BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF028L23

Length=704
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP07923.1|  unnamed protein product                                260   1e-80   Coffea canephora [robusta coffee]
ref|XP_004160525.1|  PREDICTED: UBX domain-containing protein 2-like    252   2e-79   
ref|XP_010270774.1|  PREDICTED: UBX domain-containing protein 2 i...    256   5e-79   Nelumbo nucifera [Indian lotus]
ref|XP_004140414.1|  PREDICTED: UBX domain-containing protein 7-like    253   5e-78   Cucumis sativus [cucumbers]
ref|XP_008456878.1|  PREDICTED: UBX domain-containing protein 2         253   6e-78   
ref|XP_010270775.1|  PREDICTED: UBX domain-containing protein 2 i...    252   9e-78   Nelumbo nucifera [Indian lotus]
ref|XP_010270773.1|  PREDICTED: UBX domain-containing protein 2 i...    252   1e-77   Nelumbo nucifera [Indian lotus]
ref|XP_009775836.1|  PREDICTED: UBX domain-containing protein 2         251   4e-77   Nicotiana sylvestris
ref|XP_009587838.1|  PREDICTED: UBX domain-containing protein 2         250   8e-77   Nicotiana tomentosiformis
ref|XP_011070500.1|  PREDICTED: UBX domain-containing protein 2         250   1e-76   Sesamum indicum [beniseed]
ref|XP_006355016.1|  PREDICTED: UBX domain-containing protein 2-like    249   4e-76   Solanum tuberosum [potatoes]
ref|XP_007222574.1|  hypothetical protein PRUPE_ppa008429mg             242   6e-75   
ref|XP_008220984.1|  PREDICTED: UBX domain-containing protein 2 i...    245   8e-75   Prunus mume [ume]
ref|XP_004236895.1|  PREDICTED: UBX domain-containing protein 2         244   4e-74   Solanum lycopersicum
ref|XP_008220982.1|  PREDICTED: UBX domain-containing protein 2 i...    243   6e-74   Prunus mume [ume]
gb|KHG06883.1|  UBX domain-containing 7                                 243   6e-74   Gossypium arboreum [tree cotton]
gb|KJB30690.1|  hypothetical protein B456_005G158000                    243   9e-74   Gossypium raimondii
ref|XP_007045358.1|  UBX domain-containing protein isoform 3            241   2e-73   
ref|XP_010088526.1|  UBX domain-containing protein 2                    242   4e-73   Morus notabilis
gb|KJB30689.1|  hypothetical protein B456_005G158000                    239   7e-73   Gossypium raimondii
gb|KDP38216.1|  hypothetical protein JCGZ_04859                         240   8e-73   Jatropha curcas
gb|KJB30687.1|  hypothetical protein B456_005G158000                    240   1e-72   Gossypium raimondii
gb|KDO53546.1|  hypothetical protein CISIN_1g013325mg                   233   2e-72   Citrus sinensis [apfelsine]
ref|XP_007045357.1|  UBX domain-containing protein isoform 2            239   3e-72   
ref|XP_007045359.1|  UBX domain-containing protein isoform 4            238   3e-72   
ref|XP_007045356.1|  UBX domain-containing protein isoform 1            239   4e-72   
ref|XP_006470883.1|  PREDICTED: UBX domain-containing protein 2-like    237   8e-72   Citrus sinensis [apfelsine]
ref|XP_003531952.1|  PREDICTED: UBX domain-containing protein 7-l...    238   9e-72   Glycine max [soybeans]
gb|KDO53545.1|  hypothetical protein CISIN_1g013325mg                   233   2e-71   Citrus sinensis [apfelsine]
ref|XP_010680042.1|  PREDICTED: UBX domain-containing protein 2         236   4e-71   Beta vulgaris subsp. vulgaris [field beet]
gb|EYU30237.1|  hypothetical protein MIMGU_mgv1a006061mg                234   1e-70   Erythranthe guttata [common monkey flower]
gb|EYU30238.1|  hypothetical protein MIMGU_mgv1a006061mg                234   1e-70   Erythranthe guttata [common monkey flower]
gb|EYU30239.1|  hypothetical protein MIMGU_mgv1a006061mg                234   1e-70   Erythranthe guttata [common monkey flower]
gb|KDO53544.1|  hypothetical protein CISIN_1g013325mg                   234   1e-70   Citrus sinensis [apfelsine]
gb|KDO53543.1|  hypothetical protein CISIN_1g013325mg                   234   1e-70   Citrus sinensis [apfelsine]
ref|XP_002521873.1|  UBX domain-containing protein, putative            232   1e-69   
gb|KHN06997.1|  UBX domain-containing protein 7                         233   1e-69   Glycine soja [wild soybean]
ref|XP_003547850.1|  PREDICTED: UBX domain-containing protein 7-l...    232   2e-69   Glycine max [soybeans]
ref|XP_007156392.1|  hypothetical protein PHAVU_003G282600g             229   1e-68   Phaseolus vulgaris [French bean]
ref|XP_004509607.1|  PREDICTED: UBX domain-containing protein 7-like    229   1e-68   Cicer arietinum [garbanzo]
ref|XP_011025166.1|  PREDICTED: UBX domain-containing protein 7-like    226   2e-67   Populus euphratica
ref|XP_006855568.1|  hypothetical protein AMTR_s00044p00018360          224   5e-67   Amborella trichopoda
ref|XP_002311564.2|  hypothetical protein POPTR_0008s14230g             225   5e-67   
ref|XP_010654914.1|  PREDICTED: UBX domain-containing protein 2 i...    225   5e-67   Vitis vinifera
ref|XP_003631347.1|  PREDICTED: UBX domain-containing protein 2 i...    224   8e-67   Vitis vinifera
ref|XP_010654910.1|  PREDICTED: UBX domain-containing protein 2 i...    224   9e-67   Vitis vinifera
ref|XP_011463491.1|  PREDICTED: UBX domain-containing protein 2 i...    225   1e-66   Fragaria vesca subsp. vesca
ref|XP_004297788.1|  PREDICTED: UBX domain-containing protein 2 i...    224   2e-66   Fragaria vesca subsp. vesca
gb|EYU30240.1|  hypothetical protein MIMGU_mgv1a006061mg                223   3e-66   Erythranthe guttata [common monkey flower]
ref|XP_003628976.1|  UBX domain-containing protein                      222   9e-66   Medicago truncatula
ref|XP_009351644.1|  PREDICTED: UBX domain-containing protein 2 i...    221   1e-65   Pyrus x bretschneideri [bai li]
ref|XP_010527852.1|  PREDICTED: UBX domain-containing protein 2 i...    219   4e-65   Tarenaya hassleriana [spider flower]
ref|XP_008389122.1|  PREDICTED: UBX domain-containing protein 2-l...    219   8e-65   Malus domestica [apple tree]
