BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF029B09

Length=772
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_002510391.1|  60S ribosomal protein L11, putative                337   8e-114   Ricinus communis
gb|KDP21119.1|  hypothetical protein JCGZ_21590                         336   9e-114   Jatropha curcas
ref|XP_009138940.1|  PREDICTED: 60S ribosomal protein L11-1-like        337   1e-113   Brassica rapa
ref|XP_009628928.1|  PREDICTED: 60S ribosomal protein L11-1             335   2e-113   Nicotiana tomentosiformis
ref|XP_011082984.1|  PREDICTED: 60S ribosomal protein L11               335   2e-113   Sesamum indicum [beniseed]
gb|EYU21905.1|  hypothetical protein MIMGU_mgv1a014651mg                335   3e-113   Erythranthe guttata [common monkey flower]
gb|EYU29260.1|  hypothetical protein MIMGU_mgv1a014673mg                335   4e-113   Erythranthe guttata [common monkey flower]
ref|XP_009132192.1|  PREDICTED: 60S ribosomal protein L11-2 isofo...    334   6e-113   Brassica rapa
ref|XP_006398262.1|  hypothetical protein EUTSA_v10001041mg             334   6e-113   Eutrema salsugineum [saltwater cress]
emb|CDX71934.1|  BnaC08g29400D                                          337   7e-113   
emb|CDY26360.1|  BnaA02g24100D                                          336   8e-113   Brassica napus [oilseed rape]
ref|XP_011081868.1|  PREDICTED: 60S ribosomal protein L11-like          334   1e-112   Sesamum indicum [beniseed]
ref|XP_006850965.1|  hypothetical protein AMTR_s00025p00203150          334   1e-112   Amborella trichopoda
ref|XP_009629723.1|  PREDICTED: 60S ribosomal protein L11-1-like        333   1e-112   Nicotiana tomentosiformis
ref|XP_004134655.1|  PREDICTED: 60S ribosomal protein L11-1-like        333   2e-112   Cucumis sativus [cucumbers]
ref|XP_002522234.1|  60S ribosomal protein L11, putative                333   2e-112   Ricinus communis
ref|XP_010525185.1|  PREDICTED: 60S ribosomal protein L11-1             333   2e-112   Tarenaya hassleriana [spider flower]
ref|NP_001266161.1|  60S ribosomal protein L11-like                     333   2e-112   Cicer arietinum [garbanzo]
ref|NP_191429.1|  60S ribosomal protein L11-2                           333   2e-112   Arabidopsis thaliana [mouse-ear cress]
ref|NP_850376.2|  60S ribosomal protein L16A                            333   2e-112   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006446820.1|  hypothetical protein CICLE_v10016875mg             333   2e-112   Citrus clementina [clementine]
ref|XP_011088013.1|  PREDICTED: 60S ribosomal protein L11-like          333   3e-112   Sesamum indicum [beniseed]
ref|XP_007215050.1|  hypothetical protein PRUPE_ppa012119mg             333   3e-112   Prunus persica
gb|EYU41113.1|  hypothetical protein MIMGU_mgv1a014638mg                333   3e-112   Erythranthe guttata [common monkey flower]
ref|XP_010246451.1|  PREDICTED: 60S ribosomal protein L11-like          333   3e-112   Nelumbo nucifera [Indian lotus]
ref|XP_009626014.1|  PREDICTED: 60S ribosomal protein L11-1-like        332   3e-112   Nicotiana tomentosiformis
emb|CDY49245.1|  BnaA09g55240D                                          335   3e-112   Brassica napus [oilseed rape]
ref|XP_010529208.1|  PREDICTED: 60S ribosomal protein L11-1-like        332   4e-112   Tarenaya hassleriana [spider flower]
ref|XP_009132184.1|  PREDICTED: 60S ribosomal protein L11-2 isofo...    332   4e-112   Brassica rapa
emb|CDX87764.1|  BnaC02g31850D                                          334   4e-112   
ref|XP_006414065.1|  hypothetical protein EUTSA_v10026344mg             332   5e-112   Eutrema salsugineum [saltwater cress]
emb|CDX99436.1|  BnaC01g11160D                                          332   5e-112   
ref|XP_008225318.1|  PREDICTED: 60S ribosomal protein L11               332   5e-112   Prunus mume [ume]
emb|CAA57395.1|  ribosomal protein L16                                  332   6e-112   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008381196.1|  PREDICTED: 60S ribosomal protein L11 isoform X2    332   6e-112   Malus domestica [apple tree]
ref|XP_006843688.1|  hypothetical protein AMTR_s00007p00200160          332   6e-112   Amborella trichopoda
gb|ABK22492.1|  unknown                                                 332   7e-112   Picea sitchensis
ref|XP_009790976.1|  PREDICTED: 60S ribosomal protein L11-1             332   7e-112   Nicotiana sylvestris
ref|XP_004505457.1|  PREDICTED: 60S ribosomal protein L11-like          332   8e-112   
gb|KFK28544.1|  hypothetical protein AALP_AA7G010400                    332   8e-112   Arabis alpina [alpine rockcress]
sp|P46287.1|RL11_MEDSA  RecName: Full=60S ribosomal protein L11; ...    331   9e-112   Medicago sativa [alfalfa]
ref|XP_010052848.1|  PREDICTED: 60S ribosomal protein L11-1             331   1e-111   Eucalyptus grandis [rose gum]
ref|XP_010274422.1|  PREDICTED: 60S ribosomal protein L11               331   1e-111   Nelumbo nucifera [Indian lotus]
gb|AFK48866.1|  unknown                                                 331   1e-111   Lotus japonicus
ref|XP_002880003.1|  60S ribosomal protein L11                          331   1e-111   Arabidopsis lyrata subsp. lyrata
emb|CAA57394.1|  ribosomal protein L16                                  331   1e-111   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006449533.1|  hypothetical protein CICLE_v10016873mg             331   1e-111   Citrus clementina [clementine]
ref|XP_002876475.1|  60S ribosomal protein L11                          331   1e-111   
gb|AAR83867.1|  ribosomal protein L11-like protein                      331   1e-111   Capsicum annuum
ref|XP_009378940.1|  PREDICTED: 60S ribosomal protein L11 isoform X2    331   2e-111   Pyrus x bretschneideri [bai li]
ref|XP_002309361.1|  60S ribosomal protein L11                          331   2e-111   Populus trichocarpa [western balsam poplar]
ref|XP_009116550.1|  PREDICTED: 60S ribosomal protein L11-1             331   2e-111   Brassica rapa
ref|XP_010689742.1|  PREDICTED: 60S ribosomal protein L11-1 isofo...    331   2e-111   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009351472.1|  PREDICTED: 60S ribosomal protein L11               331   2e-111   Pyrus x bretschneideri [bai li]
ref|XP_010427776.1|  PREDICTED: 60S ribosomal protein L11-1-like        331   2e-111   Camelina sativa [gold-of-pleasure]
ref|XP_008345917.1|  PREDICTED: 60S ribosomal protein L11               331   2e-111   Malus domestica [apple tree]
ref|XP_006285819.1|  hypothetical protein CARUB_v10007309mg             331   2e-111   Capsella rubella
ref|XP_008443441.1|  PREDICTED: 60S ribosomal protein L11-1             330   2e-111   Cucumis melo [Oriental melon]
ref|XP_010052835.1|  PREDICTED: 60S ribosomal protein L11-1-like        330   2e-111   Eucalyptus grandis [rose gum]
pir||T04865  ribosomal protein L11, cytosolic - Arabidopsis thaliana    330   2e-111   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011039398.1|  PREDICTED: 60S ribosomal protein L11               330   2e-111   Populus euphratica
ref|XP_008228941.1|  PREDICTED: 60S ribosomal protein L11 isoform X1    330   2e-111   Prunus mume [ume]
ref|XP_010538574.1|  PREDICTED: 60S ribosomal protein L11-1-like ...    330   2e-111   Tarenaya hassleriana [spider flower]
ref|XP_010538572.1|  PREDICTED: 60S ribosomal protein L11-1-like ...    330   3e-111   Tarenaya hassleriana [spider flower]
ref|XP_009365286.1|  PREDICTED: 60S ribosomal protein L11 isoform X2    330   3e-111   Pyrus x bretschneideri [bai li]
ref|NP_001237077.1|  uncharacterized protein LOC100499863               330   3e-111   Glycine max [soybeans]
gb|KHG23956.1|  60S ribosomal L11-2 -like protein                       330   3e-111   Gossypium arboreum [tree cotton]
ref|XP_011033383.1|  PREDICTED: 60S ribosomal protein L11-like          330   3e-111   Populus euphratica
gb|AFK35020.1|  unknown                                                 330   4e-111   Lotus japonicus
ref|XP_010052179.1|  PREDICTED: 60S ribosomal protein L11-1             330   4e-111   Eucalyptus grandis [rose gum]
ref|XP_008381195.1|  PREDICTED: 60S ribosomal protein L11 isoform X1    330   4e-111   Malus domestica [apple tree]
ref|XP_002281886.1|  PREDICTED: 60S ribosomal protein L11               330   4e-111   Vitis vinifera
ref|XP_003540015.1|  PREDICTED: 60S ribosomal protein L11-like          330   4e-111   
ref|NP_001274979.1|  60S ribosomal protein L11-2-like                   329   6e-111   Solanum tuberosum [potatoes]
gb|KJB57391.1|  hypothetical protein B456_009G161300                    329   6e-111   Gossypium raimondii
ref|XP_004293968.1|  PREDICTED: 60S ribosomal protein L11               329   6e-111   Fragaria vesca subsp. vesca
ref|XP_008786958.1|  PREDICTED: 60S ribosomal protein L11-like          329   7e-111   Phoenix dactylifera
ref|XP_008343092.1|  PREDICTED: 60S ribosomal protein L11-like is...    329   8e-111   
ref|XP_007132813.1|  hypothetical protein PHAVU_011G126600g             329   8e-111   Phaseolus vulgaris [French bean]
gb|KHN42782.1|  60S ribosomal protein L11                               329   8e-111   Glycine soja [wild soybean]
ref|XP_009383242.1|  PREDICTED: 60S ribosomal protein L11               329   9e-111   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009378939.1|  PREDICTED: 60S ribosomal protein L11 isoform X1    328   1e-110   Pyrus x bretschneideri [bai li]
ref|XP_010915478.1|  PREDICTED: 60S ribosomal protein L11-like          328   1e-110   Elaeis guineensis
gb|KDO77896.1|  hypothetical protein CISIN_1g029665mg                   329   1e-110   Citrus sinensis [apfelsine]
ref|XP_003628237.1|  60S ribosomal protein L11                          328   1e-110   Medicago truncatula
ref|XP_009404521.1|  PREDICTED: 60S ribosomal protein L11               328   1e-110   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008366039.1|  PREDICTED: 60S ribosomal protein L11-1             328   1e-110   Malus domestica [apple tree]
gb|AFP44117.1|  60S ribosomal protein                                   328   1e-110   Lycoris longituba
ref|XP_009408897.1|  PREDICTED: 60S ribosomal protein L11               328   1e-110   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABK93207.1|  unknown                                                 328   1e-110   Populus trichocarpa [western balsam poplar]
gb|AFK37822.1|  unknown                                                 328   1e-110   Medicago truncatula
ref|NP_001132427.1|  60S ribosomal protein L11-1                        328   1e-110   Zea mays [maize]
ref|XP_010936718.1|  PREDICTED: 60S ribosomal protein L11               328   2e-110   Elaeis guineensis
gb|KHG08920.1|  60S ribosomal L11-1 -like protein                       328   2e-110   Gossypium arboreum [tree cotton]
ref|NP_001238636.1|  uncharacterized protein LOC100305912               328   2e-110   Glycine max [soybeans]
ref|XP_010689741.1|  PREDICTED: 60S ribosomal protein L11-1 isofo...    328   2e-110   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007048733.1|  Ribosomal L5P family protein isoform 1             328   2e-110   Theobroma cacao [chocolate]
gb|AFK38385.1|  unknown                                                 328   2e-110   Lotus japonicus
ref|XP_009365285.1|  PREDICTED: 60S ribosomal protein L11 isoform X1    328   2e-110   Pyrus x bretschneideri [bai li]
ref|XP_007148755.1|  hypothetical protein PHAVU_005G011400g             328   3e-110   Phaseolus vulgaris [French bean]
gb|ADE77225.1|  unknown                                                 327   3e-110   Picea sitchensis
ref|XP_009405598.1|  PREDICTED: 60S ribosomal protein L11-like is...    327   3e-110   
gb|ACG31637.1|  60S ribosomal protein L11-1                             327   4e-110   Zea mays [maize]
ref|XP_007025337.1|  Ribosomal protein large subunit 16A                330   4e-110   
ref|XP_008362518.1|  PREDICTED: 60S ribosomal protein L11 isoform X2    327   4e-110   
ref|XP_007214493.1|  hypothetical protein PRUPE_ppa020372mg             330   4e-110   
ref|XP_003598139.1|  60S ribosomal protein L11                          327   5e-110   Medicago truncatula
ref|XP_003607648.1|  60S ribosomal protein L11-1                        327   6e-110   Medicago truncatula
ref|XP_009405599.1|  PREDICTED: 60S ribosomal protein L11-like is...    327   6e-110   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009403504.1|  PREDICTED: 60S ribosomal protein L11               327   6e-110   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008343091.1|  PREDICTED: 60S ribosomal protein L11-like is...    327   6e-110   
ref|XP_004133952.1|  PREDICTED: 60S ribosomal protein L11-2-like ...    327   7e-110   Cucumis sativus [cucumbers]
gb|KHN01495.1|  60S ribosomal protein L11                               328   7e-110   Glycine soja [wild soybean]
gb|ACJ86159.1|  unknown                                                 327   8e-110   Medicago truncatula
gb|KHN27796.1|  60S ribosomal protein L11                               326   1e-109   Glycine soja [wild soybean]
ref|NP_001132260.1|  hypothetical protein                               326   1e-109   Zea mays [maize]
ref|XP_010102117.1|  60S ribosomal protein L11-2                        326   3e-109   
ref|NP_001242757.1|  uncharacterized protein LOC100778713               325   3e-109   Glycine max [soybeans]
ref|XP_008362517.1|  PREDICTED: 60S ribosomal protein L11 isoform X1    325   3e-109   
ref|NP_001046386.1|  Os02g0235600                                       325   4e-109   
ref|XP_004133951.1|  PREDICTED: 60S ribosomal protein L11-2-like ...    325   5e-109   Cucumis sativus [cucumbers]
ref|XP_004976770.1|  PREDICTED: 60S ribosomal protein L11-like          324   5e-109   Setaria italica
ref|NP_001149684.1|  60S ribosomal protein L11-1                        324   5e-109   Zea mays [maize]
ref|XP_002451841.1|  hypothetical protein SORBIDRAFT_04g008530          324   6e-109   Sorghum bicolor [broomcorn]
ref|XP_008782472.1|  PREDICTED: 60S ribosomal protein L11 isoform X1    324   7e-109   Phoenix dactylifera
gb|KHG13747.1|  60S ribosomal L11-1 -like protein                       324   7e-109   Gossypium arboreum [tree cotton]
ref|NP_001148395.1|  LOC100282010                                       324   7e-109   Zea mays [maize]
ref|XP_002270266.1|  PREDICTED: 60S ribosomal protein L11-1-like        324   7e-109   Vitis vinifera
ref|NP_001131414.1|  uncharacterized protein LOC100192743               323   1e-108   Zea mays [maize]
ref|XP_006578416.1|  PREDICTED: 60S ribosomal protein L11-like          323   2e-108   
ref|XP_006654147.1|  PREDICTED: 60S ribosomal protein L11-like          323   2e-108   Oryza brachyantha
ref|XP_002454974.1|  hypothetical protein SORBIDRAFT_03g002420          323   2e-108   
ref|XP_010940061.1|  PREDICTED: 60S ribosomal protein L11-like          323   2e-108   Elaeis guineensis
ref|XP_001759707.1|  predicted protein                                  323   2e-108   
gb|AFW65990.1|  hypothetical protein ZEAMMB73_747842                    323   3e-108   
gb|ADY38658.1|  putative 60S ribosomal protein L11                      322   4e-108   Wolffia arrhiza
ref|XP_004968572.1|  PREDICTED: 60S ribosomal protein L11-like          322   4e-108   Setaria italica
gb|AAT08727.1|  60S ribosomal protein L11                               322   4e-108   Hyacinthus orientalis [common hyacinth]
ref|XP_006643887.1|  PREDICTED: 60S ribosomal protein L11-like          322   6e-108   Oryza brachyantha
ref|NP_001054899.1|  Os05g0207300                                       322   6e-108   
ref|NP_001042339.1|  Os01g0205500                                       321   1e-107   
ref|XP_001762314.1|  predicted protein                                  321   1e-107   
ref|XP_008795915.1|  PREDICTED: 60S ribosomal protein L11-like          320   2e-107   Phoenix dactylifera
ref|XP_008790022.1|  PREDICTED: 60S ribosomal protein L11-like          320   3e-107   Phoenix dactylifera
ref|XP_001760204.1|  predicted protein                                  320   4e-107   
gb|KHG21293.1|  60S ribosomal protein L11-1                             318   2e-106   Gossypium arboreum [tree cotton]
gb|KHG21292.1|  60S ribosomal protein L11-1                             320   2e-106   Gossypium arboreum [tree cotton]
ref|XP_006648487.1|  PREDICTED: 60S ribosomal protein L11-like          318   2e-106   Oryza brachyantha
emb|CDY60533.1|  BnaAnng16950D                                          317   3e-106   Brassica napus [oilseed rape]
emb|CDY62552.1|  BnaA03g58370D                                          317   3e-106   Brassica napus [oilseed rape]
ref|XP_010516520.1|  PREDICTED: 60S ribosomal protein L11-1-like        315   1e-105   Camelina sativa [gold-of-pleasure]
ref|NP_851137.1|  60S ribosomal protein L11-2                           315   1e-105   Arabidopsis thaliana [mouse-ear cress]
gb|KHN11195.1|  60S ribosomal protein L11                               312   2e-104   Glycine soja [wild soybean]
ref|XP_007048734.1|  Ribosomal L5P family protein isoform 2             312   2e-104   Theobroma cacao [chocolate]
gb|ACD56663.1|  putative ribosomal protein                              312   2e-104   Gossypium arboreum [tree cotton]
emb|CBI22012.3|  unnamed protein product                                312   2e-104   Vitis vinifera
gb|AAT64021.1|  putative ribosomal protein                              312   2e-104   Gossypium hirsutum [American cotton]
gb|KHN20558.1|  Endoglucanase 9                                         328   3e-104   Glycine soja [wild soybean]
gb|KJB34908.1|  hypothetical protein B456_006G089700                    311   7e-104   Gossypium raimondii
ref|XP_003565263.1|  PREDICTED: 60S ribosomal protein L11               311   7e-104   Brachypodium distachyon [annual false brome]
gb|EMS61347.1|  60S ribosomal protein L11                               310   1e-103   Triticum urartu
emb|CDP15952.1|  unnamed protein product                                310   2e-103   Coffea canephora [robusta coffee]
ref|XP_001751962.1|  predicted protein                                  310   2e-103   
gb|ACN35575.1|  unknown                                                 309   4e-103   Zea mays [maize]
emb|CBI30709.3|  unnamed protein product                                309   5e-103   Vitis vinifera
gb|ADR71243.1|  60S ribosomal protein L11A                              308   1e-102   Hevea brasiliensis [jebe]
pdb|3J61|J  Chain J, Localization Of The Large Subunit Ribosomal ...    308   1e-102   Triticum aestivum [Canadian hard winter wheat]
dbj|BAJ85332.1|  predicted protein                                      308   1e-102   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006656151.1|  PREDICTED: 60S ribosomal protein L11-like          306   3e-102   
gb|AAD21733.1|  60S ribosomal protein L11B                              306   5e-102   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002981065.1|  hypothetical protein SELMODRAFT_444767             305   3e-101   Selaginella moellendorffii
gb|EMS66091.1|  60S ribosomal protein L11                               305   6e-101   Triticum urartu
gb|AAB82139.1|  ribosomal protein                                       302   4e-100   Oryza sativa Indica Group [Indian rice]
ref|XP_002438544.1|  hypothetical protein SORBIDRAFT_10g021710          301   5e-100   
gb|AAQ96376.1|  ribosomal protein L11-like protein                      300   1e-99    Solanum palustre
dbj|BAD53703.1|  putative 60S ribosomal protein L11-1                   297   2e-98    Oryza sativa Japonica Group [Japonica rice]
gb|KHN28096.1|  60S ribosomal protein L11                               296   4e-98    Glycine soja [wild soybean]
ref|XP_009617442.1|  PREDICTED: 60S ribosomal protein L11-1-like        291   6e-96    Nicotiana tomentosiformis
tpg|DAA52967.1|  TPA: hypothetical protein ZEAMMB73_694767              308   8e-95    
ref|XP_011397124.1|  60S ribosomal protein L11-1                        286   4e-94    Auxenochlorella protothecoides
gb|KDD76069.1|  hypothetical protein H632_c370p1                        282   2e-92    Helicosporidium sp. ATCC 50920
gb|KJB57390.1|  hypothetical protein B456_009G161300                    276   2e-90    Gossypium raimondii
gb|KIY97763.1|  60S ribosomal protein L11                               275   8e-90    Monoraphidium neglectum
ref|XP_005647682.1|  ribosomal protein L5                               273   5e-89    Coccomyxa subellipsoidea C-169
gb|ABR25412.1|  60S ribosomal protein l11                               269   1e-87    Oryza sativa Indica Group [Indian rice]
emb|CBJ30107.1|  conserved unknown protein                              269   2e-87    Ectocarpus siliculosus
ref|XP_006446821.1|  hypothetical protein CICLE_v10016875mg             266   4e-86    
emb|CEF97266.1|  Ribosomal protein L5, conserved site                   265   8e-86    Ostreococcus tauri
ref|XP_003598138.1|  60S ribosomal protein L11-1                        267   9e-86    Medicago truncatula
emb|CCI45988.1|  unnamed protein product                                263   3e-85    Albugo candida
tpe|CAL69062.1|  TPA: putative 60S ribosomal protein L11                263   1e-84    Spadella cephaloptera
gb|AIU94837.1|  60S ribosomal protein                                   261   2e-84    Phragmatopoma lapidosa
ref|XP_007511979.1|  60S ribosomal protein L11                          258   2e-83    Bathycoccus prasinos
ref|XP_002507327.1|  ribosomal protein L11                              258   4e-83    Micromonas commoda
ref|XP_008912007.1|  60S ribosomal protein L11                          258   6e-83    Phytophthora parasitica INRA-310
ref|NP_477054.1|  ribosomal protein L11, isoform A                      256   4e-82    Drosophila melanogaster
ref|XP_005988804.1|  PREDICTED: 60S ribosomal protein L11 isoform X2    256   4e-82    Latimeria chalumnae
ref|XP_004678660.1|  PREDICTED: 60S ribosomal protein L11 isoform X2    256   5e-82    
ref|XP_004603489.1|  PREDICTED: 60S ribosomal protein L11 isoform X2    255   6e-82    Sorex araneus [Eurasian shrew]
gb|AAX42399.1|  ribosomal protein L11                                   255   6e-82    synthetic construct
ref|XP_007874680.1|  hypothetical protein PNEG_02659                    255   7e-82    Pneumocystis murina B123
ref|XP_002063810.1|  GK15870                                            255   7e-82    Drosophila willistoni
ref|XP_006179217.1|  PREDICTED: 60S ribosomal protein L11 isoform X2    255   7e-82    
ref|XP_679576.1|  60S ribosomal protein L11a                            255   7e-82    Plasmodium berghei ANKA
ref|NP_001002139.1|  60S ribosomal protein L11                          255   8e-82    Danio rerio [leopard danio]
ref|XP_004220956.1|  60S ribosomal protein L11                          254   8e-82    Plasmodium cynomolgi strain B
ref|NP_001186731.1|  60S ribosomal protein L11 isoform 2                255   9e-82    Homo sapiens [man]
ref|XP_002049941.1|  GJ21865                                            255   9e-82    Drosophila virilis
ref|XP_002005901.1|  GI18837                                            255   9e-82    Drosophila mojavensis
ref|XP_005955884.1|  PREDICTED: 60S ribosomal protein L11 isoform X2    254   1e-81    
gb|AAX29834.1|  ribosomal protein L11                                   254   1e-81    synthetic construct
ref|XP_006862372.1|  PREDICTED: 60S ribosomal protein L11               254   1e-81    Chrysochloris asiatica
gb|AAV90722.1|  60S ribosomal protein L11                               255   1e-81    Aedes albopictus [forest day mosquito]
ref|XP_002184288.1|  predicted protein                                  254   1e-81    Phaeodactylum tricornutum CCAP 1055/1
gb|AGM32143.1|  60S ribosomal protein L11                               255   1e-81    Coptotermes formosanus
emb|CCE35354.1|  probable ribosomal protein L11.e.A, cytosolic          254   1e-81    Claviceps purpurea 20.1
ref|XP_001612822.1|  60S ribosomal protein L11                          254   2e-81    Plasmodium vivax
gb|ABV44749.1|  60S ribosomal protein L11-like protein                  255   2e-81    Phlebotomus papatasi
ref|NP_001016640.1|  ribosomal protein L11                              254   2e-81    Xenopus tropicalis [western clawed frog]
ref|XP_008625536.1|  60S ribosomal protein L11                          253   3e-81    Plasmodium vinckei vinckei
gb|KFD51459.1|  hypothetical protein M513_07672                         254   3e-81    Trichuris suis
ref|XP_001663129.1|  AAEL012944-PB                                      253   3e-81    Aedes aegypti
gb|KDR12481.1|  60S ribosomal protein L11                               254   3e-81    Zootermopsis nevadensis
gb|KHJ43623.1|  ribosomal protein L5                                    254   3e-81    Trichuris suis
gb|KDB13460.1|  60S ribosomal protein L11                               253   4e-81    Ustilaginoidea virens
gb|AAX11430.1|  cell growth-inhibiting protein 34                       253   4e-81    Homo sapiens [man]
ref|NP_001087287.1|  ribosomal protein L11                              253   5e-81    Xenopus laevis [clawed frog]
ref|XP_003054830.1|  predicted protein                                  253   5e-81    Micromonas pusilla CCMP1545
ref|XP_002171744.1|  60S ribosomal protein L11                          253   5e-81    Schizosaccharomyces japonicus yFS275
emb|CCF73368.1|  unnamed protein product                                253   5e-81    Babesia microti strain RI
ref|XP_004517673.1|  PREDICTED: 60S ribosomal protein L11-like          253   5e-81    Ceratitis capitata [medfly]
ref|XP_005905227.1|  PREDICTED: 60S ribosomal protein L11 isoform X2    253   5e-81    Bos mutus
ref|XP_002261116.1|  60S ribosomal protein L11a                         253   6e-81    Plasmodium knowlesi strain H
ref|XP_005802897.1|  PREDICTED: 60S ribosomal protein L11-like          253   6e-81    
ref|XP_002364229.1|  ribosomal protein L11, putative                    253   6e-81    Toxoplasma gondii ME49
ref|XP_007175169.1|  PREDICTED: 60S ribosomal protein L11 isoform X2    253   6e-81    Balaenoptera acutorostrata scammoni
ref|XP_010743989.1|  PREDICTED: 60S ribosomal protein L11 isoform X1    253   7e-81    
ref|XP_010898594.1|  PREDICTED: 60S ribosomal protein L11 isoform X1    253   7e-81    Esox lucius
ref|XP_008329249.1|  PREDICTED: 60S ribosomal protein L11               253   7e-81    
ref|XP_003227609.1|  PREDICTED: 60S ribosomal protein L11               253   7e-81    Anolis carolinensis [Carolina anole]
ref|XP_008291103.1|  PREDICTED: 60S ribosomal protein L11               253   8e-81    Stegastes partitus
ref|XP_006019455.1|  PREDICTED: 60S ribosomal protein L11               253   8e-81    
gb|ABW06869.1|  ribosomal protein L11                                   252   8e-81    Perca flavescens
ref|XP_001863416.1|  ribosomal protein L11                              253   8e-81    Culex quinquefasciatus
emb|CDS05445.1|  Putative 60S ribosomal protein L11                     252   8e-81    Lichtheimia ramosa
ref|XP_002018508.1|  GL17744                                            253   8e-81    Drosophila persimilis
ref|XP_003968865.1|  PREDICTED: 60S ribosomal protein L11-like          252   8e-81    Takifugu rubripes [tiger puffer]
gb|EPY49528.1|  60S ribosomal protein L11                               252   8e-81    Schizosaccharomyces cryophilus OY26
ref|XP_005875279.1|  PREDICTED: LOW QUALITY PROTEIN: ribosomal pr...    252   8e-81    
ref|XP_005187420.1|  PREDICTED: 60S ribosomal protein L11               253   8e-81    Musca domestica
ref|XP_004678659.1|  PREDICTED: 60S ribosomal protein L11 isoform X1    252   8e-81    Condylura cristata
ref|XP_005988803.1|  PREDICTED: 60S ribosomal protein L11 isoform X1    253   9e-81    Latimeria chalumnae
emb|CDH52194.1|  60s ribosomal protein l11                              252   9e-81    Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_006963013.1|  60S ribosomal protein L11, L5 family               252   1e-80    Trichoderma reesei QM6a
gb|ACI69075.1|  60S ribosomal protein L11                               252   1e-80    Salmo salar
ref|XP_009261766.1|  hypothetical protein FPSE_10374                    252   1e-80    Fusarium pseudograminearum CS3096
gb|ACH85327.1|  ribosomal protein L11                                   252   1e-80    Salmo salar
ref|XP_008421109.1|  PREDICTED: 60S ribosomal protein L11 isoform X1    252   1e-80    
ref|XP_001958882.1|  GF12342                                            252   1e-80    Drosophila ananassae
ref|XP_006737644.1|  PREDICTED: 60S ribosomal protein L11 isoform X1    253   1e-80    
gb|KHN95345.1|  60S ribosomal protein L11                               252   1e-80    Metarhizium album ARSEF 1941
ref|XP_003054198.1|  60S ribosomal protein L11                          252   1e-80    [Nectria] haematococca mpVI 77-13-4
ref|XP_007083757.1|  PREDICTED: 60S ribosomal protein L11               253   1e-80    Panthera tigris altaica
gb|EGU80777.1|  hypothetical protein FOXB_08644                         252   1e-80    Fusarium oxysporum Fo5176
ref|XP_002289769.1|  RL11A, ribosomal protein 11A 60S large ribos...    252   1e-80    Thalassiosira pseudonana CCMP1335
ref|XP_004603488.1|  PREDICTED: 60S ribosomal protein L11 isoform X1    252   1e-80    Sorex araneus [Eurasian shrew]
dbj|GAA95328.1|  hypothetical protein E5Q_01985                         252   1e-80    Mixia osmundae IAM 14324
gb|AGH15796.1|  Rpl11 protein                                           252   1e-80    Pachytriton brevipes
ref|XP_002741821.1|  PREDICTED: 60S ribosomal protein L11-like          252   1e-80    Saccoglossus kowalevskii
ref|XP_006179216.1|  PREDICTED: 60S ribosomal protein L11 isoform X1    252   1e-80    Camelus ferus
ref|XP_003884996.1|  hypothetical protein NCLIV_053950                  251   1e-80    Neospora caninum Liverpool
gb|AGH70158.1|  60S ribosomal protein L11                               252   1e-80    Placozoa sp. H4
ref|XP_007430577.1|  PREDICTED: 60S ribosomal protein L11               252   2e-80    
ref|XP_010362433.1|  PREDICTED: 60S ribosomal protein L11-like          251   2e-80    Rhinopithecus roxellana
ref|XP_005107086.1|  PREDICTED: 60S ribosomal protein L11-like          252   2e-80    Aplysia californica
ref|XP_003458587.1|  PREDICTED: 60S ribosomal protein L11-like          251   2e-80    Oreochromis niloticus
gb|KFA66324.1|  hypothetical protein S40285_01884                       251   2e-80    Stachybotrys chlorohalonata IBT 40285
gb|EPY52057.1|  60S ribosomal protein L11                               251   2e-80    Schizosaccharomyces cryophilus OY26
gb|ESA11406.1|  hypothetical protein GLOINDRAFT_190897                  251   2e-80    
gb|KIL95260.1|  hypothetical protein FAVG1_02195                        251   2e-80    
ref|XP_006924507.1|  PREDICTED: 60S ribosomal protein L11               251   2e-80    
ref|XP_005941012.1|  PREDICTED: 60S ribosomal protein L11-like is...    251   2e-80    
gb|EFB27138.1|  hypothetical protein PANDA_001098                       251   2e-80    
emb|CCE35372.1|  probable ribosomal protein L11.e.A, cytosolic          251   2e-80    
gb|EHK17585.1|  hypothetical protein TRIVIDRAFT_76021                   251   2e-80    
ref|XP_005353082.1|  PREDICTED: 60S ribosomal protein L11               251   2e-80    
ref|XP_007785480.1|  60S ribosomal protein L11                          251   2e-80    
ref|XP_006268033.1|  PREDICTED: 60S ribosomal protein L11               251   2e-80    
ref|XP_007811586.1|  60S ribosomal protein L11                          251   2e-80    
ref|NP_080195.1|  60S ribosomal protein L11                             251   2e-80    
ref|XP_008692837.1|  PREDICTED: 60S ribosomal protein L11               252   2e-80    
ref|XP_002173490.1|  60S ribosomal protein L11                          251   2e-80    
ref|XP_006980890.1|  PREDICTED: 60S ribosomal protein L11               251   2e-80    
ref|XP_005955883.1|  PREDICTED: 60S ribosomal protein L11 isoform X1    251   2e-80    
ref|XP_003138893.1|  60S ribosomal protein L11                          252   2e-80    
ref|XP_007245775.1|  PREDICTED: 60S ribosomal protein L11 isoform X1    251   2e-80    
gb|AAX62438.1|  ribosomal protein L11                                   251   2e-80    
ref|NP_001125385.1|  60S ribosomal protein L11                          251   2e-80    
ref|XP_001892371.1|  60S ribosomal protein L11                          252   2e-80    
gb|ADV03047.1|  ribosomal protein L11                                   251   2e-80    
gb|ABR27976.1|  ribosomal protein L11                                   252   2e-80    
gb|EQL04255.1|  Ribosomal protein L5                                    251   2e-80    
ref|XP_004074127.1|  PREDICTED: 60S ribosomal protein L11               251   2e-80    
gb|EXX73498.1|  ribosomal 60S subunit protein L11B                      252   2e-80    
gb|EJW85444.1|  60S ribosomal protein L11                               252   2e-80    
ref|XP_006078004.1|  PREDICTED: 60S ribosomal protein L11 isoform X1    251   2e-80    
ref|XP_006539175.1|  PREDICTED: 60S ribosomal protein L11 isoform X1    251   2e-80    
gb|AAL99919.1|AF432212_1  CLL-associated antigen KW-12                  251   2e-80    
ref|XP_008518978.1|  PREDICTED: 60S ribosomal protein L11 isoform X1    251   3e-80    
ref|XP_011330111.1|  PREDICTED: 60S ribosomal protein L11               252   3e-80    
ref|XP_010347552.1|  PREDICTED: 60S ribosomal protein L11 isoform X1    251   3e-80    
gb|EFX82862.1|  hypothetical protein DAPPUDRAFT_302274                  251   3e-80    
gb|KFA73465.1|  hypothetical protein S40288_08466                       251   3e-80    
ref|XP_005302146.1|  PREDICTED: 60S ribosomal protein L11               251   3e-80    
emb|CAH57695.1|  60S ribosomal protein L11                              251   3e-80    
gb|ELW68491.1|  60S ribosomal protein L11                               252   3e-80    
ref|XP_006697554.1|  putative ribosomal protein                         251   4e-80    
gb|KFQ51368.1|  60S ribosomal protein L11                               251   4e-80    
ref|XP_007068087.1|  PREDICTED: 60S ribosomal protein L11               251   4e-80    
gb|KFV16259.1|  60S ribosomal protein L11                               251   4e-80    
ref|NP_001187040.1|  60S ribosomal protein L11                          251   4e-80    
gb|ABF18126.1|  60S ribosomal protein L11                               251   4e-80    
ref|XP_006882367.1|  PREDICTED: 60S ribosomal protein L11-like          251   4e-80    
ref|XP_009560105.1|  PREDICTED: 60S ribosomal protein L11               251   4e-80    
ref|XP_005617268.1|  PREDICTED: 60S ribosomal protein L11 isoform X1    251   4e-80    
emb|CDS03126.1|  Putative 60S ribosomal protein L11                     251   4e-80    
ref|NP_595899.1|  60S ribosomal protein L11                             250   4e-80    
emb|CDH51840.1|  60s ribosomal protein l11                              251   4e-80    
ref|NP_001292117.1|  60S ribosomal protein L11                          251   4e-80    
ref|XP_003382768.1|  PREDICTED: 60S ribosomal protein L11-like is...    251   4e-80    
gb|KFV77896.1|  60S ribosomal protein L11                               250   4e-80    
ref|XP_001987013.1|  GH21683                                            251   4e-80    
gb|AAL09706.1|AF420431_1  ribosomal protein L11                         251   4e-80    
gb|EPX72141.1|  60S ribosomal protein L11                               250   4e-80    
gb|KFO04838.1|  60S ribosomal protein L11                               250   5e-80    
ref|XP_004783520.1|  PREDICTED: 60S ribosomal protein L11               250   5e-80    
ref|NP_001158637.1|  60S ribosomal protein L11                          250   5e-80    
gb|KID77365.1|  Ribosomal protein L5                                    250   5e-80    
ref|XP_001349097.1|  60S ribosomal protein L11a, putative               250   5e-80    
gb|KFO76848.1|  60S ribosomal protein L11                               250   5e-80    
gb|KFM05522.1|  60S ribosomal protein L11                               250   5e-80    
ref|XP_007400955.1|  hypothetical protein PHACADRAFT_264100             250   5e-80    
ref|NP_001001638.1|  60S ribosomal protein L11                          250   5e-80    
ref|XP_004893894.1|  PREDICTED: 60S ribosomal protein L11 isoform X3    251   5e-80    
gb|EDL11957.1|  mCG11809                                                250   5e-80    
ref|XP_011403972.1|  PREDICTED: 60S ribosomal protein L11-like is...    250   5e-80    
emb|CCJ29398.1|  unnamed protein product                                251   5e-80    
ref|XP_004227163.1|  PREDICTED: 60S ribosomal protein L11-like          250   5e-80    
gb|ELU08984.1|  hypothetical protein CAPTEDRAFT_228073                  251   5e-80    
ref|XP_001607270.1|  PREDICTED: 60S ribosomal protein L11               251   5e-80    
gb|ADO28174.1|  60S ribosomal protein l11                               250   5e-80    
ref|XP_004572770.1|  PREDICTED: 60S ribosomal protein L11-like is...    251   6e-80    
gb|KEY71076.1|  hypothetical protein S7711_00899                        250   6e-80    
emb|CDW52299.1|  60S ribosomal protein L11                              251   6e-80    
gb|KFZ56809.1|  60S ribosomal protein L11                               250   6e-80    
emb|CDS14192.1|  Putative 60S ribosomal protein L11                     250   6e-80    
ref|XP_001512081.1|  PREDICTED: 60S ribosomal protein L11               250   6e-80    
ref|XP_010779161.1|  PREDICTED: 60S ribosomal protein L11 isoform X2    250   7e-80    
ref|XP_010779152.1|  PREDICTED: 60S ribosomal protein L11 isoform X1    250   7e-80    
gb|AAC46585.1|  ribosomal protein DL11                                  250   7e-80    
gb|ABW90392.1|  putative ribosomal protein L11                          250   7e-80    
gb|ACI12869.1|  60S ribosomal protein L11                               250   8e-80    
ref|XP_001416745.1|  Ribosomal protein L11, component of cytosoli...    250   8e-80    
gb|KIW72643.1|  60S ribosomal protein L11                               249   9e-80    
gb|EYB99416.1|  hypothetical protein Y032_0122g1039                     250   1e-79    
gb|KEZ44553.1|  hypothetical protein SAPIO_CDS3581                      249   1e-79    
ref|XP_965640.2|  60S ribosomal protein L11                             249   1e-79    
gb|EHK50062.1|  hypothetical protein TRIATDRAFT_297405                  249   1e-79    
ref|XP_003764935.1|  PREDICTED: 60S ribosomal protein L11               249   1e-79    
ref|XP_005905226.1|  PREDICTED: 60S ribosomal protein L11 isoform X1    249   1e-79    
gb|ELR49451.1|  60S ribosomal protein L11                               249   1e-79    
gb|AAN73370.1|  ribosomal protein L11                                   249   1e-79    
gb|KHJ31708.1|  putative 60s ribosomal protein l11                      249   1e-79    
ref|XP_007720703.1|  60S ribosomal protein L11                          249   1e-79    
dbj|BAN20276.1|  ribosomal protein L11                                  250   1e-79    
ref|XP_008593474.1|  60S ribosomal protein L11                          249   1e-79    
gb|AEL28827.1|  ribosomal protein L11                                   250   1e-79    
gb|AFK10889.1|  ribosomal protein L11                                   249   1e-79    
gb|KIJ20995.1|  hypothetical protein PAXINDRAFT_165800                  249   1e-79    
ref|XP_007828704.1|  60S ribosomal protein L11                          249   2e-79    
ref|XP_001624703.1|  predicted protein                                  249   2e-79    
gb|ACO10298.1|  60S ribosomal protein L11                               249   2e-79    
gb|KFP31127.1|  60S ribosomal protein L11                               249   2e-79    
ref|XP_309477.3|  AGAP011173-PA                                         249   2e-79    
ref|XP_007864974.1|  ribosomal protein L5                               249   2e-79    
ref|XP_009039589.1|  hypothetical protein AURANDRAFT_38382              249   2e-79    
ref|XP_006631265.1|  PREDICTED: 60S ribosomal protein L11-like          248   2e-79    
ref|XP_002424337.1|  60S ribosomal protein L11, putative                249   2e-79    
ref|XP_008722843.1|  60S ribosomal protein L11                          249   2e-79    
ref|XP_010955670.1|  PREDICTED: 60S ribosomal protein L11 isoform X3    248   2e-79    
ref|XP_954382.1|  60S ribosomal protein l11a                            248   2e-79    
gb|ETN59373.1|  ribosomal protein L11                                   249   2e-79    
ref|XP_006882778.1|  PREDICTED: 60S ribosomal protein L11-like          249   2e-79    
ref|NP_001279972.1|  ribosomal protein L11                              248   2e-79    
ref|NP_001020910.1|  60S ribosomal protein L11                          248   3e-79    
ref|XP_765879.1|  60S ribosomal protein L11a                            248   3e-79    
ref|XP_011306148.1|  PREDICTED: 60S ribosomal protein L11 isoform X1    249   3e-79    
ref|XP_010387110.1|  PREDICTED: 60S ribosomal protein L11-like          248   3e-79    
ref|XP_010244733.1|  PREDICTED: 60S ribosomal protein L11-1-like        248   3e-79    
gb|AHA44486.1|  60S ribosomal-like protein                              249   3e-79    
gb|KIN04023.1|  hypothetical protein OIDMADRAFT_51953                   248   3e-79    
gb|KIK82563.1|  hypothetical protein PAXRUDRAFT_710603                  248   3e-79    
emb|CDR95780.1|  60S ribosomal protein L11, putative                    248   3e-79    
ref|XP_005349545.1|  PREDICTED: 60S ribosomal protein L11-like          248   3e-79    
ref|XP_006056934.1|  PREDICTED: 60S ribosomal protein L11-like          248   3e-79    
gb|ACY71254.1|  ribosomal protein L11                                   248   3e-79    
emb|CDJ63063.1|  ribosomal protein L11, putative                        248   4e-79    
gb|AAX48843.1|  L11                                                     248   4e-79    
ref|XP_002140629.1|  60S ribosomal protein L11                          248   4e-79    
dbj|BAB29059.1|  unnamed protein product                                248   4e-79    
ref|XP_006557708.1|  PREDICTED: 60S ribosomal protein L11-like          248   4e-79    
gb|AET50493.1|  hypothetical protein                                    248   4e-79    
ref|XP_008547261.1|  PREDICTED: 60S ribosomal protein L11               249   4e-79    
gb|ABM55572.1|  putative ribosomal protein L11                          248   4e-79    
ref|XP_011065690.1|  PREDICTED: 60S ribosomal protein L11               249   4e-79    
ref|XP_006671375.1|  60S ribosomal protein L11                          248   4e-79    
ref|NP_001155584.1|  ribosomal protein L11-like                         248   4e-79    
gb|ACO57590.1|  60S ribosomal protein L11                               248   4e-79    
gb|ACD65164.1|  putative 60S ribosomal protein RPL11                    248   4e-79    
ref|XP_003697123.1|  PREDICTED: 60S ribosomal protein L11-like          249   4e-79    
emb|CEG66561.1|  Putative 60S ribosomal protein L11                     248   4e-79    
ref|XP_011441305.1|  PREDICTED: 60S ribosomal protein L11-like          248   4e-79    
ref|XP_003393637.1|  PREDICTED: 60S ribosomal protein L11-like          248   4e-79    
ref|XP_001610475.1|  60S ribosomal protein L11                          248   4e-79    
ref|XP_003702353.1|  PREDICTED: 60S ribosomal protein L11-like          249   4e-79    
ref|XP_004347799.1|  60S ribosomal protein L11                          249   4e-79    
ref|XP_011251155.1|  PREDICTED: 60S ribosomal protein L11               249   5e-79    
gb|AFM88490.1|  ribosomal protein L11                                   248   5e-79    
gb|EJK69051.1|  hypothetical protein THAOC_09733                        248   5e-79    
ref|XP_003293531.1|  ribosomal protein L11                              248   5e-79    
ref|XP_008868808.1|  60S ribosomal protein L11                          248   5e-79    
ref|XP_003351085.1|  60S ribosomal protein L11                          248   5e-79    
gb|KDQ61798.1|  hypothetical protein JAAARDRAFT_150757                  248   5e-79    
ref|XP_010898595.1|  PREDICTED: 60S ribosomal protein L11 isoform X2    247   5e-79    
ref|NP_001155753.1|  ribosomal protein L11e-like                        248   5e-79    
emb|CDI84434.1|  ribosomal protein L11, putative                        248   6e-79    
ref|XP_010082927.1|  PREDICTED: 60S ribosomal protein L11               247   6e-79    
gb|EHH29336.1|  hypothetical protein EGK_09738                          248   6e-79    
ref|XP_005058252.1|  PREDICTED: 60S ribosomal protein L11 isoform X2    247   6e-79    
ref|XP_009840198.1|  60S ribosomal protein L11                          247   6e-79    
ref|XP_009666529.1|  PREDICTED: 60S ribosomal protein L11               247   6e-79    
ref|XP_003033464.1|  60S ribosomal protein L11                          247   7e-79    
gb|EGI69931.1|  60S ribosomal protein L11                               248   7e-79    
ref|XP_010743990.1|  PREDICTED: 60S ribosomal protein L11 isoform X2    247   7e-79    
ref|XP_007753389.1|  60S ribosomal protein L11                          247   7e-79    
ref|XP_011140346.1|  PREDICTED: 60S ribosomal protein L11 isoform X1    248   7e-79    
ref|XP_010164803.1|  PREDICTED: 60S ribosomal protein L11               247   7e-79    
ref|XP_002409414.1|  ribosomal protein L11, putative                    248   7e-79    
gb|KIX00150.1|  60S ribosomal protein L11                               247   7e-79    
gb|ACO12086.1|  60S ribosomal protein L11                               247   7e-79    
emb|CEI93245.1|  Putative 60S ribosomal protein L11                     248   7e-79    
ref|XP_011506111.1|  PREDICTED: 60S ribosomal protein L11               248   7e-79    
gb|EYB99481.1|  hypothetical protein Y032_0122g1072                     248   8e-79    
ref|NP_508413.1|  Protein RPL-11.2                                      248   8e-79    
ref|XP_011140348.1|  PREDICTED: 60S ribosomal protein L11 isoform X3    248   8e-79    
gb|ADD38729.1|  60S ribosomal protein L11                               248   8e-79    
ref|XP_011140347.1|  PREDICTED: 60S ribosomal protein L11 isoform X2    248   8e-79    
ref|XP_007854285.1|  60s ribosomal protein l11                          247   8e-79    
gb|ADV03013.1|  ribosomal protein L11                                   247   9e-79    
gb|ABI83773.1|  60S ribosomal protein L11                               248   9e-79    
emb|CDH53106.1|  60s ribosomal protein l11                              247   9e-79    
gb|KIH67504.1|  ribosomal protein L5                                    248   9e-79    
ref|XP_002608707.1|  hypothetical protein BRAFLDRAFT_58108              247   1e-78    
ref|XP_003302643.1|  60S ribosomal protein L11                          247   1e-78    
ref|XP_011167437.1|  PREDICTED: 60S ribosomal protein L11               248   1e-78    
gb|ACN10052.1|  60S ribosomal protein L11                               246   1e-78    
gb|ACO11724.1|  60S ribosomal protein L11                               247   1e-78    
ref|XP_009152279.1|  60S ribosomal protein L11                          247   1e-78    
emb|CEJ90763.1|  Putative 60S ribosomal protein L11                     247   1e-78    
ref|XP_011306149.1|  PREDICTED: 60S ribosomal protein L11 isoform X2    248   1e-78    
gb|ADV40189.1|  putative ribosomal protein L11                          248   1e-78    
ref|NP_001037215.1|  ribosomal protein L11                              248   1e-78    
gb|KIX93314.1|  60S ribosomal protein L11                               247   1e-78    
ref|XP_001939101.1|  60S ribosomal protein L11                          246   1e-78    
gb|KIW96569.1|  60S ribosomal protein L11                               247   1e-78    
ref|XP_010822095.1|  PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma...    247   1e-78    
ref|XP_001794114.1|  hypothetical protein SNOG_03556                    246   1e-78    
ref|XP_007750616.1|  60S ribosomal protein L11                          247   1e-78    
gb|KIH55130.1|  ribosomal protein L5                                    247   1e-78    
dbj|BAM17801.1|  ribosomal protein L11                                  247   1e-78    
gb|EFZ13284.1|  hypothetical protein SINV_13287                         247   1e-78    
ref|XP_003833556.1|  similar to 60s ribosomal protein l11               246   1e-78    
gb|EZA48835.1|  60S ribosomal protein L11                               246   1e-78    
ref|XP_009689157.1|  60S ribosomal protein L11a                         246   1e-78    
gb|ETN75273.1|  ribosomal protein L5                                    247   1e-78    
gb|ADT80648.1|  ribosomal protein L11                                   247   1e-78    
ref|XP_003652525.1|  60S ribosomal protein L11                          246   1e-78    
gb|ACY95309.1|  ribosomal protein L11                                   247   1e-78    
ref|XP_004661030.1|  PREDICTED: 60S ribosomal protein L11-like          246   2e-78    
ref|XP_008614451.1|  60S ribosomal protein L11                          246   2e-78    
ref|XP_007780322.1|  60S ribosomal protein L11                          247   2e-78    
ref|XP_003712966.1|  60S ribosomal protein L11                          246   2e-78    
ref|XP_009549021.1|  hypothetical protein HETIRDRAFT_477978             246   2e-78    
gb|KFM71516.1|  60S ribosomal protein L11                               247   2e-78    
ref|XP_001553621.1|  60S ribosomal protein L11                          246   2e-78    
ref|XP_011347628.1|  PREDICTED: 60S ribosomal protein L11-like          247   2e-78    
gb|EGT30223.1|  CBN-RPL-11.2 protein                                    247   2e-78    
ref|XP_667639.1|  ribosomal protein L11                                 246   2e-78    
gb|EDL01606.1|  mCG6272                                                 246   2e-78    
ref|XP_007245776.1|  PREDICTED: 60S ribosomal protein L11 isoform X2    246   2e-78    



