  FFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNPHR  157
                  H    D    CGP++D V L  + +P R
Sbjct  166  I-----HNPGVDEDPACGPLIDSVALKLLHSPKR  194


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            P+ T  NLLKN +FEEGPYVFPK   GVL PP  ED + P
Sbjct  192  PKRTRDNLLKNGNFEEGPYVFPKESWGVLIPPHIEDAYSP  231



>gb|KHN07098.1| hypothetical protein glysoja_023281 [Glycine soja]
Length=328

 Score =   196 bits (499),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 89/140 (64%), Positives = 112/140 (80%), Gaps = 0/140 (0%)
 Frame = -1

Query  582  LPAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDA  403
            LP W VESLKAVKYID++HFSVP G+ AVEL+ GKESA+ Q+ART+ GK Y L+F VGDA
Sbjct  189  LPGWIVESLKAVKYIDSDHFSVPLGKGAVELIGGKESAIAQVARTIPGKTYTLSFAVGDA  248

Query  402  SNKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDD  223
             N CEGS+ +EA+ G  ++KVPYESKG+GG+K A L+F A + RTR++F ST+Y  RSDD
Sbjct  249  GNSCEGSLSVEAYVGKESVKVPYESKGKGGFKRATLKFVAVSTRTRILFLSTFYTMRSDD  308

Query  222  FVSLCGPVVDFVKLVSVRNP  163
            F SLCGPV+D V L+S+R P
Sbjct  309  FASLCGPVIDDVTLISLRKP  328


 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 28/42 (67%), Gaps = 2/42 (5%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTED--DHFP  585
            PR TN N+LKN  FEEGPYVFP   +GVL PP   D  DH P
Sbjct  147  PRPTNKNVLKNGGFEEGPYVFPNTTSGVLIPPNIVDLSDHSP  188



>gb|KHN47787.1| hypothetical protein glysoja_029205 [Glycine soja]
Length=369

 Score =   197 bits (502),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 96/173 (55%), Positives = 126/173 (73%), Gaps = 1/173 (1%)
 Frame = -1

Query  687  ELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVPHG  508
             L+K   F  GP   P+      +P  H       LP W VESLKAVKYID++HF+VP G
Sbjct  196  NLLKNGNFEEGPYVFPKESWGVLIPP-HIEDAYSPLPGWMVESLKAVKYIDSDHFAVPEG  254

Query  507  RRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPYES  328
            +RA+ELVAGKESA+ Q+  T+ GK YDLTF+VGDA+N CEGSMV+EAFAG  T++V Y+S
Sbjct  255  KRAIELVAGKESAIAQVVITIIGKVYDLTFVVGDANNSCEGSMVVEAFAGKDTIQVQYQS  314

Query  327  KGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  169
            KG+GG+   KLRF+A + RTR+ F ST+Y T+SD+  SLCGP++D ++L+SVR
Sbjct  315  KGKGGFIRGKLRFKAMSTRTRIRFLSTFYTTKSDNTGSLCGPIIDDIRLLSVR  367


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 47/154 (31%), Positives = 64/154 (42%), Gaps = 24/154 (16%)
 Frame = -1

Query  582  LPAWTVESLKAVKYIDAEH------FSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLT  421
            +P WT+  +  V+YI +          VPHG  AV L  G E+++ Q  + V G FY LT
Sbjct  51   IPHWTISGM--VEYIKSGQKQGDMVLVVPHGTYAVRL--GNEASIKQKIQVVKGMFYSLT  106

Query  420  FLVGDASNKCEGSMVLEAFAGPSTLK-----VPYESK-GQGGYKPAKLRFRATANRTRVM  259
            F    AS  C     L     PS  K      P ++  G  G       FRA   R  ++
Sbjct  107  F---SASRTCAQEEKLNVSVVPSNEKSDWGVFPIQTMYGSNGCDSYACGFRADYPRVEIV  163

Query  258  FFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNPHR  157
                  H    D    CGP++D V L  + +P R
Sbjct  164  I-----HNPGVDEDPACGPLIDSVALKLLHSPKR  192


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            P+ T  NLLKN +FEEGPYVFPK   GVL PP  ED + P
Sbjct  190  PKRTRDNLLKNGNFEEGPYVFPKESWGVLIPPHIEDAYSP  229



>gb|AGV54541.1| hypothetical protein [Phaseolus vulgaris]
Length=376

 Score =   197 bits (502),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 99/177 (56%), Positives = 124/177 (70%), Gaps = 1/177 (1%)
 Frame = -1

Query  687  ELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVPHG  508
             L+K   F  GP   P       +P  H       LP W VESLKAVKYID++HF+VP G
Sbjct  200  NLLKNGNFEEGPYLFPNSSWGALIPP-HIEDAHSPLPGWIVESLKAVKYIDSDHFAVPEG  258

Query  507  RRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPYES  328
            +RA+ELVAGKESA+ Q+  T  G+ YDLTF VGDA+N CEGSM++EAFAG  T+++PY+S
Sbjct  259  KRAIELVAGKESALAQVVITTIGRVYDLTFAVGDANNACEGSMIVEAFAGAETVQIPYQS  318

Query  327  KGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNPHR  157
            KG+GG    KLRF+A A RTR+ F ST+Y  +SD+  SLCGPV+D VKL+SVR P R
Sbjct  319  KGKGGSVRGKLRFKAVATRTRLRFLSTFYTMKSDNSGSLCGPVIDDVKLLSVRYPRR  375


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 26/40 (65%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            P+ T  NLLKN +FEEGPY+FP    G L PP  ED H P
Sbjct  194  PKRTRANLLKNGNFEEGPYLFPNSSWGALIPPHIEDAHSP  233



>ref|XP_010914930.1| PREDICTED: uncharacterized protein LOC105040204 [Elaeis guineensis]
Length=370

 Score =   197 bits (502),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 102/177 (58%), Positives = 124/177 (70%), Gaps = 1/177 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
             + L+K   F  GP  +P       +P        P LP W V+S KAVKY+D+ HFSVP
Sbjct  189  NKNLLKNGDFEEGPYILPNTTWGVLIPPTTEDDHSP-LPGWMVDSPKAVKYLDSTHFSVP  247

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             G RAVEL+AGKESA+ Q  RTV G+ Y L F VGDASN C+G+M++EAFAG  T+KVPY
Sbjct  248  RGSRAVELLAGKESALAQEVRTVPGRAYALAFSVGDASNACQGTMIVEAFAGEHTVKVPY  307

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  163
            ESKG GG K A LRFRA+  RTR++FFS+ Y+TRSDD  SLCGPV+D V LVS+RNP
Sbjct  308  ESKGAGGAKRAVLRFRASKARTRIVFFSSNYNTRSDDLSSLCGPVLDDVALVSIRNP  364


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR +N NLLKN DFEEGPY+ P    GVL PP TEDDH P
Sbjct  185  PRRSNKNLLKNGDFEEGPYILPNTTWGVLIPPTTEDDHSP  224



>ref|XP_009598172.1| PREDICTED: uncharacterized protein LOC104094024 [Nicotiana tomentosiformis]
Length=379

 Score =   197 bits (502),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 94/140 (67%), Positives = 111/140 (79%), Gaps = 0/140 (0%)
 Frame = -1

Query  582  LPAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDA  403
            LP W +ESLKAVKYID EHF+VP G+RAVELVAG+ESA+ Q   T AGK YDL F VGDA
Sbjct  237  LPGWIIESLKAVKYIDTEHFAVPEGKRAVELVAGRESALAQQVITKAGKIYDLIFTVGDA  296

Query  402  SNKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDD  223
            +N CEGSM++EAFAG   L+VPY SKG+GG+K AK RF A + RTRV F ST YH ++D+
Sbjct  297  NNSCEGSMLIEAFAGKVALQVPYMSKGKGGFKRAKFRFTAISRRTRVRFLSTNYHMKTDN  356

Query  222  FVSLCGPVVDFVKLVSVRNP  163
              SLCGPV+D V+LVSVRNP
Sbjct  357  SGSLCGPVIDDVRLVSVRNP  376


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -2

Query  686  NLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            N+LKN +FEEGPY+FP  + G+L PP  EDDH P
Sbjct  203  NMLKNGNFEEGPYIFPNTNWGILIPPNIEDDHCP  236



>ref|NP_001242447.1| uncharacterized protein LOC100802444 precursor [Glycine max]
 gb|ACU22816.1| unknown [Glycine max]
Length=370

 Score =   197 bits (500),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 89/144 (62%), Positives = 113/144 (78%), Gaps = 0/144 (0%)
 Frame = -1

Query  582  LPAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDA  403
            LP W VESLKAV+YID++HFSVP G+RAVEL+ GKESA+ Q+ART+ GK Y L F VGDA
Sbjct  225  LPGWMVESLKAVRYIDSDHFSVPKGKRAVELIGGKESAIAQVARTIPGKTYTLFFAVGDA  284

Query  402  SNKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDD  223
             N  EGS+ +EA+ G  ++KVPYESKG+GG+K A L+F A + RT ++F ST+Y+ RSDD
Sbjct  285  GNSSEGSLSVEAYVGKESVKVPYESKGKGGFKRATLKFVAVSTRTHILFLSTFYNMRSDD  344

Query  222  FVSLCGPVVDFVKLVSVRNPHRRL  151
              SLCGPV+D V L+S+R PHRR 
Sbjct  345  LASLCGPVIDDVTLISLRKPHRRF  368



>ref|XP_008792101.1| PREDICTED: uncharacterized protein LOC103708794 [Phoenix dactylifera]
Length=371

 Score =   197 bits (500),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 103/177 (58%), Positives = 122/177 (69%), Gaps = 1/177 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
             + L+K   F  GP  +P       +P        P LP W V+S KAVKY+D+ HF VP
Sbjct  190  NKNLLKNGDFEEGPYILPNTTWGVLIPPTTEDDHSP-LPGWMVDSPKAVKYLDSAHFFVP  248

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
            HGRRAVEL+AGKESA+ Q  RTV G+ Y L F VGDASN CEGSM++EAFAG  T+KVPY
Sbjct  249  HGRRAVELLAGKESALAQEVRTVPGRAYALAFSVGDASNACEGSMIVEAFAGEHTVKVPY  308

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  163
            ESKG GG K A LRFRA+  RTR++F S+ Y TR DD  SLCGPV+D V LVS+RNP
Sbjct  309  ESKGAGGAKRAVLRFRASKARTRIVFLSSNYSTRRDDLSSLCGPVLDDVALVSIRNP  365


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            P  TN NLLKN DFEEGPY+ P    GVL PP TEDDH P
Sbjct  186  PSRTNKNLLKNGDFEEGPYILPNTTWGVLIPPTTEDDHSP  225



>ref|XP_008775036.1| PREDICTED: uncharacterized protein LOC103695476 [Phoenix dactylifera]
Length=376

 Score =   197 bits (500),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 104/181 (57%), Positives = 125/181 (69%), Gaps = 3/181 (2%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
             + L+K   F  GP  +P       +P        P LP+W VESLKAV YID+ HF VP
Sbjct  196  NKNLLKNADFEEGPYILPNTTWGVLVPPNIEDDHSP-LPSWMVESLKAVNYIDSAHFKVP  254

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             G+RAVELV GKESA+ Q+ RTV G+ Y L+F VGDA N C G+M++EAFA  ST+KVPY
Sbjct  255  QGKRAVELVGGKESALAQVVRTVVGRVYTLSFSVGDAGNACAGTMMVEAFAARSTVKVPY  314

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNPHRR  154
            +SKG GG+K A LRF A A RTRV+F STYY+TR+D   SLCGPVVD V L+SVR P RR
Sbjct  315  DSKGTGGFKRAVLRFTAEAERTRVVFLSTYYNTRTDG--SLCGPVVDDVTLLSVRKPSRR  372

Query  153  L  151
            L
Sbjct  373  L  373


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR TN NLLKN DFEEGPY+ P    GVL PP  EDDH P
Sbjct  192  PRLTNKNLLKNADFEEGPYILPNTTWGVLVPPNIEDDHSP  231



>gb|EMS52012.1| hypothetical protein TRIUR3_31218 [Triticum urartu]
Length=312

 Score =   195 bits (495),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 102/176 (58%), Positives = 129/176 (73%), Gaps = 2/176 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
             + LVK   F  GP  +P  +    +P+       P LP W VESLKAVKYID++HF+VP
Sbjct  131  NKNLVKNGDFEEGPYIIPGTKWGVLIPSRMVDEHSP-LPGWMVESLKAVKYIDSDHFAVP  189

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             GRRAVEL+AG+ESA+ Q+ RTV GK Y L+F VGDASN C GS+++EA+AG  + KVPY
Sbjct  190  RGRRAVELLAGRESAIAQVIRTVPGKQYALSFSVGDASNTCRGSLMVEAYAGRESTKVPY  249

Query  333  ESKGQGG-YKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  169
            ES GQGG  K A L FRAT++RTRV+FFS++Y+TR+DD  SLCGPV+D V +VSVR
Sbjct  250  ESAGQGGAAKRAVLPFRATSSRTRVVFFSSFYNTRTDDMSSLCGPVIDDVAVVSVR  305


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 26/40 (65%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR TN NL+KN DFEEGPY+ P    GVL P    D+H P
Sbjct  127  PRRTNKNLVKNGDFEEGPYIIPGTKWGVLIPSRMVDEHSP  166



>gb|KHG10708.1| Allergen Act d 3 [Gossypium arboreum]
Length=374

 Score =   195 bits (496),  Expect(2) = 7e-57, Method: Compositional matrix adjust.
 Identities = 86/141 (61%), Positives = 118/141 (84%), Gaps = 0/141 (0%)
 Frame = -1

Query  582  LPAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDA  403
            LP W ++SLKAVKYID++HF+VP G+RA+EL+AGKES+++Q+ RT  G+ Y L+F +GDA
Sbjct  232  LPGWIIDSLKAVKYIDSDHFTVPEGKRAIELIAGKESSLSQVVRTTIGRDYVLSFTIGDA  291

Query  402  SNKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDD  223
            +N CEGSMV+EAFA  +T+KV Y+SKG+GG+K A+LRF+A + RTR+MF+ST+Y  ++D+
Sbjct  292  NNACEGSMVVEAFANKNTVKVTYDSKGKGGFKQARLRFKADSTRTRIMFYSTFYTMKNDN  351

Query  222  FVSLCGPVVDFVKLVSVRNPH  160
              SLCGPVVD VKLVS+R  H
Sbjct  352  SGSLCGPVVDDVKLVSIRKLH  372


 Score = 53.1 bits (126),  Expect(2) = 7e-57, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 29/41 (71%), Gaps = 1/41 (2%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPK-VDTGVLCPPFTEDDHFP  585
            P+ T VNLLKN +FEEGPY+F   V  GV+ PP  EDDH P
Sbjct  191  PKRTRVNLLKNGNFEEGPYIFSGPVSEGVIIPPHIEDDHSP  231



>ref|XP_011072257.1| PREDICTED: uncharacterized protein LOC105157546 [Sesamum indicum]
Length=401

 Score =   196 bits (498),  Expect(2) = 7e-57, Method: Compositional matrix adjust.
 Identities = 90/140 (64%), Positives = 112/140 (80%), Gaps = 0/140 (0%)
 Frame = -1

Query  582  LPAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDA  403
            LP W +ESLKAVKY+D+ HF+VP G+RAVELVAG+ESA+ Q  RTV GK Y+L F +GDA
Sbjct  259  LPGWMIESLKAVKYVDSNHFAVPEGKRAVELVAGRESALAQTVRTVPGKTYNLIFSIGDA  318

Query  402  SNKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDD  223
             N CEGSM +EA AG   L+VPYESKG GG+K AKLRF+A ++RTRV F ST+YH +SD+
Sbjct  319  KNSCEGSMTVEANAGRDILQVPYESKGNGGFKRAKLRFKAVSSRTRVRFLSTFYHIKSDN  378

Query  222  FVSLCGPVVDFVKLVSVRNP  163
              SLCGP++D V+LVS+R P
Sbjct  379  SGSLCGPIIDDVRLVSIRYP  398


 Score = 52.4 bits (124),  Expect(2) = 7e-57, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            P+    N+LKN +FEEGPY+FP    G+L PP  EDDH P
Sbjct  219  PKRQRGNILKNGNFEEGPYIFPNTSYGILIPPNIEDDHSP  258



>ref|XP_003526423.1| PREDICTED: uncharacterized protein LOC100801917 [Glycine max]
Length=365

 Score =   196 bits (498),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 89/140 (64%), Positives = 112/140 (80%), Gaps = 0/140 (0%)
 Frame = -1

Query  582  LPAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDA  403
            LP W VESLKAVKYID++HFSVP G+ AVEL+ GKESA+ Q+ART+ GK Y L+F VGDA
Sbjct  226  LPGWIVESLKAVKYIDSDHFSVPLGKGAVELIGGKESAIAQVARTIPGKTYTLSFAVGDA  285

Query  402  SNKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDD  223
             N CEGS+ +EA+ G  ++KVPYESKG+GG+K A L+F A + RTR++F ST+Y  RSDD
Sbjct  286  GNSCEGSLSVEAYVGKESVKVPYESKGKGGFKRATLKFVAVSTRTRILFLSTFYTMRSDD  345

Query  222  FVSLCGPVVDFVKLVSVRNP  163
            F SLCGPV+D V L+S+R P
Sbjct  346  FASLCGPVIDDVTLISLRKP  365


 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 28/42 (67%), Gaps = 2/42 (5%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTED--DHFP  585
            PR TN N+LKN  FEEGPYVFP   +GVL PP   D  DH P
Sbjct  184  PRPTNKNVLKNGGFEEGPYVFPNTTSGVLIPPNIVDLSDHSP  225



>gb|KDP37140.1| hypothetical protein JCGZ_06196 [Jatropha curcas]
Length=375

 Score =   189 bits (479),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 85/144 (59%), Positives = 114/144 (79%), Gaps = 0/144 (0%)
 Frame = -1

Query  582  LPAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDA  403
            LP W +ESLKAVKYI++EHF VP G+RA+ELVAGKESA++QI +T+  K Y LTF VGDA
Sbjct  232  LPGWIIESLKAVKYINSEHFKVPQGKRAIELVAGKESALSQIVKTIPKKSYVLTFNVGDA  291

Query  402  SNKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDD  223
            +N CEGS+V+E +AG   +++PY SKG+GG+KPA+ +F+A +  TR+MF S++Y  +SD+
Sbjct  292  NNSCEGSLVVEVYAGNDKIEIPYVSKGKGGFKPARFQFQAVSTHTRLMFLSSFYTMKSDN  351

Query  222  FVSLCGPVVDFVKLVSVRNPHRRL  151
              SLCGPV+D VKL+SVR P   L
Sbjct  352  SGSLCGPVIDDVKLLSVRRPRHLL  375


 Score = 58.9 bits (141),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            P+ T  NLLKN DFEEGPYVFP  D GVL PP  EDDH P
Sbjct  192  PKRTRDNLLKNGDFEEGPYVFPNTDWGVLIPPHIEDDHSP  231



>emb|CBI36253.3| unnamed protein product [Vitis vinifera]
Length=405

 Score =   197 bits (500),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 100/173 (58%), Positives = 125/173 (72%), Gaps = 1/173 (1%)
 Frame = -1

Query  687  ELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVPHG  508
             L+K   F  GP   P       +P        P LP W +ESLKAVKYID++HF+VP G
Sbjct  197  NLLKNGNFEEGPYVFPTASWGVLIPPNIEDDHSP-LPGWMIESLKAVKYIDSDHFAVPEG  255

Query  507  RRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPYES  328
            +R VELVAGKESA++Q+  T+  + Y L+F VGDA+N CEGSMV+EAFAG  T+KVPYES
Sbjct  256  KRGVELVAGKESALSQVVFTIPNRVYVLSFSVGDANNSCEGSMVVEAFAGLDTVKVPYES  315

Query  327  KGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  169
            KG+GG+K AKLRF+A + RTRVMF STYY  ++D+  SLCGPV+D VKL+SVR
Sbjct  316  KGKGGFKRAKLRFKAISKRTRVMFLSTYYTMKNDNSGSLCGPVLDDVKLLSVR  368