ref|XP_010527851.1|  PREDICTED: UBX domain-containing protein 2 i...    219   8e-65   Tarenaya hassleriana [spider flower]
ref|XP_010554359.1|  PREDICTED: UBX domain-containing protein 2-like    219   9e-65   Tarenaya hassleriana [spider flower]
ref|XP_009351643.1|  PREDICTED: UBX domain-containing protein 2 i...    218   2e-64   Pyrus x bretschneideri [bai li]
ref|XP_006378421.1|  hypothetical protein POPTR_0010s10910g             218   2e-64   
ref|XP_002315828.1|  UBX domain-containing family protein               218   3e-64   
ref|XP_009351642.1|  PREDICTED: UBX domain-containing protein 2 i...    217   7e-64   Pyrus x bretschneideri [bai li]
ref|XP_008389121.1|  PREDICTED: UBX domain-containing protein 2-l...    216   1e-63   Malus domestica [apple tree]
ref|XP_008389120.1|  PREDICTED: UBX domain-containing protein 2-l...    215   2e-63   Malus domestica [apple tree]
ref|XP_007052064.1|  UBX domain-containing protein                      214   4e-63   
ref|XP_010043889.1|  PREDICTED: UBX domain-containing protein 2 i...    213   1e-62   Eucalyptus grandis [rose gum]
ref|XP_010043888.1|  PREDICTED: UBX domain-containing protein 2 i...    213   3e-62   Eucalyptus grandis [rose gum]
ref|XP_011021683.1|  PREDICTED: UBX domain-containing protein 2-like    212   4e-62   Populus euphratica
gb|AFK35082.1|  unknown                                                 203   1e-61   Medicago truncatula
ref|XP_008804300.1|  PREDICTED: UBX domain-containing protein 7         210   3e-61   Phoenix dactylifera
emb|CDY69105.1|  BnaCnng61890D                                          208   1e-60   Brassica napus [oilseed rape]
ref|XP_010935374.1|  PREDICTED: UBX domain-containing protein 2 i...    208   1e-60   Elaeis guineensis
emb|CDY45269.1|  BnaA06g09390D                                          206   1e-59   Brassica napus [oilseed rape]
ref|XP_006307428.1|  hypothetical protein CARUB_v10009052mg             205   3e-59   Capsella rubella
gb|EPS73806.1|  hypothetical protein M569_00949                         204   3e-59   Genlisea aurea
ref|XP_002890064.1|  UBX domain-containing protein                      205   4e-59   Arabidopsis lyrata subsp. lyrata
ref|NP_001077535.1|  UBX domain-containing protein                      202   3e-58   Arabidopsis thaliana [mouse-ear cress]
emb|CDY68911.1|  BnaAnng28760D                                          200   4e-58   Brassica napus [oilseed rape]
ref|NP_563954.1|  UBX domain-containing protein                         201   7e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010458959.1|  PREDICTED: UBX domain-containing protein 2-like    201   8e-58   Camelina sativa [gold-of-pleasure]
ref|XP_010496241.1|  PREDICTED: UBX domain-containing protein 2-like    201   8e-58   Camelina sativa [gold-of-pleasure]
ref|XP_009148836.1|  PREDICTED: UBX domain-containing protein 2         201   1e-57   Brassica rapa
ref|XP_006416998.1|  hypothetical protein EUTSA_v10007578mg             199   5e-57   Eutrema salsugineum [saltwater cress]
emb|CDX84023.1|  BnaC08g16220D                                          199   6e-57   
ref|XP_009110537.1|  PREDICTED: UBX domain-containing protein 2-like    198   9e-57   Brassica rapa
gb|AAF63167.1|AC010657_3  T5E21.7                                       199   1e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010476513.1|  PREDICTED: UBX domain-containing protein 2-like    197   2e-56   Camelina sativa [gold-of-pleasure]
ref|XP_009599661.1|  PREDICTED: UBX domain-containing protein 7 h...    192   2e-55   Nicotiana tomentosiformis
ref|XP_010253434.1|  PREDICTED: UBX domain-containing protein 7-like    191   5e-55   Nelumbo nucifera [Indian lotus]
ref|XP_009401234.1|  PREDICTED: UBX domain-containing protein 2         192   8e-55   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009759130.1|  PREDICTED: UBX domain-containing protein 7-like    190   2e-54   Nicotiana sylvestris
ref|NP_001054216.1|  Os04g0670800                                       182   8e-52   
ref|XP_006653862.1|  PREDICTED: UBX domain-containing protein 2-like    182   3e-51   
ref|XP_008801336.1|  PREDICTED: UBX domain-containing protein 2-like    181   4e-51   
gb|AEV40978.1|  putative UBX domain-containing protein                  184   4e-51   Oryza punctata
gb|AEV41122.1|  putative UBX domain-containing protein                  183   5e-51   Oryza officinalis
gb|AIE88273.1|  hypothetical protein OG_BBa0063K01.4                    184   9e-51   Oryza glaberrima
emb|CAE02831.2|  OSJNBa0043A12.36                                       182   2e-50   Oryza sativa Japonica Group [Japonica rice]
gb|AEV41029.1|  putative UBX domain-containing protein                  180   7e-50   Oryza minuta
gb|AEV41076.1|  putative UBX domain-containing protein                  178   1e-49   Oryza minuta
ref|XP_004960126.1|  PREDICTED: UBX domain-containing protein 2-like    177   7e-49   Setaria italica
ref|XP_002447303.1|  hypothetical protein SORBIDRAFT_06g032400          177   1e-48   Sorghum bicolor [broomcorn]
ref|XP_003580790.1|  PREDICTED: UBX domain-containing protein 2 i...    176   2e-48   Brachypodium distachyon [annual false brome]
ref|XP_010325366.1|  PREDICTED: LOW QUALITY PROTEIN: UBX domain-c...    173   6e-48   
gb|EMT10976.1|  hypothetical protein F775_30110                         172   3e-47   
ref|NP_001170636.1|  uncharacterized protein LOC100384688               172   1e-46   Zea mays [maize]
dbj|BAK05667.1|  predicted protein                                      171   1e-46   Hordeum vulgare subsp. vulgare [two-rowed barley]
tpg|DAA35438.1|  TPA: hypothetical protein ZEAMMB73_856149              169   4e-46   
tpg|DAA35439.1|  TPA: hypothetical protein ZEAMMB73_856149              170   6e-46   
ref|XP_010935375.1|  PREDICTED: UBX domain-containing protein 5 i...    167   2e-45   
ref|XP_008668717.1|  PREDICTED: UBX domain-containing protein 2-like    169   2e-45   