>ref|XP_002510391.1| 60S ribosomal protein L11, putative [Ricinus communis]
 gb|EEF52578.1| 60S ribosomal protein L11, putative [Ricinus communis]
Length=182

 Score =   337 bits (863),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 175/180 (97%), Positives = 177/180 (98%), Gaps = 0/180 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKKL+ PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDFYVVLERPGYRV RRRRCK+RVGIQHRVTKDDAMKWFQVKYEGVILNKA NI
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRCKSRVGIQHRVTKDDAMKWFQVKYEGVILNKAQNI  180



>gb|KDP21119.1| hypothetical protein JCGZ_21590 [Jatropha curcas]
Length=182

 Score =   336 bits (862),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 173/181 (96%), Positives = 178/181 (98%), Gaps = 0/181 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKKL+ PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDFYVVLERPGYRV RRRRCK++VGIQHRVTK+DAMKWFQVKYEGVILNKA NI
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRCKSKVGIQHRVTKEDAMKWFQVKYEGVILNKAQNI  180

Query  200  S  198
            +
Sbjct  181  T  181



>ref|XP_009138940.1| PREDICTED: 60S ribosomal protein L11-1-like [Brassica rapa]
 emb|CDX88999.1| BnaA04g01870D [Brassica napus]
Length=217

 Score =   337 bits (865),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 177/190 (93%), Positives = 183/190 (96%), Gaps = 4/190 (2%)
 Frame = -3

Query  767  QPQLQQ*SDMASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSK  588
            QP+    S MASEKKL+ PMR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSK
Sbjct  31   QPE----SQMASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSK  86

Query  587  ARYTVRSFGIRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEH  408
            ARYTVRSFGIRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEH
Sbjct  87   ARYTVRSFGIRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEH  146

Query  407  IDLGIKYDPSTGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEG  228
            IDLGIKYDPSTGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTKDDAMKWFQVKYEG
Sbjct  147  IDLGIKYDPSTGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTKDDAMKWFQVKYEG  206

Query  227  VILNKASNIS  198
            VILNK+ NI+
Sbjct  207  VILNKSQNIT  216



>ref|XP_009628928.1| PREDICTED: 60S ribosomal protein L11-1 [Nicotiana tomentosiformis]
 ref|XP_009796075.1| PREDICTED: 60S ribosomal protein L11-1 [Nicotiana sylvestris]
Length=181

 Score =   335 bits (860),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 175/180 (97%), Positives = 179/180 (99%), Gaps = 0/180 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKKL+ PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFS+TGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTKDDAMKWFQVKYEGVILNK+SNI
Sbjct  121  STGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTKDDAMKWFQVKYEGVILNKSSNI  180



>ref|XP_011082984.1| PREDICTED: 60S ribosomal protein L11 [Sesamum indicum]
Length=183

 Score =   335 bits (860),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 174/180 (97%), Positives = 178/180 (99%), Gaps = 0/180 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKKL+ PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFS+TGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDFYVVLERPGYRV RRRRCK+RVGIQHRVTKDDAMKWFQVKYEGVILNKASNI
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRCKSRVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  180



>gb|EYU21905.1| hypothetical protein MIMGU_mgv1a014651mg [Erythranthe guttata]
Length=182

 Score =   335 bits (859),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 173/180 (96%), Positives = 178/180 (99%), Gaps = 0/180 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MA+EKKL+ PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MAAEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDFYVVLERPGYRV RRRRCK+RVGIQHRVTKDDAMKWFQVKYEGVILNKA+NI
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRCKSRVGIQHRVTKDDAMKWFQVKYEGVILNKATNI  180



>gb|EYU29260.1| hypothetical protein MIMGU_mgv1a014673mg [Erythranthe guttata]
 gb|EYU41114.1| hypothetical protein MIMGU_mgv1a014638mg [Erythranthe guttata]
Length=182

 Score =   335 bits (858),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 173/180 (96%), Positives = 178/180 (99%), Gaps = 0/180 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKKL+ PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDFYVVLERPGYRV RRRRCK+RVGIQHRVTK+D+MKWFQVKYEGVILNKA+NI
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRCKSRVGIQHRVTKEDSMKWFQVKYEGVILNKATNI  180



>ref|XP_009132192.1| PREDICTED: 60S ribosomal protein L11-2 isoform X2 [Brassica rapa]
 ref|XP_009136955.1| PREDICTED: 60S ribosomal protein L11-2 isoform X2 [Brassica rapa]
 ref|XP_009101572.1| PREDICTED: 60S ribosomal protein L11-2 [Brassica rapa]
Length=182

 Score =   334 bits (857),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 173/181 (96%), Positives = 178/181 (98%), Gaps = 0/181 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKKL+ PMR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDFYVVLERPGYRVARRRRCK RVGIQHRVTKDDAMKWFQVKYEGVILNK+ NI
Sbjct  121  STGIYGMDFYVVLERPGYRVARRRRCKTRVGIQHRVTKDDAMKWFQVKYEGVILNKSQNI  180

Query  200  S  198
            +
Sbjct  181  T  181



>ref|XP_006398262.1| hypothetical protein EUTSA_v10001041mg [Eutrema salsugineum]
 ref|XP_006402758.1| hypothetical protein EUTSA_v10006260mg [Eutrema salsugineum]
 ref|XP_006414066.1| hypothetical protein EUTSA_v10026344mg [Eutrema salsugineum]
 ref|XP_006414067.1| hypothetical protein EUTSA_v10026344mg [Eutrema salsugineum]
 ref|XP_009128823.1| PREDICTED: 60S ribosomal protein L11-1 [Brassica rapa]
 gb|ESQ39715.1| hypothetical protein EUTSA_v10001041mg [Eutrema salsugineum]
 gb|ESQ44211.1| hypothetical protein EUTSA_v10006260mg [Eutrema salsugineum]
 gb|ESQ55519.1| hypothetical protein EUTSA_v10026344mg [Eutrema salsugineum]
 gb|ESQ55520.1| hypothetical protein EUTSA_v10026344mg [Eutrema salsugineum]
Length=182

 Score =   334 bits (857),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 174/181 (96%), Positives = 179/181 (99%), Gaps = 0/181 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKKL+ PMR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTKDDAMKWFQVKYEGVILNK+ NI
Sbjct  121  STGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTKDDAMKWFQVKYEGVILNKSQNI  180

Query  200  S  198
            +
Sbjct  181  T  181



>emb|CDX71934.1| BnaC08g29400D [Brassica napus]
Length=255

 Score =   337 bits (864),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 177/190 (93%), Positives = 183/190 (96%), Gaps = 4/190 (2%)
 Frame = -3

Query  767  QPQLQQ*SDMASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSK  588
            QP+    S MASEKKL+ PMR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSK
Sbjct  69   QPE----SQMASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSK  124

Query  587  ARYTVRSFGIRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEH  408
            ARYTVRSFGIRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEH
Sbjct  125  ARYTVRSFGIRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEH  184

Query  407  IDLGIKYDPSTGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEG  228
            IDLGIKYDPSTGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTKDDAMKWFQVKYEG
Sbjct  185  IDLGIKYDPSTGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTKDDAMKWFQVKYEG  244

Query  227  VILNKASNIS  198
            VILNK+ NI+
Sbjct  245  VILNKSQNIT  254



>emb|CDY26360.1| BnaA02g24100D [Brassica napus]
Length=227

 Score =   336 bits (861),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 174/181 (96%), Positives = 179/181 (99%), Gaps = 0/181 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKKL+ PMR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFG
Sbjct  46   MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFG  105

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  106  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  165

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTKDDAMKWFQVKYEGVILNK+ NI
Sbjct  166  STGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTKDDAMKWFQVKYEGVILNKSQNI  225

Query  200  S  198
            +
Sbjct  226  T  226



>ref|XP_011081868.1| PREDICTED: 60S ribosomal protein L11-like [Sesamum indicum]
Length=183

 Score =   334 bits (856),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 173/180 (96%), Positives = 178/180 (99%), Gaps = 0/180 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKKL+ PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFS+TGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDFYVVLERPGYRV RRRRCK+RVGIQHRVTK+DAMKWFQVKYEGVILNKASNI
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRCKSRVGIQHRVTKEDAMKWFQVKYEGVILNKASNI  180



>ref|XP_006850965.1| hypothetical protein AMTR_s00025p00203150 [Amborella trichopoda]
 gb|ERN12546.1| hypothetical protein AMTR_s00025p00203150 [Amborella trichopoda]
Length=183

 Score =   334 bits (856),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 173/180 (96%), Positives = 176/180 (98%), Gaps = 0/180 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKKL  PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLTNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDFYVVLERPGYRV RRRRCK+RVGIQHRVTKDDAMKWFQVKYEGVILNK+ NI
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRCKSRVGIQHRVTKDDAMKWFQVKYEGVILNKSQNI  180



>ref|XP_009629723.1| PREDICTED: 60S ribosomal protein L11-1-like [Nicotiana tomentosiformis]
 emb|CAC12883.1| ribosomal protein L11-like [Nicotiana tabacum]
Length=181

 Score =   333 bits (855),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 173/180 (96%), Positives = 179/180 (99%), Gaps = 0/180 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKKL+ PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFS+TGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDFYVVLERPGYRVARRRRCK+RVGIQHRVTK+DAMKWFQVKYEGVILNK+SNI
Sbjct  121  STGIYGMDFYVVLERPGYRVARRRRCKSRVGIQHRVTKEDAMKWFQVKYEGVILNKSSNI  180



>ref|XP_004134655.1| PREDICTED: 60S ribosomal protein L11-1-like [Cucumis sativus]
 ref|XP_004163354.1| PREDICTED: 60S ribosomal protein L11-1-like [Cucumis sativus]
 ref|XP_008439725.1| PREDICTED: 60S ribosomal protein L11-1-like [Cucumis melo]
 gb|KGN49316.1| hypothetical protein Csa_6G519680 [Cucumis sativus]
Length=181

 Score =   333 bits (854),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 171/181 (94%), Positives = 177/181 (98%), Gaps = 0/181 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKKL+ PMR+IKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDFYVVLERPGYRV RRRRCK+ VGIQHRVTK+DAMKWFQVKYEGVILNK+ NI
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRCKSTVGIQHRVTKEDAMKWFQVKYEGVILNKSQNI  180

Query  200  S  198
            S
Sbjct  181  S  181



>ref|XP_002522234.1| 60S ribosomal protein L11, putative [Ricinus communis]
 gb|EEF40092.1| 60S ribosomal protein L11, putative [Ricinus communis]
Length=182

 Score =   333 bits (854),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 173/180 (96%), Positives = 176/180 (98%), Gaps = 0/180 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKKL+ PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDFYVVLERPGYRV RRRRCK+RVGIQHRVTK+DAMKWFQVKYEGVILNKA  I
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRCKSRVGIQHRVTKEDAMKWFQVKYEGVILNKAQTI  180



>ref|XP_010525185.1| PREDICTED: 60S ribosomal protein L11-1 [Tarenaya hassleriana]
Length=182

 Score =   333 bits (854),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 174/181 (96%), Positives = 178/181 (98%), Gaps = 0/181 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKKL  PMR+IKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLANPMRDIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTKDDAMKWFQVKYEGVILNK+ NI
Sbjct  121  STGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTKDDAMKWFQVKYEGVILNKSQNI  180

Query  200  S  198
            +
Sbjct  181  T  181



>ref|NP_001266161.1| 60S ribosomal protein L11-like [Cicer arietinum]
 ref|XP_004510433.1| PREDICTED: 60S ribosomal protein L11-like [Cicer arietinum]
 ref|XP_004511177.1| PREDICTED: 60S ribosomal protein L11-like [Cicer arietinum]
 emb|CAD56220.1| ribosomal protein RL5 [Cicer arietinum]
Length=181

 Score =   333 bits (853),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 174/180 (97%), Positives = 176/180 (98%), Gaps = 0/180 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKKL+ PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDFYVVLERPGYRV RRRRCKARVGIQHRVTKDDAMKWFQVKYEGVILNK+  I
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRCKARVGIQHRVTKDDAMKWFQVKYEGVILNKSQAI  180



>ref|NP_191429.1| 60S ribosomal protein L11-2 [Arabidopsis thaliana]
 ref|NP_567563.1| 60S ribosomal protein L11-2 [Arabidopsis thaliana]
 ref|NP_568649.2| 60S ribosomal protein L11-2 [Arabidopsis thaliana]
 sp|P42794.2|RL112_ARATH RecName: Full=60S ribosomal protein L11-2; AltName: Full=L16 
[Arabidopsis thaliana]
 gb|AAG41458.1|AF326876_1 putative ribosomal protein L11 [Arabidopsis thaliana]
 gb|AAK00379.1|AF339697_1 putative ribosomal protein L11 [Arabidopsis thaliana]
 gb|AAK60313.1|AF385722_1 AT4g18730/F28A21_140 [Arabidopsis thaliana]
 emb|CAB88287.1| ribosomal protein L11-like [Arabidopsis thaliana]
 dbj|BAB09220.1| ribosomal protein L11-like [Arabidopsis thaliana]
 gb|AAK62625.1| AT4g18730/F28A21_140 [Arabidopsis thaliana]
 gb|AAL77722.1| AT4g18730/F28A21_140 [Arabidopsis thaliana]
 gb|AAM62465.1| ribosomal protein L11, cytosolic [Arabidopsis thaliana]
 gb|AAM64372.1| ribosomal protein L11, cytosolic [Arabidopsis thaliana]
 gb|AAM91073.1| AT4g18730/F28A21_140 [Arabidopsis thaliana]
 gb|AED95297.1| 60S ribosomal protein L11-2 [Arabidopsis thaliana]
 gb|AEE79819.1| 60S ribosomal protein L11-2 [Arabidopsis thaliana]
 gb|AEE84082.1| 60S ribosomal protein L11-2 [Arabidopsis thaliana]
Length=182

 Score =   333 bits (853),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 172/181 (95%), Positives = 178/181 (98%), Gaps = 0/181 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKKL+ PMR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDFYVVLERPGYRVARRRRCK RVGIQHRVTKDDAMKWFQVKYEGVILNK+ NI
Sbjct  121  STGIYGMDFYVVLERPGYRVARRRRCKTRVGIQHRVTKDDAMKWFQVKYEGVILNKSQNI  180