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR T  NLLKN +FEEGPYVFP    GVL PP  EDDH P
Sbjct  191  PRRTRANLLKNGNFEEGPYVFPTASWGVLIPPNIEDDHSP  230



>dbj|BAK03126.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=374

 Score =   196 bits (497),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 103/179 (58%), Positives = 129/179 (72%), Gaps = 2/179 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
             + LVK   F  GP  +P  +    +P+       P LP W VESLKAVKYID++HF+VP
Sbjct  193  NKNLVKNGDFEEGPYIIPGTKWGVLIPSRTVDEHSP-LPGWMVESLKAVKYIDSDHFAVP  251

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             GRRAVEL+AG+ESA+ Q+ RTV GK Y L+F VGDASN C GS+++EA+AG  + KVPY
Sbjct  252  RGRRAVELLAGRESAIAQVIRTVPGKQYALSFSVGDASNTCRGSLMVEAYAGRESAKVPY  311

Query  333  ESKGQGG-YKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNPH  160
            ES GQGG  K A L FRAT+ RTRV+FFS++Y+TR+DD  SLCGPV+D V +VSVR  H
Sbjct  312  ESAGQGGAAKRAVLPFRATSPRTRVVFFSSFYNTRTDDMSSLCGPVIDDVAVVSVRARH  370


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR TN NL+KN DFEEGPY+ P    GVL P  T D+H P
Sbjct  189  PRRTNKNLVKNGDFEEGPYIIPGTKWGVLIPSRTVDEHSP  228



>ref|XP_011035644.1| PREDICTED: uncharacterized protein LOC105133377 [Populus euphratica]
Length=373

 Score =   196 bits (497),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 97/179 (54%), Positives = 123/179 (69%), Gaps = 1/179 (1%)
 Frame = -1

Query  687  ELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVPHG  508
             L+K   F  GP   P       +P  +     P LP W V+SLKAVKYID+EHF+VP G
Sbjct  196  NLLKNGNFEEGPYMFPNTDWGVLIPPHNEDDQCP-LPGWIVDSLKAVKYIDSEHFTVPEG  254

Query  507  RRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPYES  328
            +RAVEL+AGKESA++QI +T+  K Y LTF VGD SN C GSMV+E +AG    +VPY+S
Sbjct  255  KRAVELIAGKESAISQIVKTIINKIYVLTFNVGDTSNSCVGSMVVEVYAGKDRTQVPYKS  314

Query  327  KGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNPHRRL  151
             G+GG+K AK  F+A +N TR+ F S++Y  +SD+  SLCGPV+D VKLVSVRNP R L
Sbjct  315  NGKGGFKRAKFVFKAVSNHTRITFLSSFYTMKSDNSGSLCGPVLDDVKLVSVRNPRRHL  373


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            P+    NLLKN +FEEGPY+FP  D GVL PP  EDD  P
Sbjct  190  PKRARDNLLKNGNFEEGPYMFPNTDWGVLIPPHNEDDQCP  229



>ref|XP_002517567.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF44731.1| conserved hypothetical protein [Ricinus communis]
Length=378

 Score =   196 bits (497),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 96/179 (54%), Positives = 125/179 (70%), Gaps = 1/179 (1%)
 Frame = -1

Query  687  ELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVPHG  508
             L+K   F  GP   P       +P  H       LP W +ESLKAVKYID +HF+VP G
Sbjct  201  NLLKNGNFEEGPYVFPNTDWGVLIPP-HIEDDHSPLPGWIIESLKAVKYIDLDHFAVPEG  259

Query  507  RRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPYES  328
            +RA+ELVAGKESA+ Q+ +T+ GK Y LTF VGDA+N CEGSM++EA+AG   ++ PY S
Sbjct  260  KRAIELVAGKESALAQVVKTIPGKTYVLTFSVGDANNACEGSMIVEAYAGKDKIQFPYVS  319

Query  327  KGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNPHRRL  151
            KG+GG+K AKL+F+A +  TR+MF S++Y  +SD+  SLCGPV+D VKL+SVR P R L
Sbjct  320  KGKGGFKTAKLQFKAVSTHTRIMFLSSFYTMKSDNSGSLCGPVLDDVKLISVRQPRRLL  378


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            P+ T  NLLKN +FEEGPYVFP  D GVL PP  EDDH P
Sbjct  195  PKRTRGNLLKNGNFEEGPYVFPNTDWGVLIPPHIEDDHSP  234



>ref|XP_011081171.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105164253 
[Sesamum indicum]
Length=373

 Score =   194 bits (494),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 111/145 (77%), Gaps = 3/145 (2%)
 Frame = -1

Query  582  LPAWTVESLKAVKYIDAEHFSVPHGRRAVELVA---GKESAVTQIARTVAGKFYDLTFLV  412
            LP W +ESLKAVKYID++HF VP G+RAVELVA   G+E A+ Q  RTV GK YDL F +
Sbjct  228  LPGWMIESLKAVKYIDSDHFGVPEGKRAVELVAVGKGRERALAQTVRTVPGKTYDLIFSI  287

Query  411  GDASNKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTR  232
            GDA N CEGSM++EA AG   L+VPYESKG GG+K AKLRF+A + RTR+ F STYYH +
Sbjct  288  GDAKNSCEGSMMVEATAGKVILQVPYESKGAGGFKRAKLRFKAISTRTRIRFLSTYYHMK  347

Query  231  SDDFVSLCGPVVDFVKLVSVRNPHR  157
            SD+  SLCGPV+D VKLV VR P R
Sbjct  348  SDNSGSLCGPVIDDVKLVGVRRPGR  372


 Score = 52.4 bits (124),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            P+    N+LKN +FEEGPY+FP    GVL PP  EDDH P
Sbjct  188  PKRQRGNMLKNGNFEEGPYIFPNTSWGVLIPPNIEDDHSP  227



>gb|KJB68131.1| hypothetical protein B456_010G227400 [Gossypium raimondii]
Length=374

 Score =   194 bits (493),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 86/142 (61%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = -1

Query  582  LPAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDA  403
            LP W ++SLKAVKYID++HF+VP G+RA+EL+AGKES+++Q+ RT  G  Y L+F +GDA
Sbjct  232  LPGWIIDSLKAVKYIDSDHFTVPEGKRAIELIAGKESSLSQVVRTTIGGDYVLSFTIGDA  291

Query  402  SNKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDD  223
            +N CEGSMV+EAFA  +T+KV Y+SKG+GG+K A+LRF+A + RTR+MF+ST+Y  ++D+
Sbjct  292  NNACEGSMVVEAFANKNTVKVTYDSKGKGGFKQARLRFKADSTRTRIMFYSTFYTMKNDN  351

Query  222  FVSLCGPVVDFVKLVSVRNPHR  157
              SLCGPVVD VKLVS+R  H 
Sbjct  352  SGSLCGPVVDDVKLVSIRKLHH  373


 Score = 52.8 bits (125),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 29/41 (71%), Gaps = 1/41 (2%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPK-VDTGVLCPPFTEDDHFP  585
            P+ T VNLLKN +FEEGPY+F   +  GV+ PP  EDDH P
Sbjct  191  PKRTRVNLLKNGNFEEGPYIFAGPISEGVIIPPHIEDDHSP  231



>gb|AFK48067.1| unknown [Lotus japonicus]
Length=204

 Score =   190 bits (482),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/142 (63%), Positives = 112/142 (79%), Gaps = 0/142 (0%)
 Frame = -1

Query  582  LPAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDA  403
            LP W VESLKAVKYID+ HF+VP G+RAVELVAGKES + Q  +T  GK Y LTF VGDA
Sbjct  62   LPGWMVESLKAVKYIDSNHFAVPAGKRAVELVAGKESVIAQNVKTTIGKVYVLTFAVGDA  121

Query  402  SNKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDD  223
            +N CEGSMV+EAFAG  T++VPY+SKG+GG+   KLRF+A + RTRV F ST+Y  ++D+
Sbjct  122  NNSCEGSMVVEAFAGGDTVQVPYQSKGKGGFVRGKLRFKAVSARTRVRFLSTFYTMKNDN  181

Query  222  FVSLCGPVVDFVKLVSVRNPHR  157
              SLCGP++D ++L+SVR P R
Sbjct  182  SGSLCGPIIDDIRLLSVRYPGR  203


 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR T  NLLKN +FEEGPY+FP    GVL PP  ED H P
Sbjct  22   PRRTRDNLLKNGNFEEGPYMFPNTSWGVLIPPHIEDAHSP  61



>ref|XP_011040006.1| PREDICTED: uncharacterized protein LOC105136392 [Populus euphratica]
Length=396

 Score =   192 bits (489),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 89/144 (62%), Positives = 111/144 (77%), Gaps = 0/144 (0%)
 Frame = -1

Query  582  LPAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDA  403
            LP W V+SLKAVKYID++HF+VP G+RAVELVAGKESA++Q+ +T   K Y LTF VGD 
Sbjct  252  LPGWMVDSLKAVKYIDSDHFTVPEGKRAVELVAGKESAISQVVKTTISKIYALTFSVGDT  311

Query  402  SNKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDD  223
            SN C GSMV+E +AG    +VPYES G+GG+K AK  F+A +N TR+ F S++Y  +SD+
Sbjct  312  SNSCVGSMVVEVYAGKDKTQVPYESNGKGGFKHAKFVFKAISNHTRITFLSSFYSMKSDN  371

Query  222  FVSLCGPVVDFVKLVSVRNPHRRL  151
              SLCGPV+D VKLVSVRNP R L
Sbjct  372  SGSLCGPVLDDVKLVSVRNPRRHL  395


 Score = 53.9 bits (128),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            P+    NLLKN +FEEGPYVFP  D GVL PP  EDDH P
Sbjct  212  PKRPKDNLLKNGNFEEGPYVFPSTDWGVLVPPNIEDDHCP  251



>ref|XP_007023946.1| Uncharacterized protein TCM_028364 [Theobroma cacao]
 gb|EOY26568.1| Uncharacterized protein TCM_028364 [Theobroma cacao]
Length=372

 Score =   195 bits (495),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 98/177 (55%), Positives = 126/177 (71%), Gaps = 1/177 (1%)
 Frame = -1

Query  687  ELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVPHG  508
             L+K   F  GP   P       +P  H       LP W +ESLKAVKYID+EHFSVP G
Sbjct  196  NLLKNGNFEEGPYIFPNTSWGVLIPP-HIEDDHSPLPGWIIESLKAVKYIDSEHFSVPEG  254

Query  507  RRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPYES  328
            +RA+ELVAGKESA+ Q+ +T  G+ Y L+F VGDA+N CEGSMV+EAFAG +T+K  Y+S
Sbjct  255  KRAIELVAGKESALAQVVKTTIGRSYVLSFTVGDANNACEGSMVVEAFAGKNTVKASYQS  314

Query  327  KGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNPHR  157
            KG+GG+K A L F+A ++RTR+MF+ST+Y  +SD+  SLCGPV+D VKL+SVR  H 
Sbjct  315  KGKGGFKRAILAFKAESSRTRIMFYSTFYTMKSDNSGSLCGPVLDDVKLLSVRKLHH  371


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            P+ T  NLLKN +FEEGPY+FP    GVL PP  EDDH P
Sbjct  190  PKRTPANLLKNGNFEEGPYIFPNTSWGVLIPPHIEDDHSP  229



>ref|XP_004252488.1| PREDICTED: uncharacterized protein LOC101250580 [Solanum lycopersicum]
Length=380

 Score =   195 bits (495),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 92/140 (66%), Positives = 111/140 (79%), Gaps = 0/140 (0%)
 Frame = -1

Query  582  LPAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDA  403
            LP W VESLKAVKY+DA+HF+VP G+RA+ELVAG+ESA+ Q   T  G+ YDL F VGDA
Sbjct  238  LPGWIVESLKAVKYVDADHFTVPEGKRAIELVAGRESAIAQQVITKTGRIYDLIFSVGDA  297

Query  402  SNKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDD  223
            +N CEGSMV+EAFAG   L+  Y SKG+GG+K AKLRF A + RTRV F S+YYH +SD+
Sbjct  298  NNACEGSMVVEAFAGNVALQFQYVSKGKGGFKRAKLRFTAMSQRTRVRFLSSYYHMKSDN  357

Query  222  FVSLCGPVVDFVKLVSVRNP  163
              SLCGPV+D V+LVSVRNP
Sbjct  358  SGSLCGPVIDDVRLVSVRNP  377


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -2

Query  686  NLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            N+LKN +FEEGPY+FP    GVL PP  EDDH P
Sbjct  204  NMLKNGNFEEGPYIFPNTSWGVLIPPNIEDDHCP  237



>ref|XP_009764126.1| PREDICTED: uncharacterized protein LOC104215887 [Nicotiana sylvestris]
Length=379

 Score =   194 bits (493),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 94/140 (67%), Positives = 111/140 (79%), Gaps = 0/140 (0%)
 Frame = -1

Query  582  LPAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDA  403
            LP W +ESLKAVKY+DAEHF+VP G+RAVELVAG+ESA+ Q   T AGK YDL F VGDA
Sbjct  237  LPGWIIESLKAVKYVDAEHFTVPEGKRAVELVAGRESALAQQVITKAGKIYDLIFTVGDA  296

Query  402  SNKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDD  223
            +N CEGSM++EAFAG   L+V Y SKG+GG+K AKLRF A + RT V F ST YH +SD+
Sbjct  297  NNSCEGSMLIEAFAGKVALQVRYMSKGKGGFKRAKLRFTAISRRTGVRFLSTNYHMKSDN  356

Query  222  FVSLCGPVVDFVKLVSVRNP  163
              SLCGPV+D V+LVSVRNP
Sbjct  357  SGSLCGPVIDDVRLVSVRNP  376


 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -2

Query  686  NLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            N+LKN +FEEGPY+FP  + G+L PP  EDDH P
Sbjct  203  NMLKNGNFEEGPYIFPNTNWGILIPPNIEDDHCP  236



>ref|XP_004486698.1| PREDICTED: uncharacterized protein LOC101495368 [Cicer arietinum]
Length=373

 Score =   194 bits (492),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 100/182 (55%), Positives = 123/182 (68%), Gaps = 9/182 (5%)
 Frame = -1

Query  687  ELVKKLGF*GGPIRVPQGRHRRSLPA----VHGGRPLPRLPAWTVESLKAVKYIDAEHFS  520
             L+K   F  GP   P       +P      HG      LP W VESLKAVKYID++HF 
Sbjct  196  NLLKNGNFEEGPYVFPNASWGVLIPPHIEDAHG-----PLPGWIVESLKAVKYIDSKHFY  250

Query  519  VPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKV  340
            VP G RA+ELVAGKESA+ Q+  T  GK YDLTF VGDA+N CEGSM +EAFAG  T++V
Sbjct  251  VPEGNRAIELVAGKESALAQVVITTIGKVYDLTFSVGDANNSCEGSMTVEAFAGGDTVQV  310

Query  339  PYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNPH  160
            PYESKG+GG+   KLRF A + RTR+ F ST+Y  ++D+  SLCGPV+D VKL+SVR P+
Sbjct  311  PYESKGKGGFVRGKLRFTALSTRTRIRFLSTFYTMKNDNSGSLCGPVIDDVKLLSVRYPN  370

Query  159  RR  154
            + 
Sbjct  371  KH  372


 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR T  NLLKN +FEEGPYVFP    GVL PP  ED H P
Sbjct  190  PRRTRANLLKNGNFEEGPYVFPNASWGVLIPPHIEDAHGP  229



>gb|EMT16005.1| hypothetical protein F775_13621 [Aegilops tauschii]
Length=340

 Score =   193 bits (490),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 100/176 (57%), Positives = 129/176 (73%), Gaps = 2/176 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
             + LVK   F  GP  +P  +    +P+       P LP W VESLKAVKYID++HF+VP
Sbjct  159  NKNLVKNGDFEEGPYIIPGTKWGVLIPSRMVDEHSP-LPGWMVESLKAVKYIDSDHFAVP  217

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             GRRAVEL+AG+ESA+ Q+ RTV G+ Y L+F VG+ASN C GS+++EA+AG  + KVPY
Sbjct  218  RGRRAVELLAGRESAIAQVIRTVPGRQYALSFSVGNASNTCRGSLMVEAYAGRESTKVPY  277

Query  333  ESKGQGG-YKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  169
            ES GQGG  K A L FRAT++RTRV+FFS++Y+TR+DD  SLCGPV+D V +VSVR
Sbjct  278  ESAGQGGAAKRAVLPFRATSSRTRVVFFSSFYNTRTDDMSSLCGPVIDDVAVVSVR  333


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 26/40 (65%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR TN NL+KN DFEEGPY+ P    GVL P    D+H P
Sbjct  155  PRRTNKNLVKNGDFEEGPYIIPGTKWGVLIPSRMVDEHSP  194



>gb|KHN44154.1| hypothetical protein glysoja_031815 [Glycine soja]
Length=374

 Score =   193 bits (490),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/140 (64%), Positives = 114/140 (81%), Gaps = 0/140 (0%)
 Frame = -1

Query  582  LPAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDA  403
            LP W VESLKAVKYID++HF+VP G+RA+ELVAGKESA+ Q+  T  GK YDLTF VGDA
Sbjct  232  LPGWIVESLKAVKYIDSDHFAVPEGKRAIELVAGKESALAQVVITTIGKTYDLTFAVGDA  291

Query  402  SNKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDD  223
            +N+CE SM++EAFAG +T++VPY+SKG+GG+   KLRF+A + RTR+ F ST+Y  +SD+
Sbjct  292  NNECEASMMVEAFAGANTVQVPYQSKGKGGFVRGKLRFKAVSTRTRLRFLSTFYTMKSDN  351

Query  222  FVSLCGPVVDFVKLVSVRNP  163
              SLCGPV+D VKL+ VR P
Sbjct  352  SGSLCGPVIDDVKLLGVRYP  371


 Score = 50.8 bits (120),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 25/40 (63%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            P+ T  NLLKN + EEGPY+FP    G L PP  ED H P
Sbjct  192  PKRTRANLLKNGNLEEGPYIFPNSSWGALIPPHIEDSHGP  231



>ref|XP_002303263.1| hypothetical protein POPTR_0003s05850g [Populus trichocarpa]
 gb|EEE78242.1| hypothetical protein POPTR_0003s05850g [Populus trichocarpa]
Length=374

 Score =   193 bits (490),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 97/181 (54%), Positives = 122/181 (67%), Gaps = 1/181 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
            +  L+K   F  GP   P       +P        P LP W V+SLKAVKYID++HF+VP
Sbjct  194  KDNLLKNGNFEEGPYVFPNADWGVLVPPNIEDDHCP-LPGWMVDSLKAVKYIDSDHFTVP  252

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             G+RAVELVAGKESA++Q+ +T   K Y LTF VGD SN C GSMV+E +AG    +VPY
Sbjct  253  EGKRAVELVAGKESAISQVVKTTISKIYALTFSVGDTSNSCVGSMVVEVYAGKDKTQVPY  312

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNPHRR  154
            ES G+GG+K AK  F+A +N TR+ F S++Y  +SD+  SLCGPV+D VKLVSVRNP R 
Sbjct  313  ESNGKGGFKHAKFVFKAISNHTRITFLSSFYTMKSDNSGSLCGPVLDDVKLVSVRNPRRH  372

Query  153  L  151
            L
Sbjct  373  L  373


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            P+    NLLKN +FEEGPYVFP  D GVL PP  EDDH P
Sbjct  190  PKRPKDNLLKNGNFEEGPYVFPNADWGVLVPPNIEDDHCP  229



>dbj|BAD16016.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD38436.1| unknown protein [Oryza sativa Japonica Group]
Length=302

 Score =   191 bits (484),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 101/176 (57%), Positives = 127/176 (72%), Gaps = 2/176 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
             + LVK   F  GP  +P  R    +P++      P LP W VESLKAVKYID++HF+VP
Sbjct  119  NKNLVKNGDFEEGPYIIPGTRWGVLIPSMVVDEHSP-LPGWMVESLKAVKYIDSDHFAVP  177

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             GRRAVEL+AG+ESA+ Q+ RTV G+ Y L+F VGDASN CEGS+V+EA+AG  + +V +
Sbjct  178  RGRRAVELLAGRESAIAQVIRTVPGRQYALSFTVGDASNGCEGSLVVEAYAGRESTRVAH  237