gb|EMS63720.1|  UBX domain-containing protein 7                         167   4e-45   Triticum urartu
ref|XP_006343881.1|  PREDICTED: UBX domain-containing protein 7-like    165   1e-44   Solanum tuberosum [potatoes]
ref|XP_010519525.1|  PREDICTED: UBX domain-containing protein 2-like    162   2e-44   Tarenaya hassleriana [spider flower]
ref|XP_006414754.1|  hypothetical protein EUTSA_v10027144mg             163   5e-44   
ref|XP_009398016.1|  PREDICTED: UBX domain-containing protein 2-like    160   1e-42   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002868299.1|  predicted protein                                  163   1e-42   
gb|KJB30688.1|  hypothetical protein B456_005G158000                    159   3e-42   Gossypium raimondii
ref|XP_010450084.1|  PREDICTED: UBX domain-containing protein 7-like    157   7e-42   Camelina sativa [gold-of-pleasure]
ref|XP_010519462.1|  PREDICTED: UBX domain-containing protein 2-like    156   1e-41   Tarenaya hassleriana [spider flower]
ref|NP_193161.3|  UBX domain-containing pseudogene                      159   6e-41   
ref|NP_001190727.1|  UBX domain-containing pseudogene                   159   7e-41   
emb|CAB10204.1|  hypothetical protein                                   158   9e-41   Arabidopsis thaliana [mouse-ear cress]
gb|EYU24728.1|  hypothetical protein MIMGU_mgv1a025994mg                152   1e-40   Erythranthe guttata [common monkey flower]
emb|CDY12748.1|  BnaC04g28930D                                          152   4e-40   Brassica napus [oilseed rape]
ref|XP_009139539.1|  PREDICTED: UBX domain-containing protein 2-like    152   6e-40   Brassica rapa
ref|XP_001758899.1|  predicted protein                                  153   7e-40   
ref|XP_006285858.1|  hypothetical protein CARUB_v10007353mg             150   2e-39   
ref|XP_006470475.1|  PREDICTED: UBX domain-containing protein 7-like    150   5e-39   
emb|CDY01207.1|  BnaA04g06120D                                          153   1e-38   
ref|XP_009139538.1|  PREDICTED: UBX domain-containing protein 2         149   2e-38   Brassica rapa
ref|XP_010490003.1|  PREDICTED: UBX domain-containing protein 2-like    145   5e-38   
gb|KFK22408.1|  hypothetical protein AALP_AAs65522U000100               147   6e-38   Arabis alpina [alpine rockcress]
ref|XP_010436606.1|  PREDICTED: UBX domain-containing protein 2-like    145   1e-37   
emb|CDY12747.1|  BnaC04g28940D                                          146   1e-37   Brassica napus [oilseed rape]
gb|AGH62811.1|  UBX1                                                    145   2e-37   Brassica napus [oilseed rape]
gb|EEE61882.1|  hypothetical protein OsJ_16574                          146   2e-37   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006446591.1|  hypothetical protein CICLE_v10017670mg             144   7e-37   Citrus clementina [clementine]
ref|XP_009139540.1|  PREDICTED: UBX domain-containing protein 7-like    142   3e-36   Brassica rapa
ref|XP_006414812.1|  hypothetical protein EUTSA_v10027208mg             140   1e-35   
ref|NP_176165.1|  pseudo                                                137   8e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002886675.1|  predicted protein                                  133   1e-33   
emb|CDY01206.1|  BnaA04g06130D                                          132   3e-32   
ref|XP_002883438.1|  hypothetical protein ARALYDRAFT_898874             125   4e-32   
gb|KFK22146.1|  hypothetical protein AALP_AAs62910U000300               131   5e-32   Arabis alpina [alpine rockcress]
ref|XP_006414811.1|  hypothetical protein EUTSA_v10027532mg             131   6e-32   
ref|XP_010436605.1|  PREDICTED: uncharacterized protein LOC104720396    128   2e-31   Camelina sativa [gold-of-pleasure]
gb|AAF79774.1|AC009317_33  T30E16.10                                    127   2e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010445452.1|  PREDICTED: UBX domain-containing protein 7         128   6e-31   Camelina sativa [gold-of-pleasure]
emb|CDY12746.1|  BnaC04g28950D                                          127   1e-30   Brassica napus [oilseed rape]
gb|KFK39659.1|  hypothetical protein AALP_AA3G272700                    120   3e-30   Arabis alpina [alpine rockcress]
ref|XP_010450078.1|  PREDICTED: UBX domain-containing protein 2-like    125   7e-30   Camelina sativa [gold-of-pleasure]
ref|XP_006406007.1|  hypothetical protein EUTSA_v10021701mg             119   8e-30   Eutrema salsugineum [saltwater cress]
ref|XP_006285935.1|  hypothetical protein CARUB_v10007447mg             124   1e-29   
ref|XP_006296631.1|  hypothetical protein CARUB_v10014834mg             117   5e-29   Capsella rubella
ref|XP_010466708.1|  PREDICTED: uncharacterized protein LOC104746864    117   9e-29   Camelina sativa [gold-of-pleasure]
ref|XP_010514980.1|  PREDICTED: uncharacterized protein LOC104790878    117   9e-29   Camelina sativa [gold-of-pleasure]
ref|XP_010488437.1|  PREDICTED: uncharacterized protein LOC104766...    117   1e-28   Camelina sativa [gold-of-pleasure]
ref|XP_010488435.1|  PREDICTED: uncharacterized protein LOC104766...    117   1e-28   Camelina sativa [gold-of-pleasure]
ref|XP_010488436.1|  PREDICTED: uncharacterized protein LOC104766...    115   3e-28   Camelina sativa [gold-of-pleasure]
ref|XP_009136068.1|  PREDICTED: uncharacterized protein LOC103860231    114   1e-27   Brassica rapa
emb|CDY50464.1|  BnaCnng19430D                                          112   5e-27   Brassica napus [oilseed rape]
ref|XP_009106587.1|  PREDICTED: uncharacterized protein LOC103832346    112   5e-27   Brassica rapa
ref|XP_006414759.1|  hypothetical protein EUTSA_v10027233mg             117   6e-27   
ref|XP_010512639.1|  PREDICTED: UBX domain-containing protein 1-like    112   6e-27   Camelina sativa [gold-of-pleasure]
emb|CDY18108.1|  BnaA01g23690D                                          111   8e-27   Brassica napus [oilseed rape]