Query  200  S  198
            +
Sbjct  181  T  181



>ref|NP_850376.2| 60S ribosomal protein L16A [Arabidopsis thaliana]
 ref|XP_002863455.1| 60S ribosomal protein L11 [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002870025.1| 60S ribosomal protein L11 [Arabidopsis lyrata subsp. lyrata]
 ref|XP_006281176.1| hypothetical protein CARUB_v10027211mg [Capsella rubella]
 ref|XP_006291911.1| hypothetical protein CARUB_v10018095mg [Capsella rubella]
 ref|XP_010504827.1| PREDICTED: 60S ribosomal protein L11-1 [Camelina sativa]
 ref|XP_010439816.1| PREDICTED: 60S ribosomal protein L11-1 isoform X2 [Camelina sativa]
 ref|XP_010441671.1| PREDICTED: 60S ribosomal protein L11-1 [Camelina sativa]
 ref|XP_010449473.1| PREDICTED: 60S ribosomal protein L11-1 isoform X2 [Camelina sativa]
 ref|XP_010481534.1| PREDICTED: 60S ribosomal protein L11-1 [Camelina sativa]
 ref|XP_010494724.1| PREDICTED: 60S ribosomal protein L11-1 [Camelina sativa]
 ref|XP_010496881.1| PREDICTED: 60S ribosomal protein L11-1 isoform X2 [Camelina sativa]
 sp|P42795.2|RL111_ARATH RecName: Full=60S ribosomal protein L11-1; AltName: Full=L16A 
[Arabidopsis thaliana]
 dbj|BAF00458.1| 60S ribosomal protein L11B [Arabidopsis thaliana]
 gb|EFH39714.1| 60S ribosomal protein L11 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46284.1| 60S ribosomal protein L11 [Arabidopsis lyrata subsp. lyrata]
 gb|AEC10163.1| 60S ribosomal protein L11-1/L16A [Arabidopsis thaliana]
 gb|EOA14074.1| hypothetical protein CARUB_v10027211mg [Capsella rubella]
 gb|EOA24809.1| hypothetical protein CARUB_v10018095mg [Capsella rubella]
Length=182

 Score =   333 bits (853),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 173/181 (96%), Positives = 179/181 (99%), Gaps = 0/181 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKKL+ PMR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTKDDAMKWFQVKYEGVILNK+ NI
Sbjct  121  STGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTKDDAMKWFQVKYEGVILNKSQNI  180

Query  200  S  198
            +
Sbjct  181  T  181



>ref|XP_006446820.1| hypothetical protein CICLE_v10016875mg [Citrus clementina]
 ref|XP_006468988.1| PREDICTED: 60S ribosomal protein L11-like [Citrus sinensis]
 gb|ESR60060.1| hypothetical protein CICLE_v10016875mg [Citrus clementina]
 gb|KDO63410.1| hypothetical protein CISIN_1g030128mg [Citrus sinensis]
Length=182

 Score =   333 bits (853),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 172/180 (96%), Positives = 177/180 (98%), Gaps = 0/180 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKKL+ PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDF+VVLERPGYRV RRRRCK+RVGIQHRVTK+DAMKWFQVKYEGVILNK+ NI
Sbjct  121  STGIYGMDFFVVLERPGYRVGRRRRCKSRVGIQHRVTKEDAMKWFQVKYEGVILNKSQNI  180



>ref|XP_011088013.1| PREDICTED: 60S ribosomal protein L11-like [Sesamum indicum]
Length=183

 Score =   333 bits (853),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 172/180 (96%), Positives = 178/180 (99%), Gaps = 0/180 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKKL+ PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFS+TGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDFYVVLERPGYRV RRRRCK+RVGIQHRVTK+D+MKWFQVKYEGVILNKASNI
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRCKSRVGIQHRVTKEDSMKWFQVKYEGVILNKASNI  180



>ref|XP_007215050.1| hypothetical protein PRUPE_ppa012119mg [Prunus persica]
 ref|XP_008228942.1| PREDICTED: 60S ribosomal protein L11 isoform X2 [Prunus mume]
 gb|EMJ16249.1| hypothetical protein PRUPE_ppa012119mg [Prunus persica]
Length=183

 Score =   333 bits (853),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 172/181 (95%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKKL  PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDF+VVLERPGYRV RRRRCK+RVGIQHRVTKDDAMKWFQVKYEGVILNK+  +
Sbjct  121  STGIYGMDFFVVLERPGYRVGRRRRCKSRVGIQHRVTKDDAMKWFQVKYEGVILNKSQQL  180

Query  200  S  198
            S
Sbjct  181  S  181



>gb|EYU41113.1| hypothetical protein MIMGU_mgv1a014638mg [Erythranthe guttata]
Length=183

 Score =   333 bits (853),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 172/179 (96%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = -3

Query  737  ASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  558
            ASEKKL+ PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI
Sbjct  3    ASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  62

Query  557  RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  378
            RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS
Sbjct  63   RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  122

Query  377  TGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            TGIYGMDFYVVLERPGYRV RRRRCK+RVGIQHRVTK+D+MKWFQVKYEGVILNKA+NI
Sbjct  123  TGIYGMDFYVVLERPGYRVGRRRRCKSRVGIQHRVTKEDSMKWFQVKYEGVILNKATNI  181



>ref|XP_010246451.1| PREDICTED: 60S ribosomal protein L11-like [Nelumbo nucifera]
Length=183

 Score =   333 bits (853),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 172/181 (95%), Positives = 178/181 (98%), Gaps = 0/181 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKKL+ PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDFYVVLERPGYRVARRRRCK+RVGIQHRVTK+DAMKWFQVKYEGVILNK+  I
Sbjct  121  STGIYGMDFYVVLERPGYRVARRRRCKSRVGIQHRVTKEDAMKWFQVKYEGVILNKSQTI  180

Query  200  S  198
            +
Sbjct  181  A  181



>ref|XP_009626014.1| PREDICTED: 60S ribosomal protein L11-1-like [Nicotiana tomentosiformis]
 ref|XP_009593767.1| PREDICTED: 60S ribosomal protein L11-1-like [Nicotiana tomentosiformis]
 ref|XP_009799522.1| PREDICTED: 60S ribosomal protein L11-1-like [Nicotiana sylvestris]
 ref|XP_009766474.1| PREDICTED: 60S ribosomal protein L11-1-like [Nicotiana sylvestris]
Length=181

 Score =   332 bits (852),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 172/180 (96%), Positives = 179/180 (99%), Gaps = 0/180 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKKL+ PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFS+TGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDFYVVLERPGYRVARRRRCK+RVGIQHRVTK+DAMKWFQVKYEGVILNK+SNI
Sbjct  121  STGIYGMDFYVVLERPGYRVARRRRCKSRVGIQHRVTKEDAMKWFQVKYEGVILNKSSNI  180



>emb|CDY49245.1| BnaA09g55240D [Brassica napus]
Length=259

 Score =   335 bits (860),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 177/190 (93%), Positives = 183/190 (96%), Gaps = 4/190 (2%)
 Frame = -3

Query  767  QPQLQQ*SDMASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSK  588
            QP+    S MASEKKL+ PMR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSK
Sbjct  73   QPE----SQMASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSK  128

Query  587  ARYTVRSFGIRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEH  408
            ARYTVRSFGIRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEH
Sbjct  129  ARYTVRSFGIRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEH  188

Query  407  IDLGIKYDPSTGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEG  228
            IDLGIKYDPSTGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTKDDAMKWFQVKYEG
Sbjct  189  IDLGIKYDPSTGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTKDDAMKWFQVKYEG  248

Query  227  VILNKASNIS  198
            VILNK+ NI+
Sbjct  249  VILNKSQNIT  258



>ref|XP_010529208.1| PREDICTED: 60S ribosomal protein L11-1-like [Tarenaya hassleriana]
 ref|XP_010538573.1| PREDICTED: 60S ribosomal protein L11-1-like isoform X2 [Tarenaya 
hassleriana]
 ref|XP_010518817.1| PREDICTED: 60S ribosomal protein L11-1-like [Tarenaya hassleriana]
Length=182

 Score =   332 bits (852),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 173/181 (96%), Positives = 179/181 (99%), Gaps = 0/181 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKKL+ PMR+IKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTK+DAMKWFQVKYEGVILNK+ NI
Sbjct  121  STGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTKEDAMKWFQVKYEGVILNKSQNI  180

Query  200  S  198
            +
Sbjct  181  T  181



>ref|XP_009132184.1| PREDICTED: 60S ribosomal protein L11-2 isoform X1 [Brassica rapa]
 ref|XP_009136954.1| PREDICTED: 60S ribosomal protein L11-2 isoform X1 [Brassica rapa]
 emb|CDY64920.1| BnaC07g50200D [Brassica napus]
Length=183

 Score =   332 bits (852),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 172/180 (96%), Positives = 177/180 (98%), Gaps = 0/180 (0%)
 Frame = -3

Query  737  ASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  558
            ASEKKL+ PMR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFGI
Sbjct  3    ASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFGI  62

Query  557  RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  378
            RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS
Sbjct  63   RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  122

Query  377  TGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNIS  198
            TGIYGMDFYVVLERPGYRVARRRRCK RVGIQHRVTKDDAMKWFQVKYEGVILNK+ NI+
Sbjct  123  TGIYGMDFYVVLERPGYRVARRRRCKTRVGIQHRVTKDDAMKWFQVKYEGVILNKSQNIT  182



>emb|CDX87764.1| BnaC02g31850D [Brassica napus]
Length=228

 Score =   334 bits (856),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 173/181 (96%), Positives = 179/181 (99%), Gaps = 0/181 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKKL+ PMR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFG
Sbjct  47   MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFG  106

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLR+NFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  107  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRKNFSDTGCFGFGIQEHIDLGIKYDP  166

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTKDDAMKWFQVKYEGVILNK+ NI
Sbjct  167  STGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTKDDAMKWFQVKYEGVILNKSQNI  226

Query  200  S  198
            +
Sbjct  227  T  227



>ref|XP_006414065.1| hypothetical protein EUTSA_v10026344mg [Eutrema salsugineum]
 gb|ESQ55518.1| hypothetical protein EUTSA_v10026344mg [Eutrema salsugineum]
Length=183

 Score =   332 bits (851),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 173/180 (96%), Positives = 178/180 (99%), Gaps = 0/180 (0%)
 Frame = -3

Query  737  ASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  558
            ASEKKL+ PMR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFGI
Sbjct  3    ASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFGI  62

Query  557  RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  378
            RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS
Sbjct  63   RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  122

Query  377  TGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNIS  198
            TGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTKDDAMKWFQVKYEGVILNK+ NI+
Sbjct  123  TGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTKDDAMKWFQVKYEGVILNKSQNIT  182



>emb|CDX99436.1| BnaC01g11160D [Brassica napus]
Length=184

 Score =   332 bits (851),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 172/180 (96%), Positives = 177/180 (98%), Gaps = 0/180 (0%)
 Frame = -3

Query  737  ASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  558
            ASEKKL+ PMR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFGI
Sbjct  4    ASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFGI  63

Query  557  RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  378
            RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS
Sbjct  64   RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  123

Query  377  TGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNIS  198
            TGIYGMDFYVVLERPGYRVARRRRCK RVGIQHRVTKDDAMKWFQVKYEGVILNK+ NI+
Sbjct  124  TGIYGMDFYVVLERPGYRVARRRRCKTRVGIQHRVTKDDAMKWFQVKYEGVILNKSQNIT  183



>ref|XP_008225318.1| PREDICTED: 60S ribosomal protein L11 [Prunus mume]
Length=182

 Score =   332 bits (851),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 172/180 (96%), Positives = 176/180 (98%), Gaps = 0/180 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKKL  PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDF+VVLERPGYRV RRRRCK+RVGIQHRVTK+DAMKWFQVKYEGVILNK+ NI
Sbjct  121  STGIYGMDFFVVLERPGYRVGRRRRCKSRVGIQHRVTKEDAMKWFQVKYEGVILNKSQNI  180



>emb|CAA57395.1| ribosomal protein L16 [Arabidopsis thaliana]
Length=182

 Score =   332 bits (851),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 172/181 (95%), Positives = 179/181 (99%), Gaps = 0/181 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKKL+ PMR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGI+YDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIRYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTKDDAMKWFQVKYEGVILNK+ NI
Sbjct  121  STGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTKDDAMKWFQVKYEGVILNKSQNI  180

Query  200  S  198
            +
Sbjct  181  T  181



>ref|XP_008381196.1| PREDICTED: 60S ribosomal protein L11 isoform X2 [Malus domestica]
Length=183

 Score =   332 bits (851),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 172/181 (95%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MA EKKL  PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MAEEKKLANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDFYVVLERPGYRV RRRRCK+RVGIQHRVTKDDAMKWFQVKYEGVILNK+  +
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRCKSRVGIQHRVTKDDAMKWFQVKYEGVILNKSQQL  180

Query  200  S  198
            S
Sbjct  181  S  181



>ref|XP_006843688.1| hypothetical protein AMTR_s00007p00200160 [Amborella trichopoda]
 gb|ERN05363.1| hypothetical protein AMTR_s00007p00200160 [Amborella trichopoda]
Length=183

 Score =   332 bits (851),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 172/180 (96%), Positives = 176/180 (98%), Gaps = 0/180 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKKL  PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLTNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDFYVVLERPGYRV RRRRCK+RVGIQHRVTK+DAMKWFQVKYEGVILNK+ NI
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRCKSRVGIQHRVTKEDAMKWFQVKYEGVILNKSQNI  180



>gb|ABK22492.1| unknown [Picea sitchensis]
 gb|ABK26358.1| unknown [Picea sitchensis]
Length=180

 Score =   332 bits (850),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 166/180 (92%), Positives = 176/180 (98%), Gaps = 0/180 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MA+EKKLN PMREIKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MAAEKKLNNPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRG+KA+QLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKALQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDF+VVLERPGYR+ RR+R ++RVGIQHRVTKDDAMKWFQVKYEGVILNK+ NI
Sbjct  121  STGIYGMDFFVVLERPGYRIGRRKRAQSRVGIQHRVTKDDAMKWFQVKYEGVILNKSQNI  180



>ref|XP_009790976.1| PREDICTED: 60S ribosomal protein L11-1 [Nicotiana sylvestris]
Length=181

 Score =   332 bits (850),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 171/180 (95%), Positives = 179/180 (99%), Gaps = 0/180 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKKL+ PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFS+TGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDFYVVLERPGYRVARRRRCK+RVGIQHRVTK+DAMKWFQVKYEGVILNK+SN+
Sbjct  121  STGIYGMDFYVVLERPGYRVARRRRCKSRVGIQHRVTKEDAMKWFQVKYEGVILNKSSNL  180



>ref|XP_004505457.1| PREDICTED: 60S ribosomal protein L11-like [Cicer arietinum]
Length=181

 Score =   332 bits (850),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 172/180 (96%), Positives = 176/180 (98%), Gaps = 0/180 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKKL+ PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDF+VVLERPGYRV RRRRCK+RVGIQHRVTKDDAMKWFQVKYEGVILNK+  I
Sbjct  121  STGIYGMDFFVVLERPGYRVGRRRRCKSRVGIQHRVTKDDAMKWFQVKYEGVILNKSQAI  180



>gb|KFK28544.1| hypothetical protein AALP_AA7G010400 [Arabis alpina]
 gb|KFK31523.1| hypothetical protein AALP_AA6G123700 [Arabis alpina]
Length=182

 Score =   332 bits (850),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 172/181 (95%), Positives = 179/181 (99%), Gaps = 0/181 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKKL+ PMR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLR+NFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRKNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTKDDAMKWFQVKYEGVILNK+ NI
Sbjct  121  STGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTKDDAMKWFQVKYEGVILNKSQNI  180

Query  200  S  198
            +
Sbjct  181  T  181



>sp|P46287.1|RL11_MEDSA RecName: Full=60S ribosomal protein L11; AltName: Full=L5 [Medicago 
sativa]
 emb|CAA55090.1| RL5 ribosomal protein [Medicago sativa]
Length=181

 Score =   331 bits (849),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 173/180 (96%), Positives = 176/180 (98%), Gaps = 0/180 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKKL+ PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDF+VVLERPGYRV RRRRCKARVGIQHRVTKDDAMKWFQVKYEGVILNK+  I
Sbjct  121  STGIYGMDFFVVLERPGYRVGRRRRCKARVGIQHRVTKDDAMKWFQVKYEGVILNKSQAI  180



>ref|XP_010052848.1| PREDICTED: 60S ribosomal protein L11-1 [Eucalyptus grandis]
 gb|KCW89658.1| hypothetical protein EUGRSUZ_A01929 [Eucalyptus grandis]
Length=182

 Score =   331 bits (849),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 170/181 (94%), Positives = 178/181 (98%), Gaps = 0/181 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKKL+ PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDFY+VLERPGYRV RRRRCK+RVGIQHRVTK+DAMKWFQVKYEGVILNK+ NI
Sbjct  121  STGIYGMDFYIVLERPGYRVGRRRRCKSRVGIQHRVTKEDAMKWFQVKYEGVILNKSQNI  180

Query  200  S  198
            +
Sbjct  181  T  181



>ref|XP_010274422.1| PREDICTED: 60S ribosomal protein L11 [Nelumbo nucifera]
Length=182

 Score =   331 bits (849),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 172/180 (96%), Positives = 177/180 (98%), Gaps = 0/180 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKKL+ PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDFYVVLERPGYRVARRRRCK+RVGIQHRVTK+DAMKWFQVKYEGVILNK+  I
Sbjct  121  STGIYGMDFYVVLERPGYRVARRRRCKSRVGIQHRVTKEDAMKWFQVKYEGVILNKSQTI  180



>gb|AFK48866.1| unknown [Lotus japonicus]
Length=181

 Score =   331 bits (849),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 172/180 (96%), Positives = 175/180 (97%), Gaps = 0/180 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKKL  PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLR+NFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRKNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDFYVVLERPGYRV RRRRCK+RVGIQHRVTKDDAMKWFQVKYEGVILNKA  +
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRCKSRVGIQHRVTKDDAMKWFQVKYEGVILNKAQAV  180



>ref|XP_002880003.1| 60S ribosomal protein L11 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56262.1| 60S ribosomal protein L11 [Arabidopsis lyrata subsp. lyrata]
Length=182

 Score =   331 bits (849),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 172/181 (95%), Positives = 178/181 (98%), Gaps = 0/181 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKKL+ PMR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
             RRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   TRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTKDDAMKWFQVKYEGVILNK+ NI
Sbjct  121  STGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTKDDAMKWFQVKYEGVILNKSQNI  180

Query  200  S  198
            +
Sbjct  181  T  181



>emb|CAA57394.1| ribosomal protein L16 [Arabidopsis thaliana]
Length=182

 Score =   331 bits (849),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 171/181 (94%), Positives = 178/181 (98%), Gaps = 0/181 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKKL+ PMR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGM+FYVVLERPGYRVARRRRCK RVGIQHRVTKDDAMKWFQVKYEGVILNK+ NI
Sbjct  121  STGIYGMEFYVVLERPGYRVARRRRCKTRVGIQHRVTKDDAMKWFQVKYEGVILNKSQNI  180

Query  200  S  198
            +
Sbjct  181  T  181



>ref|XP_006449533.1| hypothetical protein CICLE_v10016873mg [Citrus clementina]
 ref|XP_006467622.1| PREDICTED: 60S ribosomal protein L11-like [Citrus sinensis]
 gb|ESR62773.1| hypothetical protein CICLE_v10016873mg [Citrus clementina]
 gb|KDO77895.1| hypothetical protein CISIN_1g029665mg [Citrus sinensis]
Length=182

 Score =   331 bits (848),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 171/180 (95%), Positives = 177/180 (98%), Gaps = 0/180 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MAS+KKL+ PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASDKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDF+VVLERPGYRV RRRRCK+RVGIQHRVTK+DAMKWFQVKYEGVILNK+ NI
Sbjct  121  STGIYGMDFFVVLERPGYRVGRRRRCKSRVGIQHRVTKEDAMKWFQVKYEGVILNKSQNI  180



>ref|XP_002876475.1| 60S ribosomal protein L11 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52734.1| 60S ribosomal protein L11 [Arabidopsis lyrata subsp. lyrata]
Length=182

 Score =   331 bits (848),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 172/181 (95%), Positives = 178/181 (98%), Gaps = 0/181 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKKL+ PMR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSK RYTVRSFG
Sbjct  1    MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKGRYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTKDDAMKWFQVKYEGVILNK+ NI
Sbjct  121  STGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTKDDAMKWFQVKYEGVILNKSQNI  180

Query  200  S  198
            +
Sbjct  181  T  181



>gb|AAR83867.1| ribosomal protein L11-like protein [Capsicum annuum]
Length=181

 Score =   331 bits (848),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 171/180 (95%), Positives = 178/180 (99%), Gaps = 0/180 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASE KLN PMR+IKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASENKLNNPMRDIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFS+TGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDFYVVLERPGYRVARRRRCK+RVGIQHRVTK+DAMKWFQVKYEGVILNK+SNI
Sbjct  121  STGIYGMDFYVVLERPGYRVARRRRCKSRVGIQHRVTKEDAMKWFQVKYEGVILNKSSNI  180



>ref|XP_009378940.1| PREDICTED: 60S ribosomal protein L11 isoform X2 [Pyrus x bretschneideri]
Length=182

 Score =   331 bits (848),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 171/181 (94%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MA EKKL  PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MAEEKKLANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDFYVVLERPGYRV RRRRCK+RVGIQHRVTKDDAMKWFQVKYEGVILNK+  +
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRCKSRVGIQHRVTKDDAMKWFQVKYEGVILNKSQQL  180

Query  200  S  198
            +
Sbjct  181  T  181



>ref|XP_002309361.1| 60S ribosomal protein L11 [Populus trichocarpa]
 ref|XP_002309362.1| 60S ribosomal protein L11-2 [Populus trichocarpa]
 ref|XP_002317400.1| ribosomal protein RL5 [Populus trichocarpa]
 ref|XP_002317401.1| ribosomal protein RL5 [Populus trichocarpa]
 gb|ABK93699.1| unknown [Populus trichocarpa]
 gb|EEE92884.1| 60S ribosomal protein L11 [Populus trichocarpa]
 gb|EEE92885.1| 60S ribosomal protein L11-2 [Populus trichocarpa]
 gb|EEE98012.1| ribosomal protein RL5 [Populus trichocarpa]
 gb|EEE98013.1| ribosomal protein RL5 [Populus trichocarpa]
Length=180

 Score =   331 bits (848),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 172/180 (96%), Positives = 175/180 (97%), Gaps = 0/180 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKKL+ PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDFYVVLERPGYRV RRRRCK+RVGI  RVTKDDAMKWFQVKYEGVILNK+ NI
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRCKSRVGIHQRVTKDDAMKWFQVKYEGVILNKSQNI  180



>ref|XP_009116550.1| PREDICTED: 60S ribosomal protein L11-1 [Brassica rapa]
Length=182

 Score =   331 bits (848),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 173/181 (96%), Positives = 178/181 (98%), Gaps = 0/181 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKKL+ PMR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHI LGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIYLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTKDDAMKWFQVKYEGVILNK+ NI
Sbjct  121  STGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTKDDAMKWFQVKYEGVILNKSQNI  180

Query  200  S  198
            +
Sbjct  181  T  181



>ref|XP_010689742.1| PREDICTED: 60S ribosomal protein L11-1 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=182

 Score =   331 bits (848),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 173/180 (96%), Positives = 177/180 (98%), Gaps = 0/180 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MA EKKL+ PMR+IKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYTVRSFG
Sbjct  1    MAPEKKLSNPMRDIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTKDDAMKWFQVKYEGVILNKA NI
Sbjct  121  STGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTKDDAMKWFQVKYEGVILNKAHNI  180



>ref|XP_009351472.1| PREDICTED: 60S ribosomal protein L11 [Pyrus x bretschneideri]
Length=182

 Score =   331 bits (848),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 171/181 (94%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASE KL  PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASESKLANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDF+VVLERPGYRV RRRRCK+RVGIQHRVTK+DAMKWFQVKYEGVILNK+ NI
Sbjct  121  STGIYGMDFFVVLERPGYRVGRRRRCKSRVGIQHRVTKEDAMKWFQVKYEGVILNKSQNI  180

Query  200  S  198
            +
Sbjct  181  T  181



>ref|XP_010427776.1| PREDICTED: 60S ribosomal protein L11-1-like [Camelina sativa]
Length=182

 Score =   331 bits (848),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 172/181 (95%), Positives = 178/181 (98%), Gaps = 0/181 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKKL+ PMR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRG+KAMQLLE GLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLEGGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTKDDAMKWFQVKYEGVILNK+ NI
Sbjct  121  STGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTKDDAMKWFQVKYEGVILNKSQNI  180

Query  200  S  198
            +
Sbjct  181  T  181



>ref|XP_008345917.1| PREDICTED: 60S ribosomal protein L11 [Malus domestica]
Length=182

 Score =   331 bits (848),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 172/181 (95%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASE KL  PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASENKLANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDF+VVLERPGYRV RRRRCKARVGIQHRVTK+DAMKWFQVKYEGVILNK+ NI
Sbjct  121  STGIYGMDFFVVLERPGYRVGRRRRCKARVGIQHRVTKEDAMKWFQVKYEGVILNKSQNI  180

Query  200  S  198
            +
Sbjct  181  T  181



>ref|XP_006285819.1| hypothetical protein CARUB_v10007309mg [Capsella rubella]
 ref|XP_010439815.1| PREDICTED: 60S ribosomal protein L11-1 isoform X1 [Camelina sativa]
 ref|XP_010449472.1| PREDICTED: 60S ribosomal protein L11-1 isoform X1 [Camelina sativa]
 ref|XP_010496880.1| PREDICTED: 60S ribosomal protein L11-1 isoform X1 [Camelina sativa]
 gb|EOA18717.1| hypothetical protein CARUB_v10007309mg [Capsella rubella]
Length=183

 Score =   331 bits (848),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 172/180 (96%), Positives = 178/180 (99%), Gaps = 0/180 (0%)
 Frame = -3

Query  737  ASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  558
            ASEKKL+ PMR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFGI
Sbjct  3    ASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFGI  62

Query  557  RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  378
            RRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS
Sbjct  63   RRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  122

Query  377  TGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNIS  198
            TGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTKDDAMKWFQVKYEGVILNK+ NI+
Sbjct  123  TGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTKDDAMKWFQVKYEGVILNKSQNIT  182



>ref|XP_008443441.1| PREDICTED: 60S ribosomal protein L11-1 [Cucumis melo]
 gb|KGN65615.1| hypothetical protein Csa_1G470310 [Cucumis sativus]
Length=182

 Score =   330 bits (847),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 169/181 (93%), Positives = 177/181 (98%), Gaps = 0/181 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKKL+ PMR+IKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDFYVVLERPGYRV RRRRCK+ VGIQHRVTK+DAMKWFQVKYEGVILNK+ NI
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRCKSSVGIQHRVTKEDAMKWFQVKYEGVILNKSQNI  180

Query  200  S  198
            +
Sbjct  181  T  181



>ref|XP_010052835.1| PREDICTED: 60S ribosomal protein L11-1-like [Eucalyptus grandis]
Length=182

 Score =   330 bits (847),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 170/181 (94%), Positives = 178/181 (98%), Gaps = 0/181 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MA+EKKL+ PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MAAEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDFYVVLERPGYRV RRRRCK+RVGIQHRVTK+DAMKWFQVKYEGVILNK+ NI
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRCKSRVGIQHRVTKEDAMKWFQVKYEGVILNKSQNI  180

Query  200  S  198
            +
Sbjct  181  T  181



>pir||T04865 ribosomal protein L11, cytosolic - Arabidopsis thaliana
 emb|CAA57396.1| ribosomal protein L16 [Arabidopsis thaliana]
 emb|CAB37458.1| ribosomal protein L11, cytosolic [Arabidopsis thaliana]
 emb|CAB78875.1| ribosomal protein L11, cytosolic [Arabidopsis thaliana]
Length=184

 Score =   330 bits (847),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 171/180 (95%), Positives = 177/180 (98%), Gaps = 0/180 (0%)
 Frame = -3

Query  737  ASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  558
            ASEKKL+ PMR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFGI
Sbjct  4    ASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFGI  63

Query  557  RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  378
            RRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS
Sbjct  64   RRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  123

Query  377  TGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNIS  198
            TGIYGMDFYVVLERPGYRVARRRRCK RVGIQHRVTKDDAMKWFQVKYEGVILNK+ NI+
Sbjct  124  TGIYGMDFYVVLERPGYRVARRRRCKTRVGIQHRVTKDDAMKWFQVKYEGVILNKSQNIT  183



>ref|XP_011039398.1| PREDICTED: 60S ribosomal protein L11 [Populus euphratica]
 ref|XP_011039399.1| PREDICTED: 60S ribosomal protein L11 [Populus euphratica]
 ref|XP_011039400.1| PREDICTED: 60S ribosomal protein L11 [Populus euphratica]
Length=182

 Score =   330 bits (847),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 172/180 (96%), Positives = 175/180 (97%), Gaps = 0/180 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKKL+ PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDFYVVLERPGYRV RRRRCK+RVGI  RVTKDDAMKWFQVKYEGVILNK+ NI
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRCKSRVGIHQRVTKDDAMKWFQVKYEGVILNKSQNI  180



>ref|XP_008228941.1| PREDICTED: 60S ribosomal protein L11 isoform X1 [Prunus mume]
Length=184

 Score =   330 bits (847),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 171/180 (95%), Positives = 175/180 (97%), Gaps = 0/180 (0%)
 Frame = -3

Query  737  ASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  558
            ASEKKL  PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI
Sbjct  3    ASEKKLANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  62

Query  557  RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  378
            RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS
Sbjct  63   RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  122

Query  377  TGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNIS  198
            TGIYGMDF+VVLERPGYRV RRRRCK+RVGIQHRVTKDDAMKWFQVKYEGVILNK+  +S
Sbjct  123  TGIYGMDFFVVLERPGYRVGRRRRCKSRVGIQHRVTKDDAMKWFQVKYEGVILNKSQQLS  182



>ref|XP_010538574.1| PREDICTED: 60S ribosomal protein L11-1-like isoform X3 [Tarenaya 
hassleriana]
Length=183

 Score =   330 bits (847),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 171/180 (95%), Positives = 177/180 (98%), Gaps = 0/180 (0%)
 Frame = -3

Query  737  ASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  558
            ASEKKL+ PMR+IKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI
Sbjct  3    ASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  62

Query  557  RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  378
            RRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS
Sbjct  63   RRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  122

Query  377  TGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNIS  198
            TGIYGMDFYVVLERPGYRVARRRR KARVGIQHRVTK+DAMKWFQVKYEGVILNK+ NI+
Sbjct  123  TGIYGMDFYVVLERPGYRVARRRRGKARVGIQHRVTKEDAMKWFQVKYEGVILNKSQNIT  182



>ref|XP_010538572.1| PREDICTED: 60S ribosomal protein L11-1-like isoform X1 [Tarenaya 
hassleriana]
Length=183

 Score =   330 bits (846),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 172/180 (96%), Positives = 178/180 (99%), Gaps = 0/180 (0%)
 Frame = -3

Query  737  ASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  558
            ASEKKL+ PMR+IKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI
Sbjct  3    ASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  62

Query  557  RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  378
            RRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS
Sbjct  63   RRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  122

Query  377  TGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNIS  198
            TGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTK+DAMKWFQVKYEGVILNK+ NI+
Sbjct  123  TGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTKEDAMKWFQVKYEGVILNKSQNIT  182



>ref|XP_009365286.1| PREDICTED: 60S ribosomal protein L11 isoform X2 [Pyrus x bretschneideri]
Length=183

 Score =   330 bits (846),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 171/181 (94%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MA E KL  PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MAEENKLANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDFYVVLERPGYRV RRRRCK+RVGIQHRVTKDDAMKWFQVKYEGVILNK+  +
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRCKSRVGIQHRVTKDDAMKWFQVKYEGVILNKSQQL  180

Query  200  S  198
            S
Sbjct  181  S  181



>ref|NP_001237077.1| uncharacterized protein LOC100499863 [Glycine max]
 ref|XP_003527577.1| PREDICTED: 60S ribosomal protein L11-like [Glycine max]
 ref|XP_006582268.1| PREDICTED: 60S ribosomal protein L11-like [Glycine max]
 ref|XP_006598073.1| PREDICTED: 60S ribosomal protein L11-like [Glycine max]
 gb|ACU13960.1| unknown [Glycine max]
 gb|ACU24606.1| unknown [Glycine max]
 gb|KHN27795.1| 60S ribosomal protein L11 [Glycine soja]
Length=181

 Score =   330 bits (846),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 171/180 (95%), Positives = 176/180 (98%), Gaps = 0/180 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKKL+ PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDF+VVLERPGYRV RRRRCK+RVGIQHRVTK+DAMKWFQVKYEGVILNK+  I
Sbjct  121  STGIYGMDFFVVLERPGYRVGRRRRCKSRVGIQHRVTKEDAMKWFQVKYEGVILNKSQAI  180



>gb|KHG23956.1| 60S ribosomal L11-2 -like protein [Gossypium arboreum]
Length=182