Query  333  ESKGQGG-YKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  169
            ES G+GG  K A L FRA A RTRV+FFS++Y TRSDD  SLCGPV+D V +VSVR
Sbjct  238  ESAGRGGAAKRAVLPFRAAAARTRVVFFSSFYSTRSDDMSSLCGPVIDDVAVVSVR  293


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 26/40 (65%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR TN NL+KN DFEEGPY+ P    GVL P    D+H P
Sbjct  115  PRRTNKNLVKNGDFEEGPYIIPGTRWGVLIPSMVVDEHSP  154



>ref|XP_009333642.1| PREDICTED: uncharacterized protein LOC103926567 [Pyrus x bretschneideri]
Length=373

 Score =   186 bits (473),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/138 (64%), Positives = 108/138 (78%), Gaps = 0/138 (0%)
 Frame = -1

Query  582  LPAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDA  403
            LP W +ESLKAVKYID++HFSVP GRRA+ELVAGKESA+ Q+  T+ GK Y LTF VGD+
Sbjct  233  LPGWIIESLKAVKYIDSKHFSVPEGRRAIELVAGKESALAQVVFTLPGKLYALTFTVGDS  292

Query  402  SNKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDD  223
            +N CEGS+ +EAFAG  TLKV Y+SKGQGG+K A+  F A   RTRVMF+S +Y   +D 
Sbjct  293  NNACEGSLAVEAFAGKDTLKVLYQSKGQGGFKRARFLFTAVGPRTRVMFYSMFYTMAADH  352

Query  222  FVSLCGPVVDFVKLVSVR  169
              SLCGPV+D VKL+SVR
Sbjct  353  SGSLCGPVIDDVKLLSVR  370


 Score = 57.0 bits (136),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            P+ T  NLLKN +FEEGPYVFP    GVL PP  EDDH P
Sbjct  193  PKRTRANLLKNGNFEEGPYVFPNTSWGVLIPPHIEDDHSP  232



>ref|XP_007218161.1| hypothetical protein PRUPE_ppa007461mg [Prunus persica]
 gb|EMJ19360.1| hypothetical protein PRUPE_ppa007461mg [Prunus persica]
Length=291

 Score =   190 bits (482),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 92/172 (53%), Positives = 124/172 (72%), Gaps = 1/172 (1%)
 Frame = -1

Query  687  ELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVPHG  508
             LV+  GF   P R+    H   LP        P LP W +ESLKAVK+ID++HF+VP G
Sbjct  120  NLVRNPGFEEAPHRLFNSSHGVLLPPKQLDVTSP-LPGWIIESLKAVKFIDSQHFNVPFG  178

Query  507  RRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPYES  328
            + AVELVAG+ESA+ Q+ RTV  K YDL+F+VGDA N C GSM++EAFAG  TLKVP+ S
Sbjct  179  KGAVELVAGRESAIAQVLRTVPNKIYDLSFVVGDARNGCHGSMMVEAFAGKDTLKVPFTS  238

Query  327  KGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  172
            +G+GG+K A L+F+A + RTR+ F+S++YHTR DD+ +LCGP++D V++  V
Sbjct  239  QGKGGFKAASLKFKAASPRTRITFYSSFYHTRVDDYGALCGPILDQVRVYPV  290



>ref|XP_002298115.2| hypothetical protein POPTR_0001s17430g [Populus trichocarpa]
 gb|EEE82920.2| hypothetical protein POPTR_0001s17430g [Populus trichocarpa]
Length=389

 Score =   192 bits (489),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 98/179 (55%), Positives = 120/179 (67%), Gaps = 1/179 (1%)
 Frame = -1

Query  687  ELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVPHG  508
             L+K   F  GP   P       +P        P LP W V+SLKAVKYID EHF+VP G
Sbjct  212  NLLKNGNFEEGPYMFPNTDWGVLIPPHIEDDQCP-LPGWIVDSLKAVKYIDREHFTVPEG  270

Query  507  RRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPYES  328
            +RAVELVAGKESA++Q  +T+  K Y LTF VGD SN C GSMV+E +AG    +VPYES
Sbjct  271  KRAVELVAGKESAISQTVKTIINKIYVLTFYVGDTSNSCVGSMVVEVYAGKDRTQVPYES  330

Query  327  KGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNPHRRL  151
             G+GG+K AK  F+A +N TR+ F S++Y  +SD+  SLCGPV+D VKLVSVRNP R L
Sbjct  331  NGKGGFKRAKFVFKAVSNHTRITFLSSFYTMKSDNSGSLCGPVLDDVKLVSVRNPRRHL  389


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            P+    NLLKN +FEEGPY+FP  D GVL PP  EDD  P
Sbjct  206  PKRARDNLLKNGNFEEGPYMFPNTDWGVLIPPHIEDDQCP  245



>ref|XP_004307221.1| PREDICTED: uncharacterized protein LOC101292742 [Fragaria vesca 
subsp. vesca]
Length=368

 Score =   192 bits (487),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 92/172 (53%), Positives = 123/172 (72%), Gaps = 1/172 (1%)
 Frame = -1

Query  687  ELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVPHG  508
             LV+  GF   P R+    H   LP        P LP W +ESLKAVK+IDA+HF+VP G
Sbjct  197  NLVRNPGFEEAPHRLMNSSHGVLLPPKQLDATSP-LPGWIIESLKAVKFIDAKHFNVPFG  255

Query  507  RRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPYES  328
            + AVELVAG+ESA+ Q+ RTV  K Y L+F +GDA N C GSM++EAFAG  TLKVP+ S
Sbjct  256  KGAVELVAGRESAIAQVLRTVPNKLYSLSFTIGDARNGCHGSMMVEAFAGKDTLKVPFNS  315

Query  327  KGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  172
            +G+GG+K A  +F+AT+ RTR+ FFS++YHTR+DD+ +LCGP++D VK+  +
Sbjct  316  QGKGGFKNASFKFKATSFRTRITFFSSFYHTRTDDYGALCGPILDEVKVSPI  367



>ref|XP_010534242.1| PREDICTED: uncharacterized protein LOC104809851 [Tarenaya hassleriana]
Length=365

 Score =   192 bits (487),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 96/172 (56%), Positives = 119/172 (69%), Gaps = 1/172 (1%)
 Frame = -1

Query  687  ELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVPHG  508
             LV+  GF  GP R+        LP        P LP W +ESLKAVK+ID++HF+VP+G
Sbjct  194  NLVRNPGFEEGPHRLVNSTGGVLLPPKQEDSTSP-LPGWIIESLKAVKFIDSKHFNVPYG  252

Query  507  RRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPYES  328
              A+ELVAGKESA+ Q+ RTV  K Y L+F VGDA N C GSMV+EAFAG  TLKVP+ S
Sbjct  253  EAAIELVAGKESAIAQVIRTVPNKVYSLSFAVGDARNGCHGSMVVEAFAGKDTLKVPHNS  312

Query  327  KGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  172
             G G YK A L+F+A   RTR+ FFSTYYHT+ DDF SLCGP++D +++V V
Sbjct  313  VGAGHYKTASLKFKALEARTRITFFSTYYHTKKDDFGSLCGPIIDDIRVVPV  364



>gb|KJB70570.1| hypothetical protein B456_011G080200 [Gossypium raimondii]
Length=203

 Score =   186 bits (473),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 85/142 (60%), Positives = 110/142 (77%), Gaps = 0/142 (0%)
 Frame = -1

Query  582  LPAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDA  403
            LP W +ESLKA+KYID+EH SVP G+ A+EL+AGKESAV QI +T  G+ Y L+F+VGDA
Sbjct  61   LPGWIIESLKAIKYIDSEHLSVPQGKWAIELIAGKESAVAQIVKTTIGRNYVLSFVVGDA  120

Query  402  SNKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDD  223
            +N CEG M++EAFAG + + V Y SKG+GG+K A+L FRA + RTR+MF+ST Y  +SD+
Sbjct  121  NNGCEGPMMVEAFAGKNMVMVSYNSKGKGGFKAARLAFRAESTRTRIMFYSTIYTIKSDN  180

Query  222  FVSLCGPVVDFVKLVSVRNPHR  157
              SLCGPV+D V L+SVR  H 
Sbjct  181  SGSLCGPVLDDVMLLSVRKLHH  202



>ref|XP_011466738.1| PREDICTED: uncharacterized protein LOC101306247 isoform X2 [Fragaria 
vesca subsp. vesca]
 ref|XP_011466739.1| PREDICTED: uncharacterized protein LOC101306247 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=333

 Score =   185 bits (469),  Expect(2) = 6e-55, Method: Compositional matrix adjust.
 Identities = 88/138 (64%), Positives = 108/138 (78%), Gaps = 0/138 (0%)
 Frame = -1

Query  582  LPAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDA  403
            LP W +ESLKAVKYID++HF+VP GRRA+EL+AGKESA+ Q+  T  G+ Y LTF VGD 
Sbjct  191  LPGWIIESLKAVKYIDSKHFAVPEGRRAIELIAGKESALAQVVFTKPGRRYTLTFSVGDG  250

Query  402  SNKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDD  223
            +N CEGS+ +EAFAG  T+KVPYESKG+GG+K A+L F A + RTRVMF ST Y   SD 
Sbjct  251  NNGCEGSLFIEAFAGKETVKVPYESKGKGGFKKARLFFTAVSPRTRVMFLSTMYTMTSDH  310

Query  222  FVSLCGPVVDFVKLVSVR  169
              SLCGPV+D VKL+S+R
Sbjct  311  SGSLCGPVIDDVKLLSIR  328


 Score = 57.0 bits (136),  Expect(2) = 6e-55, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            P+ T  NLLKN +FEEGPYVFP    GVL PP  EDDH P
Sbjct  151  PKRTRANLLKNGNFEEGPYVFPNTSWGVLIPPHIEDDHSP  190



>ref|XP_011466736.1| PREDICTED: uncharacterized protein LOC101306247 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=373

 Score =   185 bits (469),  Expect(2) = 6e-55, Method: Compositional matrix adjust.
 Identities = 88/138 (64%), Positives = 108/138 (78%), Gaps = 0/138 (0%)
 Frame = -1

Query  582  LPAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDA  403
            LP W +ESLKAVKYID++HF+VP GRRA+EL+AGKESA+ Q+  T  G+ Y LTF VGD 
Sbjct  231  LPGWIIESLKAVKYIDSKHFAVPEGRRAIELIAGKESALAQVVFTKPGRRYTLTFSVGDG  290

Query  402  SNKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDD  223
            +N CEGS+ +EAFAG  T+KVPYESKG+GG+K A+L F A + RTRVMF ST Y   SD 
Sbjct  291  NNGCEGSLFIEAFAGKETVKVPYESKGKGGFKKARLFFTAVSPRTRVMFLSTMYTMTSDH  350

Query  222  FVSLCGPVVDFVKLVSVR  169
              SLCGPV+D VKL+S+R
Sbjct  351  SGSLCGPVIDDVKLLSIR  368


 Score = 57.0 bits (136),  Expect(2) = 6e-55, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            P+ T  NLLKN +FEEGPYVFP    GVL PP  EDDH P
Sbjct  191  PKRTRANLLKNGNFEEGPYVFPNTSWGVLIPPHIEDDHSP  230



>ref|XP_010061944.1| PREDICTED: uncharacterized protein LOC104449472 [Eucalyptus grandis]
 gb|KCW68990.1| hypothetical protein EUGRSUZ_F02553 [Eucalyptus grandis]
Length=372

 Score =   191 bits (485),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 98/174 (56%), Positives = 122/174 (70%), Gaps = 1/174 (1%)
 Frame = -1

Query  687  ELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVPHG  508
             LVK   F  GP   P+      +P  H       LP W +ESLKAVK++D++HF+VP G
Sbjct  196  NLVKNGNFEEGPYVPPKTSWGVLIPP-HIEDDHSPLPGWIIESLKAVKFVDSDHFAVPEG  254

Query  507  RRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPYES  328
            +RAVELVAGKESA+ Q+  T  GK Y LTF VGDA N CEGSM +EA+AG +++ VPY S
Sbjct  255  KRAVELVAGKESAIAQVVSTQRGKVYVLTFAVGDAKNSCEGSMAVEAYAGTASVTVPYTS  314

Query  327  KGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRN  166
             G+GGY  AKLRF AT++RTRV F S+YY+ +SD   SLCGPV+D V+LVSVRN
Sbjct  315  TGKGGYVHAKLRFTATSDRTRVRFLSSYYNMQSDHSGSLCGPVIDDVRLVSVRN  368


 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            P+ TN NL+KN +FEEGPYV PK   GVL PP  EDDH P
Sbjct  190  PKRTNANLVKNGNFEEGPYVPPKTSWGVLIPPHIEDDHSP  229



>ref|XP_008228640.1| PREDICTED: uncharacterized protein LOC103328032 [Prunus mume]
Length=375

 Score =   182 bits (463),  Expect(2) = 9e-55, Method: Compositional matrix adjust.
 Identities = 87/138 (63%), Positives = 106/138 (77%), Gaps = 0/138 (0%)
 Frame = -1

Query  582  LPAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDA  403
            LP W +ESLKAVKYID+ HF+VP G+RA+ELVAGKESA+ Q+  T  G+ Y LTF VGD+
Sbjct  234  LPGWIIESLKAVKYIDSNHFAVPEGQRAIELVAGKESALAQVVFTKPGRLYALTFSVGDS  293

Query  402  SNKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDD  223
             N CEGS+V+EAFAG  TLKVPYES G+GG+K A+L F A    TRVMF S++Y   +D 
Sbjct  294  KNSCEGSLVVEAFAGKDTLKVPYESMGKGGFKRARLLFTAVETHTRVMFLSSFYTMSADH  353

Query  222  FVSLCGPVVDFVKLVSVR  169
              SLCGPV+D VKL+SVR
Sbjct  354  SGSLCGPVIDDVKLLSVR  371


 Score = 58.5 bits (140),  Expect(2) = 9e-55, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            P+ T  NLLKN DFEEGPYVFP    GVL PP  EDDH P
Sbjct  194  PKRTRANLLKNGDFEEGPYVFPNTSWGVLIPPHIEDDHSP  233



>gb|EYU24667.1| hypothetical protein MIMGU_mgv1a008541mg [Erythranthe guttata]
Length=370

 Score =   191 bits (484),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 95/177 (54%), Positives = 122/177 (69%), Gaps = 1/177 (1%)
 Frame = -1

Query  687  ELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVPHG  508
             ++K   F  GP   P  +    +P        P LP W +ESLKAVKYID+++F VP G
Sbjct  194  NMLKNGNFEAGPYIFPNTKWGVLIPPNIEDDHSP-LPGWMIESLKAVKYIDSDNFRVPEG  252

Query  507  RRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPYES  328
            +RAVELV G+ES V Q+ RT   K YDL F VGD++NKCEGSM++ A+AG   L+VPYES
Sbjct  253  KRAVELVGGRESVVAQVVRTEPEKVYDLVFSVGDSNNKCEGSMMVVAYAGVDILQVPYES  312

Query  327  KGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNPHR  157
            KG GG+K A++RF+AT+ RTR+ F S YYH +SD+  SLCGPVVD V+LV +R P R
Sbjct  313  KGHGGFKSARMRFKATSTRTRIRFSSEYYHMKSDNSGSLCGPVVDDVRLVRIRYPSR  369


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 26/40 (65%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR    N+LKN +FE GPY+FP    GVL PP  EDDH P
Sbjct  188  PRRPRGNMLKNGNFEAGPYIFPNTKWGVLIPPNIEDDHSP  227



>gb|EEE56530.1| hypothetical protein OsJ_05823 [Oryza sativa Japonica Group]
Length=379

 Score =   191 bits (485),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 101/176 (57%), Positives = 127/176 (72%), Gaps = 2/176 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
             + LVK   F  GP  +P  R    +P++      P LP W VESLKAVKYID++HF+VP
Sbjct  196  NKNLVKNGDFEEGPYIIPGTRWGVLIPSMVVDEHSP-LPGWMVESLKAVKYIDSDHFAVP  254

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             GRRAVEL+AG+ESA+ Q+ RTV G+ Y L+F VGDASN CEGS+V+EA+AG  + +V +
Sbjct  255  RGRRAVELLAGRESAIAQVIRTVPGRQYALSFTVGDASNGCEGSLVVEAYAGRESTRVAH  314

Query  333  ESKGQGG-YKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  169
            ES G+GG  K A L FRA A RTRV+FFS++Y TRSDD  SLCGPV+D V +VSVR
Sbjct  315  ESAGRGGAAKRAVLPFRAAAARTRVVFFSSFYSTRSDDMSSLCGPVIDDVAVVSVR  370


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 26/40 (65%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR TN NL+KN DFEEGPY+ P    GVL P    D+H P
Sbjct  192  PRRTNKNLVKNGDFEEGPYIIPGTRWGVLIPSMVVDEHSP  231



>ref|XP_003597843.1| hypothetical protein MTR_2g103170 [Medicago truncatula]
 gb|AES68094.1| plant/F18G18-200 protein [Medicago truncatula]
Length=373

 Score =   191 bits (484),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 99/181 (55%), Positives = 123/181 (68%), Gaps = 9/181 (5%)
 Frame = -1

Query  687  ELVKKLGF*GGPIRVPQGRHRRSLPA----VHGGRPLPRLPAWTVESLKAVKYIDAEHFS  520
             L+K   F  GP   P       +P      HG      LP W VESLKAVKYID+EHF+
Sbjct  196  NLLKNGNFEEGPYVFPNASWGVLIPPHIEDAHG-----PLPGWIVESLKAVKYIDSEHFT  250

Query  519  VPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKV  340
            VP G+RA+ELVAGKESA+ Q   T  GK Y LTF VGDA+N CEGSM +EAFAG  T++V
Sbjct  251  VPEGKRAIELVAGKESALAQEVFTTIGKVYVLTFAVGDANNACEGSMTVEAFAGRDTVQV  310

Query  339  PYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNPH  160
            PY+SKG+GG+   KLRF+A+  RTR+ F ST+Y  ++D+  SLCGPV+D VKL+SVR P+
Sbjct  311  PYQSKGKGGFVRGKLRFKASTRRTRIRFLSTFYTMKNDNSGSLCGPVIDDVKLLSVRYPN  370

Query  159  R  157
             
Sbjct  371  N  371


 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 26/40 (65%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            P  T  NLLKN +FEEGPYVFP    GVL PP  ED H P
Sbjct  190  PIRTRANLLKNGNFEEGPYVFPNASWGVLIPPHIEDAHGP  229



>ref|XP_008347484.1| PREDICTED: uncharacterized protein LOC103410579 [Malus domestica]
Length=374

 Score =   191 bits (484),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 98/173 (57%), Positives = 120/173 (69%), Gaps = 1/173 (1%)
 Frame = -1

Query  687  ELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVPHG  508
             L+K   F  GP   P       +P  H       LP W +ESLKAVKYID+EHF VP G
Sbjct  199  NLLKNGNFEEGPYVSPNTSWGTLIPP-HIEDDHSPLPGWIIESLKAVKYIDSEHFFVPEG  257

Query  507  RRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPYES  328
            RRA+ELV GKESA+TQ+  T  GK Y LTF VGD++N CEGS+V+EAFAG  TLKVPY+S
Sbjct  258  RRAIELVTGKESALTQVVFTKPGKLYALTFSVGDSNNSCEGSLVVEAFAGKDTLKVPYQS  317

Query  327  KGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  169
            KG+GG+K A+L F A   RTR+MF+ST+Y   +D   SLCGP++D VKL+SVR
Sbjct  318  KGKGGFKRARLIFTAVGPRTRIMFYSTFYTMVADHSGSLCGPIIDDVKLLSVR  370


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 26/40 (65%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            P+ T  NLLKN +FEEGPYV P    G L PP  EDDH P
Sbjct  193  PKRTRANLLKNGNFEEGPYVSPNTSWGTLIPPHIEDDHSP  232



>gb|EEC72709.1| hypothetical protein OsI_06304 [Oryza sativa Indica Group]
Length=379