gb|AAM66019.1|  unknown                                                 110   2e-26   Arabidopsis thaliana [mouse-ear cress]
ref|NP_566733.1|  UBX domain-containing protein                         110   2e-26   Arabidopsis thaliana [mouse-ear cress]
gb|KDO55137.1|  hypothetical protein CISIN_1g036413mg                 98.6    1e-20   Citrus sinensis [apfelsine]
emb|CDX92988.1|  BnaA03g37100D                                        89.4    1e-18   
emb|CDX94853.1|  BnaC03g43350D                                        87.8    5e-18   
ref|XP_005643712.1|  hypothetical protein COCSUDRAFT_59648            84.3    2e-15   Coccomyxa subellipsoidea C-169
ref|XP_010274053.1|  PREDICTED: homeobox-leucine zipper protein H...  82.4    3e-15   Nelumbo nucifera [Indian lotus]
gb|KDO53547.1|  hypothetical protein CISIN_1g013325mg                 80.1    2e-14   Citrus sinensis [apfelsine]
ref|XP_006420698.1|  hypothetical protein CICLE_v10005240mg           79.7    5e-14   
gb|KEH28763.1|  structural constituent of ribosome protein            78.6    8e-14   Medicago truncatula
ref|XP_010270205.1|  PREDICTED: uncharacterized protein LOC104606607  73.2    1e-12   
ref|XP_002874517.1|  predicted protein                                74.7    2e-12   
ref|XP_002891290.1|  hypothetical protein ARALYDRAFT_891395           70.5    6e-12   
ref|XP_002900938.1|  conserved hypothetical protein                   73.9    8e-12   Phytophthora infestans T30-4
ref|XP_008915021.1|  hypothetical protein PPTG_18885                  73.2    1e-11   Phytophthora parasitica INRA-310
gb|ETI31731.1|  hypothetical protein F443_21327                       73.2    1e-11   Phytophthora parasitica P1569
ref|XP_008915022.1|  hypothetical protein, variant                    71.6    4e-11   Phytophthora parasitica INRA-310
gb|ETI31732.1|  hypothetical protein, variant 1                       71.6    5e-11   Phytophthora parasitica P1569
ref|XP_008383892.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  65.9    7e-11   
ref|XP_010497037.1|  PREDICTED: UBX domain-containing protein 7-like  69.3    1e-10   Camelina sativa [gold-of-pleasure]
ref|XP_002872422.1|  hypothetical protein ARALYDRAFT_911175           62.8    8e-10   
ref|XP_009533837.1|  hypothetical protein PHYSODRAFT_352438           67.0    2e-09   Phytophthora sojae
emb|CCI43060.1|  unnamed protein product                              66.6    2e-09   Albugo candida
gb|KDO48110.1|  hypothetical protein CISIN_1g021440mg                 65.5    3e-09   Citrus sinensis [apfelsine]
emb|CDY51383.1|  BnaC02g46180D                                        62.4    5e-09   Brassica napus [oilseed rape]
gb|KDO48111.1|  hypothetical protein CISIN_1g021440mg                 64.7    6e-09   Citrus sinensis [apfelsine]
ref|XP_008864408.1|  hypothetical protein H310_02617                  63.9    1e-08   Aphanomyces invadans
ref|XP_003604169.1|  UBX domain-containing protein                    63.5    2e-08   
gb|KEH28537.1|  UBX domain protein                                    62.8    2e-08   Medicago truncatula
gb|KEH28538.1|  UBX domain protein                                    63.2    2e-08   Medicago truncatula
ref|XP_005843123.1|  hypothetical protein CHLNCDRAFT_55386            62.8    3e-08   Chlorella variabilis
gb|KDO22673.1|  hypothetical protein SPRG_10988                       60.8    1e-07   Saprolegnia parasitica CBS 223.65
gb|AFW86620.1|  hypothetical protein ZEAMMB73_563531                  59.7    3e-07   
ref|XP_002957220.1|  hypothetical protein VOLCADRAFT_98325            59.7    5e-07   Volvox carteri f. nagariensis
ref|XP_010240593.1|  PREDICTED: UBX domain-containing protein 7 i...  58.5    1e-06   
ref|XP_008617322.1|  hypothetical protein SDRG_13017                  57.8    2e-06   Saprolegnia diclina VS20
emb|CCA23196.1|  conserved hypothetical protein                       57.0    4e-06   Albugo laibachii Nc14
ref|XP_011463688.1|  PREDICTED: uncharacterized protein LOC105351367  57.0    5e-06   Fragaria vesca subsp. vesca
ref|NP_594518.1|  UBX domain protein Ubx2                             55.8    9e-06   Schizosaccharomyces pombe
ref|XP_003604178.1|  UBX domain-containing protein                    55.5    9e-06   Medicago truncatula
gb|EPY51977.1|  UB Xdomain protein Ubx2                               54.7    2e-05   Schizosaccharomyces cryophilus OY26
ref|XP_009844374.1|  hypothetical protein H257_17329                  54.3    3e-05   Aphanomyces astaci
ref|XP_006480636.1|  PREDICTED: UBX domain-containing protein 7-l...  53.5    4e-05   
ref|XP_006480635.1|  PREDICTED: UBX domain-containing protein 7-l...  53.1    5e-05   
ref|XP_006480637.1|  PREDICTED: UBX domain-containing protein 7-l...  53.1    5e-05   
ref|XP_001691879.1|  hypothetical protein CHLREDRAFT_145485           53.1    7e-05   Chlamydomonas reinhardtii
emb|CDH49981.1|  ubx domain protein                                   53.1    8e-05   Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_008812862.1|  PREDICTED: uncharacterized protein LOC103723...  49.7    1e-04   Phoenix dactylifera
ref|XP_011399212.1|  UBX domain-containing protein 7                  50.8    3e-04   Auxenochlorella protothecoides
emb|CDS04684.1|  hypothetical protein LRAMOSA07234                    50.8    4e-04   Lichtheimia ramosa
gb|EPX70813.1|  UB Xdomain protein Ubx2                               50.4    5e-04   Schizosaccharomyces octosporus yFS286
ref|XP_006677415.1|  hypothetical protein BATDEDRAFT_34588            50.4    6e-04   Batrachochytrium dendrobatidis JAM81
ref|XP_002173242.1|  UB Xdomain protein Ubx2                          50.4    6e-04   Schizosaccharomyces japonicus yFS275
ref|XP_010440502.1|  PREDICTED: UBX domain-containing protein 7-like  50.1    7e-04   
ref|XP_002461860.1|  hypothetical protein SORBIDRAFT_02g009430        50.1    8e-04   Sorghum bicolor [broomcorn]