 Score =   330 bits (846),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 170/180 (94%), Positives = 175/180 (97%), Gaps = 0/180 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKKL+ PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDFYVVLER GYRV RRRRCK+ VGIQHRVTK+DAMKWFQVKYEGVILNK+ NI
Sbjct  121  STGIYGMDFYVVLERAGYRVGRRRRCKSSVGIQHRVTKEDAMKWFQVKYEGVILNKSQNI  180



>ref|XP_011033383.1| PREDICTED: 60S ribosomal protein L11-like [Populus euphratica]
 ref|XP_011015073.1| PREDICTED: 60S ribosomal protein L11-like isoform X1 [Populus 
euphratica]
 ref|XP_011015074.1| PREDICTED: 60S ribosomal protein L11-like isoform X2 [Populus 
euphratica]
Length=182

 Score =   330 bits (846),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 171/180 (95%), Positives = 175/180 (97%), Gaps = 0/180 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKKL+ PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDFYVVLERPGYRV RRRRCK+RVGI  RVTKDDAMKWFQ+KYEGVILNK+ NI
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRCKSRVGIHQRVTKDDAMKWFQIKYEGVILNKSQNI  180



>gb|AFK35020.1| unknown [Lotus japonicus]
Length=181

 Score =   330 bits (845),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 171/180 (95%), Positives = 175/180 (97%), Gaps = 0/180 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKKL  PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLR+NFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRKNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDF+VVLERPGYRV RRRRCK+RVGIQHRVTKDDAMKWFQVKYEGVILNKA  +
Sbjct  121  STGIYGMDFFVVLERPGYRVGRRRRCKSRVGIQHRVTKDDAMKWFQVKYEGVILNKAQAV  180



>ref|XP_010052179.1| PREDICTED: 60S ribosomal protein L11-1 [Eucalyptus grandis]
 gb|KCW76098.1| hypothetical protein EUGRSUZ_D00478 [Eucalyptus grandis]
Length=182

 Score =   330 bits (845),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 170/181 (94%), Positives = 178/181 (98%), Gaps = 0/181 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKKL+ PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDFYVVLERPGYRV RRRRCK+RVGI+HRVTK+DAMKWFQVKYEGVILNK+ NI
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRCKSRVGIRHRVTKEDAMKWFQVKYEGVILNKSQNI  180

Query  200  S  198
            +
Sbjct  181  T  181



>ref|XP_008381195.1| PREDICTED: 60S ribosomal protein L11 isoform X1 [Malus domestica]
Length=184

 Score =   330 bits (846),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 171/180 (95%), Positives = 174/180 (97%), Gaps = 0/180 (0%)
 Frame = -3

Query  737  ASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  558
            A EKKL  PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI
Sbjct  3    AEEKKLANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  62

Query  557  RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  378
            RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS
Sbjct  63   RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  122

Query  377  TGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNIS  198
            TGIYGMDFYVVLERPGYRV RRRRCK+RVGIQHRVTKDDAMKWFQVKYEGVILNK+  +S
Sbjct  123  TGIYGMDFYVVLERPGYRVGRRRRCKSRVGIQHRVTKDDAMKWFQVKYEGVILNKSQQLS  182



>ref|XP_002281886.1| PREDICTED: 60S ribosomal protein L11 [Vitis vinifera]
Length=183

 Score =   330 bits (845),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 170/181 (94%), Positives = 177/181 (98%), Gaps = 0/181 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKKL+ PMR+IKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDF+VVLERPGYRV RRRRCK+RVGIQHRVTKDD+MKWFQVKYEGVILNKA  I
Sbjct  121  STGIYGMDFFVVLERPGYRVGRRRRCKSRVGIQHRVTKDDSMKWFQVKYEGVILNKAQTI  180

Query  200  S  198
            +
Sbjct  181  A  181



>ref|XP_003540015.1| PREDICTED: 60S ribosomal protein L11-like [Glycine max]
Length=181

 Score =   330 bits (845),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 171/180 (95%), Positives = 176/180 (98%), Gaps = 0/180 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKKL+ PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDF+VVLERPGYRV RRRRCK+RVGIQHRVTK+DAMKWFQVKYEGVILNK+  I
Sbjct  121  STGIYGMDFFVVLERPGYRVGRRRRCKSRVGIQHRVTKEDAMKWFQVKYEGVILNKSQAI  180



>ref|NP_001274979.1| 60S ribosomal protein L11-2-like [Solanum tuberosum]
 ref|XP_004232337.1| PREDICTED: 60S ribosomal protein L11-1 [Solanum lycopersicum]
 ref|XP_004243273.1| PREDICTED: 60S ribosomal protein L11-1 [Solanum lycopersicum]
 ref|XP_004248195.1| PREDICTED: 60S ribosomal protein L11-1 [Solanum lycopersicum]
 ref|XP_004251809.1| PREDICTED: 60S ribosomal protein L11-1 [Solanum lycopersicum]
 ref|XP_006348888.1| PREDICTED: 60S ribosomal protein L11-2-like [Solanum tuberosum]
 ref|XP_006350023.1| PREDICTED: 60S ribosomal protein L11-2-like [Solanum tuberosum]
 ref|XP_006357834.1| PREDICTED: 60S ribosomal protein L11-2-like [Solanum tuberosum]
 gb|ABB29943.1| ribosomal protein L11-like protein [Solanum tuberosum]
Length=181

 Score =   329 bits (844),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 170/180 (94%), Positives = 179/180 (99%), Gaps = 0/180 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKKL+ PMR+IKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFS+TGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDFYVVLERPGYRVARRRRCK+RVGIQHRVTK+D+MKWFQVKYEGVILNK+SNI
Sbjct  121  STGIYGMDFYVVLERPGYRVARRRRCKSRVGIQHRVTKEDSMKWFQVKYEGVILNKSSNI  180



>gb|KJB57391.1| hypothetical protein B456_009G161300 [Gossypium raimondii]
 gb|KJB66842.1| hypothetical protein B456_010G160100 [Gossypium raimondii]
 gb|KJB66843.1| hypothetical protein B456_010G160100 [Gossypium raimondii]
 gb|KJB68369.1| hypothetical protein B456_010G241400 [Gossypium raimondii]
 gb|KJB69699.1| hypothetical protein B456_011G038200 [Gossypium raimondii]
Length=182

 Score =   329 bits (844),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 171/180 (95%), Positives = 176/180 (98%), Gaps = 0/180 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKKL+ PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDFYVVLER GYRV RRRRCK+RVGIQHRVTK+DAMKWFQVKYEGVILNK+ NI
Sbjct  121  STGIYGMDFYVVLERAGYRVGRRRRCKSRVGIQHRVTKEDAMKWFQVKYEGVILNKSQNI  180



>ref|XP_004293968.1| PREDICTED: 60S ribosomal protein L11 [Fragaria vesca subsp. vesca]
Length=181

 Score =   329 bits (844),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 172/180 (96%), Positives = 175/180 (97%), Gaps = 0/180 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKKL  PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLR+NFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRKNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDF+VVLERPGYRV RRRRCKARVGIQHRVTKDDAMKWFQVKYEGVILNK+  I
Sbjct  121  STGIYGMDFFVVLERPGYRVGRRRRCKARVGIQHRVTKDDAMKWFQVKYEGVILNKSQAI  180



>ref|XP_008786958.1| PREDICTED: 60S ribosomal protein L11-like [Phoenix dactylifera]
Length=181

 Score =   329 bits (843),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 169/181 (93%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKK++ PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKMSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDFYVVLERPGYRV RRRRCK+ VGIQHRVTK+DAMKWFQVKYEGVILNK+   
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRCKSGVGIQHRVTKEDAMKWFQVKYEGVILNKSQAT  180

Query  200  S  198
            S
Sbjct  181  S  181



>ref|XP_008343092.1| PREDICTED: 60S ribosomal protein L11-like isoform X2 [Malus domestica]
Length=182

 Score =   329 bits (843),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 170/181 (94%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MA EKKL  PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MAEEKKLANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDFYVVLERPGYRV RRRRCK+RVGI+HRVTKDDAMKWFQVKYEGVILNK+  +
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRCKSRVGIRHRVTKDDAMKWFQVKYEGVILNKSQQL  180

Query  200  S  198
            +
Sbjct  181  T  181



>ref|XP_007132813.1| hypothetical protein PHAVU_011G126600g [Phaseolus vulgaris]
 gb|ESW04807.1| hypothetical protein PHAVU_011G126600g [Phaseolus vulgaris]
Length=181

 Score =   329 bits (843),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 170/180 (94%), Positives = 176/180 (98%), Gaps = 0/180 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKKL+ PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDF+VVLERPGYRV RRRRCK+RVGIQHRVTK+D+MKWFQVKYEGVILNK+  I
Sbjct  121  STGIYGMDFFVVLERPGYRVGRRRRCKSRVGIQHRVTKEDSMKWFQVKYEGVILNKSQAI  180



>gb|KHN42782.1| 60S ribosomal protein L11 [Glycine soja]
Length=181

 Score =   329 bits (843),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 170/180 (94%), Positives = 176/180 (98%), Gaps = 0/180 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKKL+ PMREIKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDF+VVLERPGYRV RRRRCK+RVGIQHRVTK+DAMKWFQVKYEGVILNK+  I
Sbjct  121  STGIYGMDFFVVLERPGYRVGRRRRCKSRVGIQHRVTKEDAMKWFQVKYEGVILNKSQAI  180



>ref|XP_009383242.1| PREDICTED: 60S ribosomal protein L11 [Musa acuminata subsp. malaccensis]
Length=182

 Score =   329 bits (843),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 171/179 (96%), Positives = 176/179 (98%), Gaps = 0/179 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKKL+ PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASN  204
            STGIYGMDFYVVLER GYRVARRRRCK+RVGIQHRVTK+DAMKWFQVKYEGVILNK+ +
Sbjct  121  STGIYGMDFYVVLERAGYRVARRRRCKSRVGIQHRVTKEDAMKWFQVKYEGVILNKSQS  179



>ref|XP_009378939.1| PREDICTED: 60S ribosomal protein L11 isoform X1 [Pyrus x bretschneideri]
Length=183

 Score =   328 bits (842),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 170/180 (94%), Positives = 174/180 (97%), Gaps = 0/180 (0%)
 Frame = -3

Query  737  ASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  558
            A EKKL  PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI
Sbjct  3    AEEKKLANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  62

Query  557  RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  378
            RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS
Sbjct  63   RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  122

Query  377  TGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNIS  198
            TGIYGMDFYVVLERPGYRV RRRRCK+RVGIQHRVTKDDAMKWFQVKYEGVILNK+  ++
Sbjct  123  TGIYGMDFYVVLERPGYRVGRRRRCKSRVGIQHRVTKDDAMKWFQVKYEGVILNKSQQLT  182



>ref|XP_010915478.1| PREDICTED: 60S ribosomal protein L11-like [Elaeis guineensis]
 ref|XP_010925608.1| PREDICTED: 60S ribosomal protein L11-like [Elaeis guineensis]
Length=182

 Score =   328 bits (842),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 170/177 (96%), Positives = 175/177 (99%), Gaps = 0/177 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKK++ PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKMSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKA  210
            STGIYGMDFYVVLERPGYRV RRRRCK+RVGIQHRVTK+DAMKWFQVKYEGVILNKA
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRCKSRVGIQHRVTKEDAMKWFQVKYEGVILNKA  177



>gb|KDO77896.1| hypothetical protein CISIN_1g029665mg [Citrus sinensis]
Length=190

 Score =   329 bits (843),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 170/181 (94%), Positives = 177/181 (98%), Gaps = 0/181 (0%)
 Frame = -3

Query  743  DMASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSF  564
            + AS+KKL+ PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSF
Sbjct  8    NQASDKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSF  67

Query  563  GIRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYD  384
            GIRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYD
Sbjct  68   GIRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYD  127

Query  383  PSTGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASN  204
            PSTGIYGMDF+VVLERPGYRV RRRRCK+RVGIQHRVTK+DAMKWFQVKYEGVILNK+ N
Sbjct  128  PSTGIYGMDFFVVLERPGYRVGRRRRCKSRVGIQHRVTKEDAMKWFQVKYEGVILNKSQN  187

Query  203  I  201
            I
Sbjct  188  I  188



>ref|XP_003628237.1| 60S ribosomal protein L11 [Medicago truncatula]
 gb|AET02713.1| 50S ribosomal protein L5P [Medicago truncatula]
 gb|AFK39602.1| unknown [Medicago truncatula]
Length=181

 Score =   328 bits (842),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 171/180 (95%), Positives = 176/180 (98%), Gaps = 0/180 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKKL+ PMR+IKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDF+VVLERPGYRV RRRRCKARVGIQHRVTKDD+MKWFQVKYEGVILNK+  I
Sbjct  121  STGIYGMDFFVVLERPGYRVGRRRRCKARVGIQHRVTKDDSMKWFQVKYEGVILNKSQAI  180



>ref|XP_009404521.1| PREDICTED: 60S ribosomal protein L11 [Musa acuminata subsp. malaccensis]
Length=182

 Score =   328 bits (842),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 171/181 (94%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKKL+ PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDF+VVLER GYRVARRRRCK+RVGIQHRVTKDDAMKWFQVKYEGVILNK+   
Sbjct  121  STGIYGMDFFVVLERAGYRVARRRRCKSRVGIQHRVTKDDAMKWFQVKYEGVILNKSQTT  180

Query  200  S  198
            +
Sbjct  181  T  181



>ref|XP_008366039.1| PREDICTED: 60S ribosomal protein L11-1 [Malus domestica]
 ref|XP_009352738.1| PREDICTED: 60S ribosomal protein L11-1 [Pyrus x bretschneideri]
Length=182

 Score =   328 bits (842),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 169/181 (93%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASE K+  PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASESKMANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDFYVVLERPGYRV RRRRCK+RVGIQHRVTK+D+MKWFQVKYEGVILNK+ NI
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRCKSRVGIQHRVTKEDSMKWFQVKYEGVILNKSQNI  180

Query  200  S  198
            +
Sbjct  181  T  181



>gb|AFP44117.1| 60S ribosomal protein [Lycoris longituba]
Length=182

 Score =   328 bits (842),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 170/181 (94%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKKL+ PMREIKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFS+TGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDFYVVLERPGYRV RRRRCK+RVGIQHRVTK+DAMKWFQVKYEGVILNKA   
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRCKSRVGIQHRVTKEDAMKWFQVKYEGVILNKAQTT  180

Query  200  S  198
            +
Sbjct  181  T  181



>ref|XP_009408897.1| PREDICTED: 60S ribosomal protein L11 [Musa acuminata subsp. malaccensis]
Length=182

 Score =   328 bits (842),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 170/181 (94%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKKL+ PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDFYVVLER GYRV+RRRRCK+RVGIQHRVTK+D+MKWFQVKYEGVILNKA   
Sbjct  121  STGIYGMDFYVVLERAGYRVSRRRRCKSRVGIQHRVTKEDSMKWFQVKYEGVILNKAQGT  180

Query  200  S  198
            +
Sbjct  181  T  181



>gb|ABK93207.1| unknown [Populus trichocarpa]
Length=180

 Score =   328 bits (841),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 171/180 (95%), Positives = 174/180 (97%), Gaps = 0/180 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKKL+ PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRGDKAMQL ESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLQESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDFYVVLERPGYRV RRRRCK+RVGI  RVTKDDAMKWFQVKYEGVILNK+ NI
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRCKSRVGIHQRVTKDDAMKWFQVKYEGVILNKSQNI  180



>gb|AFK37822.1| unknown [Medicago truncatula]
Length=181

 Score =   328 bits (841),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 170/180 (94%), Positives = 176/180 (98%), Gaps = 0/180 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKKL+ PMR+IKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDF+VVLERPGYRV RRRRCKARVGIQHRVTKDD+MKWFQVKYEGV+LNK+  I
Sbjct  121  STGIYGMDFFVVLERPGYRVGRRRRCKARVGIQHRVTKDDSMKWFQVKYEGVVLNKSQAI  180



>ref|NP_001132427.1| 60S ribosomal protein L11-1 [Zea mays]
 gb|ACF81262.1| unknown [Zea mays]
 gb|AFW81631.1| 60S ribosomal protein L11-1 [Zea mays]
Length=181

 Score =   328 bits (841),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 171/181 (94%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKK + PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKQSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDFYVVLER GYRVARRRRCK+RVGIQHRVTK+DAMKWFQVKYEGVILNKA N 
Sbjct  121  STGIYGMDFYVVLERAGYRVARRRRCKSRVGIQHRVTKEDAMKWFQVKYEGVILNKAQNT  180

Query  200  S  198
            S
Sbjct  181  S  181



>ref|XP_010936718.1| PREDICTED: 60S ribosomal protein L11 [Elaeis guineensis]
Length=182

 Score =   328 bits (841),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 170/177 (96%), Positives = 175/177 (99%), Gaps = 0/177 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKKL+ PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKA  210
            STGIYGMDF+VVLERPGYRV RRRRCK+RVGIQHRVTK+DAMKWFQVKYEGVILNKA
Sbjct  121  STGIYGMDFFVVLERPGYRVGRRRRCKSRVGIQHRVTKEDAMKWFQVKYEGVILNKA  177



>gb|KHG08920.1| 60S ribosomal L11-1 -like protein [Gossypium arboreum]
 gb|KJB34907.1| hypothetical protein B456_006G089700 [Gossypium raimondii]
Length=182

 Score =   328 bits (841),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 170/180 (94%), Positives = 176/180 (98%), Gaps = 0/180 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKKL+ PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDFYVVLER GYRV RRRRCK+RVGIQHRVTK+D+MKWFQVKYEGVILNK+ NI
Sbjct  121  STGIYGMDFYVVLERAGYRVGRRRRCKSRVGIQHRVTKEDSMKWFQVKYEGVILNKSQNI  180



>ref|NP_001238636.1| uncharacterized protein LOC100305912 [Glycine max]
 gb|ACU13823.1| unknown [Glycine max]
Length=181

 Score =   328 bits (841),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 170/180 (94%), Positives = 175/180 (97%), Gaps = 0/180 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKKL+ PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ PVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQAPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDF+VVLERPGYRV RRRRCK+RVGIQHRVTK+DAMKWFQVKYEGVILNK+  I
Sbjct  121  STGIYGMDFFVVLERPGYRVGRRRRCKSRVGIQHRVTKEDAMKWFQVKYEGVILNKSQAI  180



>ref|XP_010689741.1| PREDICTED: 60S ribosomal protein L11-1 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=183

 Score =   328 bits (841),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 172/179 (96%), Positives = 176/179 (98%), Gaps = 0/179 (0%)
 Frame = -3

Query  737  ASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  558
            A EKKL+ PMR+IKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYTVRSFGI
Sbjct  3    APEKKLSNPMRDIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRSFGI  62

Query  557  RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  378
            RRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS
Sbjct  63   RRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  122

Query  377  TGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            TGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTKDDAMKWFQVKYEGVILNKA NI
Sbjct  123  TGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTKDDAMKWFQVKYEGVILNKAHNI  181



>ref|XP_007048733.1| Ribosomal L5P family protein isoform 1 [Theobroma cacao]
 gb|EOX92890.1| Ribosomal L5P family protein isoform 1 [Theobroma cacao]
Length=182

 Score =   328 bits (840),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 170/180 (94%), Positives = 176/180 (98%), Gaps = 0/180 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASE+KL+ PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEQKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDFYVVLER GYRV RRRRCK+RVGIQHRVTK+DAMKWFQVKYEGVILNK+ NI
Sbjct  121  STGIYGMDFYVVLERAGYRVGRRRRCKSRVGIQHRVTKEDAMKWFQVKYEGVILNKSQNI  180



>gb|AFK38385.1| unknown [Lotus japonicus]
Length=181

 Score =   328 bits (840),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 170/180 (94%), Positives = 175/180 (97%), Gaps = 0/180 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKKL  PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLR+NFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRKNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDF+VVLERPGYRV RRRRCK+RVGIQHRVT+DDAMKWFQVKYEGVILNKA  +
Sbjct  121  STGIYGMDFFVVLERPGYRVGRRRRCKSRVGIQHRVTEDDAMKWFQVKYEGVILNKAQAV  180



>ref|XP_009365285.1| PREDICTED: 60S ribosomal protein L11 isoform X1 [Pyrus x bretschneideri]
Length=184

 Score =   328 bits (840),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 170/180 (94%), Positives = 173/180 (96%), Gaps = 0/180 (0%)
 Frame = -3

Query  737  ASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  558
            A E KL  PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI
Sbjct  3    AEENKLANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  62

Query  557  RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  378
            RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS
Sbjct  63   RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  122

Query  377  TGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNIS  198
            TGIYGMDFYVVLERPGYRV RRRRCK+RVGIQHRVTKDDAMKWFQVKYEGVILNK+  +S
Sbjct  123  TGIYGMDFYVVLERPGYRVGRRRRCKSRVGIQHRVTKDDAMKWFQVKYEGVILNKSQQLS  182



>ref|XP_007148755.1| hypothetical protein PHAVU_005G011400g [Phaseolus vulgaris]
 gb|ESW20749.1| hypothetical protein PHAVU_005G011400g [Phaseolus vulgaris]
Length=181

 Score =   328 bits (840),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 169/180 (94%), Positives = 176/180 (98%), Gaps = 0/180 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MA+EKKL+ PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MAAEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDF+VVLERPGYRV RRRRCK+RVGIQHRVTK+D+MKWFQVKYEGVILNK+  I
Sbjct  121  STGIYGMDFFVVLERPGYRVGRRRRCKSRVGIQHRVTKEDSMKWFQVKYEGVILNKSQAI  180



>gb|ADE77225.1| unknown [Picea sitchensis]
Length=180

 Score =   327 bits (839),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 164/180 (91%), Positives = 176/180 (98%), Gaps = 0/180 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MA+EKKLN PMR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MAAEKKLNNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRG+KA+QLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKALQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDF+VVLERPGYRV RR+R ++RVGIQHRVTK+D+MKWFQVKYEGVILNK+ NI
Sbjct  121  STGIYGMDFFVVLERPGYRVGRRKRAQSRVGIQHRVTKEDSMKWFQVKYEGVILNKSQNI  180



>ref|XP_009405598.1| PREDICTED: 60S ribosomal protein L11-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=185

 Score =   327 bits (839),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 170/182 (93%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = -3

Query  743  DMASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSF  564
            D ASEKKL+ PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSF
Sbjct  3    DTASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSF  62

Query  563  GIRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYD  384
            GIRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYD
Sbjct  63   GIRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYD  122

Query  383  PSTGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASN  204
            PSTGIYGMDF+VVLER GYRVARRRRCK+RVGIQHRVTK+DAMKWFQVKYEGVILNK+  
Sbjct  123  PSTGIYGMDFFVVLERAGYRVARRRRCKSRVGIQHRVTKEDAMKWFQVKYEGVILNKSQT  182

Query  203  IS  198
             +
Sbjct  183  TT  184



>gb|ACG31637.1| 60S ribosomal protein L11-1 [Zea mays]
Length=181

 Score =   327 bits (839),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 170/181 (94%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKK + PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKQSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTV+G+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVKGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDFYVVLER GYRVARRRRCK+RVGIQHRVTK+DAMKWFQVKYEGVILNKA N 
Sbjct  121  STGIYGMDFYVVLERAGYRVARRRRCKSRVGIQHRVTKEDAMKWFQVKYEGVILNKAQNT  180

Query  200  S  198
            S
Sbjct  181  S  181



>ref|XP_007025337.1| Ribosomal protein large subunit 16A [Theobroma cacao]
 gb|EOY27959.1| Ribosomal protein large subunit 16A [Theobroma cacao]
Length=257

 Score =   330 bits (846),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 170/180 (94%), Positives = 176/180 (98%), Gaps = 0/180 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKKL+ PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  76   MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  135

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  136  IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  195

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDFYVVLER GYRV RRRRCK+RVGIQHRVTK+DAMKWFQVKYEGVILNK+ NI
Sbjct  196  STGIYGMDFYVVLERAGYRVGRRRRCKSRVGIQHRVTKEDAMKWFQVKYEGVILNKSQNI  255



>ref|XP_008362518.1| PREDICTED: 60S ribosomal protein L11 isoform X2 [Malus domestica]
Length=182

 Score =   327 bits (838),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 169/181 (93%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MA EKKL  PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MAEEKKLANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDFY VLERPGYRV RRRRCK+RVGI+HRVTKDDAMKWFQVKYEGVILNK+  +
Sbjct  121  STGIYGMDFYXVLERPGYRVGRRRRCKSRVGIRHRVTKDDAMKWFQVKYEGVILNKSQQL  180

Query  200  S  198
            +
Sbjct  181  T  181



>ref|XP_007214493.1| hypothetical protein PRUPE_ppa020372mg [Prunus persica]
 gb|EMJ15692.1| hypothetical protein PRUPE_ppa020372mg [Prunus persica]
Length=276

 Score =   330 bits (847),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 171/179 (96%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = -3

Query  737  ASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  558
            ASEKKL  PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI
Sbjct  96   ASEKKLANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  155

Query  557  RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  378
            RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS
Sbjct  156  RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  215

Query  377  TGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            TGIYGMDF+VVLERPGYRV RRRRCK+RVGIQHRVTK+DAMKWFQVKYEGVILNK+ NI
Sbjct  216  TGIYGMDFFVVLERPGYRVGRRRRCKSRVGIQHRVTKEDAMKWFQVKYEGVILNKSQNI  274



>ref|XP_003598139.1| 60S ribosomal protein L11 [Medicago truncatula]
 gb|AES68390.1| 50S ribosomal protein L5P [Medicago truncatula]
 gb|AFK34937.1| unknown [Medicago truncatula]
Length=182

 Score =   327 bits (838),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 171/178 (96%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = -3

Query  734  SEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIR  555
            SEKKL+ PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIR
Sbjct  4    SEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIR  63

Query  554  RNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPST  375
            RNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPST
Sbjct  64   RNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPST  123

Query  374  GIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            GIYGMDF+VVLERPGYRV RRRRCKARVGIQHRVTKDDAMKWFQVKYEGVILNK+  I
Sbjct  124  GIYGMDFFVVLERPGYRVGRRRRCKARVGIQHRVTKDDAMKWFQVKYEGVILNKSQAI  181



>ref|XP_003607648.1| 60S ribosomal protein L11-1 [Medicago truncatula]
 gb|ACJ86168.1| unknown [Medicago truncatula]
 gb|AES89845.1| 50S ribosomal protein L5P [Medicago truncatula]
 gb|AFK48476.1| unknown [Medicago truncatula]
Length=181

 Score =   327 bits (837),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 170/180 (94%), Positives = 175/180 (97%), Gaps = 0/180 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MAS+KKL  PMR++KVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASDKKLANPMRDMKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDF+VVLERPGYRV RRRRCKARVGIQHRVTKDDAMKWFQVKYEGVILNK+  I
Sbjct  121  STGIYGMDFFVVLERPGYRVGRRRRCKARVGIQHRVTKDDAMKWFQVKYEGVILNKSQAI  180



>ref|XP_009405599.1| PREDICTED: 60S ribosomal protein L11-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=182

 Score =   327 bits (838),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 170/181 (94%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKKL+ PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDF+VVLER GYRVARRRRCK+RVGIQHRVTK+DAMKWFQVKYEGVILNK+   
Sbjct  121  STGIYGMDFFVVLERAGYRVARRRRCKSRVGIQHRVTKEDAMKWFQVKYEGVILNKSQTT  180

Query  200  S  198
            +
Sbjct  181  T  181



>ref|XP_009403504.1| PREDICTED: 60S ribosomal protein L11 [Musa acuminata subsp. malaccensis]
Length=182

 Score =   327 bits (837),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 169/181 (93%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKKL+ PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDF+VVLER GYRV+RRRRCK+RVGIQHRVTK+DAMKWFQVKYEGVILNK+   
Sbjct  121  STGIYGMDFFVVLERAGYRVSRRRRCKSRVGIQHRVTKEDAMKWFQVKYEGVILNKSQTT  180

Query  200  S  198
            +
Sbjct  181  T  181



>ref|XP_008343091.1| PREDICTED: 60S ribosomal protein L11-like isoform X1 [Malus domestica]
Length=183

 Score =   327 bits (837),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 169/180 (94%), Positives = 174/180 (97%), Gaps = 0/180 (0%)
 Frame = -3

Query  737  ASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  558
            A EKKL  PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI
Sbjct  3    AEEKKLANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  62

Query  557  RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  378
            RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS
Sbjct  63   RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  122

Query  377  TGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNIS  198
            TGIYGMDFYVVLERPGYRV RRRRCK+RVGI+HRVTKDDAMKWFQVKYEGVILNK+  ++
Sbjct  123  TGIYGMDFYVVLERPGYRVGRRRRCKSRVGIRHRVTKDDAMKWFQVKYEGVILNKSQQLT  182



>ref|XP_004133952.1| PREDICTED: 60S ribosomal protein L11-2-like isoform 2 [Cucumis 
sativus]
 ref|XP_004164745.1| PREDICTED: 60S ribosomal protein L11-2-like isoform 2 [Cucumis 
sativus]
 ref|XP_008438244.1| PREDICTED: 60S ribosomal protein L11-1-like isoform X2 [Cucumis 
melo]
 gb|KGN56659.1| hypothetical protein Csa_3G127210 [Cucumis sativus]
Length=182

 Score =   327 bits (837),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 168/181 (93%), Positives = 177/181 (98%), Gaps = 0/181 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKKL+ PMR+IKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDF+VVLERPGYRV RRRRCK+RVGIQHRVTK+DAMKWFQVKYEGVILNK+  I
Sbjct  121  STGIYGMDFFVVLERPGYRVGRRRRCKSRVGIQHRVTKEDAMKWFQVKYEGVILNKSQQI  180

Query  200  S  198
            +
Sbjct  181  T  181



>gb|KHN01495.1| 60S ribosomal protein L11 [Glycine soja]
Length=224

 Score =   328 bits (841),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 170/179 (95%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = -3

Query  737  ASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  558
            ASEKKL+ PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI
Sbjct  45   ASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  104

Query  557  RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  378
            RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS
Sbjct  105  RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  164

Query  377  TGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            TGIYGMDF+VVLERPGYRV RRRRCK+RVGIQHRVTK+DAMKWFQVKYEGVILNK+  I
Sbjct  165  TGIYGMDFFVVLERPGYRVGRRRRCKSRVGIQHRVTKEDAMKWFQVKYEGVILNKSQAI  223



>gb|ACJ86159.1| unknown [Medicago truncatula]
Length=181

 Score =   327 bits (837),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 170/180 (94%), Positives = 175/180 (97%), Gaps = 0/180 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKKL+ PMR+IKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRN SDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNLSDTGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDF+VVLERPGYRV RRRRCKARVGIQHRVTKDD+MKWFQVKYEGVILNK+  I
Sbjct  121  STGIYGMDFFVVLERPGYRVGRRRRCKARVGIQHRVTKDDSMKWFQVKYEGVILNKSQAI  180



>gb|KHN27796.1| 60S ribosomal protein L11, partial [Glycine soja]
Length=182

 Score =   326 bits (836),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 169/179 (94%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = -3

Query  737  ASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  558
            ASEKKL+ PMRE+KVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI
Sbjct  3    ASEKKLSNPMREMKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  62

Query  557  RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  378
            RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS
Sbjct  63   RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  122

Query  377  TGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            TGIYGMDF+VVLERPGYRV RRRRCK+RVGIQHRVTK+DAMKWFQVKYEGVILNK+  I
Sbjct  123  TGIYGMDFFVVLERPGYRVGRRRRCKSRVGIQHRVTKEDAMKWFQVKYEGVILNKSQAI  181



>ref|NP_001132260.1| hypothetical protein [Zea mays]
 gb|ACF81036.1| unknown [Zea mays]
 gb|AFW65988.1| hypothetical protein ZEAMMB73_747842 [Zea mays]
Length=182

 Score =   326 bits (835),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 170/177 (96%), Positives = 174/177 (98%), Gaps = 0/177 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKK + PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKQSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKA  210
            STGIYGMDFYVVLER GYRVARRRRCK+RVGIQHRVTK+D+MKWFQVKYEGVILNKA
Sbjct  121  STGIYGMDFYVVLERAGYRVARRRRCKSRVGIQHRVTKEDSMKWFQVKYEGVILNKA  177



>ref|XP_010102117.1| 60S ribosomal protein L11-2 [Morus notabilis]
 gb|EXB92367.1| 60S ribosomal protein L11-2 [Morus notabilis]
Length=207

 Score =   326 bits (835),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 168/180 (93%), Positives = 175/180 (97%), Gaps = 0/180 (0%)
 Frame = -3

Query  737  ASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  558
            ASEKKL  PMR+IKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFGI
Sbjct  27   ASEKKLANPMRDIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFGI  86

Query  557  RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  378
            RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS
Sbjct  87   RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  146

Query  377  TGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNIS  198
            TGIYGMDFYVVLER GYRV RRRRCK+RVGIQHRVTK+DAMKWFQ+KYEGVILNK+ NI+
Sbjct  147  TGIYGMDFYVVLERAGYRVGRRRRCKSRVGIQHRVTKEDAMKWFQIKYEGVILNKSQNIT  206