 Score =   191 bits (484),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 101/176 (57%), Positives = 127/176 (72%), Gaps = 2/176 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
             + LVK   F  GP  +P  R    +P++      P LP W VESLKAVKYID++HF+VP
Sbjct  196  NKNLVKNGDFEEGPYIIPGTRWGVLIPSMVVDEHSP-LPGWMVESLKAVKYIDSDHFAVP  254

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             GRRAVEL+AG+ESA+ Q+ RTV G+ Y L+F VGDASN CEGS+V+EA+AG  + +V +
Sbjct  255  RGRRAVELLAGRESAIAQVIRTVPGRQYALSFTVGDASNGCEGSLVVEAYAGRESTRVAH  314

Query  333  ESKGQGG-YKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  169
            ES G+GG  K A L FRA A RTRV+FFS++Y TRSDD  SLCGPV+D V +VSVR
Sbjct  315  ESAGRGGAAKRAVLPFRAAAARTRVVFFSSFYSTRSDDMSSLCGPVIDDVAVVSVR  370


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 26/40 (65%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR TN NL+KN DFEEGPY+ P    GVL P    D+H P
Sbjct  192  PRRTNKNLVKNGDFEEGPYIIPGTRWGVLIPSMVVDEHSP  231



>ref|NP_001046247.2| Os02g0205200 [Oryza sativa Japonica Group]
 dbj|BAF08161.2| Os02g0205200, partial [Oryza sativa Japonica Group]
Length=365

 Score =   190 bits (483),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 101/176 (57%), Positives = 127/176 (72%), Gaps = 2/176 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
             + LVK   F  GP  +P  R    +P++      P LP W VESLKAVKYID++HF+VP
Sbjct  182  NKNLVKNGDFEEGPYIIPGTRWGVLIPSMVVDEHSP-LPGWMVESLKAVKYIDSDHFAVP  240

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             GRRAVEL+AG+ESA+ Q+ RTV G+ Y L+F VGDASN CEGS+V+EA+AG  + +V +
Sbjct  241  RGRRAVELLAGRESAIAQVIRTVPGRQYALSFTVGDASNGCEGSLVVEAYAGRESTRVAH  300

Query  333  ESKGQGG-YKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  169
            ES G+GG  K A L FRA A RTRV+FFS++Y TRSDD  SLCGPV+D V +VSVR
Sbjct  301  ESAGRGGAAKRAVLPFRAAAARTRVVFFSSFYSTRSDDMSSLCGPVIDDVAVVSVR  356


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 26/40 (65%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR TN NL+KN DFEEGPY+ P    GVL P    D+H P
Sbjct  178  PRRTNKNLVKNGDFEEGPYIIPGTRWGVLIPSMVVDEHSP  217



>ref|XP_007218160.1| hypothetical protein PRUPE_ppa007461mg [Prunus persica]
 gb|EMJ19359.1| hypothetical protein PRUPE_ppa007461mg [Prunus persica]
Length=367

 Score =   190 bits (482),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 92/172 (53%), Positives = 124/172 (72%), Gaps = 1/172 (1%)
 Frame = -1

Query  687  ELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVPHG  508
             LV+  GF   P R+    H   LP        P LP W +ESLKAVK+ID++HF+VP G
Sbjct  196  NLVRNPGFEEAPHRLFNSSHGVLLPPKQLDVTSP-LPGWIIESLKAVKFIDSQHFNVPFG  254

Query  507  RRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPYES  328
            + AVELVAG+ESA+ Q+ RTV  K YDL+F+VGDA N C GSM++EAFAG  TLKVP+ S
Sbjct  255  KGAVELVAGRESAIAQVLRTVPNKIYDLSFVVGDARNGCHGSMMVEAFAGKDTLKVPFTS  314

Query  327  KGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  172
            +G+GG+K A L+F+A + RTR+ F+S++YHTR DD+ +LCGP++D V++  V
Sbjct  315  QGKGGFKAASLKFKAASPRTRITFYSSFYHTRVDDYGALCGPILDQVRVYPV  366



>ref|XP_004149718.1| PREDICTED: uncharacterized protein LOC101216438 [Cucumis sativus]
 ref|XP_004164153.1| PREDICTED: uncharacterized LOC101216438 [Cucumis sativus]
 gb|KGN58580.1| hypothetical protein Csa_3G689790 [Cucumis sativus]
Length=368

 Score =   189 bits (481),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 95/173 (55%), Positives = 123/173 (71%), Gaps = 1/173 (1%)
 Frame = -1

Query  687  ELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVPHG  508
             LV+   F  GP R+    +   LP        P LP W +ESLKAVK+ID++HF+VP G
Sbjct  197  NLVRNPSFEVGPHRLVNSTNGVLLPPRQEDVTSP-LPGWIIESLKAVKFIDSKHFNVPVG  255

Query  507  RRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPYES  328
              A+ELVAG+ESAV QI RT+  K Y LTF VGDA N C GSM++EAFA   T+KVP++S
Sbjct  256  LAAIELVAGRESAVAQIIRTIPNKVYSLTFKVGDAKNGCHGSMMVEAFAAKETVKVPFQS  315

Query  327  KGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  169
            +G+G YK A L+F+AT+ RTR+ FFS+YYHTR+DDF SLCGPV+D V+++S  
Sbjct  316  QGKGLYKNAILKFKATSRRTRITFFSSYYHTRTDDFGSLCGPVLDDVRVISTN  368



>ref|XP_010241207.1| PREDICTED: uncharacterized protein LOC104585883 [Nelumbo nucifera]
Length=365

 Score =   189 bits (481),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 94/172 (55%), Positives = 119/172 (69%), Gaps = 1/172 (1%)
 Frame = -1

Query  687  ELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVPHG  508
             LV+  GF  GP  +    +   LP        P LP W +ESLKAVK+ID+ HF+VP+G
Sbjct  193  NLVRNGGFEEGPHLLKNSTNGVLLPPKQEDATSP-LPGWIIESLKAVKFIDSAHFNVPYG  251

Query  507  RRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPYES  328
              AVELVAGKESA+ Q+ RTV  K Y+LTF VGDA N C GSM +EAFAG  TLKVP+ES
Sbjct  252  SAAVELVAGKESAIAQVIRTVPNKLYNLTFTVGDARNGCHGSMSVEAFAGAETLKVPFES  311

Query  327  KGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  172
            KG+GG+K    +F+A   RTR+ FFS++YHTR DD+ SLCGP++D V++  V
Sbjct  312  KGKGGFKAVSFKFKAVGARTRITFFSSFYHTRVDDYGSLCGPILDQVRVFPV  363



>ref|XP_010257157.1| PREDICTED: uncharacterized protein LOC104597377 [Nelumbo nucifera]
Length=366

 Score =   189 bits (479),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 93/175 (53%), Positives = 122/175 (70%), Gaps = 1/175 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
            +  LVK  GF  GP  +    +   LP        P LP W +ESLKAVK+ID+ HF+VP
Sbjct  192  KDNLVKNSGFEEGPHLLQNSTNGVLLPPKQEDSTSP-LPGWIIESLKAVKFIDSAHFNVP  250

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
            +G +AVELVAG+ESA+ QI RTV  + Y ++F VGDA N C GSM++EAFA   TLKVPY
Sbjct  251  YGFKAVELVAGRESAIAQIIRTVPNRLYGVSFTVGDARNGCHGSMMVEAFAAKETLKVPY  310

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  169
            ES G+GG+K A  +F+A   RTR+ F+S++YHTR DD+ SLCGP++D V++V VR
Sbjct  311  ESHGKGGFKTASFKFKAIEPRTRITFYSSFYHTRVDDYGSLCGPILDQVRVVPVR  365



>gb|EYU21602.1| hypothetical protein MIMGU_mgv1a008411mg [Erythranthe guttata]
Length=374

 Score =   189 bits (480),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 88/142 (62%), Positives = 111/142 (78%), Gaps = 0/142 (0%)
 Frame = -1

Query  582  LPAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDA  403
            LP W +ESLKAVKY+D++H+ VP G+RAVELVAG+ESA+ QI +TV GK YDL FL+GDA
Sbjct  232  LPGWIIESLKAVKYVDSDHYGVPEGKRAVELVAGRESALAQIVKTVPGKTYDLYFLLGDA  291

Query  402  SNKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDD  223
             N CEG M +EA AG ++L+  YESKG GG++ +KLRF+A + RTRV F S  YH +SD+
Sbjct  292  KNSCEGMMTVEAAAGKNSLQFHYESKGAGGFQRSKLRFKAVSVRTRVRFLSMLYHMKSDN  351

Query  222  FVSLCGPVVDFVKLVSVRNPHR  157
              SLCGPV+D V+LV VRNP R
Sbjct  352  TGSLCGPVIDDVRLVGVRNPGR  373



>ref|XP_002453515.1| hypothetical protein SORBIDRAFT_04g007160 [Sorghum bicolor]
 gb|EES06491.1| hypothetical protein SORBIDRAFT_04g007160 [Sorghum bicolor]
Length=364

 Score =   188 bits (477),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 98/181 (54%), Positives = 126/181 (70%), Gaps = 5/181 (3%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPA--VHGGRPLPRLPAWTVESLKAVKYIDAEHFS  520
             + LVK   F  GP  +P  +    +P+  V    PLP    W VESLKA+KYID++ F+
Sbjct  186  NKNLVKNGDFEEGPYIIPGTKWGVLIPSRVVDDHSPLP---GWMVESLKAIKYIDSDSFA  242

Query  519  VPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKV  340
            VP GRRAVEL+AG+ESA+ Q+ RTV G+ Y L+F VGDASN C GS+++EA+AG  + KV
Sbjct  243  VPRGRRAVELLAGRESAIAQVIRTVPGRQYALSFTVGDASNACRGSLMVEAYAGRESTKV  302

Query  339  PYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNPH  160
             YES G+GG K A L FRA + RTR++FFS++Y TRSDD  SLCGPV+D V +VSVR   
Sbjct  303  AYESAGKGGVKRAVLPFRAASARTRLVFFSSFYSTRSDDLSSLCGPVLDDVAVVSVRTTK  362

Query  159  R  157
            R
Sbjct  363  R  363


 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 26/40 (65%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR TN NL+KN DFEEGPY+ P    GVL P    DDH P
Sbjct  182  PRRTNKNLVKNGDFEEGPYIIPGTKWGVLIPSRVVDDHSP  221



>gb|KHG21630.1| Adenosylhomocysteinase [Gossypium arboreum]
Length=374

 Score =   186 bits (472),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 85/141 (60%), Positives = 111/141 (79%), Gaps = 0/141 (0%)
 Frame = -1

Query  582  LPAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDA  403
            LP W +ESLKA+K+ID+EHFSVP G+RA+EL+AGKES V QI +T  G+ Y L+F+VGDA
Sbjct  232  LPGWIIESLKAIKHIDSEHFSVPQGKRAIELIAGKESTVVQIVKTSIGRNYLLSFVVGDA  291

Query  402  SNKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDD  223
            +N CEG M++EAFAG + + V Y SKG+GG+K A+L FRA + RTR+ F+ST Y  +SD+
Sbjct  292  NNGCEGPMMVEAFAGKNMVMVSYNSKGKGGFKAARLAFRAESTRTRITFYSTIYTIKSDN  351

Query  222  FVSLCGPVVDFVKLVSVRNPH  160
              SLCGPV+D VKL+SVR  H
Sbjct  352  SGSLCGPVLDDVKLLSVRKLH  372


 Score = 51.2 bits (121),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 28/41 (68%), Gaps = 1/41 (2%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPK-VDTGVLCPPFTEDDHFP  585
            P+ T  NLLKN +FEEGPY+FP     GV+ PP  EDDH P
Sbjct  191  PKRTRANLLKNGNFEEGPYIFPIPTSEGVIIPPEIEDDHSP  231



>ref|XP_009348421.1| PREDICTED: uncharacterized protein LOC103940075 [Pyrus x bretschneideri]
Length=374

 Score =   188 bits (477),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 95/173 (55%), Positives = 120/173 (69%), Gaps = 1/173 (1%)
 Frame = -1

Query  687  ELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVPHG  508
             L+K   F  GP  +P       +P  H       LP W +ESLKAVKYID++HF VP G
Sbjct  199  NLLKNGNFEEGPYVLPNASWGVLIPP-HIEDDHSPLPGWIIESLKAVKYIDSKHFFVPEG  257

Query  507  RRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPYES  328
            RRA+ELV GKESA+ Q+  T  GK Y LTF VGD++N CEGS+++EAFAG  TLKVPY+S
Sbjct  258  RRAIELVGGKESALAQVVFTKPGKLYALTFSVGDSNNACEGSLIVEAFAGKDTLKVPYQS  317

Query  327  KGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  169
            KG+GG+K A+L F A   RTR+MF+ST+Y   +D   SLCGP++D VKL+SVR
Sbjct  318  KGKGGFKRARLLFTAVGPRTRIMFYSTFYTMSADHSGSLCGPIIDDVKLLSVR  370


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            P+ T  NLLKN +FEEGPYV P    GVL PP  EDDH P
Sbjct  193  PKRTRANLLKNGNFEEGPYVLPNASWGVLIPPHIEDDHSP  232



>ref|XP_007052493.1| F17A17.37 protein [Theobroma cacao]
 gb|EOX96650.1| F17A17.37 protein [Theobroma cacao]
Length=385

 Score =   188 bits (477),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 93/172 (54%), Positives = 122/172 (71%), Gaps = 1/172 (1%)
 Frame = -1

Query  687  ELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVPHG  508
             LVK  GF  GP R+    +   LP        P LP W +ESLKAVK+ID++HF+VP G
Sbjct  214  NLVKNPGFEEGPHRLVNSTNGVLLPPRQEDSTSP-LPGWIIESLKAVKFIDSKHFNVPAG  272

Query  507  RRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPYES  328
            + AVELVAG+ESA+ QI RTV  + YDLTF++GDA N C G M++EAFA  +T+KVP+ S
Sbjct  273  KAAVELVAGRESAIAQILRTVPNQLYDLTFIIGDARNGCHGEMMVEAFADKNTVKVPFTS  332

Query  327  KGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  172
            +G+G +K A L+F+A   RTR+ FFS+YYHTR +DF SLCGPV+D V++  V
Sbjct  333  RGKGEFKTASLKFKAVTARTRITFFSSYYHTRINDFGSLCGPVLDEVRVSPV  384



>ref|XP_010539514.1| PREDICTED: uncharacterized protein LOC104813570 [Tarenaya hassleriana]
Length=365

 Score =   184 bits (467),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/139 (63%), Positives = 103/139 (74%), Gaps = 0/139 (0%)
 Frame = -1

Query  582  LPAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDA  403
            LP W VESLKAVKY+D  HF+VP G RA+ELV GKES+V QI RT   KFY LTF VGDA
Sbjct  224  LPGWIVESLKAVKYVDKAHFAVPEGHRAIELVGGKESSVAQIVRTTPNKFYKLTFAVGDA  283

Query  402  SNKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDD  223
             N CEG M +EAFAG   + V Y S G+GG KPA+L F+A + RTRV F ST+YHT+SD 
Sbjct  284  GNSCEGPMAVEAFAGRGRISVDYVSSGKGGSKPARLMFKAISARTRVTFLSTFYHTKSDH  343

Query  222  FVSLCGPVVDFVKLVSVRN  166
              SLCGPV+D V+LV VR+
Sbjct  344  SGSLCGPVIDDVRLVPVRS  362


 Score = 52.8 bits (125),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 31/44 (70%), Gaps = 2/44 (5%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDH--FPGF  579
            PR    N++KN +FEEGPYVFP V  GVL PPF EDD+   PG+
Sbjct  184  PRFLRNNMIKNGNFEEGPYVFPNVKWGVLIPPFIEDDNSALPGW  227



>gb|ABF99456.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAH00287.1| unnamed protein product [Oryza sativa Japonica Group]
Length=295

 Score =   185 bits (469),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 95/171 (56%), Positives = 117/171 (68%), Gaps = 1/171 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
            +  L+K  GF  GP           LP        P LP W +ESLKAV++IDA HFSVP
Sbjct  121  KDNLIKNEGFEIGPQVFKNSTVGVLLPPKQKDATSP-LPGWIIESLKAVRFIDAAHFSVP  179

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             G+ AVELVAG+ESA+ Q+ RTVA + Y+L+F+VGDA N C GSM++EAFAG  T KVP+
Sbjct  180  AGQYAVELVAGRESAIAQVIRTVANRAYNLSFVVGDAKNGCHGSMLVEAFAGNVTQKVPF  239

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKL  181
            ES G GG+KPA  RF A   RTRV F+S+YYHT+  D VSLCGPV+D VK+
Sbjct  240  ESVGNGGFKPASFRFVAAGVRTRVTFYSSYYHTKVSDGVSLCGPVLDQVKV  290



>ref|XP_006465391.1| PREDICTED: uncharacterized protein LOC102618171 [Citrus sinensis]
Length=374

 Score =   178 bits (452),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 85/138 (62%), Positives = 106/138 (77%), Gaps = 0/138 (0%)
 Frame = -1

Query  582  LPAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDA  403
            LP W +ESLKAVKYID +HFSVP GRRAVELVAGKESA+TQ+ +T   K Y L+F VGDA
Sbjct  230  LPGWIIESLKAVKYIDLKHFSVPEGRRAVELVAGKESALTQVVKTEVNKTYALSFAVGDA  289

Query  402  SNKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDD  223
             N C G++ +EA+AG   +KV Y SKG+GG+K A LRF+A + RTR+MF ST+Y+ +SD 
Sbjct  290  GNGCAGTLGVEAYAGRDNVKVTYASKGKGGFKKALLRFKAVSPRTRIMFLSTFYNMQSDS  349

Query  222  FVSLCGPVVDFVKLVSVR  169
              SLCGPV+D VKL+  R
Sbjct  350  SGSLCGPVIDDVKLLVAR  367


 Score = 57.8 bits (138),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            P+ T VN+LKN +FEEGPYVFP    GVL PP  EDDH P
Sbjct  190  PKRTGVNMLKNGNFEEGPYVFPNASWGVLIPPKIEDDHSP  229



>ref|XP_008377611.1| PREDICTED: uncharacterized protein LOC103440696 [Malus domestica]
Length=374

 Score =   187 bits (474),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 94/173 (54%), Positives = 120/173 (69%), Gaps = 1/173 (1%)
 Frame = -1

Query  687  ELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVPHG  508
             L+K   F  GP  +P       +P  H       LP W +ESLKAVKYID++HF VP G
Sbjct  199  NLLKNGNFEEGPYVLPNTSWGVLIPP-HIEDDHSPLPGWIIESLKAVKYIDSQHFFVPEG  257

Query  507  RRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPYES  328
            R+A+ELV GKESA+ Q+  T  GK Y LTF VGD++N CEGS+++EAFAG  TLKVPY+S
Sbjct  258  RKAIELVGGKESALAQVVFTKPGKLYALTFSVGDSNNACEGSLIVEAFAGKDTLKVPYQS  317

Query  327  KGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  169
            KG+GG+K A+L F A   RTR+MF+ST+Y   +D   SLCGP++D VKL+SVR
Sbjct  318  KGKGGFKRARLLFTAVGPRTRIMFYSTFYTMSADHSGSLCGPIIDDVKLLSVR  370


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            P+ T  NLLKN +FEEGPYV P    GVL PP  EDDH P
Sbjct  193  PKRTRANLLKNGNFEEGPYVLPNTSWGVLIPPHIEDDHSP  232



>emb|CDP07813.1| unnamed protein product [Coffea canephora]
Length=377

 Score =   187 bits (474),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 93/173 (54%), Positives = 118/173 (68%), Gaps = 1/173 (1%)
 Frame = -1

Query  687  ELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVPHG  508
             LVK   F  GP R+    H   LP     R  P LP W +ESLKAVK+IDA HF+VP G
Sbjct  205  NLVKNGDFEEGPYRLINSSHGVLLPPSQEDRTSP-LPGWIIESLKAVKFIDAMHFNVPSG  263

Query  507  RRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPYES  328
            R A+EL+ G+ES + QI RTV  K Y+LTF VGD  N C GSM++EAFA  STLKVP++S
Sbjct  264  RAAIELLGGRESVIAQIIRTVPNKEYNLTFSVGDGKNGCHGSMMVEAFAAKSTLKVPFQS  323