>emb|CDP07923.1| unnamed protein product [Coffea canephora]
Length=448

 Score =   260 bits (665),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 141/197 (72%), Positives = 159/197 (81%), Gaps = 6/197 (3%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRESPQAPPlhkddake  527
            DP+TGQKMRSWRGMVQPETLLEDLLPFMDGSP+DH V+LSHKRPRESP   P       E
Sbjct  257  DPVTGQKMRSWRGMVQPETLLEDLLPFMDGSPTDHHVNLSHKRPRESPVIRPHRVQGETE  316

Query  526  edeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGDKNLVC  347
            EDE++L+ALAASMEG+KD +     +  ES     +T + K P YPPLPEEPKGDKNL+C
Sbjct  317  EDEDMLRALAASMEGVKDMDKKEADDVDES----PQTLLTKNPAYPPLPEEPKGDKNLLC  372

Query  346  RVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFESNL  167
            RVG+RLPDGRRLQRNFLRSDPIQLLWSFC S LEE   +PFRLTQAIPG + SLD+  +L
Sbjct  373  RVGVRLPDGRRLQRNFLRSDPIQLLWSFCCSQLEEAKTRPFRLTQAIPG-SKSLDYNIDL  431

Query  166  TFEESGLANSMISVTWD  116
            TFE SGLANSMISVTW+
Sbjct  432  TFEASGLANSMISVTWE  448



>ref|XP_004160525.1| PREDICTED: UBX domain-containing protein 2-like [Cucumis sativus]
Length=288

 Score =   252 bits (644),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 135/198 (68%), Positives = 157/198 (79%), Gaps = 6/198 (3%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRESPQAPPlhkddake  527
            DPITGQKM SW GMVQPE LLEDLLPFMDG P DH V+LSHKRPRES   PP  ++   E
Sbjct  95   DPITGQKMHSWFGMVQPERLLEDLLPFMDGGPKDHHVTLSHKRPRESSLTPPKVREVEYE  154

Query  526  edeellqalaASMEGMKDTNVDALKESSE-SDVLGKETNVVKKPVYPPLPEEPKGDKNLV  350
            EDEE+ +ALA S+EGMK+    A+K SSE  D    E    K P YPPLPEEPKGD+ L+
Sbjct  155  EDEEVQRALAVSLEGMKE----AVKLSSEDKDTKVAEKEEEKCPTYPPLPEEPKGDRKLL  210

Query  349  CRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFESN  170
            CR+G+RLP+GRR QRNFLR+DPIQLLWSFCSS LE+ + KPF+LT AIPGAT +LD+++ 
Sbjct  211  CRIGVRLPNGRRCQRNFLRTDPIQLLWSFCSSQLEDGETKPFKLTHAIPGATKTLDYDTQ  270

Query  169  LTFEESGLANSMISVTWD  116
            +TFEESGLANSMISVTWD
Sbjct  271  MTFEESGLANSMISVTWD  288



>ref|XP_010270774.1| PREDICTED: UBX domain-containing protein 2 isoform X2 [Nelumbo 
nucifera]
Length=448

 Score =   256 bits (654),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 141/198 (71%), Positives = 158/198 (80%), Gaps = 6/198 (3%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRESPQAP-Plhkddak  530
            DPITGQKMR W GMVQPE LLEDLLPFMD  P DH VSL HKRPRES Q P P  +++  
Sbjct  255  DPITGQKMRLWNGMVQPERLLEDLLPFMDNGPKDHHVSLPHKRPRESSQTPIPKLQEETN  314

Query  529  eedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGDKNLV  350
            EEDEE+L ALAASME  K T  D  +  +E      E++  KK  YPPLPEEPKGD+NL+
Sbjct  315  EEDEEVLLALAASMENTKPTYTDKEEPKTEE----AESSSAKKTTYPPLPEEPKGDRNLL  370

Query  349  CRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFESN  170
            CRVGIRLPDGRRLQRNFLR DPIQLLWSFC + LEE++A+PFRLTQAIPGA+ SLD++S 
Sbjct  371  CRVGIRLPDGRRLQRNFLRKDPIQLLWSFCHAELEESEARPFRLTQAIPGASKSLDYDSK  430

Query  169  LTFEESGLANSMISVTWD  116
            LTFEESGLANSMISVTWD
Sbjct  431  LTFEESGLANSMISVTWD  448



>ref|XP_004140414.1| PREDICTED: UBX domain-containing protein 7-like [Cucumis sativus]
Length=450

 Score =   253 bits (647),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 136/202 (67%), Positives = 160/202 (79%), Gaps = 14/202 (7%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRESPQAPPlhkddake  527
            DPITGQKM SW GMVQPE LLEDLLPFMDG P DH V+LSHKRPRES   PP  ++   E
Sbjct  257  DPITGQKMHSWFGMVQPERLLEDLLPFMDGGPKDHHVTLSHKRPRESSLTPPKVREVEYE  316

Query  526  edeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKK-----PVYPPLPEEPKGD  362
            EDEE+ +ALA S+EGMK+    A+K SSE     K+T V +K     P YPPLPEEPKGD
Sbjct  317  EDEEVQRALAVSLEGMKE----AVKLSSED----KDTKVAEKEEEKCPTYPPLPEEPKGD  368

Query  361  KNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLD  182
            + L+CR+G+RLP+GRR QRNFLR+DPIQLLWSFCSS LE+ + KPF+LT AIPGAT +LD
Sbjct  369  RKLLCRIGVRLPNGRRCQRNFLRTDPIQLLWSFCSSQLEDGETKPFKLTHAIPGATKTLD  428

Query  181  FESNLTFEESGLANSMISVTWD  116
            +++ +TFEESGLANSMISVTWD
Sbjct  429  YDTQMTFEESGLANSMISVTWD  450



>ref|XP_008456878.1| PREDICTED: UBX domain-containing protein 2 [Cucumis melo]
 ref|XP_008456880.1| PREDICTED: UBX domain-containing protein 2 [Cucumis melo]
 ref|XP_008456881.1| PREDICTED: UBX domain-containing protein 2 [Cucumis melo]
Length=450

 Score =   253 bits (646),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 136/202 (67%), Positives = 160/202 (79%), Gaps = 14/202 (7%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRESPQAPPlhkddake  527
            DPITGQKM SW GMVQPE LLEDLLPFMDG P DH V+LSHKRPRES   PP  ++   E
Sbjct  257  DPITGQKMHSWFGMVQPERLLEDLLPFMDGGPKDHHVTLSHKRPRESSLTPPKVREVDYE  316

Query  526  edeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKK-----PVYPPLPEEPKGD  362
            EDEE+ +ALA S+EGMK+    A+K SSE     K+T V +K     P YPPLPEEPKGD
Sbjct  317  EDEEVQRALAVSLEGMKE----AVKLSSED----KDTKVAEKEEEKCPTYPPLPEEPKGD  368

Query  361  KNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLD  182
            +NL+CR+G+RLP+GRR QRNFLR+DPIQLLWSFCSS LE+ + KPF+LT AIPGAT +LD
Sbjct  369  RNLLCRIGVRLPNGRRCQRNFLRTDPIQLLWSFCSSQLEDGETKPFKLTHAIPGATKTLD  428

Query  181  FESNLTFEESGLANSMISVTWD  116
            +++ +TFEESGLANSMISV WD
Sbjct  429  YDTQMTFEESGLANSMISVVWD  450



>ref|XP_010270775.1| PREDICTED: UBX domain-containing protein 2 isoform X3 [Nelumbo 
nucifera]
Length=427