>ref|NP_001242757.1| uncharacterized protein LOC100778713 [Glycine max]
 gb|ACU13845.1| unknown [Glycine max]
Length=181

 Score =   325 bits (832),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 168/180 (93%), Positives = 174/180 (97%), Gaps = 0/180 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKKL+ PMREIKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDF+VVLERPGYRV RRRRCK+RVGIQHR TK+DA KWFQVKYEGVILNK+  I
Sbjct  121  STGIYGMDFFVVLERPGYRVGRRRRCKSRVGIQHRATKEDATKWFQVKYEGVILNKSQAI  180



>ref|XP_008362517.1| PREDICTED: 60S ribosomal protein L11 isoform X1 [Malus domestica]
Length=183

 Score =   325 bits (832),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 168/180 (93%), Positives = 173/180 (96%), Gaps = 0/180 (0%)
 Frame = -3

Query  737  ASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  558
            A EKKL  PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI
Sbjct  3    AEEKKLANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  62

Query  557  RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  378
            RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS
Sbjct  63   RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  122

Query  377  TGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNIS  198
            TGIYGMDFY VLERPGYRV RRRRCK+RVGI+HRVTKDDAMKWFQVKYEGVILNK+  ++
Sbjct  123  TGIYGMDFYXVLERPGYRVGRRRRCKSRVGIRHRVTKDDAMKWFQVKYEGVILNKSQQLT  182



>ref|NP_001046386.1| Os02g0235600 [Oryza sativa Japonica Group]
 dbj|BAF08300.1| Os02g0235600 [Oryza sativa Japonica Group]
 dbj|BAH00003.1| unnamed protein product [Oryza sativa Japonica Group]
Length=182

 Score =   325 bits (832),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 169/177 (95%), Positives = 174/177 (98%), Gaps = 0/177 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKK + PMREIKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKQSNPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKA  210
            STGIYGMDFYVVLER GYRVARRRRCK+RVGIQHRVTK+DAMKWFQVKYEGVILNKA
Sbjct  121  STGIYGMDFYVVLERAGYRVARRRRCKSRVGIQHRVTKEDAMKWFQVKYEGVILNKA  177



>ref|XP_004133951.1| PREDICTED: 60S ribosomal protein L11-2-like isoform 1 [Cucumis 
sativus]
 ref|XP_004164744.1| PREDICTED: 60S ribosomal protein L11-2-like isoform 1 [Cucumis 
sativus]
 ref|XP_008438243.1| PREDICTED: 60S ribosomal protein L11-like isoform X1 [Cucumis 
melo]
Length=184

 Score =   325 bits (832),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 167/180 (93%), Positives = 176/180 (98%), Gaps = 0/180 (0%)
 Frame = -3

Query  737  ASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  558
            ASEKKL+ PMR+IKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFGI
Sbjct  4    ASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFGI  63

Query  557  RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  378
            RRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS
Sbjct  64   RRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  123

Query  377  TGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNIS  198
            TGIYGMDF+VVLERPGYRV RRRRCK+RVGIQHRVTK+DAMKWFQVKYEGVILNK+  I+
Sbjct  124  TGIYGMDFFVVLERPGYRVGRRRRCKSRVGIQHRVTKEDAMKWFQVKYEGVILNKSQQIT  183



>ref|XP_004976770.1| PREDICTED: 60S ribosomal protein L11-like [Setaria italica]
Length=180

 Score =   324 bits (831),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 169/177 (95%), Positives = 174/177 (98%), Gaps = 0/177 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKK + PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKQSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKA  210
            STGIYGMDFYVVLER GYRVARRRRCK+RVGIQHRVTK+DAMKWFQVKYEGVILNKA
Sbjct  121  STGIYGMDFYVVLERAGYRVARRRRCKSRVGIQHRVTKEDAMKWFQVKYEGVILNKA  177



>ref|NP_001149684.1| 60S ribosomal protein L11-1 [Zea mays]
 gb|ACF85974.1| unknown [Zea mays]
 gb|ACG36357.1| 60S ribosomal protein L11-1 [Zea mays]
 gb|ACR34870.1| unknown [Zea mays]
 gb|AFW71163.1| 60S ribosomal protein L11-1 [Zea mays]
Length=182

 Score =   324 bits (831),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 169/177 (95%), Positives = 174/177 (98%), Gaps = 0/177 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MA EKKL+ PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MAHEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKA  210
            STGIYGMDFYVVLER GYRVARRRRCK+RVGIQHRVTK+D+MKWFQVKYEGVILNKA
Sbjct  121  STGIYGMDFYVVLERAGYRVARRRRCKSRVGIQHRVTKEDSMKWFQVKYEGVILNKA  177



>ref|XP_002451841.1| hypothetical protein SORBIDRAFT_04g008530 [Sorghum bicolor]
 ref|XP_002451842.1| hypothetical protein SORBIDRAFT_04g008540 [Sorghum bicolor]
 gb|EES04817.1| hypothetical protein SORBIDRAFT_04g008530 [Sorghum bicolor]
 gb|EES04818.1| hypothetical protein SORBIDRAFT_04g008540 [Sorghum bicolor]
Length=182

 Score =   324 bits (831),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 170/177 (96%), Positives = 174/177 (98%), Gaps = 0/177 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKK + PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKQSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKA  210
            STGIYGMDFYVVLER GYRVARRRRCKARVGIQHRVTK+D+MKWFQVKYEGVILNKA
Sbjct  121  STGIYGMDFYVVLERAGYRVARRRRCKARVGIQHRVTKEDSMKWFQVKYEGVILNKA  177



>ref|XP_008782472.1| PREDICTED: 60S ribosomal protein L11 isoform X1 [Phoenix dactylifera]
Length=180

 Score =   324 bits (830),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 168/177 (95%), Positives = 174/177 (98%), Gaps = 0/177 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKKL+ PMR IKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMRGIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKA  210
            STGIYGMDF+VVLERPGYRV RRRRCK+RVGIQHRVTK+DAMKWFQVKYEGVILNK+
Sbjct  121  STGIYGMDFFVVLERPGYRVGRRRRCKSRVGIQHRVTKEDAMKWFQVKYEGVILNKS  177



>gb|KHG13747.1| 60S ribosomal L11-1 -like protein [Gossypium arboreum]
Length=188

 Score =   324 bits (831),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 169/179 (94%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = -3

Query  737  ASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  558
            ASEKKL+ PMREIKVQKLVLNI VGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI
Sbjct  8    ASEKKLSNPMREIKVQKLVLNICVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  67

Query  557  RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  378
            RRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS
Sbjct  68   RRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  127

Query  377  TGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            TGIYGMDFYVVLER GYRV RRRRCK+RVGIQHRVTK+DAMKWFQVKYEGVILNK+ NI
Sbjct  128  TGIYGMDFYVVLERAGYRVGRRRRCKSRVGIQHRVTKEDAMKWFQVKYEGVILNKSQNI  186



>ref|NP_001148395.1| LOC100282010 [Zea mays]
 gb|ACG31313.1| 60S ribosomal protein L11-1 [Zea mays]
 gb|AFW86972.1| 60S ribosomal protein L11-1 [Zea mays]
Length=182

 Score =   324 bits (830),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 169/177 (95%), Positives = 174/177 (98%), Gaps = 0/177 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKK + PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKQSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKA  210
            STGIYGMDFYVVLER GYRVARRRRCK+RVGIQHRVTK+DAMKWFQVKYEGVILNKA
Sbjct  121  STGIYGMDFYVVLERAGYRVARRRRCKSRVGIQHRVTKEDAMKWFQVKYEGVILNKA  177



>ref|XP_002270266.1| PREDICTED: 60S ribosomal protein L11-1-like [Vitis vinifera]
Length=183

 Score =   324 bits (830),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 169/180 (94%), Positives = 173/180 (96%), Gaps = 0/180 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASE+KL  PMR+IKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSF 
Sbjct  1    MASERKLANPMRDIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFA  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDFYVVLERPGYRV RRRRCKARVG  HRVTKDDAMKWFQVKYEGVILNKA NI
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRCKARVGPHHRVTKDDAMKWFQVKYEGVILNKAQNI  180



>ref|NP_001131414.1| uncharacterized protein LOC100192743 [Zea mays]
 gb|ACF79812.1| unknown [Zea mays]
 gb|ACG39381.1| 60S ribosomal protein L11-1 [Zea mays]
 tpg|DAA52966.1| TPA: 60S ribosomal protein L11-1 [Zea mays]
Length=182

 Score =   323 bits (828),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 168/177 (95%), Positives = 174/177 (98%), Gaps = 0/177 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKK + PMRE+KVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKQSNPMREMKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKA  210
            STGIYGMDFYVVLER GYRVARRRRCK+RVGIQHRVTK+DAMKWFQVKYEGVILNKA
Sbjct  121  STGIYGMDFYVVLERAGYRVARRRRCKSRVGIQHRVTKEDAMKWFQVKYEGVILNKA  177



>ref|XP_006578416.1| PREDICTED: 60S ribosomal protein L11-like [Glycine max]
Length=181

 Score =   323 bits (828),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 168/180 (93%), Positives = 173/180 (96%), Gaps = 0/180 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKKL  PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIAC+VTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACHVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDF+VVLERPGYRV RR RCKARV IQHRVTK+DAMKWFQVKYEGVILNK+  +
Sbjct  121  STGIYGMDFFVVLERPGYRVGRRCRCKARVRIQHRVTKEDAMKWFQVKYEGVILNKSQAL  180



>ref|XP_006654147.1| PREDICTED: 60S ribosomal protein L11-like [Oryza brachyantha]
Length=182

 Score =   323 bits (827),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 168/177 (95%), Positives = 174/177 (98%), Gaps = 0/177 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKK + PMREIKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKQSNPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFS+TGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKA  210
            STGIYGMDFYVVLER GYRVARRRRCK+RVGIQHRVTK+DAMKWFQVKYEGVILNKA
Sbjct  121  STGIYGMDFYVVLERAGYRVARRRRCKSRVGIQHRVTKEDAMKWFQVKYEGVILNKA  177



>ref|XP_002454974.1| hypothetical protein SORBIDRAFT_03g002420 [Sorghum bicolor]
 gb|EES00094.1| hypothetical protein SORBIDRAFT_03g002420 [Sorghum bicolor]
Length=182

 Score =   323 bits (827),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 168/177 (95%), Positives = 174/177 (98%), Gaps = 0/177 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKK + PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKQSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFS+TGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKA  210
            STGIYGMDFYVVLER GYRVARRRRCK+RVGIQHRVTK+DAMKWFQVKYEGVILNKA
Sbjct  121  STGIYGMDFYVVLERAGYRVARRRRCKSRVGIQHRVTKEDAMKWFQVKYEGVILNKA  177



>ref|XP_010940061.1| PREDICTED: 60S ribosomal protein L11-like [Elaeis guineensis]
Length=181

 Score =   323 bits (827),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 169/177 (95%), Positives = 174/177 (98%), Gaps = 1/177 (1%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEK+ N PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKQSN-PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  59

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  60   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  119

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKA  210
            STGIYGMDFYVVLERPGYRV RRRRCK+RVG+QHRVTK+DAMKWFQVKYEGVILNKA
Sbjct  120  STGIYGMDFYVVLERPGYRVGRRRRCKSRVGLQHRVTKEDAMKWFQVKYEGVILNKA  176



>ref|XP_001759707.1| predicted protein [Physcomitrella patens]
 ref|XP_001778446.1| predicted protein [Physcomitrella patens]
 ref|XP_001779787.1| predicted protein [Physcomitrella patens]
 gb|EDQ55388.1| predicted protein [Physcomitrella patens]
 gb|EDQ56721.1| predicted protein [Physcomitrella patens]
 gb|EDQ75619.1| predicted protein [Physcomitrella patens]
Length=181

 Score =   323 bits (827),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 164/181 (91%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKK+   MREIKVQKLVLNISVGESGDRLTRA+KVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKMQNSMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQSPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFS++GCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSESGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDFYVVLERPGYRV RRRR K+RVGIQHRVTK+DAMKWFQVKYEGVILNK+  I
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRAKSRVGIQHRVTKEDAMKWFQVKYEGVILNKSQQI  180

Query  200  S  198
            +
Sbjct  181  A  181



>gb|AFW65990.1| hypothetical protein ZEAMMB73_747842 [Zea mays]
Length=187

 Score =   323 bits (827),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 169/176 (96%), Positives = 173/176 (98%), Gaps = 0/176 (0%)
 Frame = -3

Query  737  ASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  558
            ASEKK + PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI
Sbjct  7    ASEKKQSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  66

Query  557  RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  378
            RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS
Sbjct  67   RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  126

Query  377  TGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKA  210
            TGIYGMDFYVVLER GYRVARRRRCK+RVGIQHRVTK+D+MKWFQVKYEGVILNKA
Sbjct  127  TGIYGMDFYVVLERAGYRVARRRRCKSRVGIQHRVTKEDSMKWFQVKYEGVILNKA  182



>gb|ADY38658.1| putative 60S ribosomal protein L11 [Wolffia arrhiza]
Length=182

 Score =   322 bits (825),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 168/181 (93%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKK + PMREIKVQKLVLNI VGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKQSNPMREIKVQKLVLNICVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFS+TGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDFYVVLER GYRV RRRRCKARVGIQHRVTK+DAMKWFQVKYEGVILNK+  I
Sbjct  121  STGIYGMDFYVVLERAGYRVGRRRRCKARVGIQHRVTKEDAMKWFQVKYEGVILNKSQAI  180

Query  200  S  198
            +
Sbjct  181  T  181



>ref|XP_004968572.1| PREDICTED: 60S ribosomal protein L11-like [Setaria italica]
Length=181

 Score =   322 bits (825),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 168/177 (95%), Positives = 173/177 (98%), Gaps = 0/177 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKK   PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKQANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFS+TGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKA  210
            STGIYGMDFYVVLER GYRVARRRRCK+RVGIQHRVTK+DAMKWFQVKYEGVILNKA
Sbjct  121  STGIYGMDFYVVLERAGYRVARRRRCKSRVGIQHRVTKEDAMKWFQVKYEGVILNKA  177



>gb|AAT08727.1| 60S ribosomal protein L11 [Hyacinthus orientalis]
Length=189

 Score =   322 bits (826),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 168/178 (94%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = -3

Query  731  EKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRR  552
             KKL  PMREIKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFGIRR
Sbjct  11   HKKLANPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFGIRR  70

Query  551  NEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTG  372
            NEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTG
Sbjct  71   NEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTG  130

Query  371  IYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNIS  198
            IYGMDFYVVLERPGYRV RRRRCK+RVGIQHRVTKDDAM WFQVKYEGVILNK+ NI+
Sbjct  131  IYGMDFYVVLERPGYRVGRRRRCKSRVGIQHRVTKDDAMNWFQVKYEGVILNKSQNIT  188



>ref|XP_006643887.1| PREDICTED: 60S ribosomal protein L11-like [Oryza brachyantha]
Length=182

 Score =   322 bits (824),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 168/177 (95%), Positives = 174/177 (98%), Gaps = 0/177 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKK + PMREIKVQKLVLNISVGESGDRLTRA+KVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKQSNPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQSPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFS+TGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKA  210
            STGIYGMDFYVVLER GYRVARRRRCKARVGIQHRVTK+DAMKWFQVKYEGVILNKA
Sbjct  121  STGIYGMDFYVVLERAGYRVARRRRCKARVGIQHRVTKEDAMKWFQVKYEGVILNKA  177



>ref|NP_001054899.1| Os05g0207300 [Oryza sativa Japonica Group]
 ref|NP_001057834.2| Os06g0550000 [Oryza sativa Japonica Group]
 sp|Q0DK10.1|RL11_ORYSJ RecName: Full=60S ribosomal protein L11 [Oryza sativa Japonica 
Group]
 sp|A2YDY2.2|RL11_ORYSI RecName: Full=60S ribosomal protein L11 [Oryza sativa Indica 
Group]
 gb|AAU90185.1| putative 60S ribosomal protein L11 [Oryza sativa Japonica Group]
 dbj|BAF16813.1| Os05g0207300 [Oryza sativa Japonica Group]
 dbj|BAG92054.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC78695.1| hypothetical protein OsI_18846 [Oryza sativa Indica Group]
 gb|EEC80790.1| hypothetical protein OsI_23322 [Oryza sativa Indica Group]
 gb|EEE62702.1| hypothetical protein OsJ_17505 [Oryza sativa Japonica Group]
 gb|EEE65858.1| hypothetical protein OsJ_21642 [Oryza sativa Japonica Group]
 dbj|BAF19748.2| Os06g0550000 [Oryza sativa Japonica Group]
Length=182

 Score =   322 bits (824),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 167/177 (94%), Positives = 174/177 (98%), Gaps = 0/177 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKK + PMREIKVQKLVLNISVGESGDRLTRA+KVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKQSNPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQSPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFS+TGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKA  210
            STGIYGMDFYVVLER GYRVARRRRCK+RVGIQHRVTK+DAMKWFQVKYEGVILNKA
Sbjct  121  STGIYGMDFYVVLERAGYRVARRRRCKSRVGIQHRVTKEDAMKWFQVKYEGVILNKA  177



>ref|NP_001042339.1| Os01g0205500 [Oryza sativa Japonica Group]
 dbj|BAA92964.1| putative 60S ribosomal protein L11-1 [Oryza sativa Japonica Group]
 dbj|BAF04253.1| Os01g0205500 [Oryza sativa Japonica Group]
 gb|EAY72954.1| hypothetical protein OsI_00826 [Oryza sativa Indica Group]
 gb|EAZ10965.1| hypothetical protein OsJ_00808 [Oryza sativa Japonica Group]
 dbj|BAG90584.1| unnamed protein product [Oryza sativa Japonica Group]
Length=182

 Score =   321 bits (822),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 167/177 (94%), Positives = 173/177 (98%), Gaps = 0/177 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKK   PMREIKVQKLVLNISVGESGDRLTRA+KVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKQANPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQSPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFS+TGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKA  210
            STGIYGMDFYVVLER GYRVARRRRCK+RVGIQHRVTK+DAMKWFQVKYEGVILNKA
Sbjct  121  STGIYGMDFYVVLERAGYRVARRRRCKSRVGIQHRVTKEDAMKWFQVKYEGVILNKA  177



>ref|XP_001762314.1| predicted protein [Physcomitrella patens]
 gb|EDQ72781.1| predicted protein [Physcomitrella patens]
Length=181

 Score =   321 bits (822),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 164/181 (91%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKK    MREIKVQKLVLNISVGESGDRLTRA+KVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKQQNSMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQSPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFS++GCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSESGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDFYVVLERPGYRV RRRR K+RVGIQHRVTK+DAMKWFQVKYEGVILNK+  I
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRAKSRVGIQHRVTKEDAMKWFQVKYEGVILNKSQAI  180

Query  200  S  198
            +
Sbjct  181  A  181



>ref|XP_008795915.1| PREDICTED: 60S ribosomal protein L11-like [Phoenix dactylifera]
Length=179

 Score =   320 bits (820),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 167/177 (94%), Positives = 174/177 (98%), Gaps = 1/177 (1%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEK+ N PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKQSN-PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  59

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  60   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  119

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKA  210
            STGIYGMDF+VVLERPGYRV RRRRCK+RVG+QHRVTK+DAMKWFQVKYEGVILNK+
Sbjct  120  STGIYGMDFFVVLERPGYRVGRRRRCKSRVGLQHRVTKEDAMKWFQVKYEGVILNKS  176



>ref|XP_008790022.1| PREDICTED: 60S ribosomal protein L11-like [Phoenix dactylifera]
Length=182

 Score =   320 bits (820),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 167/177 (94%), Positives = 172/177 (97%), Gaps = 0/177 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKKL  PMR+I VQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLLNPMRDINVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKA  210
            STGIYGMDFYVVLERPGYRV RRRRCK+RVGIQH VTK+DAMKWFQVKYEGVILNK+
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRCKSRVGIQHGVTKEDAMKWFQVKYEGVILNKS  177



>ref|XP_001760204.1| predicted protein [Physcomitrella patens]
 gb|EDQ74960.1| predicted protein [Physcomitrella patens]
Length=181

 Score =   320 bits (819),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 164/181 (91%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKK    MREIKVQKLVLNISVGESGDRLTRA+KVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKQQNLMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQSPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFS++GCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSESGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDFYVVLERPGYRV RRRR K+RVGIQHRVTK+DAMKWFQVKYEGVILNK++ I
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRAKSRVGIQHRVTKEDAMKWFQVKYEGVILNKSNAI  180

Query  200  S  198
            +
Sbjct  181  A  181



>gb|KHG21293.1| 60S ribosomal protein L11-1 [Gossypium arboreum]
Length=199

 Score =   318 bits (816),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 170/197 (86%), Positives = 176/197 (89%), Gaps = 17/197 (9%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKKL+ PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGI----  393
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGI    
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGINSHL  120

Query  392  -------------KYDPSTGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMK  252
                         +YDPSTGIYGMDFYVVLER GYRV RRRRCK+RVGIQHRVTK+DAMK
Sbjct  121  TRLSNRTRFGIINRYDPSTGIYGMDFYVVLERAGYRVGRRRRCKSRVGIQHRVTKEDAMK  180

Query  251  WFQVKYEGVILNKASNI  201
            WFQVKYEGVILNK+ NI
Sbjct  181  WFQVKYEGVILNKSQNI  197



>gb|KHG21292.1| 60S ribosomal protein L11-1 [Gossypium arboreum]
Length=228

 Score =   320 bits (819),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 170/197 (86%), Positives = 176/197 (89%), Gaps = 17/197 (9%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKKL+ PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  30   MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  89

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGI----  393
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGI    
Sbjct  90   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGINSHL  149

Query  392  -------------KYDPSTGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMK  252
                         +YDPSTGIYGMDFYVVLER GYRV RRRRCK+RVGIQHRVTK+DAMK
Sbjct  150  TRLSNRTRFGIINRYDPSTGIYGMDFYVVLERAGYRVGRRRRCKSRVGIQHRVTKEDAMK  209

Query  251  WFQVKYEGVILNKASNI  201
            WFQVKYEGVILNK+ NI
Sbjct  210  WFQVKYEGVILNKSQNI  226



>ref|XP_006648487.1| PREDICTED: 60S ribosomal protein L11-like [Oryza brachyantha]
Length=189

 Score =   318 bits (814),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 166/176 (94%), Positives = 172/176 (98%), Gaps = 0/176 (0%)
 Frame = -3

Query  737  ASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  558
            A EKK + PMREIKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFGI
Sbjct  9    ALEKKQSNPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFGI  68

Query  557  RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  378
            RRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFS+TGCFGFGIQEHIDLGIKYDPS
Sbjct  69   RRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDPS  128

Query  377  TGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKA  210
            TGIYGMDFYVVLER GYRVARRRRCK+RVGIQHRVTK+DAMKWFQVKYEGVILNKA
Sbjct  129  TGIYGMDFYVVLERAGYRVARRRRCKSRVGIQHRVTKEDAMKWFQVKYEGVILNKA  184



>emb|CDY60533.1| BnaAnng16950D [Brassica napus]
 emb|CDY23103.1| BnaC09g18570D [Brassica napus]
 emb|CDY00582.1| BnaC04g23430D [Brassica napus]
 emb|CDX77611.1| BnaC07g18650D [Brassica napus]
Length=172

 Score =   317 bits (812),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 166/171 (97%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = -3

Query  710  MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  531
            MR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY
Sbjct  1    MRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  60

Query  530  VTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  351
            VTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY
Sbjct  61   VTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  120

Query  350  VVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNIS  198
            VVLERPGYRVARRRRCKARVGIQHRVTKDDAMKWFQVKYEGVILNK+ NI+
Sbjct  121  VVLERPGYRVARRRRCKARVGIQHRVTKDDAMKWFQVKYEGVILNKSQNIT  171



>emb|CDY62552.1| BnaA03g58370D [Brassica napus]
 emb|CDY39447.1| BnaAnng05780D [Brassica napus]
 emb|CDX78887.1| BnaA01g09540D [Brassica napus]
Length=172

 Score =   317 bits (812),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 165/171 (96%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = -3

Query  710  MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  531
            MR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY
Sbjct  1    MRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  60

Query  530  VTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  351
            VTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY
Sbjct  61   VTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  120

Query  350  VVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNIS  198
            VVLERPGYRVARRRRCK RVGIQHRVTKDDAMKWFQVKYEGVILNK+ NI+
Sbjct  121  VVLERPGYRVARRRRCKTRVGIQHRVTKDDAMKWFQVKYEGVILNKSQNIT  171



>ref|XP_010516520.1| PREDICTED: 60S ribosomal protein L11-1-like [Camelina sativa]
 gb|AAL69452.1| At2g42740/F7D19.26 [Arabidopsis thaliana]
Length=172

 Score =   315 bits (808),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 165/171 (96%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = -3

Query  710  MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  531
            MR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY
Sbjct  1    MRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  60

Query  530  VTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  351
            VTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY
Sbjct  61   VTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  120

Query  350  VVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNIS  198
            VVLERPGYRVARRRRCKARVGIQHRVTKDDAMKWFQVKYEGVILNK+ NI+
Sbjct  121  VVLERPGYRVARRRRCKARVGIQHRVTKDDAMKWFQVKYEGVILNKSQNIT  171



>ref|NP_851137.1| 60S ribosomal protein L11-2 [Arabidopsis thaliana]
 gb|AAM64289.1| ribosomal protein L11, cytosolic [Arabidopsis thaliana]
 gb|AED95296.1| 60S ribosomal protein L11-2 [Arabidopsis thaliana]
Length=172

 Score =   315 bits (808),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 164/171 (96%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = -3

Query  710  MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  531
            MR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY
Sbjct  1    MRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  60

Query  530  VTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  351
            VTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY
Sbjct  61   VTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  120

Query  350  VVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNIS  198
            VVLERPGYRVARRRRCK RVGIQHRVTKDDAMKWFQVKYEGVILNK+ NI+
Sbjct  121  VVLERPGYRVARRRRCKTRVGIQHRVTKDDAMKWFQVKYEGVILNKSQNIT  171



>gb|KHN11195.1| 60S ribosomal protein L11 [Glycine soja]
Length=171

 Score =   312 bits (800),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 163/170 (96%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  710  MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  531
            MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY
Sbjct  1    MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  60

Query  530  VTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  351
            VTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDF+
Sbjct  61   VTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFF  120

Query  350  VVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            VVLERPGYRV RRRRCK+RVGIQHRVTK+DAMKWFQVKYEGVILNK+  I
Sbjct  121  VVLERPGYRVGRRRRCKSRVGIQHRVTKEDAMKWFQVKYEGVILNKSQAI  170



>ref|XP_007048734.1| Ribosomal L5P family protein isoform 2 [Theobroma cacao]
 gb|EOX92891.1| Ribosomal L5P family protein isoform 2 [Theobroma cacao]
Length=172

 Score =   312 bits (800),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 163/170 (96%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  710  MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  531
            MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY
Sbjct  1    MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  60

Query  530  VTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  351
            VTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY
Sbjct  61   VTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  120

Query  350  VVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            VVLER GYRV RRRRCK+RVGIQHRVTK+DAMKWFQVKYEGVILNK+ NI
Sbjct  121  VVLERAGYRVGRRRRCKSRVGIQHRVTKEDAMKWFQVKYEGVILNKSQNI  170



>gb|ACD56663.1| putative ribosomal protein [Gossypium arboreum]
Length=172

 Score =   312 bits (800),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 162/170 (95%), Positives = 166/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  710  MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  531
            MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY
Sbjct  1    MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  60

Query  530  VTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  351
            VTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY
Sbjct  61   VTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  120

Query  350  VVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            VVLER GYRV RRRRCK+ VGIQHRVTK+DAMKWFQVKYEGVILNK+ NI
Sbjct  121  VVLERAGYRVGRRRRCKSSVGIQHRVTKEDAMKWFQVKYEGVILNKSQNI  170



>emb|CBI22012.3| unnamed protein product [Vitis vinifera]
Length=173

 Score =   312 bits (800),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 162/171 (95%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = -3

Query  710  MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  531
            MR+IKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY
Sbjct  1    MRDIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  60

Query  530  VTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  351
            VTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDF+
Sbjct  61   VTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFF  120

Query  350  VVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNIS  198
            VVLERPGYRV RRRRCK+RVGIQHRVTKDD+MKWFQVKYEGVILNKA  I+
Sbjct  121  VVLERPGYRVGRRRRCKSRVGIQHRVTKDDSMKWFQVKYEGVILNKAQTIA  171



>gb|AAT64021.1| putative ribosomal protein [Gossypium hirsutum]
 gb|AAT64031.1| putative ribosomal protein [Gossypium hirsutum]
 gb|ACD56649.1| putative ribosomal protein [Gossypioides kirkii]
 gb|KJB68370.1| hypothetical protein B456_010G241400 [Gossypium raimondii]
 gb|KJB69700.1| hypothetical protein B456_011G038200 [Gossypium raimondii]
Length=172

 Score =   312 bits (799),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 163/170 (96%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  710  MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  531
            MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY
Sbjct  1    MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  60

Query  530  VTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  351
            VTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY
Sbjct  61   VTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  120

Query  350  VVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            VVLER GYRV RRRRCK+RVGIQHRVTK+DAMKWFQVKYEGVILNK+ NI
Sbjct  121  VVLERAGYRVGRRRRCKSRVGIQHRVTKEDAMKWFQVKYEGVILNKSQNI  170



>gb|KHN20558.1| Endoglucanase 9 [Glycine soja]
Length=677

 Score =   328 bits (842),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 171/182 (94%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = -3

Query  746  SDMASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRS  567
            + MASEKKL+ PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRS
Sbjct  495  ATMASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRS  554

Query  566  FGIRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKY  387
            FGIRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKY
Sbjct  555  FGIRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKY  614

Query  386  DPSTGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKAS  207
            DPSTGIYGMDF+VVLERPGYRV RRRRCK+RVGIQHRVTK+DAMKWFQVKYEGVILNK+ 
Sbjct  615  DPSTGIYGMDFFVVLERPGYRVGRRRRCKSRVGIQHRVTKEDAMKWFQVKYEGVILNKSQ  674

Query  206  NI  201
             I
Sbjct  675  AI  676



>gb|KJB34908.1| hypothetical protein B456_006G089700 [Gossypium raimondii]
Length=172

 Score =   311 bits (796),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 162/170 (95%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  710  MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  531
            MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY
Sbjct  1    MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  60

Query  530  VTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  351
            VTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY
Sbjct  61   VTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  120

Query  350  VVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            VVLER GYRV RRRRCK+RVGIQHRVTK+D+MKWFQVKYEGVILNK+ NI
Sbjct  121  VVLERAGYRVGRRRRCKSRVGIQHRVTKEDSMKWFQVKYEGVILNKSQNI  170



>ref|XP_003565263.1| PREDICTED: 60S ribosomal protein L11 [Brachypodium distachyon]
 ref|XP_003568752.1| PREDICTED: 60S ribosomal protein L11 [Brachypodium distachyon]
 ref|XP_003571886.1| PREDICTED: 60S ribosomal protein L11 [Brachypodium distachyon]
Length=180

 Score =   311 bits (797),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 162/177 (92%), Positives = 171/177 (97%), Gaps = 0/177 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            M++EKK   PMREIKVQKLVLNISVGESGDRLTRA+KVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MSTEKKQLNPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQSPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLG+KYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGMKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKA  210
            STGIYGMDFYVVLER GYRV+RRRRCKARVGI  RVTK+DAMKWFQVKYEGVILNK+
Sbjct  121  STGIYGMDFYVVLERAGYRVSRRRRCKARVGIHQRVTKEDAMKWFQVKYEGVILNKS  177



>gb|EMS61347.1| 60S ribosomal protein L11 [Triticum urartu]
Length=180

 Score =   310 bits (795),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 161/177 (91%), Positives = 171/177 (97%), Gaps = 0/177 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            M++EKK   PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MSTEKKQLNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVT+RG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLG+KYDP
Sbjct  61   IRRNEKIACYVTIRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGMKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKA  210
            STGIYGMDF+VVLER GYRV+RRRRCKARVGI  RVTK+DAMKWFQVKYEGVILNK+
Sbjct  121  STGIYGMDFFVVLERAGYRVSRRRRCKARVGIHQRVTKEDAMKWFQVKYEGVILNKS  177



>emb|CDP15952.1| unnamed protein product [Coffea canephora]
Length=173

 Score =   310 bits (794),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 162/170 (95%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  710  MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  531
            MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFGIRRNEKIACY
Sbjct  1    MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFGIRRNEKIACY  60

Query  530  VTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  351
            VTVRGDKAMQLLESGLKVKEYELL+RNFS+TGCFGFGIQEHIDLGIKYDPSTGIYGMDFY
Sbjct  61   VTVRGDKAMQLLESGLKVKEYELLKRNFSETGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  120

Query  350  VVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            VVLERPGYRVARRRRCK+RVGI  RVTK+DAMKWFQVKYEGVILNKA NI
Sbjct  121  VVLERPGYRVARRRRCKSRVGIHQRVTKEDAMKWFQVKYEGVILNKAQNI  170