Query  327  KGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  169
             G+G YK    +F A + RTR+ FFS++YHT+ DD+ +LCGPV+D VK+V+ R
Sbjct  324  VGKGQYKTVSFKFTAISARTRLTFFSSFYHTKIDDYGALCGPVLDNVKVVTAR  376



>ref|XP_008231461.1| PREDICTED: uncharacterized protein LOC103330638 [Prunus mume]
Length=454

 Score =   188 bits (478),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 91/172 (53%), Positives = 124/172 (72%), Gaps = 1/172 (1%)
 Frame = -1

Query  687  ELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVPHG  508
             LV+  GF   P R+    H   LP        P LP W +ESLKAVK+ID++HF+VP G
Sbjct  283  NLVRNPGFEEAPHRLFNSSHGVLLPPKQLDVTSP-LPGWIIESLKAVKFIDSQHFNVPFG  341

Query  507  RRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPYES  328
            + AVELVAG+ESA+ Q+ RTV  K Y+L+F+VGDA N C GSM++EAFAG  TLKVP+ S
Sbjct  342  KGAVELVAGRESAIAQVLRTVPNKIYNLSFVVGDARNGCHGSMMVEAFAGKDTLKVPFTS  401

Query  327  KGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  172
            +G+GG+K A L+F+A + RTR+ F+S++YHTR DD+ +LCGP++D V++  V
Sbjct  402  QGKGGFKAASLKFKAASPRTRITFYSSFYHTRVDDYGALCGPILDQVRVYPV  453



>gb|KJB24990.1| hypothetical protein B456_004G171200 [Gossypium raimondii]
Length=385

 Score =   186 bits (473),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 93/172 (54%), Positives = 120/172 (70%), Gaps = 1/172 (1%)
 Frame = -1

Query  687  ELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVPHG  508
             LVK  GF  GP R+    +   LP        P LP W +ESLKAVK+IDA+HF+VP G
Sbjct  214  NLVKNNGFEEGPHRLVNSTNGVLLPPRQEDFTSP-LPGWIIESLKAVKFIDAKHFNVPAG  272

Query  507  RRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPYES  328
              AVELVAG+ESA+ QI RT+  K Y++TF++GDA N C G M++EAFA   T+KVP+ S
Sbjct  273  HSAVELVAGRESAIAQILRTIPNKSYNMTFIIGDARNGCNGEMMVEAFAAKHTVKVPFTS  332

Query  327  KGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  172
            +G+G +K A L F+A   RTRV F+S+YYHTRSDDF SLCGPV+D V++  +
Sbjct  333  RGKGEFKAASLMFKADTARTRVTFYSSYYHTRSDDFGSLCGPVLDEVRVYPI  384



>ref|XP_002517797.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF44604.1| conserved hypothetical protein [Ricinus communis]
Length=365

 Score =   186 bits (472),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 93/169 (55%), Positives = 117/169 (69%), Gaps = 1/169 (1%)
 Frame = -1

Query  687  ELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVPHG  508
             LVK  GF  GP R+    +   LP        P LP W +ESLKAVK+ID++HF+VP G
Sbjct  194  NLVKNPGFEEGPHRLVNTSNGVLLPPRQEDLTSP-LPGWIIESLKAVKFIDSKHFNVPFG  252

Query  507  RRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPYES  328
              AVELVAG+ESA+ QI RT+  K YDLTF VGDA N C GSM++EAFA   T KVP+ES
Sbjct  253  LAAVELVAGRESAIAQILRTIPNKVYDLTFSVGDAKNGCHGSMMVEAFAAKDTFKVPFES  312

Query  327  KGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKL  181
            +G+G +K     F+A + RTR+ F+S+YYHTR DDF SLCGPV+D V++
Sbjct  313  QGKGKFKTVSFNFKAVSARTRITFYSSYYHTRIDDFGSLCGPVLDQVRV  361



>ref|XP_007217604.1| hypothetical protein PRUPE_ppa018156mg [Prunus persica]
 gb|EMJ18803.1| hypothetical protein PRUPE_ppa018156mg [Prunus persica]
Length=375

 Score =   186 bits (472),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 97/173 (56%), Positives = 117/173 (68%), Gaps = 1/173 (1%)
 Frame = -1

Query  687  ELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVPHG  508
             L+K   F  GP   P       +P  H       LP W +ESLKAVKYID+ HF+VP G
Sbjct  200  NLLKNGNFEEGPFVFPNTSWGVLIPP-HIEDDHSPLPGWIIESLKAVKYIDSTHFAVPEG  258

Query  507  RRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPYES  328
            +RA+ELVAGKESA+ Q+  T  G+ Y LTF VGD+ N CEGS+V+EAFAG  TLKVPYES
Sbjct  259  QRAIELVAGKESALAQVVFTKPGRLYALTFSVGDSKNACEGSLVVEAFAGKDTLKVPYES  318

Query  327  KGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  169
            KG+GG+K A+L F A    TRVMF ST+Y   +D   SLCGPV+D VKL+SVR
Sbjct  319  KGKGGFKRARLLFTAVETHTRVMFLSTFYTMSADHSGSLCGPVIDDVKLLSVR  371


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            P+ T  NLLKN +FEEGP+VFP    GVL PP  EDDH P
Sbjct  194  PKRTRANLLKNGNFEEGPFVFPNTSWGVLIPPHIEDDHSP  233



>emb|CDO98109.1| unnamed protein product [Coffea canephora]
Length=332

 Score =   183 bits (465),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/138 (62%), Positives = 107/138 (78%), Gaps = 0/138 (0%)
 Frame = -1

Query  582  LPAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDA  403
            LP W +ESLKAVKY+D+EHFSVP G+RAVEL+AG+ESA+ QI +T+ G +YDL F VGDA
Sbjct  191  LPGWIIESLKAVKYVDSEHFSVPEGKRAVELIAGRESAIAQIVKTIPGWWYDLVFSVGDA  250

Query  402  SNKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDD  223
             N CEGSM++EA AG  TL+VPY+S G+G +  A  RFRA + RTRV F S  YH RSD+
Sbjct  251  KNGCEGSMLIEASAGKVTLQVPYQSSGKGKFIRATHRFRAVSRRTRVRFLSINYHMRSDN  310

Query  222  FVSLCGPVVDFVKLVSVR  169
              +LCGPV+D V+L S+R
Sbjct  311  TGTLCGPVIDDVRLYSLR  328


 Score = 51.2 bits (121),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 26/40 (65%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            P  T  NLLKN +FEEGPY+FP    G L PP  EDDH P
Sbjct  151  PLKTRGNLLKNGNFEEGPYIFPNTTWGALIPPNIEDDHSP  190



>ref|XP_010067858.1| PREDICTED: uncharacterized protein LOC104454644 [Eucalyptus grandis]
 gb|KCW66091.1| hypothetical protein EUGRSUZ_G03366 [Eucalyptus grandis]
Length=369

 Score =   186 bits (471),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 94/170 (55%), Positives = 121/170 (71%), Gaps = 1/170 (1%)
 Frame = -1

Query  687  ELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVPHG  508
             LVK  GF  GP R+    +   LP        P LP W +ESLKAVK+ID +HF+VP G
Sbjct  196  NLVKNAGFEEGPHRLINSSNGVLLPPRQEDLTSP-LPGWIIESLKAVKFIDKKHFNVPFG  254

Query  507  RRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPYES  328
              AVELVAG+ESA+ Q+ RT+  K Y+LTF VGDA N C GSM++EAFA   TLKVP++S
Sbjct  255  LAAVELVAGRESAIAQMIRTLPSKCYNLTFAVGDARNGCHGSMMVEAFAAKDTLKVPFQS  314

Query  327  KGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLV  178
            +G+G +K A L+F+A + RTR+ FFS++YHTR DDF SLCGPV+D V++V
Sbjct  315  QGKGRFKTASLKFKALSARTRLTFFSSFYHTRIDDFGSLCGPVLDEVRVV  364



>gb|KJB24991.1| hypothetical protein B456_004G171200 [Gossypium raimondii]
Length=414

 Score =   186 bits (473),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 93/172 (54%), Positives = 120/172 (70%), Gaps = 1/172 (1%)
 Frame = -1

Query  687  ELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVPHG  508
             LVK  GF  GP R+    +   LP        P LP W +ESLKAVK+IDA+HF+VP G
Sbjct  243  NLVKNNGFEEGPHRLVNSTNGVLLPPRQEDFTSP-LPGWIIESLKAVKFIDAKHFNVPAG  301

Query  507  RRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPYES  328
              AVELVAG+ESA+ QI RT+  K Y++TF++GDA N C G M++EAFA   T+KVP+ S
Sbjct  302  HSAVELVAGRESAIAQILRTIPNKSYNMTFIIGDARNGCNGEMMVEAFAAKHTVKVPFTS  361

Query  327  KGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  172
            +G+G +K A L F+A   RTRV F+S+YYHTRSDDF SLCGPV+D V++  +
Sbjct  362  RGKGEFKAASLMFKADTARTRVTFYSSYYHTRSDDFGSLCGPVLDEVRVYPI  413



>gb|KHG12815.1| DNA-directed RNA polymerase subunit beta'' [Gossypium arboreum]
Length=385

 Score =   186 bits (471),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 92/172 (53%), Positives = 120/172 (70%), Gaps = 1/172 (1%)
 Frame = -1

Query  687  ELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVPHG  508
             LVK  GF  GP R+    +   LP        P LP W +ESLKAVK+IDA+HF+VP G
Sbjct  214  NLVKNSGFEEGPHRLVNSTNGVLLPPRQEDFTSP-LPGWIIESLKAVKFIDAKHFNVPAG  272

Query  507  RRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPYES  328
              AVELVAG+ESA+ QI RT+  K Y++TF++GDA N C G M++EAFA   T+KVP+ S
Sbjct  273  HSAVELVAGRESAIAQILRTIPNKSYNMTFVIGDARNGCNGEMMVEAFAAKHTVKVPFTS  332

Query  327  KGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  172
            +G+G +K A L F+A   RTR+ F+S+YYHTRSDDF SLCGPV+D V++  +
Sbjct  333  RGKGEFKAASLMFKADTARTRITFYSSYYHTRSDDFGSLCGPVLDEVRVYPI  384



>ref|XP_010088264.1| hypothetical protein L484_005140 [Morus notabilis]
 gb|EXB33248.1| hypothetical protein L484_005140 [Morus notabilis]
Length=378

 Score =   185 bits (469),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 98/177 (55%), Positives = 117/177 (66%), Gaps = 1/177 (1%)
 Frame = -1

Query  687  ELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVPHG  508
             L+K   F  GP   P       +P  H       LP W ++SLKAVKYID++HF VP G
Sbjct  199  NLLKNGNFEEGPYVFPNAPWGVLIPP-HIDDAHSPLPGWIIDSLKAVKYIDSDHFHVPEG  257

Query  507  RRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPYES  328
            +RA+ELV GKES++ QI RT  GK Y LTF VGDA N C GS+ +EAFAG  T KV Y S
Sbjct  258  KRAIELVGGKESSIAQIVRTEPGKEYVLTFAVGDAKNSCVGSLGIEAFAGNGTTKVVYVS  317

Query  327  KGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNPHR  157
             G GG+K AKLRF+AT  RTRVMFFST+Y   SD+  +LCGP +D VKL+SVR P R
Sbjct  318  TGSGGFKRAKLRFKATQWRTRVMFFSTFYTMTSDNSGTLCGPTLDDVKLISVRTPPR  374


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            P+ T  NLLKN +FEEGPYVFP    GVL PP  +D H P
Sbjct  193  PKRTRANLLKNGNFEEGPYVFPNAPWGVLIPPHIDDAHSP  232



>gb|EAY92272.1| hypothetical protein OsI_13995 [Oryza sativa Indica Group]
Length=363

 Score =   184 bits (467),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 95/171 (56%), Positives = 117/171 (68%), Gaps = 1/171 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
            +  L+K  GF  GP           LP        P LP W +ESLKAV++IDA HFSVP
Sbjct  189  KDNLIKNEGFEIGPQVFKNSTVGVLLPPKQKDATSP-LPGWIIESLKAVRFIDAAHFSVP  247

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             G+ AVELVAG+ESA+ Q+ RTVA + Y+L+F+VGDA N C GSM++EAFAG  T KVP+
Sbjct  248  AGQYAVELVAGRESAIAQVIRTVANRAYNLSFVVGDAKNGCHGSMLVEAFAGNVTQKVPF  307

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKL  181
            ES G GG+KPA  RF A   RTRV F+S+YYHT+  D VSLCGPV+D VK+
Sbjct  308  ESVGNGGFKPASFRFVAAGVRTRVTFYSSYYHTKVSDGVSLCGPVLDQVKV  358



>ref|XP_003564086.1| PREDICTED: uncharacterized protein LOC100845370 [Brachypodium 
distachyon]
Length=393

 Score =   185 bits (469),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 95/171 (56%), Positives = 117/171 (68%), Gaps = 1/171 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
            +  L+K  GF  GP           LP        P LP W +ESLKAV+YIDA HFSVP
Sbjct  219  KENLIKNEGFEIGPQVFKNSTVGVLLPPKQKDATSP-LPGWIIESLKAVRYIDAAHFSVP  277

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             G  AVELVAG+ESA+ Q+ RTV  + Y+++F VGDA N C GSM++EAFAG  TLKVP+
Sbjct  278  SGNYAVELVAGRESAIAQVIRTVPNRAYNVSFAVGDAKNGCHGSMLVEAFAGNVTLKVPF  337

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKL  181
            ES G+GG+K A LRF A   RTRV F+S+YYHT++ D VSLCGPV+D VK+
Sbjct  338  ESAGKGGFKTASLRFVAGGVRTRVTFYSSYYHTKATDGVSLCGPVLDQVKI  388



>ref|XP_008461812.1| PREDICTED: uncharacterized protein LOC103500323 [Cucumis melo]
Length=368

 Score =   184 bits (466),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 93/169 (55%), Positives = 118/169 (70%), Gaps = 1/169 (1%)
 Frame = -1

Query  687  ELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVPHG  508
             LV+   F  GP R+    +   LP        P LP W +ESLKAVK+ID++HF+VP G
Sbjct  197  NLVRNPSFEVGPHRLGNSTNGVLLPPRQEDVTSP-LPGWIIESLKAVKFIDSKHFNVPDG  255

Query  507  RRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPYES  328
              A+ELVAG+ESAV QI RT+  K Y L F VGDA N C GSM++EAFA   T+KVP++S
Sbjct  256  EAAIELVAGRESAVAQIIRTIPNKVYSLKFKVGDAKNGCHGSMMVEAFAAKETVKVPFQS  315

Query  327  KGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKL  181
            +G+G YK A L+F AT+ RTR+ FFS+YYHTR+DDF SLCGPV+D V +
Sbjct  316  EGKGLYKDAILKFTATSPRTRITFFSSYYHTRTDDFGSLCGPVLDDVSV  364



>ref|XP_008375195.1| PREDICTED: uncharacterized protein LOC103438421 [Malus domestica]
Length=367

 Score =   184 bits (466),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 94/172 (55%), Positives = 120/172 (70%), Gaps = 3/172 (2%)
 Frame = -1

Query  687  ELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVPHG  508
             LV+  GF   P R+    H   LP        P LP W +ESLKAVK+ID+ HF+VP G
Sbjct  198  NLVRNPGFEEAPHRLLNSSHGVLLPPKQLDVTSP-LPGWIIESLKAVKFIDSNHFNVPVG  256

Query  507  RRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPYES  328
            + AVELVAG+ESA+ QI RTV  K Y L+F VGDA N C+GSM++EAFAG  TLKVP+ S
Sbjct  257  KGAVELVAGRESAIAQIIRTVPNKLYSLSFTVGDARNGCQGSMMVEAFAGKDTLKVPFAS  316

Query  327  KGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  172
            KG+GG+K A  RF+A + RTR+ FFS+YYHT+  D+ +LCGP++D VK+  V
Sbjct  317  KGKGGFKKASFRFKAVSIRTRITFFSSYYHTK--DYGALCGPILDEVKVSPV  366



>gb|AFK44456.1| unknown [Lotus japonicus]
Length=177

 Score =   178 bits (451),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 92/172 (53%), Positives = 115/172 (67%), Gaps = 1/172 (1%)
 Frame = -1

Query  687  ELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVPHG  508
             LVK   F  GP  +    +   LP     R  P LP W +ESLKAVK+IDA+HF+VP G
Sbjct  6    NLVKNPSFEEGPFPIFNSTNGVLLPPQQQDRFSP-LPGWIIESLKAVKFIDAKHFNVPFG  64

Query  507  RRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPYES  328
              AVELVAG+ESA+ QI RT A K Y++TF VGDA N C GSM++EAFA   T KVP++S
Sbjct  65   LGAVELVAGRESAIAQIIRTEANKVYNITFSVGDAKNGCHGSMMVEAFAAKDTFKVPFKS  124

Query  327  KGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  172
             G+G +      F+A A RTR+ F+S+YYHTR+DDF SLCGPV+D V +  V
Sbjct  125  VGKGKFVTVSFEFKAIAPRTRLTFYSSYYHTRTDDFGSLCGPVLDRVIVFPV  176



>ref|XP_004951511.1| PREDICTED: uncharacterized protein LOC101755979 [Setaria italica]
Length=374

 Score =   184 bits (466),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 97/177 (55%), Positives = 123/177 (69%), Gaps = 5/177 (3%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPA--VHGGRPLPRLPAWTVESLKAVKYIDAEHFS  520
             R LVK   F  GP  +P  +    +P+  V    PLP    W VESLKAV+Y+D   F+
Sbjct  197  NRNLVKNGDFEEGPYILPGTKWGVLIPSRVVDDHSPLP---GWMVESLKAVRYVDGGSFA  253

Query  519  VPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKV  340
            VP GRRAVEL+AG+E AV Q+ RTV G+ Y L+F VGDA N C GS+V+EA+AG  ++KV
Sbjct  254  VPRGRRAVELLAGREGAVAQVVRTVPGRRYALSFTVGDAGNACRGSLVVEAYAGRESVKV  313

Query  339  PYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  169
             YES+G+GG + A L FRA A RTR++FFS++Y TRSDD  SLCGPV+D V +VSVR
Sbjct  314  AYESEGKGGARRAVLPFRAAAARTRIVFFSSFYSTRSDDLSSLCGPVLDDVAVVSVR  370


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 26/40 (65%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR TN NL+KN DFEEGPY+ P    GVL P    DDH P
Sbjct  193  PRRTNRNLVKNGDFEEGPYILPGTKWGVLIPSRVVDDHSP  232



>ref|NP_001051644.1| Os03g0807700 [Oryza sativa Japonica Group]
 gb|AAP21410.1| unknown protein [Oryza sativa Japonica Group]
 gb|ABF99455.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF13558.1| Os03g0807700 [Oryza sativa Japonica Group]
 gb|EAZ28993.1| hypothetical protein OsJ_13041 [Oryza sativa Japonica Group]
 dbj|BAG86944.1| unnamed protein product [Oryza sativa Japonica Group]
Length=393

 Score =   184 bits (467),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 95/171 (56%), Positives = 117/171 (68%), Gaps = 1/171 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
            +  L+K  GF  GP           LP        P LP W +ESLKAV++IDA HFSVP
Sbjct  219  KDNLIKNEGFEIGPQVFKNSTVGVLLPPKQKDATSP-LPGWIIESLKAVRFIDAAHFSVP  277

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             G+ AVELVAG+ESA+ Q+ RTVA + Y+L+F+VGDA N C GSM++EAFAG  T KVP+
Sbjct  278  AGQYAVELVAGRESAIAQVIRTVANRAYNLSFVVGDAKNGCHGSMLVEAFAGNVTQKVPF  337

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKL  181
            ES G GG+KPA  RF A   RTRV F+S+YYHT+  D VSLCGPV+D VK+
Sbjct  338  ESVGNGGFKPASFRFVAAGVRTRVTFYSSYYHTKVSDGVSLCGPVLDQVKV  388



>ref|XP_008245331.1| PREDICTED: uncharacterized protein LOC103343457 [Prunus mume]
Length=373