 Score =   252 bits (643),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 140/200 (70%), Positives = 156/200 (78%), Gaps = 8/200 (4%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRESPQAPP---lhkdd  536
            DPITGQKMR W GMVQPE LLEDLLPFMD  P DH VSL HKRPRES Q P       ++
Sbjct  232  DPITGQKMRLWNGMVQPERLLEDLLPFMDNGPKDHHVSLPHKRPRESSQTPIPKLQVAEE  291

Query  535  akeedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGDKN  356
              EEDEE+L ALAASME  K T  D  +  +E      E++  KK  YPPLPEEPKGD+N
Sbjct  292  TNEEDEEVLLALAASMENTKPTYTDKEEPKTEE----AESSSAKKTTYPPLPEEPKGDRN  347

Query  355  LVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFE  176
            L+CRVGIRLPDGRRLQRNFLR DPIQLLWSFC + LEE++A+PFRLTQAIPGA+ SLD++
Sbjct  348  LLCRVGIRLPDGRRLQRNFLRKDPIQLLWSFCHAELEESEARPFRLTQAIPGASKSLDYD  407

Query  175  SNLTFEESGLANSMISVTWD  116
            S LTFEESGLANSMISVTWD
Sbjct  408  SKLTFEESGLANSMISVTWD  427



>ref|XP_010270773.1| PREDICTED: UBX domain-containing protein 2 isoform X1 [Nelumbo 
nucifera]
Length=450

 Score =   252 bits (644),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 140/200 (70%), Positives = 156/200 (78%), Gaps = 8/200 (4%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRESPQAPP---lhkdd  536
            DPITGQKMR W GMVQPE LLEDLLPFMD  P DH VSL HKRPRES Q P       ++
Sbjct  255  DPITGQKMRLWNGMVQPERLLEDLLPFMDNGPKDHHVSLPHKRPRESSQTPIPKLQVAEE  314

Query  535  akeedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGDKN  356
              EEDEE+L ALAASME  K T  D  +  +E      E++  KK  YPPLPEEPKGD+N
Sbjct  315  TNEEDEEVLLALAASMENTKPTYTDKEEPKTEE----AESSSAKKTTYPPLPEEPKGDRN  370

Query  355  LVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFE  176
            L+CRVGIRLPDGRRLQRNFLR DPIQLLWSFC + LEE++A+PFRLTQAIPGA+ SLD++
Sbjct  371  LLCRVGIRLPDGRRLQRNFLRKDPIQLLWSFCHAELEESEARPFRLTQAIPGASKSLDYD  430

Query  175  SNLTFEESGLANSMISVTWD  116
            S LTFEESGLANSMISVTWD
Sbjct  431  SKLTFEESGLANSMISVTWD  450



>ref|XP_009775836.1| PREDICTED: UBX domain-containing protein 2 [Nicotiana sylvestris]
Length=454

 Score =   251 bits (642),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 137/200 (69%), Positives = 166/200 (83%), Gaps = 4/200 (2%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSD-HVSLSHKRPRESPQAPPlhkddake  527
            DPITGQKMRSWRGMVQPETLLEDL+ FMD SPS+ HV+LSHKRPRE+PQAPP       E
Sbjct  255  DPITGQKMRSWRGMVQPETLLEDLISFMDASPSEYHVNLSHKRPRETPQAPPRQPQPQNE  314

Query  526  ---edeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGDKN  356
               EDEEL +ALAASMEG++D    A KE++E++  G+E +++KKP YPPLPEEPKGD+ 
Sbjct  315  IGEEDEELQRALAASMEGIEDPGAVASKETNEANNDGEEKHLIKKPSYPPLPEEPKGDRA  374

Query  355  LVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFE  176
            L+CRV IR PDGRRLQRNFLRSD I+LLWSFCS+ LEE + +PFR TQAIPGA+  L+++
Sbjct  375  LLCRVAIRFPDGRRLQRNFLRSDSIKLLWSFCSTQLEEAETRPFRFTQAIPGASKFLEYD  434

Query  175  SNLTFEESGLANSMISVTWD  116
            +N+TFEESGLANS+IS TW+
Sbjct  435  NNITFEESGLANSIISFTWE  454



>ref|XP_009587838.1| PREDICTED: UBX domain-containing protein 2 [Nicotiana tomentosiformis]
Length=453

 Score =   250 bits (639),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 135/199 (68%), Positives = 166/199 (83%), Gaps = 3/199 (2%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSD-HVSLSHKRPRESPQAPPlhkddak-  530
            DPITGQKMRSWRGMVQPETLLEDL+ FMD SPS+ HV+LSHKRPRE+PQAP   +   + 
Sbjct  255  DPITGQKMRSWRGMVQPETLLEDLISFMDASPSEYHVNLSHKRPRETPQAPRQPQPQNEI  314

Query  529  -eedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGDKNL  353
             EEDEEL +ALAASMEG++D    A KE++E++  G+E +++KKP YP LPEEPKGD+ L
Sbjct  315  GEEDEELQRALAASMEGIEDPGAVASKETNEANDDGEEKHLIKKPSYPSLPEEPKGDRTL  374

Query  352  VCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFES  173
            +CRV IR PDGRRLQRNFLR+D I+LLWSFCS+ LEE + +PFR TQAIPGA+  L+++S
Sbjct  375  LCRVAIRFPDGRRLQRNFLRTDSIKLLWSFCSTQLEEAETRPFRFTQAIPGASKFLEYDS  434

Query  172  NLTFEESGLANSMISVTWD  116
            N+TFEESGLANS+IS TW+
Sbjct  435  NITFEESGLANSIISFTWE  453



>ref|XP_011070500.1| PREDICTED: UBX domain-containing protein 2 [Sesamum indicum]
Length=453

 Score =   250 bits (639),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 138/200 (69%), Positives = 159/200 (80%), Gaps = 8/200 (4%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRESPQAPPlhkdd---  536
            DPITGQKM SWRGMVQPE LLEDLLPFMDG+PSDH VSLSHKRPRES QAP  H      
Sbjct  258  DPITGQKMHSWRGMVQPENLLEDLLPFMDGNPSDHHVSLSHKRPRESSQAPIPHVKSMPD  317

Query  535  akeedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGDKN  356
               EDEEL +ALAASME  K+ +   LKE S ++   K    +KKP Y PLPEEPKGD++
Sbjct  318  ENNEDEELQRALAASMENFKEIDGVDLKEVSNTNAEEK----MKKPTYSPLPEEPKGDRS  373

Query  355  LVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFE  176
            LVCRVG+RLPDGRR+QRNFLR+DP+QLLWSFC S L+E   +PFRLTQAIPGA+ SLDF+
Sbjct  374  LVCRVGVRLPDGRRVQRNFLRTDPVQLLWSFCYSELKEDRERPFRLTQAIPGASRSLDFD  433