>ref|XP_001751962.1| predicted protein [Physcomitrella patens]
 gb|EDQ83397.1| predicted protein [Physcomitrella patens]
Length=171

 Score =   310 bits (793),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 158/171 (92%), Positives = 167/171 (98%), Gaps = 0/171 (0%)
 Frame = -3

Query  710  MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  531
            MREIKVQKLVLNISVGESGDRLTRA+KVLEQLSGQ+PVFSKARYTVRSFGIRRNEKIACY
Sbjct  1    MREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQSPVFSKARYTVRSFGIRRNEKIACY  60

Query  530  VTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  351
            VTVRG+KAMQLLESGLKVKEYELLRRNFS++GCFGFGIQEHIDLGIKYDPSTGIYGMDFY
Sbjct  61   VTVRGEKAMQLLESGLKVKEYELLRRNFSESGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  120

Query  350  VVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNIS  198
            VVLERPGYRV RRRR K+RVGIQHRVTK+DAMKWFQVKYEGVILNK+  I+
Sbjct  121  VVLERPGYRVGRRRRAKSRVGIQHRVTKEDAMKWFQVKYEGVILNKSQQIA  171



>gb|ACN35575.1| unknown [Zea mays]
 gb|AFW71161.1| hypothetical protein ZEAMMB73_877153 [Zea mays]
 gb|AFW71162.1| hypothetical protein ZEAMMB73_877153 [Zea mays]
Length=172

 Score =   309 bits (792),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 162/167 (97%), Positives = 166/167 (99%), Gaps = 0/167 (0%)
 Frame = -3

Query  710  MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  531
            MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY
Sbjct  1    MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  60

Query  530  VTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  351
            VTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY
Sbjct  61   VTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  120

Query  350  VVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKA  210
            VVLER GYRVARRRRCK+RVGIQHRVTK+D+MKWFQVKYEGVILNKA
Sbjct  121  VVLERAGYRVARRRRCKSRVGIQHRVTKEDSMKWFQVKYEGVILNKA  167



>emb|CBI30709.3| unnamed protein product [Vitis vinifera]
Length=173

 Score =   309 bits (791),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 162/170 (95%), Positives = 165/170 (97%), Gaps = 0/170 (0%)
 Frame = -3

Query  710  MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  531
            MR+IKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSF IRRNEKIACY
Sbjct  1    MRDIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFAIRRNEKIACY  60

Query  530  VTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  351
            VTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY
Sbjct  61   VTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  120

Query  350  VVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            VVLERPGYRV RRRRCKARVG  HRVTKDDAMKWFQVKYEGVILNKA NI
Sbjct  121  VVLERPGYRVGRRRRCKARVGPHHRVTKDDAMKWFQVKYEGVILNKAQNI  170



>gb|ADR71243.1| 60S ribosomal protein L11A [Hevea brasiliensis]
Length=172

 Score =   308 bits (789),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 162/170 (95%), Positives = 164/170 (96%), Gaps = 0/170 (0%)
 Frame = -3

Query  710  MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  531
            MREIKVQK VLNISVGESGDRLTRAAKVLEQLSGQ PVFSKARYTVRSFGIR NEKIACY
Sbjct  1    MREIKVQKRVLNISVGESGDRLTRAAKVLEQLSGQAPVFSKARYTVRSFGIRCNEKIACY  60

Query  530  VTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  351
            VTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY
Sbjct  61   VTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  120

Query  350  VVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            VVLERPGYRV RRRRCK+RVGIQHRVTK+DAMKWFQVKYEGVILNKA  I
Sbjct  121  VVLERPGYRVGRRRRCKSRVGIQHRVTKEDAMKWFQVKYEGVILNKAQTI  170



>pdb|3J61|J Chain J, Localization Of The Large Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
 gb|AAW50983.1| ribosomal protein L11 [Triticum aestivum]
 gb|EMT22063.1| 60S ribosomal protein L11 [Aegilops tauschii]
Length=180

 Score =   308 bits (789),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 171/177 (97%), Gaps = 0/177 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            M++EKK   PMR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MSTEKKQLNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQSPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVT+RG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLG+KYDP
Sbjct  61   IRRNEKIACYVTIRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGMKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKA  210
            STGIYGMDF+VVLER GYRV+RRRRCKARVGI  RVTK+DAMKWFQVKYEGVILNK+
Sbjct  121  STGIYGMDFFVVLERAGYRVSRRRRCKARVGIHQRVTKEDAMKWFQVKYEGVILNKS  177



>dbj|BAJ85332.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95551.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|EMT17477.1| 60S ribosomal protein L11 [Aegilops tauschii]
Length=180

 Score =   308 bits (788),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 160/177 (90%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            M++EKK    MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MSTEKKQLNTMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVT+RG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLG+KYDP
Sbjct  61   IRRNEKIACYVTIRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGMKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKA  210
            STGIYGMDF+VVLER GYRV+RRRRCKARVGI  RVTK+DAMKWFQVKYEGVILNK+
Sbjct  121  STGIYGMDFFVVLERAGYRVSRRRRCKARVGIHQRVTKEDAMKWFQVKYEGVILNKS  177



>ref|XP_006656151.1| PREDICTED: 60S ribosomal protein L11-like [Oryza brachyantha]
Length=172

 Score =   306 bits (785),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 160/167 (96%), Positives = 166/167 (99%), Gaps = 0/167 (0%)
 Frame = -3

Query  710  MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  531
            MREIKVQKLVLNISVGESGDRLTRA+KVLEQLSGQ+PVFSKARYTVRSFGIRRNEKIACY
Sbjct  1    MREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQSPVFSKARYTVRSFGIRRNEKIACY  60

Query  530  VTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  351
            VTVRG+KAMQLLESGLKVKEYELLRRNFS+TGCFGFGIQEHIDLGIKYDPSTGIYGMDFY
Sbjct  61   VTVRGEKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  120

Query  350  VVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKA  210
            VVLER GYRVARRRRCK+RVGIQHRVTK+DAMKWFQVKYEGVILNKA
Sbjct  121  VVLERAGYRVARRRRCKSRVGIQHRVTKEDAMKWFQVKYEGVILNKA  167



>gb|AAD21733.1| 60S ribosomal protein L11B [Arabidopsis thaliana]
Length=182

 Score =   306 bits (785),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 165/181 (91%), Positives = 170/181 (94%), Gaps = 10/181 (6%)
 Frame = -3

Query  710  MREIKVQKLVLNISVGESGDRLTRAAKV----------LEQLSGQTPVFSKARYTVRSFG  561
            MR+IKVQKLVLNISVGESGDRLTRA+KV          LEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MRDIKVQKLVLNISVGESGDRLTRASKVPPVFYPFSVVLEQLSGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            STGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTKDDAMKWFQVKYEGVILNK+ NI
Sbjct  121  STGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTKDDAMKWFQVKYEGVILNKSQNI  180

Query  200  S  198
            +
Sbjct  181  T  181



>ref|XP_002981065.1| hypothetical protein SELMODRAFT_444767 [Selaginella moellendorffii]
 ref|XP_002982539.1| hypothetical protein SELMODRAFT_271568 [Selaginella moellendorffii]
 gb|EFJ16292.1| hypothetical protein SELMODRAFT_271568 [Selaginella moellendorffii]
 gb|EFJ17766.1| hypothetical protein SELMODRAFT_444767 [Selaginella moellendorffii]
Length=177

 Score =   305 bits (780),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 158/171 (92%), Positives = 166/171 (97%), Gaps = 0/171 (0%)
 Frame = -3

Query  713  PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIAC  534
            PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ PVFSKAR+TVRSFGIRRNEKIAC
Sbjct  7    PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQQPVFSKARFTVRSFGIRRNEKIAC  66

Query  533  YVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDF  354
            YVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDF
Sbjct  67   YVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDF  126

Query  353  YVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            +VVLERPGYRVARRRRCK++VG + RVTK+DAMKWFQ+KYEGVILNK+  I
Sbjct  127  FVVLERPGYRVARRRRCKSKVGHKQRVTKEDAMKWFQLKYEGVILNKSQAI  177



>gb|EMS66091.1| 60S ribosomal protein L11 [Triticum urartu]
Length=225

 Score =   305 bits (782),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 158/176 (90%), Positives = 170/176 (97%), Gaps = 0/176 (0%)
 Frame = -3

Query  737  ASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  558
            ++EKK   PMR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQ+PVFSKARYTVRSFGI
Sbjct  47   STEKKQLNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQSPVFSKARYTVRSFGI  106

Query  557  RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  378
            RRNEKIACYVT+RG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLG+KYDPS
Sbjct  107  RRNEKIACYVTIRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGMKYDPS  166

Query  377  TGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKA  210
            TGIYGMDF+VVLER GYRV+RRRRCKARVGI  RVTK+DAMKWFQVKYEGVILNK+
Sbjct  167  TGIYGMDFFVVLERAGYRVSRRRRCKARVGIHQRVTKEDAMKWFQVKYEGVILNKS  222



>gb|AAB82139.1| ribosomal protein [Oryza sativa Indica Group]
Length=182

 Score =   302 bits (773),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 160/182 (88%), Positives = 172/182 (95%), Gaps = 1/182 (1%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKK + PMR+IKVQKLVLNISVGESGDRLTRA+KVLEQL GQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKQSNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLIGQSPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRG+KAMQLLESGLKVKE ELLRR+ S+TGCFGFGIQEHIDLGI+ DP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKECELLRRSCSETGCFGFGIQEHIDLGIQCDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKA-SN  204
            STG YGMDFYVVLER GYRVARRRRCK+RVGIQHRVTK+DAMKWFQVKYEGVI NKA +N
Sbjct  121  STGFYGMDFYVVLERAGYRVARRRRCKSRVGIQHRVTKEDAMKWFQVKYEGVIFNKAQAN  180

Query  203  IS  198
            +S
Sbjct  181  MS  182



>ref|XP_002438544.1| hypothetical protein SORBIDRAFT_10g021710 [Sorghum bicolor]
 gb|EER89911.1| hypothetical protein SORBIDRAFT_10g021710 [Sorghum bicolor]
Length=183

 Score =   301 bits (772),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 167/178 (94%), Gaps = 1/178 (1%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLE-QLSGQTPVFSKARYTVRSF  564
            MASEKK + PMREIKVQKLVLNISVGESGDRLTRAAK++     GQ+PVFSKARYTVRSF
Sbjct  1    MASEKKQSNPMREIKVQKLVLNISVGESGDRLTRAAKLMHLSWRGQSPVFSKARYTVRSF  60

Query  563  GIRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYD  384
            GIRRNEKI CYVTVRG+KAMQLLESGLKVKEYELLRRNFS+TGCFGFGIQEHIDLGIKYD
Sbjct  61   GIRRNEKIVCYVTVRGEKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYD  120

Query  383  PSTGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKA  210
            PSTGIYGMDFYVVLER GYRVARR RCK+RVGIQH VTK+DAMKWFQVKYEGVILNKA
Sbjct  121  PSTGIYGMDFYVVLERAGYRVARRCRCKSRVGIQHIVTKEDAMKWFQVKYEGVILNKA  178



>gb|AAQ96376.1| ribosomal protein L11-like protein [Solanum palustre]
Length=163

 Score =   300 bits (768),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 156/163 (96%), Positives = 163/163 (100%), Gaps = 0/163 (0%)
 Frame = -3

Query  689  KLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACYVTVRGDK  510
            KLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFGIRRNEKIACYVTVRG+K
Sbjct  1    KLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFGIRRNEKIACYVTVRGEK  60

Query  509  AMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFYVVLERPG  330
            AMQLLESGLKVKEYELLRRNFS+TGCFGFGIQEHIDLGIKYDPSTGIYGMDFYVVLERPG
Sbjct  61   AMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDPSTGIYGMDFYVVLERPG  120

Query  329  YrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            YRVARRRRCK+RVGIQHRVTK+D+MKWFQVKYEGVILNK+SNI
Sbjct  121  YRVARRRRCKSRVGIQHRVTKEDSMKWFQVKYEGVILNKSSNI  163



>dbj|BAD53703.1| putative 60S ribosomal protein L11-1 [Oryza sativa Japonica Group]
Length=182

 Score =   297 bits (761),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 160/177 (90%), Positives = 166/177 (94%), Gaps = 10/177 (6%)
 Frame = -3

Query  710  MREIKVQKLVLNISVGESGDRLTRAAKV----------LEQLSGQTPVFSKARYTVRSFG  561
            MREIKVQKLVLNISVGESGDRLTRA+KV          LEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MREIKVQKLVLNISVGESGDRLTRASKVWPIFSMYFQVLEQLSGQSPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFS+TGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKA  210
            STGIYGMDFYVVLER GYRVARRRRCK+RVGIQHRVTK+DAMKWFQVKYEGVILNKA
Sbjct  121  STGIYGMDFYVVLERAGYRVARRRRCKSRVGIQHRVTKEDAMKWFQVKYEGVILNKA  177



>gb|KHN28096.1| 60S ribosomal protein L11 [Glycine soja]
Length=170

 Score =   296 bits (758),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 157/170 (92%), Positives = 162/170 (95%), Gaps = 1/170 (1%)
 Frame = -3

Query  710  MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  531
            MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ PVFSK    +RSFGIRRNEKIACY
Sbjct  1    MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQAPVFSKG-TLIRSFGIRRNEKIACY  59

Query  530  VTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  351
            VTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDF+
Sbjct  60   VTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFF  119

Query  350  VVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            VVLERPGYRV RRRRCK+RVGIQHRVTK+DAMKWFQVKYEGVILNK+  I
Sbjct  120  VVLERPGYRVGRRRRCKSRVGIQHRVTKEDAMKWFQVKYEGVILNKSQAI  169



>ref|XP_009617442.1| PREDICTED: 60S ribosomal protein L11-1-like [Nicotiana tomentosiformis]
Length=171

 Score =   291 bits (744),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 150/170 (88%), Positives = 160/170 (94%), Gaps = 0/170 (0%)
 Frame = -3

Query  710  MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  531
            MREIKV KL LNIS+ ESGDRLTRAAKVLEQLSGQ+P+FSKARYTVRSFGIRRNEKI  Y
Sbjct  1    MREIKVHKLFLNISISESGDRLTRAAKVLEQLSGQSPIFSKARYTVRSFGIRRNEKIPYY  60

Query  530  VTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  351
            VTVRGDKAMQL ESGLKVKEYELLRRNFS+T CFGFGIQEHIDLGIKYDPSTGIYG++FY
Sbjct  61   VTVRGDKAMQLFESGLKVKEYELLRRNFSETSCFGFGIQEHIDLGIKYDPSTGIYGINFY  120

Query  350  VVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
            VVLE PGYRVAR RRCK+RVGIQHRVTK+DAMKWFQVKY+GVILN +SNI
Sbjct  121  VVLEHPGYRVARHRRCKSRVGIQHRVTKEDAMKWFQVKYKGVILNNSSNI  170



>tpg|DAA52967.1| TPA: hypothetical protein ZEAMMB73_694767 [Zea mays]
Length=831

 Score =   308 bits (788),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 159/168 (95%), Positives = 165/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKK + PMRE+KVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKQSNPMREMKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVK  237
            STGIYGMDFYVVLER GYRVARRRRCK+RVGIQHRVTK+DAMKWFQVK
Sbjct  121  STGIYGMDFYVVLERAGYRVARRRRCKSRVGIQHRVTKEDAMKWFQVK  168



>ref|XP_011397124.1| 60S ribosomal protein L11-1 [Auxenochlorella protothecoides]
 gb|KFM24237.1| 60S ribosomal protein L11-1 [Auxenochlorella protothecoides]
Length=180

 Score =   286 bits (733),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 142/178 (80%), Positives = 162/178 (91%), Gaps = 0/178 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            M ++KK + PMREI+V KLVLN  VGESGDRL +AAKVLEQL+GQ PVF KARYTVR + 
Sbjct  1    MVADKKASNPMREIRVAKLVLNCCVGESGDRLQKAAKVLEQLTGQQPVFGKARYTVRQWS  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            +RRNEKI+C+VTVRG+KA+QLLE+GLKVKEYELLRRNFSD+G FGFGI EHIDLGIKYDP
Sbjct  61   VRRNEKISCHVTVRGEKALQLLEAGLKVKEYELLRRNFSDSGNFGFGITEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKAS  207
            STGIYGMDFYVVLERPGYRVA+RR+  ARVG+QHRVTKDDAMKWFQ ++EGV+LNKAS
Sbjct  121  STGIYGMDFYVVLERPGYRVAKRRKQLARVGVQHRVTKDDAMKWFQTRFEGVVLNKAS  178



>gb|KDD76069.1| hypothetical protein H632_c370p1 [Helicosporidium sp. ATCC 50920]
Length=179

 Score =   282 bits (722),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 141/178 (79%), Positives = 159/178 (89%), Gaps = 0/178 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKK   PMR+I+V KLVLN  VGESGDRL +AAKVLEQL+GQ PVF +ARYTVR + 
Sbjct  1    MASEKKKQNPMRDIRVAKLVLNCEVGESGDRLQKAAKVLEQLTGQQPVFGRARYTVRQWS  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRR EKI+C+VTVRGDKA+QLLE+GLKVKEYELLRRNFSDTG FGFGI EHIDLGIKYDP
Sbjct  61   IRRGEKISCFVTVRGDKALQLLEAGLKVKEYELLRRNFSDTGNFGFGISEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKAS  207
            STGIYGMDFYVVLERPGYRV++R+R  +RVG+QHRVTK DAM WF+ K+EGVILNKA+
Sbjct  121  STGIYGMDFYVVLERPGYRVSKRKRAPSRVGVQHRVTKGDAMNWFKTKFEGVILNKAA  178



>gb|KJB57390.1| hypothetical protein B456_009G161300 [Gossypium raimondii]
Length=154

 Score =   276 bits (706),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 145/180 (81%), Gaps = 28/180 (16%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKKL+ PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIK   
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKCKS  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASNI  201
                                          GIQHRVTK+DAMKWFQVKYEGVILNK+ NI
Sbjct  121  RV----------------------------GIQHRVTKEDAMKWFQVKYEGVILNKSQNI  152



>gb|KIY97763.1| 60S ribosomal protein L11, partial [Monoraphidium neglectum]
 gb|KIZ07647.1| 60S ribosomal protein L11 [Monoraphidium neglectum]
Length=180

 Score =   275 bits (704),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 138/177 (78%), Positives = 158/177 (89%), Gaps = 0/177 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            M ++ K   PMREI+V KLVLNI VGESGDRL +AAKVLEQL+GQ PV+ KARYTVRSF 
Sbjct  1    MVNDAKAGNPMREIRVSKLVLNICVGESGDRLQKAAKVLEQLTGQQPVYGKARYTVRSFS  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKI+C VTVRG+KAMQLL++GLKVKEYEL+R+NFS++G FGFGI EHIDLGIKYDP
Sbjct  61   IRRNEKISCSVTVRGEKAMQLLDAGLKVKEYELIRKNFSESGNFGFGISEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKA  210
            STGIYGMDFYV LERPGYRVARRRR  +RVG+QHRVTK+DA +WFQ K+EGV+LNKA
Sbjct  121  STGIYGMDFYVCLERPGYRVARRRRVHSRVGVQHRVTKEDATRWFQTKFEGVVLNKA  177



>ref|XP_005647682.1| ribosomal protein L5 [Coccomyxa subellipsoidea C-169]
 gb|EIE23138.1| ribosomal protein L5 [Coccomyxa subellipsoidea C-169]
Length=180

 Score =   273 bits (699),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 138/178 (78%), Positives = 157/178 (88%), Gaps = 0/178 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            M ++KK   PMREI+V KLVLNI VGESGDRL +AAKVLEQL+GQ PVF KARYTVR+F 
Sbjct  1    MVNDKKTTNPMREIRVAKLVLNICVGESGDRLQKAAKVLEQLTGQQPVFGKARYTVRTFA  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKI+  VTVRG+KA+QL+E+GLKVKEYELLRRNFS+TG FGFGI EHIDLGIKYDP
Sbjct  61   IRRNEKISTSVTVRGEKALQLIEAGLKVKEYELLRRNFSETGNFGFGINEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKAS  207
            STGIYGMDFYVVLER GYRVARRR+  A+VG+QHRV KDDA+KWFQ K+EG++ NK S
Sbjct  121  STGIYGMDFYVVLERAGYRVARRRQRLAKVGVQHRVGKDDAIKWFQTKFEGIVHNKQS  178



>gb|ABR25412.1| 60S ribosomal protein l11 [Oryza sativa Indica Group]
Length=152

 Score =   269 bits (687),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 130/138 (94%), Positives = 135/138 (98%), Gaps = 0/138 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEKK + PMREIKVQKLVLNISVGESGDRLTRA+KVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKQSNPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQSPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFS+TGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGY  327
            STGIYGMDFYVVLER GY
Sbjct  121  STGIYGMDFYVVLERAGY  138



>emb|CBJ30107.1| conserved unknown protein [Ectocarpus siliculosus]
Length=173

 Score =   269 bits (688),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 133/171 (78%), Positives = 156/171 (91%), Gaps = 1/171 (1%)
 Frame = -3

Query  734  SEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIR  555
            +E K N PMR++KV KLVLN SVGESGDRLTRAAKVLEQL+GQ+PV+SKARYTVRSFGIR
Sbjct  2    AEIKTN-PMRDLKVDKLVLNCSVGESGDRLTRAAKVLEQLTGQSPVYSKARYTVRSFGIR  60

Query  554  RNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPST  375
            RNEKIAC+VTVRGDKA+++LE GLKVKEYEL R+NFS+TG FGFGIQEHIDLG+KYDPST
Sbjct  61   RNEKIACHVTVRGDKALEILERGLKVKEYELKRKNFSNTGSFGFGIQEHIDLGLKYDPST  120

Query  374  GIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVI  222
            GIYGMDF+VVL RPGYRVA+R+   A++G QH+VTK DA+KWFQ K+EG++
Sbjct  121  GIYGMDFFVVLNRPGYRVAKRKAKCAKIGYQHKVTKTDAVKWFQAKFEGIV  171



>ref|XP_006446821.1| hypothetical protein CICLE_v10016875mg [Citrus clementina]
 gb|ESR60061.1| hypothetical protein CICLE_v10016875mg [Citrus clementina]
Length=167

 Score =   266 bits (679),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 138/145 (95%), Positives = 143/145 (99%), Gaps = 0/145 (0%)
 Frame = -3

Query  635  AKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLR  456
            A+VLEQLSGQTPVFSKARYTVRSFGIRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLR
Sbjct  21   AQVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLR  80

Query  455  RNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFYVVLERPGYrvarrrrckarVGIQHR  276
            RNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDF+VVLERPGYRV RRRRCK+RVGIQHR
Sbjct  81   RNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFFVVLERPGYRVGRRRRCKSRVGIQHR  140

Query  275  VTKDDAMKWFQVKYEGVILNKASNI  201
            VTK+DAMKWFQVKYEGVILNK+ NI
Sbjct  141  VTKEDAMKWFQVKYEGVILNKSQNI  165



>emb|CEF97266.1| Ribosomal protein L5, conserved site [Ostreococcus tauri]
Length=179

 Score =   265 bits (678),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 135/178 (76%), Positives = 156/178 (88%), Gaps = 2/178 (1%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MA +K  N PMR I++ KLVLNI VGESGDRLT+AAKVLEQL+GQ P+FSKARYTVR+FG
Sbjct  1    MAGDKSEN-PMRAIRIHKLVLNICVGESGDRLTKAAKVLEQLTGQQPIFSKARYTVRTFG  59

Query  560  IRRNEKIACYVTVRG-DKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYD  384
            IRRNEKI+ +VT+   DKAMQ+LESGLKVKE+ELL+RNFS TG FGFGI EHIDLGIKYD
Sbjct  60   IRRNEKISAHVTIGNRDKAMQILESGLKVKEFELLKRNFSATGNFGFGISEHIDLGIKYD  119

Query  383  PSTGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKA  210
            PSTGIYGMDFYVVLERPGYRV RRR+ + ++G QH++TK DAM+WFQ  +EGVILNKA
Sbjct  120  PSTGIYGMDFYVVLERPGYRVHRRRKQQKKIGKQHKLTKADAMRWFQQTFEGVILNKA  177



>ref|XP_003598138.1| 60S ribosomal protein L11-1 [Medicago truncatula]
 gb|AES68389.1| 50S ribosomal protein L5P [Medicago truncatula]
Length=241

 Score =   267 bits (683),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 143/177 (81%), Positives = 155/177 (88%), Gaps = 2/177 (1%)
 Frame = -3

Query  737  ASEKKL-NXPMREIKVQKLVLNISVG-ESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSF  564
            A EKKL N P+R+IKVQKLVLNISVG ES  RLTRAA VL  LSGQTPV SKA++TVRSF
Sbjct  61   AYEKKLLNNPLRDIKVQKLVLNISVGGESRHRLTRAAMVLHHLSGQTPVLSKAKHTVRSF  120

Query  563  GIRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYD  384
            G RRNEKI+CYVTVRGDKAMQLLES LKVKEY+LL RNFSDTGCF F IQ+HI+LG KYD
Sbjct  121  GNRRNEKISCYVTVRGDKAMQLLESSLKVKEYKLLSRNFSDTGCFCFSIQDHIELGFKYD  180

Query  383  PSTGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNK  213
            PS GIYGM+F+VVLERPG RV RR R KAR+GIQHRVTKDDAMKWFQ KYEGVILN+
Sbjct  181  PSIGIYGMNFFVVLERPGNRVGRRPRGKARLGIQHRVTKDDAMKWFQGKYEGVILNR  237



>emb|CCI45988.1| unnamed protein product [Albugo candida]
Length=176

 Score =   263 bits (673),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 129/176 (73%), Positives = 153/176 (87%), Gaps = 0/176 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MA +KK N  MREIKV KLV+N  VGESGD+LTRAA+VLEQL+GQ PV+SKARYTVRSFG
Sbjct  1    MAGDKKSNNAMREIKVDKLVINCCVGESGDKLTRAARVLEQLTGQKPVYSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKI+C+VTVRG+ A ++L+ GLKVKEYEL R+NFSDTG FGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKISCHVTVRGEMASEILDRGLKVKEYELKRKNFSDTGNFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNK  213
            STGIYGMDF+VVL RPG RV+ R+  ++R+G  HR+ KDDA+ WFQ KYEG++L+K
Sbjct  121  STGIYGMDFFVVLSRPGARVSHRKIQQSRIGAPHRLRKDDAINWFQTKYEGIVLDK  176



>tpe|CAL69062.1| TPA: putative 60S ribosomal protein L11 [Spadella cephaloptera]
Length=207

 Score =   263 bits (672),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 132/174 (76%), Positives = 147/174 (84%), Gaps = 0/174 (0%)
 Frame = -3

Query  737  ASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  558
            A  KK N PMR+IK+ KL LNI VGESGDRLTRAAKVLEQLSGQ PVFSKARYTVRSFGI
Sbjct  12   AVTKKANNPMRDIKIMKLCLNICVGESGDRLTRAAKVLEQLSGQQPVFSKARYTVRSFGI  71

Query  557  RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  378
            RRNEKIAC+ TVRG KA ++LE GLKV EYEL R  FSDTG FGFG+QEHIDLGIKYDPS
Sbjct  72   RRNEKIACHCTVRGPKAEEILEKGLKVVEYELRRDCFSDTGSFGFGLQEHIDLGIKYDPS  131

Query  377  TGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILN  216
             GIYG+DFYVVL R GY V +RR  K+ +G+QHRVTKD+AMKWF  KY+G++LN
Sbjct  132  IGIYGLDFYVVLGRAGYNVNQRRARKSTIGVQHRVTKDEAMKWFVGKYDGILLN  185



>gb|AIU94837.1| 60S ribosomal protein [Phragmatopoma lapidosa]
Length=179

 Score =   261 bits (668),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 132/174 (76%), Positives = 150/174 (86%), Gaps = 0/174 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MA +KK N  MRE+++ KL LNI VGESGDRLTRAAKVLEQL+GQ PVFSKARYTVRSFG
Sbjct  1    MAEDKKKNNAMRELRILKLCLNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIA + TVRG KA ++LE GLKV+EYEL R NFS TG FGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIAVHCTVRGAKAEEILEKGLKVREYELRRNNFSGTGNFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVIL  219
            S GIYGMDFYVVL RPG+ V++RR+ K+ +G QHRVTKD++MKWFQ KY+GVIL
Sbjct  121  SIGIYGMDFYVVLGRPGFNVSKRRKRKSVIGFQHRVTKDESMKWFQQKYDGVIL  174



>ref|XP_007511979.1| 60S ribosomal protein L11 [Bathycoccus prasinos]
 emb|CCO66067.1| 60S ribosomal protein L11 [Bathycoccus prasinos]
Length=169

 Score =   258 bits (660),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 130/168 (77%), Positives = 155/168 (92%), Gaps = 1/168 (1%)
 Frame = -3

Query  710  MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  531
            M++I++ KL+LNISVGESGDRLT+AAKVLEQL+GQ PVFSKARYTVR+FGIRRNEKIAC+
Sbjct  1    MKDIRIHKLILNISVGESGDRLTKAAKVLEQLTGQQPVFSKARYTVRTFGIRRNEKIACH  60

Query  530  VTVRG-DKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDF  354
            VTV   DKA+Q+LESGLKVKE+ELL++NFS TG FGFGIQEHIDLGIKYDPSTGIYGMDF
Sbjct  61   VTVGNRDKALQILESGLKVKEFELLKKNFSSTGNFGFGIQEHIDLGIKYDPSTGIYGMDF  120

Query  353  YVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKA  210
            +VVLERPG+RV+RRR+C+ +VG  H++TK DAMKWFQ K+EG+IL +A
Sbjct  121  FVVLERPGFRVSRRRKCQKKVGKSHKLTKTDAMKWFQQKFEGIILARA  168



>ref|XP_002507327.1| ribosomal protein L11 [Micromonas sp. RCC299]
 gb|ACO68585.1| ribosomal protein L11 [Micromonas sp. RCC299]
Length=170

 Score =   258 bits (659),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 131/170 (77%), Positives = 153/170 (90%), Gaps = 1/170 (1%)
 Frame = -3

Query  710  MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  531
            MRE+++ KLVLNISVGESGDRLT+AAKVLEQL+GQ PVFSKARYTVR+FGIRRNEKIA +
Sbjct  1    MREVRIHKLVLNISVGESGDRLTKAAKVLEQLTGQQPVFSKARYTVRTFGIRRNEKIATH  60

Query  530  VTVRG-DKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDF  354
            VTV   DKAMQ+LESGLKVKEYEL++ NFS TGCFGFGI EHIDLGIKYDPSTGIYGMDF
Sbjct  61   VTVGNRDKAMQILESGLKVKEYELIKSNFSQTGCFGFGISEHIDLGIKYDPSTGIYGMDF  120

Query  353  YVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASN  204
            +VVLERPG+RVA+RR+C+ ++G  H++ K DAMK+FQ K+EGVIL K+ N
Sbjct  121  FVVLERPGFRVAKRRKCQTKIGAPHKLKKTDAMKFFQSKFEGVILAKSYN  170



>ref|XP_008912007.1| 60S ribosomal protein L11 [Phytophthora parasitica INRA-310]
 gb|ETI37223.1| 60S ribosomal protein L11 [Phytophthora parasitica P1569]
 gb|ETK77445.1| 60S ribosomal protein L11 [Phytophthora parasitica]
 gb|ETL30892.1| 60S ribosomal protein L11 [Phytophthora parasitica]
 gb|ETL84131.1| 60S ribosomal protein L11 [Phytophthora parasitica]
 gb|ETM37312.1| 60S ribosomal protein L11 [Phytophthora parasitica]
 gb|ETN02792.1| 60S ribosomal protein L11 [Phytophthora parasitica INRA-310]
 gb|ETO65966.1| 60S ribosomal protein L11 [Phytophthora parasitica P1976]
 gb|ETP07076.1| 60S ribosomal protein L11 [Phytophthora parasitica CJ01A1]
 gb|ETP35169.1| 60S ribosomal protein L11 [Phytophthora parasitica P10297]
Length=178

 Score =   258 bits (659),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 128/179 (72%), Positives = 156/179 (87%), Gaps = 1/179 (1%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MA +K  N PMR+I V KLV+N  VGESGD+LTRAA+VLEQL+GQ PV+SKARYTVR+FG
Sbjct  1    MAGDKS-NNPMRDIHVDKLVINCCVGESGDKLTRAARVLEQLTGQKPVYSKARYTVRTFG  59

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKI+C+VT+RG+ A ++L+ GLKVKEYELLR+NFS+TG FGFGIQEHIDLGIKYDP
Sbjct  60   IRRNEKISCHVTIRGELAQEILDRGLKVKEYELLRKNFSETGNFGFGIQEHIDLGIKYDP  119

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKASN  204
            STGIYGMDF+VVL+RPG RVARR+  ++RVG  HR+TKDDA+ WFQ K+EG++L+   N
Sbjct  120  STGIYGMDFFVVLKRPGARVARRKMQQSRVGHPHRLTKDDAINWFQTKFEGIVLDAPRN  178