 Score =   184 bits (466),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 93/173 (54%), Positives = 118/173 (68%), Gaps = 1/173 (1%)
 Frame = -1

Query  684  LVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVPHGR  505
            LVK  GF  GP           LP     +  P LP W +ESLK VKYID +HFSVP G 
Sbjct  201  LVKNGGFESGPHVFKNFSTGILLPPKAKDQISP-LPGWIIESLKPVKYIDKKHFSVPGGL  259

Query  504  RAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPYESK  325
             A+ELVAG+ESA+ QI RT+  KFY+LTF +GDA N C GSM++EAFAG  TLKVPY S+
Sbjct  260  AAIELVAGRESAIAQIIRTIPNKFYNLTFTIGDAKNACHGSMMVEAFAGKETLKVPYTSQ  319

Query  324  GQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRN  166
            G+GG+K A  +F+AT+ RTR+ F+S YYHT+  DF  +CGPV+D V ++ V +
Sbjct  320  GKGGFKTASFKFQATSPRTRITFYSAYYHTKLHDFGHMCGPVLDNVIVLPVSS  372



>ref|XP_006427179.1| hypothetical protein CICLE_v10025880mg [Citrus clementina]
 gb|ESR40419.1| hypothetical protein CICLE_v10025880mg [Citrus clementina]
Length=374

 Score =   174 bits (441),  Expect(2) = 7e-52, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 104/135 (77%), Gaps = 0/135 (0%)
 Frame = -1

Query  582  LPAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDA  403
            LP W +ESLKAVKYID +HF VP GRRA+ELVAGKESA+TQ+ +T   K Y L+F VGDA
Sbjct  230  LPGWIIESLKAVKYIDLKHFFVPEGRRAIELVAGKESALTQVVKTEVNKTYALSFAVGDA  289

Query  402  SNKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDD  223
             N C G++ +EA+AG   +KV Y SKG+GG+K A LRF+A + RTR+MF ST+Y+ +SD 
Sbjct  290  GNGCAGTLGVEAYAGRENVKVTYASKGKGGFKKALLRFKAVSPRTRIMFLSTFYNMQSDS  349

Query  222  FVSLCGPVVDFVKLV  178
              SLCGPV+D VKL+
Sbjct  350  SGSLCGPVIDDVKLL  364


 Score = 57.4 bits (137),  Expect(2) = 7e-52, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            P+ T VN+LKN +FEEGPYVFP    GVL PP  EDDH P
Sbjct  190  PKRTGVNILKNGNFEEGPYVFPNASWGVLIPPKIEDDHSP  229



>gb|KFK42429.1| hypothetical protein AALP_AA2G255100 [Arabis alpina]
Length=368

 Score =   183 bits (464),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 92/174 (53%), Positives = 116/174 (67%), Gaps = 1/174 (1%)
 Frame = -1

Query  690  RELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVPH  511
              L+K   F  GP   P  +    +P        P LP W +ESLKAVKY+D  HF+VP 
Sbjct  193  NNLIKNGNFEEGPYVFPTAKWGVLIPPFIEDDNSP-LPGWIIESLKAVKYVDKAHFAVPE  251

Query  510  GRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPYE  331
            G RA+ELVAGKESA++QI RT   +FY LTF VGDA + CEG M++EAFAG S + V Y 
Sbjct  252  GHRAIELVAGKESAISQIVRTSLNQFYALTFNVGDARDTCEGPMIVEAFAGRSKIMVDYV  311

Query  330  SKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  169
            SKG+GG+   KL F+A + RTRV F ST+YH +SD   SLCGPV+D V+LV++R
Sbjct  312  SKGKGGFTQGKLVFKAVSTRTRVTFLSTFYHMKSDHSGSLCGPVIDDVRLVAIR  365


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR    NL+KN +FEEGPYVFP    GVL PPF EDD+ P
Sbjct  188  PRFIGNNLIKNGNFEEGPYVFPTAKWGVLIPPFIEDDNSP  227



>ref|XP_009354784.1| PREDICTED: uncharacterized protein LOC103945912 [Pyrus x bretschneideri]
 ref|XP_009354785.1| PREDICTED: uncharacterized protein LOC103945913 [Pyrus x bretschneideri]
Length=367

 Score =   183 bits (464),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 93/172 (54%), Positives = 120/172 (70%), Gaps = 3/172 (2%)
 Frame = -1

Query  687  ELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVPHG  508
             LV+  GF   P R+    H   LP        P LP W +ESLKAVK+ID+ HF+VP G
Sbjct  198  NLVRNPGFEEAPHRLLNSSHGVLLPPKQLDATSP-LPGWIIESLKAVKFIDSNHFNVPVG  256

Query  507  RRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPYES  328
            + AVELVAG+ESA+ QI RTV  K Y L+F VGDA N C+GSM++EAFAG  TLKVP+ S
Sbjct  257  KGAVELVAGRESAIAQIIRTVPNKLYSLSFTVGDARNGCQGSMMVEAFAGKETLKVPFAS  316

Query  327  KGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  172
            KG+GG+K A  RF+A + RTR+ FFS++YHT+  D+ +LCGP++D VK+  V
Sbjct  317  KGKGGFKKASFRFKAVSIRTRITFFSSFYHTK--DYGALCGPILDEVKVSPV  366



>ref|XP_008363312.1| PREDICTED: uncharacterized protein LOC103427013 [Malus domestica]
Length=367

 Score =   182 bits (463),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 92/172 (53%), Positives = 120/172 (70%), Gaps = 3/172 (2%)
 Frame = -1

Query  687  ELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVPHG  508
             LV+  GF   P R+    H   LP        P LP W +ESLKA+K+IDA+HF+VP G
Sbjct  198  NLVRNPGFEEAPHRLFNSSHGVLLPPKQLDATSP-LPGWIIESLKAIKFIDAKHFNVPFG  256

Query  507  RRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPYES  328
            + AVELVAG+ESA+ Q+ RTV  K Y L+F VGDA N C GSM++EAFAG  TLKVP+ S
Sbjct  257  KGAVELVAGRESAIAQVLRTVPNKLYSLSFTVGDARNGCHGSMMVEAFAGKETLKVPFTS  316

Query  327  KGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  172
            KG+GG+K A  RF+A + RTR+ FFS++YHT+  D+ +LCGP++D VK+  V
Sbjct  317  KGKGGFKTASFRFKAVSIRTRITFFSSFYHTK--DYGALCGPILDEVKVSPV  366



>ref|XP_002299934.2| hypothetical protein POPTR_0001s27110g [Populus trichocarpa]
 gb|ABK94155.1| unknown [Populus trichocarpa]
 gb|EEE84739.2| hypothetical protein POPTR_0001s27110g [Populus trichocarpa]
Length=365

 Score =   182 bits (462),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 92/172 (53%), Positives = 115/172 (67%), Gaps = 1/172 (1%)
 Frame = -1

Query  687  ELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVPHG  508
             LVK  GF  GP R+        LP        P LP W +ESLKAVK+ID +HF+VP G
Sbjct  194  NLVKNHGFEEGPHRLVNTSSGVLLPPRQEDLTSP-LPGWMIESLKAVKFIDKKHFNVPFG  252

Query  507  RRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPYES  328
              AVELVAG+ESA+ QI RT+  K Y LTF VGDA N C GSM++EAFA   T KVP+ES
Sbjct  253  LAAVELVAGRESAIAQILRTIPDKVYGLTFTVGDARNGCHGSMMVEAFAAKDTFKVPFES  312

Query  327  KGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  172
            KG+G +K    +F+A   RTR+ F+S+YYHTR DDF SLCGP++D V++  +
Sbjct  313  KGKGEFKTVSFKFKAVTARTRITFYSSYYHTRIDDFGSLCGPILDEVRVFPI  364



>ref|XP_011047367.1| PREDICTED: uncharacterized protein LOC105141733 [Populus euphratica]
Length=365

 Score =   182 bits (462),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 91/172 (53%), Positives = 115/172 (67%), Gaps = 1/172 (1%)
 Frame = -1

Query  687  ELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVPHG  508
             LVK  GF  GP R+        LP        P LP W +ESLKAVK+ID +HF+VP G
Sbjct  194  NLVKNHGFEEGPHRLVNTSSGVLLPPRQEDLTSP-LPGWMIESLKAVKFIDKKHFNVPFG  252

Query  507  RRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPYES  328
              AVELVAG+ESA+ QI RT+  K Y LTF +GDA N C GSM++EAFA   T KVP+ES
Sbjct  253  LAAVELVAGRESAIAQILRTIPDKVYGLTFTIGDARNGCHGSMMVEAFAAKDTFKVPFES  312

Query  327  KGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  172
            KG+G +K    +F+A   RTR+ F+S+YYHTR DDF SLCGP++D V++  +
Sbjct  313  KGKGEFKTVSFKFKAVTARTRITFYSSYYHTRIDDFGSLCGPILDEVRVFPI  364



>ref|XP_011013325.1| PREDICTED: uncharacterized protein LOC105117377 [Populus euphratica]
Length=365

 Score =   182 bits (461),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 91/172 (53%), Positives = 115/172 (67%), Gaps = 1/172 (1%)
 Frame = -1

Query  687  ELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVPHG  508
             LVK  GF  GP R+        LP        P LP W +ESLKAVK+ID +HF+VP G
Sbjct  194  NLVKNHGFEEGPHRLVNTSSGVLLPPRQEDLTSP-LPGWMIESLKAVKFIDKKHFNVPFG  252

Query  507  RRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPYES  328
              AVELVAG+ESA+ QI RT+  K Y LTF +GDA N C GSM++EAFA   T KVP+ES
Sbjct  253  LAAVELVAGRESAIAQILRTIPDKVYGLTFTIGDARNGCHGSMMVEAFAAKDTFKVPFES  312

Query  327  KGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  172
            KG+G +K    +F+A   RTR+ F+S+YYHTR DDF SLCGP++D V++  +
Sbjct  313  KGKGEFKTVSFKFKAVTARTRITFYSSYYHTRIDDFGSLCGPILDEVRVFPI  364



>ref|XP_006845336.1| hypothetical protein AMTR_s00141p00085330 [Amborella trichopoda]
 gb|ERN07011.1| hypothetical protein AMTR_s00141p00085330 [Amborella trichopoda]
Length=369

 Score =   182 bits (461),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 118/171 (69%), Gaps = 1/171 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
            +  LVK  GF  GP  +        LP        P LP W +ES+KAV+Y+D+ HF+VP
Sbjct  197  KDNLVKNGGFEEGPHVLKNSTSGILLPPKQNDINSP-LPGWIIESIKAVRYLDSHHFTVP  255

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             G  AVELVAG+ESA+ Q+ RTV  K Y L+F+VGDA N C GSM++EAFAG  T+KVP+
Sbjct  256  LGAAAVELVAGRESAIAQLIRTVPKKVYTLSFIVGDAKNGCHGSMLVEAFAGKDTVKVPF  315

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKL  181
            ES+GQGGYK  K+RF A   RTR+ FFS++YHT+ DD  ++CGP+VD VK+
Sbjct  316  ESRGQGGYKVGKMRFMALEPRTRITFFSSFYHTKVDDPGTMCGPIVDEVKV  366



>ref|XP_010057181.1| PREDICTED: uncharacterized protein LOC104445070 [Eucalyptus grandis]
 gb|KCW90190.1| hypothetical protein EUGRSUZ_A02362 [Eucalyptus grandis]
Length=370

 Score =   182 bits (461),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 95/173 (55%), Positives = 116/173 (67%), Gaps = 1/173 (1%)
 Frame = -1

Query  687  ELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVPHG  508
             L+K  GF  GP           LPA       P LP W +ES+K VKY+D +HF VP G
Sbjct  199  NLIKNGGFEIGPHVFKNFSTGVLLPAKQKDLISP-LPGWIIESMKPVKYVDRKHFFVPSG  257

Query  507  RRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPYES  328
              AVELVAG+ESA+ QI RTV  KFY+LTF VGDA N C GSM++EAFA   TLKVPYES
Sbjct  258  LAAVELVAGRESAMAQIIRTVPNKFYNLTFTVGDAKNGCHGSMMVEAFAAKDTLKVPYES  317

Query  327  KGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  169
              +GG K A L+F+AT+ RTR+ FFS YYHT+  D+  +CGPV+D VK+V V+
Sbjct  318  TSKGGSKTANLKFQATSTRTRITFFSAYYHTKLHDYGHMCGPVLDDVKVVPVK  370



>ref|XP_002466246.1| hypothetical protein SORBIDRAFT_01g004270 [Sorghum bicolor]
 gb|EER93244.1| hypothetical protein SORBIDRAFT_01g004270 [Sorghum bicolor]
Length=386

 Score =   182 bits (462),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 94/175 (54%), Positives = 119/175 (68%), Gaps = 1/175 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
            +  L+K  GF  GP  +        LP        P LP W +ESLKAV++IDA HFSVP
Sbjct  212  KDNLIKNDGFEIGPQVLKNSTVGVLLPPKQKDATSP-LPGWIIESLKAVRFIDAAHFSVP  270

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             G+ AVELVAG+ESA+ Q+ RTV  + Y+L+F VGDA N C GSM++EAFAG  T KVP+
Sbjct  271  AGQYAVELVAGRESAIAQVIRTVPNRAYNLSFAVGDAKNGCHGSMLVEAFAGNVTQKVPF  330

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  169
            ES G+GG+K A  RF A   RTR+ F+S+YYHT+  D VSLCGPV+D VK+V V+
Sbjct  331  ESAGKGGFKAAAFRFVAAGARTRLTFYSSYYHTKVTDGVSLCGPVLDQVKVVPVK  385



>ref|XP_007201993.1| hypothetical protein PRUPE_ppa024647mg [Prunus persica]
 gb|EMJ03192.1| hypothetical protein PRUPE_ppa024647mg [Prunus persica]
Length=384

 Score =   182 bits (461),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 92/173 (53%), Positives = 117/173 (68%), Gaps = 1/173 (1%)
 Frame = -1

Query  684  LVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVPHGR  505
            LVK  GF  GP           LP     +  P LP W +ESLK VKYID +HF VP G 
Sbjct  212  LVKNGGFESGPHVFKNFSTGILLPPKAKDQISP-LPGWIIESLKPVKYIDKKHFQVPGGL  270

Query  504  RAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPYESK  325
             A+ELVAG+ESA+ QI RT+  KFY+LTF +GDA N C GSM++EAFAG  TLKVPY S+
Sbjct  271  AAIELVAGRESAIAQIIRTIPNKFYNLTFTIGDAKNACHGSMMVEAFAGKETLKVPYMSQ  330

Query  324  GQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRN  166
            G+GG+K A  +F+AT+ RTR+ F+S YYHT+  DF  +CGPV+D V ++ V +
Sbjct  331  GKGGFKTASFKFQATSPRTRITFYSAYYHTKLHDFGHMCGPVLDNVIVLPVSS  383



>gb|KJB36028.1| hypothetical protein B456_006G137000 [Gossypium raimondii]
 gb|KJB36029.1| hypothetical protein B456_006G137000 [Gossypium raimondii]
 gb|KJB36030.1| hypothetical protein B456_006G137000 [Gossypium raimondii]
Length=371

 Score =   181 bits (460),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 93/177 (53%), Positives = 119/177 (67%), Gaps = 2/177 (1%)
 Frame = -1

Query  699  TYQR-ELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHF  523
            TY +  LVK  GF  GP           LP  H    +  LP W +ESLK VK+ID +HF
Sbjct  195  TYTKGNLVKNSGFETGPHTFKNFSTGVLLPP-HKQDTISPLPGWIIESLKPVKFIDKKHF  253

Query  522  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  343
            SVP G+ A+E+VAG+ESA+ Q+ RTV  K Y LTF VGDA N C GSM++EAFAG  TLK
Sbjct  254  SVPSGQFAIEMVAGRESAIAQVIRTVPNKDYTLTFTVGDAKNDCHGSMMVEAFAGKGTLK  313

Query  342  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  172
            VPY S+G+GG+K +  RF+A + RTR+ F+S YYHT+  DF  +CGPV+D VK++ V
Sbjct  314  VPYVSQGKGGFKTSSFRFQAISARTRITFYSAYYHTKLHDFGHMCGPVLDDVKVLPV  370



>gb|EMT25156.1| hypothetical protein F775_26385 [Aegilops tauschii]
Length=397

 Score =   182 bits (461),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 85/138 (62%), Positives = 108/138 (78%), Gaps = 0/138 (0%)
 Frame = -1

Query  582  LPAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDA  403
            LP W +ESLKAV+YIDA HFSVP G+ AVELVAG+ESA+ Q+ RTV  + Y+L+++VGDA
Sbjct  259  LPGWIIESLKAVRYIDAAHFSVPAGQYAVELVAGRESAIAQVIRTVPNRAYNLSYVVGDA  318

Query  402  SNKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDD  223
             N C GSM++EAFA   T KVP+ES G+GG+K A LRF A   RTRV F+S+YYHT+  D
Sbjct  319  KNGCHGSMLVEAFAANVTQKVPFESTGKGGFKAASLRFVAAGVRTRVTFYSSYYHTKVTD  378

Query  222  FVSLCGPVVDFVKLVSVR  169
             VSLCGPV+D VK+V ++
Sbjct  379  GVSLCGPVLDQVKIVPMK  396



>ref|XP_006826721.1| hypothetical protein AMTR_s00264p00012960 [Amborella trichopoda]
 gb|ERM93958.1| hypothetical protein AMTR_s00264p00012960 [Amborella trichopoda]
Length=372

 Score =   181 bits (460),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 94/170 (55%), Positives = 118/170 (69%), Gaps = 1/170 (1%)
 Frame = -1

Query  687  ELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVPHG  508
             L+K   F  GP  +P       +P     R  P LP WT+ SLK+V+YID+ HFSVP G
Sbjct  196  NLLKNGDFEEGPYFLPNNLDGVLIPPNQIDRNSP-LPGWTILSLKSVRYIDSPHFSVPEG  254

Query  507  RRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPYES  328
            R+AVEL+AGKES ++Q A TV   +Y LTFLVGDA+N C+GSM +EA+AG  +LKV YES
Sbjct  255  RKAVELLAGKESIISQTATTVPKAYYVLTFLVGDANNTCKGSMAVEAYAGRGSLKVDYES  314

Query  327  KGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLV  178
            KG GG+K AKL F A    TR +F+ST+Y TR+DD  SLCGPV+D V+LV
Sbjct  315  KGLGGFKRAKLVFVALEKVTRFVFYSTFYMTRTDDLSSLCGPVIDDVRLV  364



>gb|KDP26060.1| hypothetical protein JCGZ_21093 [Jatropha curcas]
Length=370

 Score =   181 bits (459),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 90/173 (52%), Positives = 115/173 (66%), Gaps = 1/173 (1%)
 Frame = -1

Query  687  ELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVPHG  508
             LVK  GF  GP           LPA      +  LP W +ESLK VKYID +HFSVP G
Sbjct  198  NLVKNGGFENGPHVFKNFSTGVLLPAKQQDL-ISALPGWIIESLKPVKYIDNKHFSVPSG  256

Query  507  RRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPYES  328
              A+ELVAG+ESA+ Q+ RTVA KFY+LTF +GDA N C GSMV+EAFA   TLKVP+ES
Sbjct  257  FAAIELVAGRESALAQVIRTVANKFYNLTFTIGDAKNGCHGSMVVEAFAAKETLKVPFES  316

Query  327  KGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  169
            + +G +K A  +F+A +NRTR+ F+S  YHT+  DF  +CGP++D V +  +R
Sbjct  317  QSKGEFKTASFKFQAISNRTRITFYSANYHTKLHDFGHMCGPILDNVSVFPIR  369



>gb|KJB19256.1| hypothetical protein B456_003G091800 [Gossypium raimondii]
Length=307

 Score =   179 bits (454),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 97/172 (56%), Positives = 114/172 (66%), Gaps = 2/172 (1%)
 Frame = -1

Query  699  TYQR-ELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHF  523
            TY R  LVK  GF  GP           LP     R  P L  W +ESLK VKYID +HF
Sbjct  131  TYTRGNLVKNGGFETGPHTFKNFSTGVLLPPKKLDRISP-LVGWIIESLKPVKYIDKKHF  189