Query  175  SNLTFEESGLANSMISVTWD  116
             + TFEESGLAN+M+SVTW+
Sbjct  434  VHSTFEESGLANTMVSVTWE  453



>ref|XP_006355016.1| PREDICTED: UBX domain-containing protein 2-like [Solanum tuberosum]
Length=462

 Score =   249 bits (635),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 139/209 (67%), Positives = 170/209 (81%), Gaps = 14/209 (7%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSD-HVSLSHKRPRESPQAPPlhk-----  542
            DPITGQKMRSWRGMVQPETLLEDLL FMD SPS+ HV+LSHKRPRE+PQAP   +     
Sbjct  255  DPITGQKMRSWRGMVQPETLLEDLLSFMDASPSEYHVNLSHKRPRETPQAPRHPQPQPQP  314

Query  541  -----ddakeedeellqalaASMEGMKDTNVDALKESSE--SDVLGKETNVVKKPVYPPL  383
                 ++  EEDEEL +ALAASMEG++D+   A KE++E  SDV+ KE N++KKP YPPL
Sbjct  315  LPQPQNEVGEEDEELQRALAASMEGIEDSGSVASKETNEAASDVV-KEENLIKKPSYPPL  373

Query  382  PEEPKGDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIP  203
            PEEPKGD+NL+CRV IR PDGRRLQRNFLR+D I+LLWSFCS+  EE +++PF+ TQAIP
Sbjct  374  PEEPKGDRNLLCRVAIRFPDGRRLQRNFLRTDSIKLLWSFCSTQFEEAESRPFKFTQAIP  433

Query  202  GATSSLDFESNLTFEESGLANSMISVTWD  116
            G +  L+F++N+TFEESGLANS+IS TW+
Sbjct  434  GVSKFLEFDNNMTFEESGLANSIISFTWE  462



>ref|XP_007222574.1| hypothetical protein PRUPE_ppa008429mg [Prunus persica]
 gb|EMJ23773.1| hypothetical protein PRUPE_ppa008429mg [Prunus persica]
Length=332

 Score =   242 bits (617),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 133/201 (66%), Positives = 159/201 (79%), Gaps = 8/201 (4%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRES--PQAPPlhkdda  533
            DPITGQ+MRSW GMVQPE LLEDLLPF+D  P DH V+LSHKRPRES  PQ P   KD+ 
Sbjct  135  DPITGQRMRSWNGMVQPECLLEDLLPFLDSGPRDHHVTLSHKRPRESSLPQ-PQKTKDET  193

Query  532  keedeellqalaASMEGMKDTNVDALKESSESDVLGKETN--VVKKPVYPPLPEEPKGDK  359
             EEDEE+ +ALAASMEGM++T    + +  +  +  KE    + K P YPPLPEEPKGDK
Sbjct  194  NEEDEEVQRALAASMEGMQETG--GISKDKDEIITDKEEEKCLAKTPAYPPLPEEPKGDK  251

Query  358  NLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDF  179
            NL+CRVG+RLPDGRR+QRNFLR+DPIQ+LWSFC S L+E + + FRLTQAIPGA+ SLD+
Sbjct  252  NLLCRVGVRLPDGRRVQRNFLRTDPIQMLWSFCYSQLKEAETRRFRLTQAIPGASKSLDY  311

Query  178  ESNLTFEESGLANSMISVTWD  116
            +   TFEESGLANSM+SVTW+
Sbjct  312  DCQSTFEESGLANSMVSVTWE  332



>ref|XP_008220984.1| PREDICTED: UBX domain-containing protein 2 isoform X2 [Prunus 
mume]
Length=454

 Score =   245 bits (626),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 134/201 (67%), Positives = 159/201 (79%), Gaps = 8/201 (4%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRES--PQAPPlhkdda  533
            DPITGQ+MRSW GMVQPE LLEDLLPF+D  P DH V+LSHKRPRES  PQ P   KD+ 
Sbjct  257  DPITGQRMRSWNGMVQPECLLEDLLPFLDSGPRDHHVTLSHKRPRESSLPQ-PQKTKDET  315

Query  532  keedeellqalaASMEGMKDTNVDALKESSESDVLGKETN--VVKKPVYPPLPEEPKGDK  359
             EEDEE+ +ALAASMEGM++T    + +  +  +  KE      K P YPPLPEEPKGDK
Sbjct  316  NEEDEEVQRALAASMEGMQETG--GISKDKDEIITDKEEEKCSAKAPAYPPLPEEPKGDK  373

Query  358  NLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDF  179
            NL+CRVG+RLPDGRR+QRNFLR+DPIQ+LWSFC S L+E + +PFRLTQAIPGA+ SLD+
Sbjct  374  NLLCRVGVRLPDGRRVQRNFLRTDPIQMLWSFCYSQLKEAETRPFRLTQAIPGASKSLDY  433

Query  178  ESNLTFEESGLANSMISVTWD  116
            +   TFEESGLANSM+SVTW+
Sbjct  434  DCQSTFEESGLANSMVSVTWE  454



>ref|XP_004236895.1| PREDICTED: UBX domain-containing protein 2 [Solanum lycopersicum]
Length=466

 Score =   244 bits (622),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 134/213 (63%), Positives = 166/213 (78%), Gaps = 18/213 (8%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSD-HVSLSHKRPRESPQAPPlhkddake  527
            DPITGQKMRSWRGMVQPETLLEDL+ FMD SPS+ HV+LSHKRPRE+PQAP   +   + 
Sbjct  255  DPITGQKMRSWRGMVQPETLLEDLISFMDASPSEYHVNLSHKRPRETPQAPRHPQPQPQP  314

Query  526  ed--------------eellqalaASMEGMKDTNVDALKESSE--SDVLGKETNVVKKPV  395
            +               EEL +ALAASM G++D+   A KE++E  SDV+ KE N++KKP 
Sbjct  315  QPQPQSQPQNEIGEEDEELQRALAASMVGIEDSGSVASKETNEATSDVV-KEENLIKKPS  373

Query  394  YPPLPEEPKGDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLT  215
            YPPLPEEPKGD+NL+CRV IR PDGRRLQRNFLR+D I+LLWSFCS+  EE +++PF+ T
Sbjct  374  YPPLPEEPKGDRNLLCRVAIRFPDGRRLQRNFLRTDSIKLLWSFCSTQFEEAESRPFKFT  433

Query  214  QAIPGATSSLDFESNLTFEESGLANSMISVTWD  116
            QAIPG +  L+F++N+TFEESGLANS+IS TW+
Sbjct  434  QAIPGVSKFLEFDNNMTFEESGLANSIISFTWE  466



>ref|XP_008220982.1| PREDICTED: UBX domain-containing protein 2 isoform X1 [Prunus 
mume]
Length=456