>ref|NP_477054.1| ribosomal protein L11, isoform A [Drosophila melanogaster]
 ref|NP_001286614.1| ribosomal protein L11, isoform B [Drosophila melanogaster]
 ref|XP_001974810.1| GG21971 [Drosophila erecta]
 ref|XP_002091784.1| GE12050 [Drosophila yakuba]
 ref|XP_002082231.1| GD11455 [Drosophila simulans]
 sp|P46222.2|RL11_DROME RecName: Full=60S ribosomal protein L11 [Drosophila melanogaster]
 pdb|3J39|J Chain J, Structure Of The D. Melanogaster 60s Ribosomal Proteins
 gb|AAF57560.1| ribosomal protein L11, isoform A [Drosophila melanogaster]
 gb|AAM11143.1| LD17235p [Drosophila melanogaster]
 gb|EDV55210.1| GG21971 [Drosophila erecta]
 gb|EDW91496.1| GE12050 [Drosophila yakuba]
 gb|EDX07816.1| GD11455 [Drosophila simulans]
 gb|ACL83948.1| RpL11-PA, partial [synthetic construct]
 gb|ACL89050.1| RpL11-PA [synthetic construct]
 gb|AHN56409.1| ribosomal protein L11, isoform B [Drosophila melanogaster]
Length=184

 Score =   256 bits (654),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 142/166 (86%), Gaps = 0/166 (0%)
 Frame = -3

Query  713  PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIAC  534
            PMR++ ++KL LNI VGESGDRLTRAAKVLEQL+GQ PVFSKARYTVRSFGIRRNEKIA 
Sbjct  16   PMRDLHIRKLCLNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTVRSFGIRRNEKIAV  75

Query  533  YVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDF  354
            + TVRG KA ++LE GLKV+EYEL R NFS TG FGFGIQEHIDLGIKYDPS GIYG+DF
Sbjct  76   HCTVRGAKAEEILERGLKVREYELRRENFSSTGNFGFGIQEHIDLGIKYDPSIGIYGLDF  135

Query  353  YVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILN  216
            YVVL RPGY V  R+R    VG QHR+TK+DAMKWFQ KY+G+ILN
Sbjct  136  YVVLGRPGYNVNHRKRKSGTVGFQHRLTKEDAMKWFQQKYDGIILN  181



>ref|XP_005988804.1| PREDICTED: 60S ribosomal protein L11 isoform X2 [Latimeria chalumnae]
Length=177

 Score =   256 bits (653),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 124/174 (71%), Positives = 150/174 (86%), Gaps = 0/174 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MA + +   PMRE++++KL LNI VGESGDRLTRAAKVLEQL+GQTPVFSKARYTVRSFG
Sbjct  1    MAEKSEKENPMRELRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIA + TVRG KA ++LE GLKV+EYEL + NFSDTG FGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIAVHCTVRGAKAEEILEKGLKVREYELRKNNFSDTGNFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVIL  219
            S GIYG+DFYVVL RPG+ +A ++R   R+G +HR++K++AM+WFQ KY+G+IL
Sbjct  121  SIGIYGLDFYVVLGRPGFSIADKKRKTGRIGAKHRISKEEAMRWFQQKYDGIIL  174



>ref|XP_004678660.1| PREDICTED: 60S ribosomal protein L11 isoform X2 [Condylura cristata]
Length=177

 Score =   256 bits (653),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 123/174 (71%), Positives = 149/174 (86%), Gaps = 0/174 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MA + +   PMRE++++KL LNI VGESGDRLTRAAKVLEQL+GQTPVFSKARYTVRSFG
Sbjct  1    MADQSEKENPMRELRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIA + TVRG KA ++LE GLKV+EYEL + NFSDTG FGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIAVHCTVRGAKAEEILEKGLKVREYELRKNNFSDTGNFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVIL  219
            S GIYG+DFYVVL RPG+ +A ++R    +G +HR++K++AM+WFQ KY+G+IL
Sbjct  121  SIGIYGLDFYVVLGRPGFSIADKKRRTGCIGAKHRISKEEAMRWFQQKYDGIIL  174



>ref|XP_004603489.1| PREDICTED: 60S ribosomal protein L11 isoform X2 [Sorex araneus]
Length=177

 Score =   255 bits (652),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 123/174 (71%), Positives = 149/174 (86%), Gaps = 0/174 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MA + +   PMRE++++KL LNI VGESGDRLTRAAKVLEQL+GQTPVFSKARYTVRSFG
Sbjct  1    MADQAEKENPMRELRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIA + TVRG KA ++LE GLKV+EYEL + NFSDTG FGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIAVHCTVRGAKAEEILEKGLKVREYELRKNNFSDTGNFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVIL  219
            S GIYG+DFYVVL RPG+ +A ++R    +G +HR++K++AM+WFQ KY+G+IL
Sbjct  121  SIGIYGLDFYVVLGRPGFSIADKKRRTGCIGAKHRISKEEAMRWFQQKYDGIIL  174



>gb|AAX42399.1| ribosomal protein L11 [synthetic construct]
Length=177

 Score =   255 bits (652),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 123/174 (71%), Positives = 149/174 (86%), Gaps = 0/174 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MA + +   PMRE++++KL LNI VGESGDRLTRAAKVLEQL+GQTPVFSKARYTVRSFG
Sbjct  1    MADQGEKENPMRELRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIA + TVRG KA ++LE GLKV+EYEL + NFSDTG FGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIAVHCTVRGAKAEEILEKGLKVREYELRKNNFSDTGNFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVIL  219
            S GIYG+DFYVVL RPG+ +A ++R    +G +HR++K++AM+WFQ KY+G+IL
Sbjct  121  SIGIYGLDFYVVLGRPGFSIANKKRRTGCIGAKHRISKEEAMRWFQQKYDGIIL  174



>ref|XP_007874680.1| hypothetical protein PNEG_02659 [Pneumocystis murina B123]
 gb|EMR08874.1| hypothetical protein PNEG_02659 [Pneumocystis murina B123]
Length=175

 Score =   255 bits (651),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 131/176 (74%), Positives = 154/176 (88%), Gaps = 1/176 (1%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            M  EK  N PMREIK+QKLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYT+R+FG
Sbjct  1    MEIEKGSN-PMREIKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTIRAFG  59

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKI+ YVTVRG KA ++LE GLKVKEYEL R NFSDTG FGFGI EHIDL IKYDP
Sbjct  60   IRRNEKISVYVTVRGAKAEEILERGLKVKEYELKRSNFSDTGNFGFGIHEHIDLNIKYDP  119

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNK  213
            S GI+GM+FYVVL RPG+RV++RRRC++ VG  H+VTK+DA++WF+ +Y+  +LN+
Sbjct  120  SIGIFGMNFYVVLGRPGFRVSKRRRCRSSVGSNHKVTKEDAIRWFKNRYDATVLNR  175



>ref|XP_002063810.1| GK15870 [Drosophila willistoni]
 gb|EDW74796.1| GK15870 [Drosophila willistoni]
Length=187

 Score =   255 bits (652),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 142/166 (86%), Gaps = 0/166 (0%)
 Frame = -3

Query  713  PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIAC  534
            PMR++ ++KL LNI VGESGDRLTRAAKVLEQL+GQ PVFSKARYTVRSFGIRRNEKIA 
Sbjct  19   PMRDLHIRKLCLNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTVRSFGIRRNEKIAV  78

Query  533  YVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDF  354
            + TVRG KA ++LE GLKV+EYEL R NFS TG FGFGIQEHIDLGIKYDPS GIYG+DF
Sbjct  79   HCTVRGAKAEEILERGLKVREYELRRENFSATGNFGFGIQEHIDLGIKYDPSIGIYGLDF  138

Query  353  YVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILN  216
            YVVL RPGY V  R+R    VG QHR+TK+DAMKWFQ KY+G+ILN
Sbjct  139  YVVLGRPGYNVLHRKRKAGTVGFQHRLTKEDAMKWFQQKYDGIILN  184



>ref|XP_006179217.1| PREDICTED: 60S ribosomal protein L11 isoform X2 [Camelus ferus]
 ref|XP_006196822.1| PREDICTED: 60S ribosomal protein L11 isoform X2 [Vicugna pacos]
Length=177

 Score =   255 bits (651),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 123/174 (71%), Positives = 149/174 (86%), Gaps = 0/174 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MA + +   PMRE++++KL LNI VGESGDRLTRAAKVLEQL+GQTPVFSKARYTVRSFG
Sbjct  1    MADQGEKENPMRELRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIA + TVRG KA ++LE GLKV+EYEL + NFSDTG FGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIAVHCTVRGAKAEEILEKGLKVREYELRKNNFSDTGNFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVIL  219
            S GIYG+DFYVVL RPG+ +A ++R    +G +HR++K++AM+WFQ KY+G+IL
Sbjct  121  SIGIYGLDFYVVLGRPGFSIADKKRKTGCIGAKHRISKEEAMRWFQQKYDGIIL  174



>ref|XP_679576.1| 60S ribosomal protein L11a [Plasmodium berghei strain ANKA]
 ref|XP_741752.1| 60S ribosomal protein L11a [Plasmodium chabaudi chabaudi]
 ref|XP_730342.1| ribosomal protein L11 [Plasmodium yoelii yoelii 17XNL]
 gb|EAA21907.1| ribosomal protein L11-like [Plasmodium yoelii yoelii]
 emb|CAH98826.1| 60S ribosomal protein L11a, putative [Plasmodium berghei]
 emb|CAH89249.1| 60S ribosomal protein L11a, putative [Plasmodium chabaudi chabaudi]
 emb|CDR11742.1| 60S ribosomal protein L11a, putative [Plasmodium chabaudi chabaudi]
 emb|CDS45545.1| 60S ribosomal protein L11a, putative [Plasmodium berghei ANKA]
 emb|CDU17049.1| 60S ribosomal protein L11a, putative [Plasmodium yoelii]
 emb|CDZ14859.1| 60S ribosomal protein L11a, putative [Plasmodium yoelii]
Length=173

 Score =   255 bits (651),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 126/171 (74%), Positives = 149/171 (87%), Gaps = 0/171 (0%)
 Frame = -3

Query  731  EKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRR  552
            EKK +  MREIKV KL+LNI VGESGDRLTRAA+VLEQL+ Q P+F K R+T+RSFG+RR
Sbjct  2    EKKEDNVMREIKVNKLILNICVGESGDRLTRAARVLEQLTEQKPIFGKCRFTIRSFGVRR  61

Query  551  NEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTG  372
            NEKI+C+VTVRG KA+++LE GLKVKEYEL R+NFSDTG FGFGIQEHIDLGIKYDPSTG
Sbjct  62   NEKISCFVTVRGKKALEILEKGLKVKEYELRRKNFSDTGNFGFGIQEHIDLGIKYDPSTG  121

Query  371  IYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVIL  219
            IYGMDFYV L RPGYRV RRRR ++ +   H+VTK+DAMKWFQ K++G++L
Sbjct  122  IYGMDFYVHLSRPGYRVTRRRRKRSTISKTHKVTKEDAMKWFQTKFDGILL  172



>ref|NP_001002139.1| 60S ribosomal protein L11 [Danio rerio]
 gb|AAH71420.1| Ribosomal protein L11 [Danio rerio]
 gb|AAT68159.1| 60S ribosomal protein L11 [Danio rerio]
Length=178

 Score =   255 bits (651),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 127/172 (74%), Positives = 150/172 (87%), Gaps = 1/172 (1%)
 Frame = -3

Query  734  SEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIR  555
            SEKK N PMRE++++KL LNI VGESGDRLTRAAKVLEQL+GQTPVFSKARYTVRSFGIR
Sbjct  5    SEKKEN-PMRELRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRSFGIR  63

Query  554  RNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPST  375
            RNEKIA + TVRG KA ++LE GLKV+EYEL + NFSDTG FGFGIQEHIDLGIKYDPS 
Sbjct  64   RNEKIAVHCTVRGAKAEEILEKGLKVREYELRKNNFSDTGNFGFGIQEHIDLGIKYDPSI  123

Query  374  GIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVIL  219
            GIYG+DFYVVL RPG+ +A ++R   R+G +HR+ K++AM+WFQ KY+G+IL
Sbjct  124  GIYGLDFYVVLGRPGFSIADKKRKTGRIGAKHRIRKEEAMRWFQQKYDGIIL  175



>ref|XP_004220956.1| 60S ribosomal protein L11 [Plasmodium cynomolgi strain B]
 dbj|GAB64825.1| 60S ribosomal protein L11 [Plasmodium cynomolgi strain B]
Length=173

 Score =   254 bits (650),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 125/171 (73%), Positives = 149/171 (87%), Gaps = 0/171 (0%)
 Frame = -3

Query  731  EKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRR  552
            EKK +  MREIKV KLVLNI VGESGDRLTRAA+VLEQL+ Q P+F K R+T+RSFG+RR
Sbjct  2    EKKEDNVMREIKVNKLVLNICVGESGDRLTRAARVLEQLTEQKPIFGKCRFTIRSFGVRR  61

Query  551  NEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTG  372
            NEKI+C+VTVRG KA+++LE GLKVKEYEL R+NFS+TG FGFGIQEHIDLGIKYDPSTG
Sbjct  62   NEKISCFVTVRGKKALEILEKGLKVKEYELRRKNFSETGNFGFGIQEHIDLGIKYDPSTG  121

Query  371  IYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVIL  219
            IYGMDFYV L RPGYRV +RRR ++ +   H+VTKD+AMKWFQ K++G++L
Sbjct  122  IYGMDFYVHLSRPGYRVTKRRRKRSTISKTHKVTKDEAMKWFQAKFDGILL  172



>ref|NP_001186731.1| 60S ribosomal protein L11 isoform 2 [Homo sapiens]
 ref|NP_001240836.1| 60S ribosomal protein L11 isoform 2 [Canis lupus familiaris]
 ref|XP_004592319.1| PREDICTED: 60S ribosomal protein L11 [Ochotona princeps]
 ref|XP_004637664.1| PREDICTED: 60S ribosomal protein L11 isoform X2 [Octodon degus]
 ref|XP_005394827.1| PREDICTED: 60S ribosomal protein L11 isoform X2 [Chinchilla lanigera]
 ref|XP_006094109.1| PREDICTED: 60S ribosomal protein L11 isoform X2 [Myotis lucifugus]
 ref|XP_006145208.1| PREDICTED: 60S ribosomal protein L11 isoform X2 [Tupaia chinensis]
 ref|XP_006777626.1| PREDICTED: 60S ribosomal protein L11 isoform X2 [Myotis davidii]
 ref|XP_006737646.1| PREDICTED: 60S ribosomal protein L11 isoform X3 [Leptonychotes 
weddellii]
 ref|XP_006883589.1| PREDICTED: 60S ribosomal protein L11-like isoform X2 [Elephantulus 
edwardii]
 ref|XP_007459240.1| PREDICTED: 60S ribosomal protein L11 isoform X2 [Lipotes vexillifer]
 ref|XP_008059999.1| PREDICTED: 60S ribosomal protein L11 isoform X2 [Tarsius syrichta]
 ref|XP_008146325.1| PREDICTED: 60S ribosomal protein L11 isoform X2 [Eptesicus fuscus]
 ref|XP_008571168.1| PREDICTED: 60S ribosomal protein L11 isoform X3 [Galeopterus 
variegatus]
 gb|AAD20460.3| ribosomal protein L11 [Homo sapiens]
 gb|AAH18970.1| Ribosomal protein L11 [Homo sapiens]
 gb|ABM87711.1| ribosomal protein L11 [synthetic construct]
 gb|ABW03860.1| ribosomal protein L11 [synthetic construct]
 gb|AIC49613.1| RPL11, partial [synthetic construct]
Length=177

 Score =   255 bits (651),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 123/174 (71%), Positives = 149/174 (86%), Gaps = 0/174 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MA + +   PMRE++++KL LNI VGESGDRLTRAAKVLEQL+GQTPVFSKARYTVRSFG
Sbjct  1    MADQGEKENPMRELRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIA + TVRG KA ++LE GLKV+EYEL + NFSDTG FGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIAVHCTVRGAKAEEILEKGLKVREYELRKNNFSDTGNFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVIL  219
            S GIYG+DFYVVL RPG+ +A ++R    +G +HR++K++AM+WFQ KY+G+IL
Sbjct  121  SIGIYGLDFYVVLGRPGFSIADKKRRTGCIGAKHRISKEEAMRWFQQKYDGIIL  174



>ref|XP_002049941.1| GJ21865 [Drosophila virilis]
 gb|EDW61134.1| GJ21865 [Drosophila virilis]
Length=187

 Score =   255 bits (651),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 128/166 (77%), Positives = 143/166 (86%), Gaps = 0/166 (0%)
 Frame = -3

Query  713  PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIAC  534
            PMR++ ++KL LNI VGESGDRLTRAAKVLEQL+GQ PVFSKARYTVRSFGIRRNEKIA 
Sbjct  19   PMRDLHIRKLCLNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTVRSFGIRRNEKIAV  78

Query  533  YVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDF  354
            + TVRG KA ++LE GLKV+EYEL R NFS TG FGFGIQEHIDLGIKYDPS GIYG+DF
Sbjct  79   HCTVRGAKAEEILERGLKVREYELRRDNFSATGNFGFGIQEHIDLGIKYDPSIGIYGLDF  138

Query  353  YVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILN  216
            YVVL RPGY VA R+R    VG QHR+TK+DAMKWFQ KY+G+ILN
Sbjct  139  YVVLGRPGYNVAHRKRKSGTVGFQHRLTKEDAMKWFQQKYDGIILN  184



>ref|XP_002005901.1| GI18837 [Drosophila mojavensis]
 gb|EDW09836.1| GI18837 [Drosophila mojavensis]
Length=187

 Score =   255 bits (651),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 128/166 (77%), Positives = 143/166 (86%), Gaps = 0/166 (0%)
 Frame = -3

Query  713  PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIAC  534
            PMR++ ++KL LNI VGESGDRLTRAAKVLEQL+GQ PVFSKARYTVRSFGIRRNEKIA 
Sbjct  19   PMRDLHIRKLCLNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTVRSFGIRRNEKIAV  78

Query  533  YVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDF  354
            + TVRG KA ++LE GLKV+EYEL R NFS TG FGFGIQEHIDLGIKYDPS GIYG+DF
Sbjct  79   HCTVRGAKAEEILERGLKVREYELRRDNFSATGNFGFGIQEHIDLGIKYDPSIGIYGLDF  138

Query  353  YVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILN  216
            YVVL RPGY VA R+R    VG QHR+TK+DAMKWFQ KY+G+ILN
Sbjct  139  YVVLGRPGYNVAHRKRKAGTVGFQHRLTKEDAMKWFQQKYDGIILN  184



>ref|XP_005955884.1| PREDICTED: 60S ribosomal protein L11 isoform X2 [Pantholops hodgsonii]
Length=177

 Score =   254 bits (650),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/174 (71%), Positives = 149/174 (86%), Gaps = 0/174 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MA + +   PMRE++++KL LNI VGESGDRLTRAAKVLEQL+GQTPVFSKARYTVRSFG
Sbjct  1    MADQGEKENPMRELRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIA + TVRG KA ++LE GLKV+EYEL + NFSDTG FGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIAVHCTVRGPKAEEILEKGLKVREYELRKNNFSDTGNFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVIL  219
            S GIYG+DFYVVL RPG+ +A ++R    +G +HR++K++AM+WFQ KY+G+IL
Sbjct  121  SIGIYGLDFYVVLGRPGFSIADKKRRTGCIGAKHRISKEEAMRWFQQKYDGIIL  174



>gb|AAX29834.1| ribosomal protein L11 [synthetic construct]
Length=178

 Score =   254 bits (650),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/174 (71%), Positives = 149/174 (86%), Gaps = 0/174 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MA + +   PMRE++++KL LNI VGESGDRLTRAAKVLEQL+GQTPVFSKARYTVRSFG
Sbjct  1    MADQGEKENPMRELRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIA + TVRG KA ++LE GLKV+EYEL + NFSDTG FGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIAVHCTVRGAKAEEILEKGLKVREYELRKNNFSDTGNFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVIL  219
            S GIYG+DFYVVL RPG+ +A ++R    +G +HR++K++AM+WFQ KY+G+IL
Sbjct  121  SIGIYGLDFYVVLGRPGFSIADKKRRTGCIGAKHRISKEEAMRWFQQKYDGIIL  174



>ref|XP_006862372.1| PREDICTED: 60S ribosomal protein L11 [Chrysochloris asiatica]
Length=177

 Score =   254 bits (650),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/174 (71%), Positives = 149/174 (86%), Gaps = 0/174 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MA + +   PMRE++++KL LNI VGESGDRLTRAAKVLEQL+GQTPVFSKARYTVRSFG
Sbjct  1    MADQGEKENPMRELRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIA + TVRG KA ++LE GLKV+EYEL + NFSDTG FGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIAVHCTVRGAKAEEILERGLKVREYELRKNNFSDTGNFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVIL  219
            S GIYG+DFYVVL RPG+ +A ++R    +G +HR++K++AM+WFQ KY+G+IL
Sbjct  121  SIGIYGLDFYVVLGRPGFSIADKKRRTGCIGAKHRISKEEAMRWFQQKYDGIIL  174



>gb|AAV90722.1| 60S ribosomal protein L11 [Aedes albopictus]
Length=183

 Score =   255 bits (651),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 129/180 (72%), Positives = 151/180 (84%), Gaps = 0/180 (0%)
 Frame = -3

Query  746  SDMASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRS  567
            +  AS+ K    MR+++++KL LNI VGESGDRLTRAAKVLEQL+GQTPV+SKARYTVRS
Sbjct  3    TKTASKDKSKNIMRDLRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVYSKARYTVRS  62

Query  566  FGIRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKY  387
            FGIRRNEKIA + TVRG KA ++LE GLKV+EYEL R NFS TG FGFGIQEHIDLGIKY
Sbjct  63   FGIRRNEKIAVHCTVRGTKAEEILERGLKVREYELRRDNFSQTGNFGFGIQEHIDLGIKY  122

Query  386  DPSTGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKAS  207
            DPS GIYG+DFYVVL RPGY VA+RRR   ++G  HR+TK+DAMKWFQ KY+G+ILN  +
Sbjct  123  DPSIGIYGLDFYVVLGRPGYNVAQRRRKTGKIGFIHRLTKEDAMKWFQQKYDGIILNSKA  182



>ref|XP_002184288.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC44037.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=176

 Score =   254 bits (650),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 129/176 (73%), Positives = 153/176 (87%), Gaps = 1/176 (1%)
 Frame = -3

Query  734  SEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIR  555
            SE K N  MREIKV KL+LN  VGESGDRLTRAA+VLEQL+GQ PVFSKARYT+RSFGIR
Sbjct  2    SETKTN-AMREIKVDKLILNCCVGESGDRLTRAARVLEQLTGQQPVFSKARYTLRSFGIR  60

Query  554  RNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPST  375
            RNEKIA +VTVRG+KA+++LE GLKVKEYELL++NFSDTG FGFGI EHIDLGIKYDP+T
Sbjct  61   RNEKIAVHVTVRGEKALEILERGLKVKEYELLQKNFSDTGNFGFGINEHIDLGIKYDPTT  120

Query  374  GIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKAS  207
            GIYGMDF+V L RPG RVARR+  + R+G  H++TK+D++KWFQ K+EGV+L K +
Sbjct  121  GIYGMDFFVCLTRPGARVARRKIRQGRIGFNHKITKEDSIKWFQDKFEGVVLAKEA  176



>gb|AGM32143.1| 60S ribosomal protein L11 [Coptotermes formosanus]
Length=201

 Score =   255 bits (652),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 129/169 (76%), Positives = 144/169 (85%), Gaps = 0/169 (0%)
 Frame = -3

Query  725  KLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNE  546
            K   PMRE++++KL LNI VGESGDRLTRAAKVLE L+GQ PVFSKARYTVRSFGIRRNE
Sbjct  28   KSKNPMREVRIRKLCLNICVGESGDRLTRAAKVLESLTGQQPVFSKARYTVRSFGIRRNE  87

Query  545  KIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIY  366
            KIA + TVRG KA ++LE GLKV+EYEL + NFSDTG FGFGIQEHIDLGIKYDPS GIY
Sbjct  88   KIAVHCTVRGAKAEEILERGLKVREYELRKDNFSDTGNFGFGIQEHIDLGIKYDPSVGIY  147

Query  365  GMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVIL  219
            G+DFYVVL RPG+ VA RRR    VG QHR+TK+DAMKWFQ KY+GVIL
Sbjct  148  GLDFYVVLGRPGFNVAHRRRKTGMVGFQHRLTKEDAMKWFQQKYDGVIL  196



>emb|CCE35354.1| probable ribosomal protein L11.e.A, cytosolic [Claviceps purpurea 
20.1]
Length=173

 Score =   254 bits (649),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 128/173 (74%), Positives = 150/173 (87%), Gaps = 1/173 (1%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEK  N PMRE+K+QKLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYTVR+FG
Sbjct  1    MASEK-ANNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFG  59

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIA +VTVRG KA ++LE GLKVKEYEL +RNFS+TG FGFGI EHIDLGIKYDP
Sbjct  60   IRRNEKIAVHVTVRGPKAEEILERGLKVKEYELRKRNFSETGNFGFGISEHIDLGIKYDP  119

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVI  222
            S GIYGMDFY  + RPG RV+RRRR K  +G  HR+ +D+ +KWF+ +++G++
Sbjct  120  SIGIYGMDFYCCMTRPGERVSRRRRMKNTIGASHRIKRDETVKWFKTRFDGIV  172



>ref|XP_001612822.1| 60S ribosomal protein L11 [Plasmodium vivax Sal-1]
 ref|XP_008818163.1| 60S ribosomal protein L11 [Plasmodium inui San Antonio 1]
 gb|EDL43095.1| 60S ribosomal protein L11, putative [Plasmodium vivax]
 gb|EUD65229.1| 60S ribosomal protein L11 [Plasmodium inui San Antonio 1]
Length=173

 Score =   254 bits (648),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 126/171 (74%), Positives = 149/171 (87%), Gaps = 0/171 (0%)
 Frame = -3

Query  731  EKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRR  552
            EKK +  MREIKV KLVLNI VGESGDRLTRAA+VLEQL+ Q P+F K R+T+RSFG+RR
Sbjct  2    EKKEDNVMREIKVNKLVLNICVGESGDRLTRAARVLEQLTEQKPIFGKCRFTIRSFGVRR  61

Query  551  NEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTG  372
            NEKI+C+VTVRG KA+++LE GLKVKEYEL R+NFS+TG FGFGIQEHIDLGIKYDPSTG
Sbjct  62   NEKISCFVTVRGKKALEILEKGLKVKEYELRRKNFSETGNFGFGIQEHIDLGIKYDPSTG  121

Query  371  IYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVIL  219
            IYGMDFYV L RPGYRV RRRR ++ +   H+VTKD+AMKWFQ K++G++L
Sbjct  122  IYGMDFYVHLSRPGYRVTRRRRKRSTISKTHKVTKDEAMKWFQTKFDGILL  172



>gb|ABV44749.1| 60S ribosomal protein L11-like protein [Phlebotomus papatasi]
Length=213

 Score =   255 bits (652),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 128/170 (75%), Positives = 145/170 (85%), Gaps = 0/170 (0%)
 Frame = -3

Query  725  KLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNE  546
            K   PMRE+ ++KL LNI VGESGDRLTRAAKVLEQL+GQ PVFSKARYTVRSFGIRRNE
Sbjct  41   KTKNPMRELHIRKLCLNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTVRSFGIRRNE  100

Query  545  KIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIY  366
            KIA + TVRG KA ++LE GLKV+EYEL R NFS TG FGFGIQEHIDLGIKYDPS GIY
Sbjct  101  KIAVHCTVRGAKAEEILERGLKVREYELRRDNFSATGNFGFGIQEHIDLGIKYDPSIGIY  160

Query  365  GMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILN  216
            G+DFYVVL RPG+ VA +RR   ++G QHR+TK+DAMKWFQ KY+G+ILN
Sbjct  161  GLDFYVVLGRPGFNVAHKRRKMGKIGFQHRLTKEDAMKWFQQKYDGIILN  210



>ref|NP_001016640.1| ribosomal protein L11 [Xenopus (Silurana) tropicalis]
 gb|AAI35523.1| hypothetical protein LOC549394 [Xenopus (Silurana) tropicalis]
Length=177

 Score =   254 bits (648),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 123/174 (71%), Positives = 148/174 (85%), Gaps = 0/174 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MA +     PMRE++++KL LNI VGESGDRLTRAAKVLEQL+GQTPVFSKARYTVRSFG
Sbjct  1    MADKSDKENPMRELRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIA + TVRG KA ++LE GLKV+EYEL + NFSDTG FGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIAVHCTVRGAKAEEILEKGLKVREYELRKNNFSDTGNFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVIL  219
            S GIYG+DFYVVL RPG+ +A ++R +  +G +HR+ K++AM+WFQ KY+G+IL
Sbjct  121  SIGIYGLDFYVVLGRPGFSIADKKRKRGTIGAKHRIGKEEAMRWFQQKYDGIIL  174



>ref|XP_008625536.1| 60S ribosomal protein L11 [Plasmodium vinckei vinckei]
 gb|EUD71030.1| 60S ribosomal protein L11 [Plasmodium vinckei petteri]
 gb|KEG01569.1| 60S ribosomal protein L11 [Plasmodium vinckei vinckei]
Length=173

 Score =   253 bits (647),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 125/171 (73%), Positives = 149/171 (87%), Gaps = 0/171 (0%)
 Frame = -3

Query  731  EKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRR  552
            EKK +  MREIKV KL+LNI VGESGDRLTRAA+VLEQL+ Q P+F K R+T+RSFG+RR
Sbjct  2    EKKEDNVMREIKVNKLILNICVGESGDRLTRAARVLEQLTEQKPIFGKCRFTIRSFGVRR  61

Query  551  NEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTG  372
            NEKI+C+VTVRG KA+++LE GLKVKEYEL ++NFSDTG FGFGIQEHIDLGIKYDPSTG
Sbjct  62   NEKISCFVTVRGKKALEILEKGLKVKEYELRKKNFSDTGNFGFGIQEHIDLGIKYDPSTG  121

Query  371  IYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVIL  219
            IYGMDFYV L RPGYRV RRRR ++ +   H+VTK+DAMKWFQ K++G++L
Sbjct  122  IYGMDFYVHLSRPGYRVTRRRRKRSTISKTHKVTKEDAMKWFQTKFDGILL  172



>gb|KFD51459.1| hypothetical protein M513_07672 [Trichuris suis]
 gb|KFD60267.1| hypothetical protein M514_07672 [Trichuris suis]
Length=191

 Score =   254 bits (649),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 130/169 (77%), Positives = 148/169 (88%), Gaps = 0/169 (0%)
 Frame = -3

Query  725  KLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNE  546
            KLN PMRE++++KL LNI VGESGDRLTRAAKVLEQL+GQTPVFSKARYTVRSFGIRRNE
Sbjct  16   KLNNPMRELRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRSFGIRRNE  75

Query  545  KIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIY  366
            KIA + TVRG KA ++LE GLKVKEYEL    FS+ G FGFGIQEHIDLGIKYDP+ GIY
Sbjct  76   KIAVHCTVRGLKAEEILEKGLKVKEYELRSSCFSECGNFGFGIQEHIDLGIKYDPTIGIY  135

Query  365  GMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVIL  219
            GMDFYVVL RPG+ V+ RRRCK ++G QHRVT+D+A+KWFQ KY+GVIL
Sbjct  136  GMDFYVVLGRPGFSVSERRRCKNKIGAQHRVTRDEAIKWFQKKYDGVIL  184



>ref|XP_001663129.1| AAEL012944-PB [Aedes aegypti]
 gb|EAT34850.1| AAEL012944-PB [Aedes aegypti]
Length=183

 Score =   253 bits (647),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 129/180 (72%), Positives = 151/180 (84%), Gaps = 0/180 (0%)
 Frame = -3

Query  746  SDMASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRS  567
            +  AS+ K    MR+++++KL LNI VGESGDRLTRAAKVLEQL+GQTPV+SKARYTVRS
Sbjct  3    TKTASKDKSKNIMRDLRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVYSKARYTVRS  62

Query  566  FGIRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKY  387
            FGIRRNEKIA + TVRG KA ++LE GLKV+EYEL R NFS TG FGFGIQEHIDLGIKY
Sbjct  63   FGIRRNEKIAVHCTVRGFKAEEILERGLKVREYELRRDNFSQTGNFGFGIQEHIDLGIKY  122

Query  386  DPSTGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKAS  207
            DPS GIYG+DFYVVL RPGY VA+RRR   ++G  HR+TK+DAMKWFQ KY+G+ILN  +
Sbjct  123  DPSIGIYGLDFYVVLGRPGYNVAQRRRKTGKIGFIHRLTKEDAMKWFQQKYDGIILNSKA  182



>gb|KDR12481.1| 60S ribosomal protein L11 [Zootermopsis nevadensis]
Length=194

 Score =   254 bits (648),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 129/169 (76%), Positives = 144/169 (85%), Gaps = 0/169 (0%)
 Frame = -3