Query  522  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  343
            SVP G  AVELVAG+ESA+ QI RTV  KFY LTF VGDA N C GSM+++AFAG  TL+
Sbjct  190  SVPSGLFAVELVAGRESAIAQIIRTVPNKFYTLTFTVGDAKNGCHGSMMVQAFAGKETLQ  249

Query  342  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFV  187
            VPY S+G+GG K A  RF+A + RTR+ FFS YYHT+ DD+  +CGPV+D V
Sbjct  250  VPYVSQGKGGLKTASFRFQAISARTRITFFSAYYHTKLDDYGHICGPVLDDV  301



>dbj|BAJ89665.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=393

 Score =   181 bits (460),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 93/175 (53%), Positives = 119/175 (68%), Gaps = 1/175 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
            +  L+K  GF  GP           LP        P LP W +ESLKAV+YIDA HFSVP
Sbjct  219  KDNLIKNDGFEIGPQVFKNSSVGVLLPPKQKDVTSP-LPGWIIESLKAVRYIDAAHFSVP  277

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             G+ AVELVAG+ESA+ Q+ RTV  + Y+L+++VGDA N C GSM++EAFA   T KVP+
Sbjct  278  AGQYAVELVAGRESAIAQVIRTVPNRAYNLSYVVGDAKNGCHGSMLVEAFAANVTQKVPF  337

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  169
            ES G+GG+K + LRF A   RTRV F+S+YYHT+  D VSLCGPV+D VK+V ++
Sbjct  338  ESTGKGGFKASSLRFVAAGARTRVTFYSSYYHTKVTDGVSLCGPVLDQVKIVPLK  392



>ref|XP_008362680.1| PREDICTED: uncharacterized protein LOC103426358 [Malus domestica]
Length=361

 Score =   179 bits (453),  Expect(2) = 8e-51, Method: Compositional matrix adjust.
 Identities = 86/138 (62%), Positives = 107/138 (78%), Gaps = 1/138 (1%)
 Frame = -1

Query  582  LPAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDA  403
            LP W +ESLKAVKYID++HFSVP G RA+ELV GKESA+ Q+  T+ GK Y LTF VGD+
Sbjct  222  LPGWIIESLKAVKYIDSKHFSVPEGWRAIELV-GKESALAQVVFTLPGKLYALTFTVGDS  280

Query  402  SNKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDD  223
            +N CEGS+V+EAFAG   LKVPY+SKG+GG+K  +  F A   RTR+MF+ST+Y   +D 
Sbjct  281  NNACEGSLVVEAFAGKDILKVPYQSKGRGGFKRXRFLFTAVGPRTRIMFYSTFYTMAADH  340

Query  222  FVSLCGPVVDFVKLVSVR  169
              SLCGPV+D VKL+SVR
Sbjct  341  SGSLCGPVIDDVKLLSVR  358


 Score = 49.3 bits (116),  Expect(2) = 8e-51, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -2

Query  686  NLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            NLLKN ++EEGPYVFP    GVL PP  ED+H P
Sbjct  188  NLLKNGNYEEGPYVFPNTSWGVLIPPHIEDNHSP  221



>gb|KHG07966.1| Imidazolonepropionase [Gossypium arboreum]
Length=371

 Score =   181 bits (458),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 91/174 (52%), Positives = 116/174 (67%), Gaps = 1/174 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
            +  LVK  GF  GP           LP  H    +  LP W +ESLK VK+ID +HFSVP
Sbjct  198  EGNLVKNSGFETGPHTFKNFSTGVLLPP-HKQDTISPLPGWIIESLKPVKFIDKKHFSVP  256

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             G+ A+E+VAG+ESA+ Q+ RT   K Y LTF VGDA N C GSM++EAFAG  TLKVPY
Sbjct  257  SGQFAIEMVAGRESAIAQVIRTAPNKDYTLTFTVGDAKNDCHGSMMVEAFAGKGTLKVPY  316

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  172
             S+G+GG+K A  RF+A + RTR+ F+S YYHT+  DF  +CGPV+D VK++ V
Sbjct  317  VSQGKGGFKTASFRFQAISARTRITFYSAYYHTKLHDFGHMCGPVLDDVKVLPV  370



>gb|KDP43556.1| hypothetical protein JCGZ_16843 [Jatropha curcas]
Length=365

 Score =   180 bits (457),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 91/172 (53%), Positives = 116/172 (67%), Gaps = 1/172 (1%)
 Frame = -1

Query  687  ELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVPHG  508
             LVK  GF  GP       +   LP        P LP W +ESLKAVK+ID++HF+VP G
Sbjct  194  NLVKNPGFEEGPHLFVNSSNGVLLPPRQLDLTSP-LPGWIIESLKAVKFIDSKHFNVPFG  252

Query  507  RRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPYES  328
              AVELVAG+ESA+ QI RT+  K Y LTF VGDA N C GSM++EAFA   T KVP+ES
Sbjct  253  LAAVELVAGRESAIAQILRTIPNKVYGLTFSVGDAKNGCHGSMMVEAFAAKDTFKVPFES  312

Query  327  KGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  172
            +G+G +K    +F+A + RTR+ F+S+YYHTR DDF SLCGPV+D V++  +
Sbjct  313  QGKGKFKTVSFKFKAVSARTRITFYSSYYHTRIDDFGSLCGPVLDQVRVFPI  364



>ref|XP_002276894.1| PREDICTED: uncharacterized protein LOC100258445 [Vitis vinifera]
Length=368

 Score =   180 bits (457),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 88/175 (50%), Positives = 117/175 (67%), Gaps = 1/175 (1%)
 Frame = -1

Query  687  ELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVPHG  508
             LVK  GF  GP  +    +   LP        P LP W +ESLKAVK+ID +HF+VP G
Sbjct  195  NLVKNSGFEEGPHLLINSSNGVLLPPKQEDLTSP-LPGWIIESLKAVKFIDKKHFNVPFG  253

Query  507  RRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPYES  328
              AVEL+AG+ESA+ Q+ RTV  K Y+LTF +GD  N C G M++EAFA   + K P++S
Sbjct  254  LAAVELLAGRESAIAQVLRTVPNKLYNLTFSIGDGKNGCHGDMMIEAFAAKDSFKAPFKS  313

Query  327  KGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  163
            +G+G +K    +F+A A RTR+ FFS++YHTR DDF SLCGPV+D V++ S+R P
Sbjct  314  RGKGEFKTVSFKFKAIAARTRLTFFSSFYHTRIDDFGSLCGPVLDQVRVFSIRKP  368


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 47/150 (31%), Positives = 64/150 (43%), Gaps = 25/150 (17%)
 Frame = -1

Query  582  LPAWTVESLKAVKYI------DAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLT  421
            LP W +    +V+YI          F+V HG  AV L  G E++++Q      G  Y LT
Sbjct  55   LPKWEING--SVEYIAGGPQPGGMFFAVAHGVHAVRL--GNEASISQTIPVKPGSLYALT  110

Query  420  FLVGDASNKCEGSMVLEAFAGPSTLKVP----YESKGQGGYKPAKLRFRATANRTRVMFF  253
            F    AS  C    VL     P T  +P    Y+S G   Y      FRAT+N  +V F 
Sbjct  111  F---GASRTCAQDEVLRVSVPPQTGDLPLQTLYDSFGGDVYA---WGFRATSNEAKVTFH  164

Query  252  STYYHTRSDDFVSLCGPVVDFVKLVSVRNP  163
            +T            CGP++D V +  +  P
Sbjct  165  NTGVQED-----PACGPLLDAVAIKELFPP  189



>emb|CDO98108.1| unnamed protein product [Coffea canephora]
Length=368

 Score =   180 bits (456),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 97/177 (55%), Positives = 120/177 (68%), Gaps = 3/177 (2%)
 Frame = -1

Query  690  RELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVPH  511
            R++++   F  GP  +P       +P        P L  W VESLKAV+YID++HF+VP 
Sbjct  194  RDILQNGNFEEGPYVLPNTSWGILIPPNVEDDHSP-LVGWMVESLKAVRYIDSDHFAVPE  252

Query  510  GRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPYE  331
            G+RAVELVAG+ES+V Q+ +TV GK YDL F VGDA N CEGSM++E  A  ST  VPYE
Sbjct  253  GKRAVELVAGRESSVAQVVKTVPGKDYDLEFYVGDARNMCEGSMLVEVNASNSTFYVPYE  312

Query  330  SKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNPH  160
            SKG+GG K A LRF+A   RTR+ F S+YYH +SD   SLCGPVVD V+L  VR PH
Sbjct  313  SKGKGGSKLALLRFKAETGRTRIRFLSSYYHMKSDFSGSLCGPVVDGVRL--VRVPH  367



>gb|EYU43005.1| hypothetical protein MIMGU_mgv1a011073mg [Erythranthe guttata]
Length=293

 Score =   178 bits (451),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 88/169 (52%), Positives = 117/169 (69%), Gaps = 1/169 (1%)
 Frame = -1

Query  687  ELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVPHG  508
             LVK  GF  GP  +    H   LP        P LP W +ESLKAVK+ID++HF+VP G
Sbjct  120  NLVKNEGFEEGPHLLMNSSHGVLLPPKQEDLTSP-LPGWIIESLKAVKFIDSKHFNVPFG  178

Query  507  RRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPYES  328
            + AVELVAG+ESA+ QI RTV  K Y+L+F+VGDA N C GSM++EAFA  +T K  ++S
Sbjct  179  KSAVELVAGRESAIAQIIRTVPNKVYNLSFVVGDAKNGCHGSMLVEAFAAKTTSKAQFKS  238

Query  327  KGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKL  181
            +G+G +     +F A ++RTR+ FFS++YHTR DDF SLCGPV+D V++
Sbjct  239  EGKGKFSTYNFQFTAVSDRTRLTFFSSFYHTRIDDFGSLCGPVLDEVRV  287



>ref|XP_010695068.1| PREDICTED: uncharacterized protein LOC104907775 [Beta vulgaris 
subsp. vulgaris]
Length=365

 Score =   180 bits (456),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 86/169 (51%), Positives = 118/169 (70%), Gaps = 1/169 (1%)
 Frame = -1

Query  687  ELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVPHG  508
             L++  GF  GP R+    +   LP        P LP W +ESLKAVKYID  HF+VP G
Sbjct  197  NLIRNGGFEEGPYRILNTSNGILLPPKQEDINSP-LPGWVIESLKAVKYIDKRHFNVPFG  255

Query  507  RRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPYES  328
            R A+ELVAG+ESA+ Q+ RTV  K Y+LTF +GDA N C+GSM++EAFAG  TLK P+ S
Sbjct  256  RSAIELVAGRESAIAQVIRTVPNKVYNLTFTIGDAKNSCKGSMLVEAFAGRDTLKAPFLS  315

Query  327  KGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKL  181
            +G G ++   ++F+A ++RTR+ FFS+YYH+++D F  LCGPV+D V++
Sbjct  316  QGLGKFQTVSMKFKAISDRTRITFFSSYYHSKADGFGILCGPVLDEVRV  364



>gb|KJB19257.1| hypothetical protein B456_003G091800 [Gossypium raimondii]
Length=341

 Score =   179 bits (454),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 97/172 (56%), Positives = 114/172 (66%), Gaps = 2/172 (1%)
 Frame = -1

Query  699  TYQR-ELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHF  523
            TY R  LVK  GF  GP           LP     R  P L  W +ESLK VKYID +HF
Sbjct  165  TYTRGNLVKNGGFETGPHTFKNFSTGVLLPPKKLDRISP-LVGWIIESLKPVKYIDKKHF  223

Query  522  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  343
            SVP G  AVELVAG+ESA+ QI RTV  KFY LTF VGDA N C GSM+++AFAG  TL+
Sbjct  224  SVPSGLFAVELVAGRESAIAQIIRTVPNKFYTLTFTVGDAKNGCHGSMMVQAFAGKETLQ  283

Query  342  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFV  187
            VPY S+G+GG K A  RF+A + RTR+ FFS YYHT+ DD+  +CGPV+D V
Sbjct  284  VPYVSQGKGGLKTASFRFQAISARTRITFFSAYYHTKLDDYGHICGPVLDDV  335



>ref|XP_011016219.1| PREDICTED: uncharacterized protein LOC105119742 [Populus euphratica]
Length=369

 Score =   179 bits (455),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 80/134 (60%), Positives = 106/134 (79%), Gaps = 0/134 (0%)
 Frame = -1

Query  582  LPAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDA  403
            LP W +ESLK VKYID++HF VP G  A+E+VAG+ESA+ QI RT+  KFY+L+F +GDA
Sbjct  232  LPGWIIESLKPVKYIDSKHFFVPTGFAAIEMVAGRESAIAQIIRTIPNKFYNLSFTIGDA  291

Query  402  SNKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDD  223
             N C GSM++EAFAG  TLKVPY S+G+GGYK A LRF+A ++RTR+ F+S YYHT+  D
Sbjct  292  KNACHGSMMVEAFAGRETLKVPYVSRGKGGYKTATLRFKAISSRTRITFYSGYYHTKLHD  351

Query  222  FVSLCGPVVDFVKL  181
            +  +CGPV+D V++
Sbjct  352  YGHMCGPVLDDVRV  365



>ref|XP_011025472.1| PREDICTED: uncharacterized protein LOC105126334 [Populus euphratica]
Length=365

 Score =   179 bits (454),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 90/169 (53%), Positives = 114/169 (67%), Gaps = 1/169 (1%)
 Frame = -1

Query  687  ELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVPHG  508
             LVK  GF  GP R+    +   LP+       P LP W +ESLKAVK+ID  HF+VP G
Sbjct  194  NLVKNHGFEEGPRRLVNASNGILLPSRQEDLTSP-LPGWIIESLKAVKFIDKRHFNVPFG  252

Query  507  RRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPYES  328
              AVELVAG+ESA+ QI RT   K Y L F +GDA N C GSM++EAFA   T KVP+ES
Sbjct  253  LAAVELVAGRESAIAQILRTAPNKVYSLAFTIGDARNGCHGSMMVEAFAAGDTFKVPFES  312

Query  327  KGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKL  181
            KG+G  K +  +F+A + RTR+ F+S+YYHTR DD+ SLCGPV+D V++
Sbjct  313  KGKGESKTSSFKFKAISARTRITFYSSYYHTRIDDYGSLCGPVLDEVRV  361



>ref|XP_008364711.1| PREDICTED: uncharacterized protein LOC103428382 [Malus domestica]
Length=367

 Score =   179 bits (454),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 92/172 (53%), Positives = 119/172 (69%), Gaps = 3/172 (2%)
 Frame = -1

Query  687  ELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVPHG  508
             LV+  GF   P R+    H   LP        P LP W +ESLKAVK+ID+ HF+VP G
Sbjct  198  NLVRNPGFEEAPHRLLNSSHGVLLPPKQLDVTSP-LPGWIIESLKAVKFIDSNHFNVPVG  256

Query  507  RRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPYES  328
            + AVELVAG+ESA+ QI RTV  K Y L+F VGDA N C+GSM++EAFAG  TLKVP+ S
Sbjct  257  KGAVELVAGRESAIAQIIRTVPNKLYSLSFTVGDARNGCQGSMMVEAFAGKDTLKVPFAS  316

Query  327  KGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  172
            KG+ G+K A  RF+A + RTR+ FFS++YHT+  D+ +LCGP++D VK+  V
Sbjct  317  KGKCGFKKASFRFKAVSIRTRITFFSSFYHTK--DYGALCGPILDEVKVSPV  366



>gb|KHN11697.1| hypothetical protein glysoja_006150 [Glycine soja]
Length=367

 Score =   179 bits (454),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 88/172 (51%), Positives = 116/172 (67%), Gaps = 1/172 (1%)
 Frame = -1

Query  687  ELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVPHG  508
             LVK  GF  GP  +    +   LP        P LP W +ESLKAVK+IDA+HF+VP G
Sbjct  196  NLVKNPGFEEGPFPIFNSTNGVLLPPEQEDHVSP-LPGWMIESLKAVKFIDAKHFNVPFG  254

Query  507  RRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPYES  328
            + AVEL+AG+ES + QI RTV  K Y++ F +GDA N C GSM++EAFA   TLKVP++S
Sbjct  255  QGAVELIAGRESVIAQILRTVPNKIYNMKFTIGDARNGCHGSMMIEAFAAKDTLKVPFKS  314

Query  327  KGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  172
            +G+G +K    +FRA  NRTR+ F+S++YHTR  D+ SLCGPV+D V +  V
Sbjct  315  EGKGEFKTVSFKFRAIENRTRITFYSSFYHTRIHDYGSLCGPVIDQVIVYPV  366



>ref|XP_004981346.1| PREDICTED: uncharacterized protein LOC101768647 [Setaria italica]
Length=389

 Score =   179 bits (455),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 92/172 (53%), Positives = 117/172 (68%), Gaps = 1/172 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
            +  L+K  GF  GP           LP        P LP W +ESLKAV++IDA HFSVP
Sbjct  213  KDNLIKNAGFEIGPQVFKNSSVGVLLPPKQKDTTSP-LPGWIIESLKAVRFIDAAHFSVP  271

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             G+ AVELVAG+ESA+ Q+ RTV  + Y+L+F VGDA N C GSM++EAFAG  T KVP+
Sbjct  272  EGQYAVELVAGRESAIAQVIRTVPNRAYNLSFAVGDAKNGCHGSMLVEAFAGNVTQKVPF  331

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLV  178
            ES G+G +K A  RF A+  RTR+ F+S+YYHT++ D VSLCGPV+D VK+V
Sbjct  332  ESAGKGAFKAAGFRFVASGVRTRLTFYSSYYHTKASDGVSLCGPVLDQVKVV  383



>ref|XP_006411450.1| hypothetical protein EUTSA_v10016825mg [Eutrema salsugineum]
 gb|ESQ52903.1| hypothetical protein EUTSA_v10016825mg [Eutrema salsugineum]
Length=370

 Score =   179 bits (454),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 82/138 (59%), Positives = 105/138 (76%), Gaps = 0/138 (0%)
 Frame = -1

Query  582  LPAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDA  403
            LP W VESLK VKYID  HF+VP G  A+E++AG+ESA+ QI RTVAGK+Y L+F+VGDA
Sbjct  233  LPGWIVESLKPVKYIDNGHFNVPSGHAAIEIIAGRESAIAQIIRTVAGKYYILSFVVGDA  292

Query  402  SNKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDD  223
             N C GSM++EAFAG ST K+ +ES G+G  K  + RFRA +NRTR+ F+S +YHT+  D
Sbjct  293  HNGCHGSMMVEAFAGRSTFKLRFESNGKGAVKVGRFRFRADSNRTRITFYSGFYHTKLHD  352

Query  222  FVSLCGPVVDFVKLVSVR  169
            F  LCGPV+D V++V  R
Sbjct  353  FGHLCGPVLDNVRVVMTR  370



>ref|XP_011048055.1| PREDICTED: uncharacterized protein LOC105142230 [Populus euphratica]
Length=365

 Score =   179 bits (453),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 92/169 (54%), Positives = 114/169 (67%), Gaps = 1/169 (1%)
 Frame = -1

Query  687  ELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVPHG  508
             LVK  GF  GP           LP     +  P LP W +ESLK VKYID++HF VP G
Sbjct  194  NLVKNGGFEVGPHMFKNFSTGVLLPPKQQDQISP-LPGWIIESLKPVKYIDSKHFFVPEG  252

Query  507  RRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPYES  328
              A+ELVAG+ESAV QI RT+  KFY+LTF VGDA N C GSM++EAFA   T+KVPY S
Sbjct  253  FAAIELVAGRESAVAQIIRTIPDKFYNLTFTVGDAKNACHGSMMVEAFAAKETVKVPYVS  312

Query  327  KGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKL  181
            +G+GGYK A LRF+A + RTR+ F+S YYHT+  D+  +CGPV+D V +
Sbjct  313  QGKGGYKTAILRFQAISARTRITFYSAYYHTKLHDYGHMCGPVLDDVSV  361



>ref|XP_009104452.1| PREDICTED: uncharacterized protein LOC103830427 [Brassica rapa]
Length=404