Query  725  KLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNE  546
            K   PMRE++++KL LNI VGESGDRLTRAAKVLE L+GQ PVFSKARYTVRSFGIRRNE
Sbjct  21   KSKNPMREVRIRKLCLNICVGESGDRLTRAAKVLESLTGQQPVFSKARYTVRSFGIRRNE  80

Query  545  KIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIY  366
            KIA + TVRG KA ++LE GLKV+EYEL + NFSDTG FGFGIQEHIDLGIKYDPS GIY
Sbjct  81   KIAVHCTVRGAKAEEILERGLKVREYELRKDNFSDTGNFGFGIQEHIDLGIKYDPSVGIY  140

Query  365  GMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVIL  219
            G+DFYVVL RPG+ VA RRR    VG QHR+TK+DAMKWFQ KY+GVIL
Sbjct  141  GLDFYVVLGRPGFNVAHRRRKTGVVGFQHRLTKEDAMKWFQQKYDGVIL  189



>gb|KHJ43623.1| ribosomal protein L5 [Trichuris suis]
Length=191

 Score =   254 bits (648),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 130/169 (77%), Positives = 148/169 (88%), Gaps = 0/169 (0%)
 Frame = -3

Query  725  KLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNE  546
            KLN PMRE++++KL LNI VGESGDRLTRAAKVLEQL+GQTPVFSKARYTVRSFGIRRNE
Sbjct  16   KLNNPMRELRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRSFGIRRNE  75

Query  545  KIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIY  366
            KIA + TVRG KA ++LE GLKVKEYEL    FS+ G FGFGIQEHIDLGIKYDP+ GIY
Sbjct  76   KIAVHCTVRGLKAEEILEKGLKVKEYELRSSCFSECGNFGFGIQEHIDLGIKYDPTIGIY  135

Query  365  GMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVIL  219
            GMDFYVVL RPG+ V+ RRRCK ++G QHRVT+D+A+KWFQ KY+GVIL
Sbjct  136  GMDFYVVLGRPGFSVSERRRCKNKIGAQHRVTRDEAIKWFQKKYDGVIL  184



>gb|KDB13460.1| 60S ribosomal protein L11 [Ustilaginoidea virens]
Length=173

 Score =   253 bits (646),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 128/173 (74%), Positives = 149/173 (86%), Gaps = 1/173 (1%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MASEK  N PMRE+K+QKLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYTVR+FG
Sbjct  1    MASEK-ANNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFG  59

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIA +VTVRG KA ++LE GLKVKEYEL +RNFS+TG FGFGI EHIDLGIKYDP
Sbjct  60   IRRNEKIAVHVTVRGPKAEEILERGLKVKEYELRKRNFSETGNFGFGISEHIDLGIKYDP  119

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVI  222
            S GIYGMDFY  + RPG RV RRRR K  +G  HR+ +D+ +KWF+ +++G++
Sbjct  120  SIGIYGMDFYCCMTRPGERVTRRRRMKTTIGASHRIKRDETVKWFKQRFDGIV  172



>gb|AAX11430.1| cell growth-inhibiting protein 34 [Homo sapiens]
Length=177

 Score =   253 bits (646),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 122/174 (70%), Positives = 148/174 (85%), Gaps = 0/174 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MA + +   PMRE++++KL LNI VGESGDRL RAAKVLEQL+GQTPVFSKARYTVRSFG
Sbjct  1    MADQGEKENPMRELRIRKLCLNICVGESGDRLARAAKVLEQLTGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIA + TVRG KA ++LE GLKV+EYEL + NFSDTG FGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIAVHCTVRGAKAEEILEKGLKVREYELRKNNFSDTGNFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVIL  219
            S GIYG+DFYVVL RPG+ +A ++R    +G +HR++K++AM+WFQ KY+G+IL
Sbjct  121  SIGIYGLDFYVVLGRPGFSIADKKRRTGCIGAKHRISKEEAMRWFQQKYDGIIL  174



>ref|NP_001087287.1| ribosomal protein L11 [Xenopus laevis]
 gb|AAH78513.1| MGC85310 protein [Xenopus laevis]
Length=177

 Score =   253 bits (646),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 123/174 (71%), Positives = 149/174 (86%), Gaps = 0/174 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MA + +   PMRE++++KL LNI VGESGDRLTRAAKVLEQL+GQTPVFSKARYTVRSFG
Sbjct  1    MADKTEKENPMRELRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIA + TVRG KA ++LE GLKV+EYEL + NFSDTG FGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIAVHCTVRGAKAEEILEKGLKVREYELRKNNFSDTGNFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVIL  219
            S GIYG+DFYVVL RPG+ +A ++R +  +G +HR+ K++AM+WFQ KY+G+IL
Sbjct  121  SIGIYGLDFYVVLGRPGFSIADKKRKRGVIGSKHRIGKEEAMRWFQQKYDGIIL  174



>ref|XP_003054830.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH60082.1| predicted protein [Micromonas pusilla CCMP1545]
Length=174

 Score =   253 bits (646),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 130/172 (76%), Positives = 154/172 (90%), Gaps = 1/172 (1%)
 Frame = -3

Query  722  LNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEK  543
            +  PM E ++ KLVLNI VGESGDRLT+AAKVLEQL+GQ P+FSKARYTVR+FGIRRNEK
Sbjct  1    MANPMMEPRIHKLVLNICVGESGDRLTKAAKVLEQLTGQQPIFSKARYTVRTFGIRRNEK  60

Query  542  IACYVTVRG-DKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIY  366
            I+ +VTV   DKAMQ+LESGLKVKEYELL++NFS+TG FGFGI EHIDLGIKYDPSTGIY
Sbjct  61   ISTHVTVGNRDKAMQILESGLKVKEYELLKKNFSNTGTFGFGISEHIDLGIKYDPSTGIY  120

Query  365  GMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKA  210
            GMDF+VVLERPGYRVA+RR+C++++G  H++TK DAMK+FQ K+EGVIL KA
Sbjct  121  GMDFFVVLERPGYRVAKRRKCQSKIGKPHKLTKVDAMKFFQSKFEGVILAKA  172



>ref|XP_002171744.1| 60S ribosomal protein L11 [Schizosaccharomyces japonicus yFS275]
 gb|EEB05451.1| 60S ribosomal protein L11 [Schizosaccharomyces japonicus yFS275]
Length=174

 Score =   253 bits (646),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 124/172 (72%), Positives = 149/172 (87%), Gaps = 0/172 (0%)
 Frame = -3

Query  728  KKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRN  549
            +K   PM+E+++ KLVLNIS+GESGDRLTRAAKVLEQLSGQTPVFSKARYT+R FGIRRN
Sbjct  3    EKAQNPMKELRIAKLVLNISLGESGDRLTRAAKVLEQLSGQTPVFSKARYTIRRFGIRRN  62

Query  548  EKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGI  369
            EKIA +VTVRG KA ++LE GLKVKE+EL RRNFS TG FGFGIQEHIDLGIKYDPS GI
Sbjct  63   EKIAVHVTVRGPKAEEILERGLKVKEFELKRRNFSATGNFGFGIQEHIDLGIKYDPSIGI  122

Query  368  YGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNK  213
            YGMDFYVV++RPG RVARR+  ++R+G  H++  DD ++WF+ KY+ ++LNK
Sbjct  123  YGMDFYVVMDRPGMRVARRKAQRSRIGAPHKINADDTIQWFKQKYDAIVLNK  174



>emb|CCF73368.1| unnamed protein product [Babesia microti strain RI]
Length=174

 Score =   253 bits (646),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 126/170 (74%), Positives = 148/170 (87%), Gaps = 0/170 (0%)
 Frame = -3

Query  725  KLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNE  546
            K   PMR+I+V+KLVLNI VGESGDRLTRA KVLEQL+ Q PVFSK R T+RSFG+RRNE
Sbjct  4    KEENPMRDIRVKKLVLNIGVGESGDRLTRAGKVLEQLTDQRPVFSKCRLTIRSFGVRRNE  63

Query  545  KIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIY  366
            KIAC+VTVRG KAM +LE GLKVKEYEL R+NFSDTG FGFGIQEHIDLG+KYDPSTGIY
Sbjct  64   KIACHVTVRGKKAMDILERGLKVKEYELKRKNFSDTGNFGFGIQEHIDLGLKYDPSTGIY  123

Query  365  GMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILN  216
            GMDFYV L RPGYRV +RR+CK+++G  H++TK+DAM+WF+  Y+G+I N
Sbjct  124  GMDFYVQLARPGYRVCKRRKCKSKIGASHKITKEDAMEWFKKTYDGIIFN  173



>ref|XP_004517673.1| PREDICTED: 60S ribosomal protein L11-like [Ceratitis capitata]
 ref|XP_011179475.1| PREDICTED: 60S ribosomal protein L11 [Bactrocera cucurbitae]
 ref|XP_011204287.1| PREDICTED: 60S ribosomal protein L11 [Bactrocera dorsalis]
Length=183

 Score =   253 bits (646),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 131/180 (73%), Positives = 147/180 (82%), Gaps = 5/180 (3%)
 Frame = -3

Query  740  MASEKKLN-----XPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYT  576
            MA  KK+       PMR++ ++KL LNI VGESGDRLTRAAKVLEQL+GQ PVFSKARYT
Sbjct  1    MADVKKIKRDPAKNPMRDLHIRKLCLNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYT  60

Query  575  VRSFGIRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLG  396
            VRSFGIRRNEKIA + TVRG KA ++LE GLKV+EYEL R NFS TG FGFGIQEHIDLG
Sbjct  61   VRSFGIRRNEKIAVHCTVRGAKAEEILERGLKVREYELRRDNFSATGNFGFGIQEHIDLG  120

Query  395  IKYDPSTGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILN  216
            IKYDPS GIYG+DFYVVL RPGY VA R+R    VG  HR+TK+DAMKWFQ KY+G+ILN
Sbjct  121  IKYDPSIGIYGLDFYVVLGRPGYNVAHRKRKSGTVGFPHRLTKEDAMKWFQQKYDGIILN  180



>ref|XP_005905227.1| PREDICTED: 60S ribosomal protein L11 isoform X2 [Bos mutus]
Length=177

 Score =   253 bits (646),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 122/174 (70%), Positives = 148/174 (85%), Gaps = 0/174 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MA + +   PMRE++++KL LNI VGESGDRLTRAAKVLEQL+GQTPVFSKARYTVRSFG
Sbjct  1    MADQGEKENPMRELRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIA + TV G KA ++LE GLKV+EYEL + NFSDTG FGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIAVHCTVHGAKAEEILEKGLKVREYELRKNNFSDTGNFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVIL  219
            S GIYG+DFYVVL RPG+ +A ++R    +G +HR++K++AM+WFQ KY+G+IL
Sbjct  121  SIGIYGLDFYVVLGRPGFSIADKKRRTGCIGAKHRISKEEAMRWFQQKYDGIIL  174



>ref|XP_002261116.1| 60S ribosomal protein L11a [Plasmodium knowlesi strain H]
 emb|CAQ38304.1| 60S ribosomal protein L11a, putative [Plasmodium knowlesi strain 
H]
Length=173

 Score =   253 bits (645),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 125/171 (73%), Positives = 149/171 (87%), Gaps = 0/171 (0%)
 Frame = -3

Query  731  EKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRR  552
            EKK +  MREIKV KLVLNI VGESGDRLTRAA+VLEQL+ Q P+F K R+T+RSFG+RR
Sbjct  2    EKKEDNVMREIKVNKLVLNICVGESGDRLTRAARVLEQLTEQKPIFGKCRFTIRSFGVRR  61

Query  551  NEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTG  372
            NEKI+C+VTVRG KA+++LE GLKVKEYEL ++NFS+TG FGFGIQEHIDLGIKYDPSTG
Sbjct  62   NEKISCFVTVRGKKALEILEKGLKVKEYELRKKNFSETGNFGFGIQEHIDLGIKYDPSTG  121

Query  371  IYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVIL  219
            IYGMDFYV L RPGYRV RRRR ++ +   H+VTKD+AMKWFQ K++G++L
Sbjct  122  IYGMDFYVHLSRPGYRVTRRRRKRSTISKTHKVTKDEAMKWFQTKFDGILL  172



>ref|XP_005802897.1| PREDICTED: 60S ribosomal protein L11-like [Xiphophorus maculatus]
 ref|XP_007560076.1| PREDICTED: 60S ribosomal protein L11 [Poecilia formosa]
 ref|XP_008421110.1| PREDICTED: 60S ribosomal protein L11 isoform X2 [Poecilia reticulata]
Length=178

 Score =   253 bits (645),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 126/171 (74%), Positives = 149/171 (87%), Gaps = 1/171 (1%)
 Frame = -3

Query  731  EKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRR  552
            EKK N PMRE++++KL LNI VGESGDRLTRAAKVLEQL+GQTPVFSKARYTVRSFGIRR
Sbjct  6    EKKEN-PMRELRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRSFGIRR  64

Query  551  NEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTG  372
            NEKIA + TVRG KA ++LE GLKV+EYEL + NFSDTG FGFGIQEHIDLGIKYDPS G
Sbjct  65   NEKIAVHCTVRGAKAEEILEKGLKVREYELRKNNFSDTGNFGFGIQEHIDLGIKYDPSIG  124

Query  371  IYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVIL  219
            IYG+DFYVVL RPG+ +A ++R   R+G +HR+ K++AM+WFQ KY+G+IL
Sbjct  125  IYGLDFYVVLGRPGFSIADKKRKTGRIGAKHRIRKEEAMRWFQQKYDGIIL  175



>ref|XP_002364229.1| ribosomal protein L11, putative [Toxoplasma gondii ME49]
 ref|XP_008886506.1| ribosomal protein RPL11 [Hammondia hammondi]
 gb|EPR60830.1| ribosomal protein RPL11 [Toxoplasma gondii GT1]
 gb|EPT26257.1| ribosomal protein RPL11 [Toxoplasma gondii ME49]
 gb|ESS34785.1| ribosomal protein RPL11 [Toxoplasma gondii VEG]
 gb|KEP62834.1| ribosomal protein RPL11 [Hammondia hammondi]
 gb|KFG40694.1| ribosomal protein RPL11 [Toxoplasma gondii p89]
 gb|KFG44652.1| ribosomal protein RPL11 [Toxoplasma gondii GAB2-2007-GAL-DOM2]
 gb|KFG55747.1| ribosomal protein RPL11 [Toxoplasma gondii FOU]
 gb|KFG57814.1| ribosomal protein RPL11 [Toxoplasma gondii RUB]
 gb|KFH02476.1| ribosomal protein RPL11 [Toxoplasma gondii VAND]
 gb|KFH13023.1| ribosomal protein RPL11 [Toxoplasma gondii MAS]
Length=175

 Score =   253 bits (645),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 126/166 (76%), Positives = 146/166 (88%), Gaps = 0/166 (0%)
 Frame = -3

Query  713  PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIAC  534
            PMR+I+++KL LNI VGESGDRLTRAA+VLEQL+GQ P FSKAR+T+RSFGIRRNEKIAC
Sbjct  9    PMRKIRIEKLTLNICVGESGDRLTRAARVLEQLTGQRPQFSKARFTIRSFGIRRNEKIAC  68

Query  533  YVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDF  354
            YVTVRG KA  +LE GLKVKEYEL ++NFSD+G FGFGIQEHIDLGIKYDPSTGIYGMDF
Sbjct  69   YVTVRGKKAEDILEKGLKVKEYELKKKNFSDSGNFGFGIQEHIDLGIKYDPSTGIYGMDF  128

Query  353  YVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILN  216
            YV L RPG RVA R+R + RVG  HRVTK+D++KWFQ  Y+G++LN
Sbjct  129  YVQLTRPGNRVAHRKRARGRVGHSHRVTKEDSIKWFQQTYDGIVLN  174



>ref|XP_007175169.1| PREDICTED: 60S ribosomal protein L11 isoform X2 [Balaenoptera 
acutorostrata scammoni]
Length=177

 Score =   253 bits (645),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 122/174 (70%), Positives = 148/174 (85%), Gaps = 0/174 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            M  + +   PMRE++++KL LNI VGESGDRLTRAAKVLEQL+GQTPVFSKARYTVRSFG
Sbjct  1    MQDQGEKENPMRELRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIA + TVRG KA ++LE GLKV+EYEL + NFSDTG FGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIAVHCTVRGAKAEEILEKGLKVREYELRKNNFSDTGNFGFGIQEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVIL  219
            S GIYG+DFYVVL RPG+ +A ++R    +G +HR++K++AM+WFQ KY+G+IL
Sbjct  121  SIGIYGLDFYVVLGRPGFSIADKKRRTGCIGAKHRISKEEAMRWFQQKYDGIIL  174



>ref|XP_010743989.1| PREDICTED: 60S ribosomal protein L11 isoform X1 [Larimichthys 
crocea]
Length=182

 Score =   253 bits (645),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 126/171 (74%), Positives = 149/171 (87%), Gaps = 1/171 (1%)
 Frame = -3

Query  731  EKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRR  552
            EKK N PMRE++++KL LNI VGESGDRLTRAAKVLEQL+GQTPVFSKARYTVRSFGIRR
Sbjct  10   EKKEN-PMRELRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRSFGIRR  68

Query  551  NEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTG  372
            NEKIA + TVRG KA ++LE GLKV+EYEL + NFSDTG FGFGIQEHIDLGIKYDPS G
Sbjct  69   NEKIAVHCTVRGAKAEEILEKGLKVREYELRKNNFSDTGNFGFGIQEHIDLGIKYDPSIG  128

Query  371  IYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVIL  219
            IYG+DFYVVL RPG+ +A ++R   R+G +HR+ K++AM+WFQ KY+G+IL
Sbjct  129  IYGLDFYVVLGRPGFSIADKKRKTGRIGFRHRIRKEEAMRWFQQKYDGIIL  179



>ref|XP_010898594.1| PREDICTED: 60S ribosomal protein L11 isoform X1 [Esox lucius]
Length=178

 Score =   253 bits (645),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 125/171 (73%), Positives = 149/171 (87%), Gaps = 1/171 (1%)
 Frame = -3

Query  731  EKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRR  552
            EKK N PMRE++++KL LNI VGESGDRLTRAAKVLEQL+GQTPVFSKARYTVRSFGIRR
Sbjct  6    EKKEN-PMRELRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRSFGIRR  64

Query  551  NEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTG  372
            NEKIA + TVRG KA ++LE GLKV+EYEL + NFSDTG FGFGIQEHIDLGIKYDPS G
Sbjct  65   NEKIAVHCTVRGAKAEEILEKGLKVREYELRKNNFSDTGNFGFGIQEHIDLGIKYDPSIG  124

Query  371  IYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVIL  219
            IYG+DFYVVL RPG+ +A +++   R+G +HR+ K++AM+WFQ KY+G+IL
Sbjct  125  IYGLDFYVVLGRPGFSIADKKQKTGRIGFRHRIRKEEAMRWFQQKYDGIIL  175



>ref|XP_008329249.1| PREDICTED: 60S ribosomal protein L11 [Cynoglossus semilaevis]
Length=178

 Score =   253 bits (645),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 126/171 (74%), Positives = 150/171 (88%), Gaps = 1/171 (1%)
 Frame = -3

Query  731  EKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRR  552
            EKK N PMRE++++KL LNI VGESGDRLTRAAKVLEQL+GQTPVFSKARYTVRSFGIRR
Sbjct  6    EKKEN-PMRELRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRSFGIRR  64

Query  551  NEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTG  372
            NEKIA + TVRG KA ++LE GLKV+EYEL + NFSDTG FGFGIQEHIDLGIKYDPS G
Sbjct  65   NEKIAVHCTVRGAKAEEILEKGLKVREYELRKNNFSDTGNFGFGIQEHIDLGIKYDPSIG  124

Query  371  IYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVIL  219
            IYG+DFYVVL RPG+ +A ++R + R+G +HR+ K++AM+WFQ KY+G+IL
Sbjct  125  IYGLDFYVVLGRPGFSIADKKRKRGRIGFKHRIRKEEAMRWFQQKYDGIIL  175



>ref|XP_003227609.1| PREDICTED: 60S ribosomal protein L11 [Anolis carolinensis]
Length=179

 Score =   253 bits (645),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 123/176 (70%), Positives = 151/176 (86%), Gaps = 2/176 (1%)
 Frame = -3

Query  740  MASEKKLN--XPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRS  567
            MA ++++    PMRE++++KL LNI VGESGDRLTRAAKVLEQL+GQTPVFSKARYTVRS
Sbjct  1    MAQQEQVEKENPMRELRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRS  60

Query  566  FGIRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKY  387
            FGIRRNEKIA + TVRG KA ++LE GLKV+EYEL + NFSDTG FGFGIQEHIDLGIKY
Sbjct  61   FGIRRNEKIAVHCTVRGAKAEEILEKGLKVREYELRKNNFSDTGNFGFGIQEHIDLGIKY  120

Query  386  DPSTGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVIL  219
            DPS GIYG+DFYVVL RPG+ +A ++R    +G +HR++K++AM+WFQ KY+G+IL
Sbjct  121  DPSIGIYGLDFYVVLGRPGFSIADKKRRTGSIGAKHRISKEEAMRWFQQKYDGIIL  176



>ref|XP_008291103.1| PREDICTED: 60S ribosomal protein L11 [Stegastes partitus]
 dbj|BAF98658.1| ribosomal protein L11 [Solea senegalensis]
Length=178

 Score =   253 bits (645),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 126/171 (74%), Positives = 150/171 (88%), Gaps = 1/171 (1%)
 Frame = -3

Query  731  EKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRR  552
            EKK N PMRE++++KL LNI VGESGDRLTRAAKVLEQL+GQTPVFSKARYTVRSFGIRR
Sbjct  6    EKKEN-PMRELRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRSFGIRR  64

Query  551  NEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTG  372
            NEKIA + TVRG KA ++LE GLKV+EYEL + NFSDTG FGFGIQEHIDLGIKYDPS G
Sbjct  65   NEKIAVHCTVRGAKAEEILEKGLKVREYELRKNNFSDTGNFGFGIQEHIDLGIKYDPSIG  124

Query  371  IYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVIL  219
            IYG+DFYVVL RPG+ +A ++R + R+G +HR+ K++AM+WFQ KY+G+IL
Sbjct  125  IYGLDFYVVLGRPGFSIADKKRKRGRIGFRHRIRKEEAMRWFQQKYDGIIL  175



>ref|XP_006019455.1| PREDICTED: 60S ribosomal protein L11 [Alligator sinensis]
Length=190

 Score =   253 bits (646),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 126/180 (70%), Positives = 150/180 (83%), Gaps = 1/180 (1%)
 Frame = -3

Query  758  LQQ*SDMASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARY  579
            LQ  S     +K N PMRE++++KL LNI VGESGDRLTRAAKVLEQL+GQTPVFSKARY
Sbjct  9    LQNHSQQDQSEKEN-PMRELRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARY  67

Query  578  TVRSFGIRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDL  399
            TVRSFGIRRNEKIA + TVRG KA ++LE GLKV+EYEL + NFSDTG FGFGIQEHIDL
Sbjct  68   TVRSFGIRRNEKIAVHCTVRGAKAEEILEKGLKVREYELRKNNFSDTGNFGFGIQEHIDL  127

Query  398  GIKYDPSTGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVIL  219
            GIKYDPS GIYG+DFYVVL RPG+ +A ++R    +G +HR+ K++AM+WFQ KY+G+IL
Sbjct  128  GIKYDPSIGIYGLDFYVVLGRPGFSIADKKRKTGSIGAKHRIGKEEAMRWFQQKYDGIIL  187



>gb|ABW06869.1| ribosomal protein L11, partial [Perca flavescens]
Length=177

 Score =   252 bits (644),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 126/171 (74%), Positives = 150/171 (88%), Gaps = 1/171 (1%)
 Frame = -3

Query  731  EKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRR  552
            EKK N PMRE++++KL LNI VGESGDRLTRAAKVLEQL+GQTPVFSKARYTVRSFGIRR
Sbjct  5    EKKEN-PMRELRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRSFGIRR  63

Query  551  NEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTG  372
            NEKIA + TVRG KA ++LE GLKV+EYEL + NFSDTG FGFGIQEHIDLGIKYDPS G
Sbjct  64   NEKIAVHCTVRGAKAEEILEKGLKVREYELRKNNFSDTGNFGFGIQEHIDLGIKYDPSIG  123

Query  371  IYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVIL  219
            IYG+DFYVVL RPG+ +A ++R + R+G +HR+ K++AM+WFQ KY+G+IL
Sbjct  124  IYGLDFYVVLGRPGFSIADKKRKRGRIGFRHRIRKEEAMRWFQQKYDGIIL  174



>ref|XP_001863416.1| ribosomal protein L11 [Culex quinquefasciatus]
 gb|EDS38543.1| ribosomal protein L11 [Culex quinquefasciatus]
Length=183

 Score =   253 bits (645),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 128/180 (71%), Positives = 150/180 (83%), Gaps = 0/180 (0%)
 Frame = -3

Query  746  SDMASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRS  567
            +  A + K    MR+++++KL LNI VGESGDRLTRAAKVLEQL+GQTPV+SKARYTVRS
Sbjct  3    TKTAGKDKSKNIMRDLRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVYSKARYTVRS  62

Query  566  FGIRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKY  387
            FGIRRNEKIA + TVRG KA ++LE GLKV+EYEL R NFS TG FGFGIQEHIDLGIKY
Sbjct  63   FGIRRNEKIAVHCTVRGAKAEEILERGLKVREYELRRDNFSQTGNFGFGIQEHIDLGIKY  122

Query  386  DPSTGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNKAS  207
            DPS GIYG+DFYVVL RPGY VA+RRR   ++G  HR+TK+DAMKWFQ KY+G+ILN  +
Sbjct  123  DPSIGIYGLDFYVVLGRPGYNVAQRRRKTGKIGFIHRLTKEDAMKWFQQKYDGIILNSKA  182



>emb|CDS05445.1| Putative 60S ribosomal protein L11 [Absidia idahoensis var. thermophila]
Length=177

 Score =   252 bits (644),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 125/177 (71%), Positives = 157/177 (89%), Gaps = 1/177 (1%)
 Frame = -3

Query  740  MASEKKLNX-PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSF  564
            M++EK++   PMR++K++KLVLNISVGESGDRLTRAAKVLEQL+GQTPV+SKARYTVR+F
Sbjct  1    MSAEKQVKKNPMRQLKIEKLVLNISVGESGDRLTRAAKVLEQLTGQTPVYSKARYTVRTF  60

Query  563  GIRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYD  384
            GIRRNEKIA +VTVRG KA ++LE GLKVKEYEL  RNFS+TG FGFGI EHIDLGIKYD
Sbjct  61   GIRRNEKIAVHVTVRGPKAEEILERGLKVKEYELRARNFSETGNFGFGIDEHIDLGIKYD  120

Query  383  PSTGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNK  213
            PS GIYGMD++VV+ RPGYRVARR++ K+ VG  HR+ K++ ++WF+ +++G++LNK
Sbjct  121  PSIGIYGMDYFVVMGRPGYRVARRKQQKSTVGFNHRIKKEETVEWFKNRFDGIVLNK  177



>ref|XP_002018508.1| GL17744 [Drosophila persimilis]
 ref|XP_002136629.1| GA27684 [Drosophila pseudoobscura pseudoobscura]
 gb|EDW36347.1| GL17744 [Drosophila persimilis]
 gb|EDY71633.1| GA27684 [Drosophila pseudoobscura pseudoobscura]
Length=188

 Score =   253 bits (645),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 126/166 (76%), Positives = 141/166 (85%), Gaps = 0/166 (0%)
 Frame = -3

Query  713  PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIAC  534
            PMR++ ++KL LNI VGESGDRLTRAAKVLEQL+GQ PVFSKARYTVRSFGIRRNEKIA 
Sbjct  19   PMRDLHIRKLCLNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTVRSFGIRRNEKIAV  78

Query  533  YVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDF  354
            + TVRG KA ++LE GLKV+EYEL R NFS TG FGFGIQEHIDLGIKYDPS GIYG+DF
Sbjct  79   HCTVRGAKAEEILERGLKVREYELRRDNFSSTGNFGFGIQEHIDLGIKYDPSIGIYGLDF  138

Query  353  YVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILN  216
            YVVL RPGY V  R+R    VG  HR+TK+DAMKWFQ KY+G+ILN
Sbjct  139  YVVLGRPGYNVNHRKRKSGTVGFPHRLTKEDAMKWFQQKYDGIILN  184



>ref|XP_003968865.1| PREDICTED: 60S ribosomal protein L11-like [Takifugu rubripes]
 emb|CAF89662.1| unnamed protein product [Tetraodon nigroviridis]
Length=178

 Score =   252 bits (644),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 125/171 (73%), Positives = 148/171 (87%), Gaps = 1/171 (1%)
 Frame = -3

Query  731  EKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRR  552
            EKK N PMRE++++KL LNI VGESGDRLTRAAKVLEQL+GQTPVFSKARYTVRSFGIRR
Sbjct  6    EKKEN-PMRELRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRSFGIRR  64

Query  551  NEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTG  372
            NEKIA + TVRG KA ++LE GLKV+EYEL + NFSDTG FGFGIQEHIDLGIKYDPS G
Sbjct  65   NEKIAVHCTVRGAKAEEILEKGLKVREYELRKNNFSDTGNFGFGIQEHIDLGIKYDPSIG  124

Query  371  IYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVIL  219
            IYG+DFYVVL RPG+ +  ++R   R+G +HR+ K++AM+WFQ KY+G+IL
Sbjct  125  IYGLDFYVVLGRPGFSITDKKRKTGRIGFRHRIRKEEAMRWFQQKYDGIIL  175



>gb|EPY49528.1| 60S ribosomal protein L11 [Schizosaccharomyces cryophilus OY26]
Length=174

 Score =   252 bits (644),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 124/172 (72%), Positives = 147/172 (85%), Gaps = 0/172 (0%)
 Frame = -3

Query  728  KKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRN  549
            +K   PM+E+++ KLVLNIS+GESGDRLTRAAKVLEQLSGQTPVFSKARYT+R FGIRRN
Sbjct  3    EKAQNPMKELRISKLVLNISLGESGDRLTRAAKVLEQLSGQTPVFSKARYTIRRFGIRRN  62

Query  548  EKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGI  369
            EKI+C+VTVRG KA ++LE GLKVKEYEL RRNFS TG FGFGIQEHIDLGIKYDPS GI
Sbjct  63   EKISCHVTVRGPKAEEILERGLKVKEYELKRRNFSATGNFGFGIQEHIDLGIKYDPSIGI  122

Query  368  YGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILNK  213
            YGMDFYVV++RPG RV RR+  ++R+G  H++T  D + WF+ KY+ V+L K
Sbjct  123  YGMDFYVVMDRPGMRVTRRKAQRSRIGFPHKITPGDTINWFKQKYDAVVLEK  174



>ref|XP_005875279.1| PREDICTED: LOW QUALITY PROTEIN: ribosomal protein L11 [Myotis 
brandtii]
Length=177

 Score =   252 bits (644),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 122/174 (70%), Positives = 148/174 (85%), Gaps = 0/174 (0%)
 Frame = -3

Query  740  MASEKKLNXPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  561
            MA + +   PMRE++++KL LNI VGESGDRLTRAAKVLEQL+GQTPVFSKARYTVRSFG
Sbjct  1    MADQGEKENPMRELRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRSFG  60

Query  560  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  381
            IRRNEKIA + TVRG KA ++LE GLKV+EYEL + NFSDTG FGFGI EHIDLGIKYDP
Sbjct  61   IRRNEKIAVHCTVRGAKAEEILEKGLKVREYELRKNNFSDTGNFGFGIXEHIDLGIKYDP  120

Query  380  STGIYGMDFYVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVIL  219
            S GIYG+DFYVVL RPG+ +A ++R    +G +HR++K++AM+WFQ KY+G+IL
Sbjct  121  SIGIYGLDFYVVLGRPGFSIADKKRRTGCIGAKHRISKEEAMRWFQQKYDGIIL  174



>ref|XP_005187420.1| PREDICTED: 60S ribosomal protein L11 [Musca domestica]
Length=187

 Score =   253 bits (645),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 142/166 (86%), Gaps = 0/166 (0%)
 Frame = -3

Query  713  PMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIAC  534
            PMR++ ++KL LNI VGESGDRLTRAAKVLEQL+GQ PVFSKARYTVRSFGIRRNEKIA 
Sbjct  19   PMRDLHIRKLCLNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTVRSFGIRRNEKIAV  78

Query  533  YVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDF  354
            + TVRG KA ++LE GLKV+EYEL R NFS TG FGFGIQEHIDLGIKYDPS GIYG+DF
Sbjct  79   HCTVRGAKAEEILEKGLKVREYELRRDNFSATGNFGFGIQEHIDLGIKYDPSIGIYGLDF  138

Query  353  YVVLERPGYrvarrrrckarVGIQHRVTKDDAMKWFQVKYEGVILN  216
            YVVL RPGY VA R+R    VG  HR+TK+DAMKWFQ KY+G+ILN
Sbjct  139  YVVLGRPGYNVAHRKRKAGTVGFPHRLTKEDAMKWFQQKYDGIILN  184



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1481068694310