 Score =   172 bits (437),  Expect(2) = 5e-50, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 101/138 (73%), Gaps = 0/138 (0%)
 Frame = -1

Query  582  LPAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDA  403
            LP W +ESLKAVKY+D  HF VP G RA+ELV GKESAV+QI RT   KFY LTF VGDA
Sbjct  228  LPGWIIESLKAVKYVDKAHFFVPEGHRAIELVGGKESAVSQIVRTSPNKFYALTFNVGDA  287

Query  402  SNKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDD  223
             + CEG M +EAFAG     V Y SKG+GG+K  +L F+A + RTRV F ST+YH ++D 
Sbjct  288  RDGCEGPMAVEAFAGRGKTLVEYVSKGKGGFKRGRLVFKAVSARTRVTFLSTFYHMKNDH  347

Query  222  FVSLCGPVVDFVKLVSVR  169
              SLCGPVVD V+LV+V+
Sbjct  348  SGSLCGPVVDDVRLVAVK  365


 Score = 53.1 bits (126),  Expect(2) = 5e-50, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR +  NL+KN +FEEGPYVF     GVL PPF EDD+ P
Sbjct  188  PRFSGYNLIKNGNFEEGPYVFSTAKWGVLIPPFIEDDNSP  227



>ref|XP_003534397.1| PREDICTED: uncharacterized protein LOC100812299 [Glycine max]
Length=367

 Score =   178 bits (452),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 88/172 (51%), Positives = 116/172 (67%), Gaps = 1/172 (1%)
 Frame = -1

Query  687  ELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVPHG  508
             LVK  GF  GP  +    +   LP        P LP W +ESLKAVK+IDA+HF+VP G
Sbjct  196  NLVKNPGFEVGPFPIFNSTNGVLLPPEQEDHVSP-LPGWMIESLKAVKFIDAKHFNVPFG  254

Query  507  RRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPYES  328
            + AVEL+AG+ES + QI RTV  K Y++ F +GDA N C GSM++EAFA   TLKVP++S
Sbjct  255  QGAVELIAGRESVIAQILRTVPNKIYNMKFTIGDARNGCHGSMMIEAFAAKDTLKVPFKS  314

Query  327  KGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  172
            +G+G +K    +FRA  NRTR+ F+S++YHTR  D+ SLCGPV+D V +  V
Sbjct  315  EGKGEFKTVSFKFRAIENRTRITFYSSFYHTRIHDYGSLCGPVIDQVIVYPV  366



>ref|NP_001144239.1| uncharacterized protein LOC100277106 precursor [Zea mays]
 gb|ACG38935.1| hypothetical protein [Zea mays]
Length=390

 Score =   179 bits (453),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 93/175 (53%), Positives = 120/175 (69%), Gaps = 1/175 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
            +  L+K  GF  GP  +        LP        P LP W +ESLKAV++IDA HFSVP
Sbjct  216  KDNLIKNDGFEIGPQVLRNSTVGVLLPPKQKDATSP-LPGWIIESLKAVRFIDAAHFSVP  274

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             G+ AVELVAG+ESA+ Q+ RTV  + Y+L+F VGDA N C GSM++EAFAG  T KVP+
Sbjct  275  AGQYAVELVAGRESAIAQVIRTVPNRAYNLSFAVGDARNGCHGSMLVEAFAGNVTQKVPF  334

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  169
            +S G+GG+K A  RF A+  RTR+ F+S+YYHT+  D VSLCGPV+D VK+V V+
Sbjct  335  DSTGKGGFKTAAFRFVASGVRTRLTFYSSYYHTKVTDGVSLCGPVLDQVKVVPVK  389



>ref|XP_002887838.1| hypothetical protein ARALYDRAFT_340195 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64097.1| hypothetical protein ARALYDRAFT_340195 [Arabidopsis lyrata subsp. 
lyrata]
Length=371

 Score =   178 bits (452),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 91/173 (53%), Positives = 114/173 (66%), Gaps = 1/173 (1%)
 Frame = -1

Query  687  ELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVPHG  508
             L+K   F  GP   P  +    +P        P LP W +ESLKAVKY+D  HF+VP G
Sbjct  196  NLIKNGNFEEGPYVFPTAKSGVLIPPFIEDDNSP-LPGWMIESLKAVKYVDKAHFAVPEG  254

Query  507  RRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPYES  328
             RA+ELV GKESA++QI RT   KFY LTF VGDA + CEG M +EAFAG   + V Y S
Sbjct  255  HRAIELVGGKESAISQIVRTSLNKFYALTFSVGDARDGCEGPMTVEAFAGQGKVMVDYAS  314

Query  327  KGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  169
            KG+GG++  +L F+A + RTRV F ST+YH +SD   SLCGPV+D V+LV+VR
Sbjct  315  KGKGGFRRGRLVFKAVSARTRVTFLSTFYHMKSDHSGSLCGPVIDDVRLVAVR  367


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR +  NL+KN +FEEGPYVFP   +GVL PPF EDD+ P
Sbjct  190  PRFSGYNLIKNGNFEEGPYVFPTAKSGVLIPPFIEDDNSP  229



>emb|CDY57694.1| BnaA07g38340D [Brassica napus]
Length=370

 Score =   172 bits (435),  Expect(2) = 7e-50, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 101/138 (73%), Gaps = 0/138 (0%)
 Frame = -1

Query  582  LPAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDA  403
            LP W +ESLKAVKY+D  HF VP G RA+ELV GKESAV+QI RT   KFY LTF VGDA
Sbjct  229  LPGWIIESLKAVKYVDKAHFFVPEGHRAIELVGGKESAVSQIVRTSPNKFYALTFNVGDA  288

Query  402  SNKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDD  223
             + CEG M +EAFAG     V Y SKG+GG+K  +L F+A + RTRV F ST+YH ++D 
Sbjct  289  RDACEGPMAVEAFAGRGKTLVEYVSKGKGGFKRGRLVFKAVSARTRVTFLSTFYHMKNDH  348

Query  222  FVSLCGPVVDFVKLVSVR  169
              SLCGPVVD V+LV+V+
Sbjct  349  SGSLCGPVVDDVRLVAVK  366


 Score = 53.1 bits (126),  Expect(2) = 7e-50, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR +  NL+KN +FEEGPYVF     GVL PPF EDD+ P
Sbjct  189  PRFSGYNLIKNGNFEEGPYVFSTAKWGVLIPPFIEDDNSP  228



>gb|AGV54808.1| hypothetical protein [Phaseolus vulgaris]
Length=367

 Score =   177 bits (450),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 88/172 (51%), Positives = 117/172 (68%), Gaps = 1/172 (1%)
 Frame = -1

Query  687  ELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVPHG  508
             LVK  GF  GP  +    +   LP        P LP W +ESLKAVK+ID++HF+VP G
Sbjct  196  NLVKNPGFEEGPFPIFNSTNGVLLPPQQQDGFSP-LPGWIIESLKAVKFIDSKHFNVPFG  254

Query  507  RRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPYES  328
              AVELVAG+ESA+ Q+ RT   K Y++TF VGDA N C GSM++EAFA   T KVP++S
Sbjct  255  LGAVELVAGRESAIAQVIRTDTNKVYNITFSVGDAKNGCNGSMMVEAFAAKDTFKVPFKS  314

Query  327  KGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  172
            +G+G ++    +F+A A RTR+ F+S++YHTRSDD+ SLCGPV+D V +  V
Sbjct  315  EGKGTFRTVSFKFKAIAKRTRLTFYSSFYHTRSDDYGSLCGPVIDQVIVFPV  366



>tpg|DAA52069.1| TPA: hypothetical protein ZEAMMB73_133538 [Zea mays]
Length=390

 Score =   178 bits (451),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 93/175 (53%), Positives = 119/175 (68%), Gaps = 1/175 (1%)
 Frame = -1

Query  693  QRELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVP  514
            +  L+K  GF  GP  +        LP        P LP W +ESLKAV++IDA HFSVP
Sbjct  216  KDNLIKNDGFEIGPQVLRNSTVGVLLPPKQKDATSP-LPGWIIESLKAVRFIDAAHFSVP  274

Query  513  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  334
             G+ AVELVAG+ESA+ Q+ RTV  + Y+L+F VGDA N C GSM++EAFAG  T KVP+
Sbjct  275  AGQYAVELVAGRESAIAQVIRTVPNRAYNLSFAVGDARNGCHGSMLVEAFAGNVTQKVPF  334

Query  333  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  169
            +S G+GG+K A  RF A   RTR+ F+S+YYHT+  D VSLCGPV+D VK+V V+
Sbjct  335  DSAGKGGFKTAAFRFVAGGVRTRLTFYSSYYHTKVTDGVSLCGPVLDQVKVVPVK  389



>ref|XP_002313314.1| hypothetical protein POPTR_0009s06370g [Populus trichocarpa]
 gb|EEE87269.1| hypothetical protein POPTR_0009s06370g [Populus trichocarpa]
Length=365

 Score =   177 bits (449),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 89/169 (53%), Positives = 113/169 (67%), Gaps = 1/169 (1%)
 Frame = -1

Query  687  ELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVPHG  508
             LV+  GF  GP R+    +   LP        P LP W +ESLKAVK+ID  HF+VP G
Sbjct  194  NLVRNHGFEEGPHRLVNTSNGILLPPRQEDLTSP-LPGWIIESLKAVKFIDKRHFNVPFG  252

Query  507  RRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPYES  328
              AVELVAG+ESA+ QI RT   K Y L F +GDA N C GSM++EAFA   T KVP+ES
Sbjct  253  LAAVELVAGRESAIAQILRTTPNKVYSLAFTIGDARNGCHGSMMVEAFAAGDTFKVPFES  312

Query  327  KGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKL  181
            KG+G  K A  +F+A + RTR+ F+S+YYHTR DD+ SLCGP++D V++
Sbjct  313  KGKGESKSASFKFKAISARTRITFYSSYYHTRIDDYGSLCGPILDEVRV  361



>ref|NP_178141.1| protein DUF642 L-GALL RESPONSIVE GENE 1 [Arabidopsis thaliana]
 gb|AAD55477.1|AC009322_17 Unknown protein [Arabidopsis thaliana]
 gb|ACD85595.1| At1g80240 [Arabidopsis thaliana]
 gb|AEE36374.1| uncharacterized protein AT1G80240 [Arabidopsis thaliana]
Length=370

 Score =   177 bits (449),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 90/172 (52%), Positives = 114/172 (66%), Gaps = 1/172 (1%)
 Frame = -1

Query  687  ELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVPHG  508
             L+K   F  GP   P  +    +P        P LP W +ESLKAVKY+D  HF+VP G
Sbjct  195  NLIKNGNFEEGPYVFPTAKWGVLIPPFIEDDNSP-LPGWMIESLKAVKYVDKAHFAVPEG  253

Query  507  RRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPYES  328
             RA+ELV GKESA++QI RT   KFY LTF VGDA + CEG M++EAFAG   + V Y S
Sbjct  254  HRAIELVGGKESAISQIVRTSLNKFYALTFNVGDARDGCEGPMIVEAFAGQGKVMVDYAS  313

Query  327  KGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  172
            KG+GG++  +L F+A + RTRV F ST+YH +SD   SLCGPV+D V+LV+V
Sbjct  314  KGKGGFRRGRLVFKAVSARTRVTFLSTFYHMKSDHSGSLCGPVIDDVRLVAV  365


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = -2

Query  704  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHFP  585
            PR +  NL+KN +FEEGPYVFP    GVL PPF EDD+ P
Sbjct  189  PRFSGYNLIKNGNFEEGPYVFPTAKWGVLIPPFIEDDNSP  228



>ref|XP_007148907.1| hypothetical protein PHAVU_005G024100g [Phaseolus vulgaris]
 gb|ESW20901.1| hypothetical protein PHAVU_005G024100g [Phaseolus vulgaris]
Length=367

 Score =   177 bits (449),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 88/172 (51%), Positives = 117/172 (68%), Gaps = 1/172 (1%)
 Frame = -1

Query  687  ELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVPHG  508
             LVK  GF  GP  +    +   LP        P LP W +ESLKAVK+ID++HF+VP G
Sbjct  196  NLVKNPGFEEGPFPIFNSTNGVLLPPQQQDGFSP-LPGWIIESLKAVKFIDSKHFNVPFG  254

Query  507  RRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPYES  328
              AVELVAG+ESA+ Q+ RT   K Y++TF VGDA N C GSM++EAFA   T KVP++S
Sbjct  255  LGAVELVAGRESAIAQVIRTDTNKVYNITFSVGDAKNGCNGSMMVEAFAAKDTFKVPFKS  314

Query  327  KGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  172
            +G+G ++    +F+A A RTR+ F+S++YHTRSDD+ SLCGPV+D V +  V
Sbjct  315  EGKGTFRTVSFKFKAIAKRTRLTFYSSFYHTRSDDYGSLCGPVIDQVIVFPV  366



>gb|AFK39148.1| unknown [Lotus japonicus]
Length=367

 Score =   177 bits (449),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 91/172 (53%), Positives = 115/172 (67%), Gaps = 1/172 (1%)
 Frame = -1

Query  687  ELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVPHG  508
             LVK   F  GP  +    +   LP     R  P LP W +ESLKAVK+IDA+HF+VP G
Sbjct  196  NLVKNPSFEEGPFPIFNSTNGVLLPPQQQDRFSP-LPGWIIESLKAVKFIDAKHFNVPFG  254

Query  507  RRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPYES  328
              AVELVAG+ESA+ QI RT   K Y++TF VGDA N C GSM++EAFA   T KVP++S
Sbjct  255  LGAVELVAGRESAIAQIIRTETNKVYNITFSVGDAKNGCHGSMMVEAFAAKDTFKVPFKS  314

Query  327  KGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  172
             G+G +     +F+A A RTR+ F+S+YYHTR+DDF SLCGPV+D V +  V
Sbjct  315  VGKGKFVTVSFKFKAIAPRTRLTFYSSYYHTRTDDFGSLCGPVLDRVIVFPV  366



>ref|NP_001239749.1| uncharacterized protein LOC100804119 precursor [Glycine max]
 gb|ACU23170.1| unknown [Glycine max]
 gb|KHM99195.1| hypothetical protein glysoja_035460 [Glycine soja]
Length=367

 Score =   177 bits (449),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 90/172 (52%), Positives = 116/172 (67%), Gaps = 1/172 (1%)
 Frame = -1

Query  687  ELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVPHG  508
             LVK  GF  GP  +    +   LP        P LP W +ESLKAVK+ID++HF+VP G
Sbjct  196  NLVKNPGFEEGPFPIFNSTNGVLLPPQQQDGFSP-LPGWIIESLKAVKFIDSKHFNVPFG  254

Query  507  RRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPYES  328
              AVELVAG+ESA+ QI RTV  K Y++TF VGDA N C GSM++EAFA   T K P++S
Sbjct  255  LGAVELVAGRESAIAQIIRTVTNKVYNITFSVGDAKNGCHGSMMVEAFAAKDTFKAPFKS  314

Query  327  KGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  172
            +G+G +K    +F+A A RTR+ F+S++YHTR DD+ SLCGPVVD V +  V
Sbjct  315  EGKGTFKTVSFKFKAIAPRTRLTFYSSFYHTRIDDYGSLCGPVVDQVIVFPV  366



>ref|NP_001241275.1| uncharacterized protein LOC100796094 precursor [Glycine max]
 ref|XP_006597038.1| PREDICTED: uncharacterized protein LOC100796094 isoform X1 [Glycine 
max]
 gb|ACU18215.1| unknown [Glycine max]
Length=367

 Score =   177 bits (448),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 90/172 (52%), Positives = 116/172 (67%), Gaps = 1/172 (1%)
 Frame = -1

Query  687  ELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVPHG  508
             LVK  GF  GP  +    +   LP        P LP W +ESLKAVK+ID++HF+VP G
Sbjct  196  NLVKNPGFEEGPFPIFNSTNGVLLPPQQQDGFSP-LPGWIIESLKAVKFIDSKHFNVPFG  254

Query  507  RRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPYES  328
              AVELVAG+ESA+ QI RTV  K Y++TF VGDA N C GSM++EAFA   T KVP++S
Sbjct  255  LGAVELVAGRESAIAQIIRTVTNKVYNITFSVGDAKNGCHGSMMVEAFAAKDTFKVPFKS  314

Query  327  KGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  172
            +G+G  K    +F+A A RTR+ F+S++YHTR DD+ SLCGPV+D V +  V
Sbjct  315  EGKGTSKTVSFKFKAIAPRTRLTFYSSFYHTRIDDYGSLCGPVIDQVIVFPV  366



>ref|XP_002308027.2| hypothetical protein POPTR_0006s04880g [Populus trichocarpa]
 gb|EEE91550.2| hypothetical protein POPTR_0006s04880g [Populus trichocarpa]
Length=369

 Score =   177 bits (449),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 80/134 (60%), Positives = 103/134 (77%), Gaps = 0/134 (0%)
 Frame = -1

Query  582  LPAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDA  403
            LP W +ESLK VKYID +HF VP G  A+E+VAG+ESA+ Q+ RT+  KFY+LTF +GDA
Sbjct  232  LPGWIIESLKPVKYIDNKHFFVPTGFAAIEMVAGRESAIAQVIRTIPDKFYNLTFTIGDA  291

Query  402  SNKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDD  223
             N C GSM++EAFA   TLKVPY S+G+GGYK A LRFRA + RTR+ F+S YYHT+  D
Sbjct  292  KNACHGSMMVEAFAARETLKVPYVSQGKGGYKTATLRFRAISARTRITFYSAYYHTKLHD  351

Query  222  FVSLCGPVVDFVKL  181
            +  +CGPV+D V++
Sbjct  352  YGHMCGPVLDDVRV  365



>gb|KHN45084.1| hypothetical protein glysoja_040000 [Glycine soja]
Length=367

 Score =   177 bits (448),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 90/172 (52%), Positives = 116/172 (67%), Gaps = 1/172 (1%)
 Frame = -1

Query  687  ELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVPHG  508
             LVK  GF  GP  +    +   LP        P LP W +ESLKAVK+ID++HF+VP G
Sbjct  196  NLVKNPGFEEGPFPIFNSTNGVLLPPQQQDGFSP-LPGWIIESLKAVKFIDSKHFNVPFG  254

Query  507  RRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPYES  328
              AVELVAG+ESA+ QI RTV  K Y++TF VGDA N C GSM++EAFA   T KVP++S
Sbjct  255  LGAVELVAGRESAIAQIIRTVTNKVYNITFSVGDAKNGCHGSMMVEAFAAKDTFKVPFKS  314

Query  327  KGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  172
            +G+G  K    +F+A A RTR+ F+S++YHTR DD+ SLCGPV+D V +  V
Sbjct  315  EGKGTSKTVSFKFKAIAPRTRLTFYSSFYHTRIDDYGSLCGPVIDQVIVFPV  366



>ref|XP_002308942.2| hypothetical protein POPTR_0006s04890g [Populus trichocarpa]
 gb|EEE92465.2| hypothetical protein POPTR_0006s04890g [Populus trichocarpa]
Length=373

 Score =   177 bits (448),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 89/169 (53%), Positives = 113/169 (67%), Gaps = 1/169 (1%)
 Frame = -1

Query  687  ELVKKLGF*GGPIRVPQGRHRRSLPAVHGGRPLPRLPAWTVESLKAVKYIDAEHFSVPHG  508
             LVK  GF  GP           LP     +  P LP W +ESLK VKYID++HF VP G
Sbjct  202  NLVKNGGFEVGPHMFKNFSTGVLLPPKQQDQISP-LPGWIIESLKPVKYIDSKHFFVPEG  260

Query  507  RRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPYES  328
              A+ELVAG+ESA+ Q+ RT+  KFY+LTF VGDA N C GSM++EAFA   T+KVPY S
Sbjct  261  FAAIELVAGRESAIAQVIRTIPDKFYNLTFTVGDAKNACHGSMMVEAFAAKETVKVPYVS  320

Query  327  KGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKL  181
            +G+GGYK A LRF+A + RTR+ F+S YYH +  D+  +CGPV+D V +
Sbjct  321  QGKGGYKTAILRFQAVSARTRITFYSAYYHNKQHDYGHMCGPVLDDVSV  369



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1206563851350