 Score =   243 bits (620),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 129/202 (64%), Positives = 154/202 (76%), Gaps = 8/202 (4%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRESPQAPPlhkddake  527
            DPITGQ+MRSW GMVQPE LLEDLLPF+D  P DH V+LSHKRPRES    P     A E
Sbjct  257  DPITGQRMRSWNGMVQPECLLEDLLPFLDSGPRDHHVTLSHKRPRESSLPQPQKTKVADE  316

Query  526  edee---llqalaASMEGMKDTNVDALKESSESDVLGKETN--VVKKPVYPPLPEEPKGD  362
             +EE   + +ALAASMEGM++T    + +  +  +  KE      K P YPPLPEEPKGD
Sbjct  317  TNEEDEEVQRALAASMEGMQETG--GISKDKDEIITDKEEEKCSAKAPAYPPLPEEPKGD  374

Query  361  KNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLD  182
            KNL+CRVG+RLPDGRR+QRNFLR+DPIQ+LWSFC S L+E + +PFRLTQAIPGA+ SLD
Sbjct  375  KNLLCRVGVRLPDGRRVQRNFLRTDPIQMLWSFCYSQLKEAETRPFRLTQAIPGASKSLD  434

Query  181  FESNLTFEESGLANSMISVTWD  116
            ++   TFEESGLANSM+SVTW+
Sbjct  435  YDCQSTFEESGLANSMVSVTWE  456



>gb|KHG06883.1| UBX domain-containing 7 [Gossypium arboreum]
Length=453

 Score =   243 bits (620),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 130/200 (65%), Positives = 155/200 (78%), Gaps = 5/200 (3%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSD-HVSLSHKRPRES---PQAPPlhkdd  536
            DPITGQKMRSW GMVQPE+LLEDL+ FMDG P D H +LSHKRPR S   PQ       D
Sbjct  255  DPITGQKMRSWFGMVQPESLLEDLVQFMDGGPRDYHATLSHKRPRGSSVTPQQKIKVSTD  314

Query  535  akeedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGDKN  356
               ED+E+L+A+AASME  KD+ +   ++   S    +E+ + KKP YPPLPEEPKGD+N
Sbjct  315  ETNEDKEMLRAIAASMENAKDS-IKTTEDDKVSSTTEEESCLTKKPAYPPLPEEPKGDRN  373

Query  355  LVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFE  176
            L+CRVG+RLPDGRR+QRNFLR+DPIQLLWSFC S L E ++KPFRLTQ IPGA+ SLD++
Sbjct  374  LLCRVGVRLPDGRRVQRNFLRTDPIQLLWSFCYSQLGEAESKPFRLTQPIPGASKSLDYD  433

Query  175  SNLTFEESGLANSMISVTWD  116
            S LTFEESGLANSMI V W+
Sbjct  434  SKLTFEESGLANSMILVAWE  453



>gb|KJB30690.1| hypothetical protein B456_005G158000 [Gossypium raimondii]
Length=450

 Score =   243 bits (619),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 128/197 (65%), Positives = 153/197 (78%), Gaps = 2/197 (1%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSD-HVSLSHKRPRESPQAPPlhkddake  527
            DPITGQKMRSW GMVQPE+LLEDL+ FMDG P D H +LSHKRPR S   P     D   
Sbjct  255  DPITGQKMRSWFGMVQPESLLEDLVQFMDGGPRDYHATLSHKRPRGSSVTPQQKIKDETN  314

Query  526  edeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGDKNLVC  347
            ED+E+L+A+AASME  K++ +   ++   S    +E  + KKP YPPLPEEPKGD+NL+C
Sbjct  315  EDKEMLRAIAASMENAKES-IKTTEDDKVSSTTEEEPCLTKKPAYPPLPEEPKGDRNLLC  373

Query  346  RVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFESNL  167
            RVG+RLPDGRR+QRNFLR+DPIQLLWSFC S L E ++KPFRLTQ IPGA+ SLD++S L
Sbjct  374  RVGVRLPDGRRVQRNFLRTDPIQLLWSFCYSQLGEAESKPFRLTQPIPGASKSLDYDSKL  433

Query  166  TFEESGLANSMISVTWD  116
            TFEESGLANSMI V W+
Sbjct  434  TFEESGLANSMILVAWE  450



>ref|XP_007045358.1| UBX domain-containing protein isoform 3 [Theobroma cacao]
 gb|EOY01190.1| UBX domain-containing protein isoform 3 [Theobroma cacao]
Length=451

 Score =   241 bits (616),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 129/197 (65%), Positives = 153/197 (78%), Gaps = 1/197 (1%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSD-HVSLSHKRPRESPQAPPlhkddake  527
            DPITGQKMR W GMVQPE+LLEDL+ FMDG P D H +LSHKRPR S   P     D   
Sbjct  255  DPITGQKMRFWCGMVQPESLLEDLVQFMDGGPRDYHATLSHKRPRGSSVTPQQKVKDETI  314

Query  526  edeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGDKNLVC  347
            EDEE+L+A+AASME +KD    A  +   S++  +E  + KKP YPPLPEEPKGD++L+C
Sbjct  315  EDEEMLRAVAASMENVKDFCKTASGDKVLSNIDKEEPCLTKKPTYPPLPEEPKGDRSLLC  374

Query  346  RVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFESNL  167
            RVG+RLPDGRR+QRNFLR+D IQLLWSFC + L E ++KPFRLTQ IPGA+ SLDF+S L
Sbjct  375  RVGVRLPDGRRVQRNFLRTDSIQLLWSFCCAQLGEAESKPFRLTQPIPGASKSLDFDSKL  434

Query  166  TFEESGLANSMISVTWD  116
            TFEESGLANSMISV W+
Sbjct  435  TFEESGLANSMISVAWE  451



>ref|XP_010088526.1| UBX domain-containing protein 2 [Morus notabilis]
 gb|EXB36443.1| UBX domain-containing protein 2 [Morus notabilis]
Length=486

 Score =   242 bits (617),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 137/207 (66%), Positives = 158/207 (76%), Gaps = 13/207 (6%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRESPQA-------PPl  548
            DPITGQKMRSW GMV+PE LLEDLLPFM+G P DH V+LSHKRPRES  A        P+
Sbjct  282  DPITGQKMRSWNGMVEPERLLEDLLPFMEGGPRDHHVTLSHKRPRESSFARPQKTKDAPV  341

Query  547  hkddakeedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVV---KKPVYPPLPE  377
              D   EEDEE+LQA+AASMEG+K T+        E + L  +  +    KKP YPPLPE
Sbjct  342  VADKTSEEDEEVLQAIAASMEGIKGTS--GWGSDDEDENLTNQEEITCQDKKPSYPPLPE  399

Query  376  EPKGDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGA  197
            EPKGDK L+CRVGIRLP GRR+QRNFLR+DPIQLLWSFC S L E + +PFRLT+AIPGA
Sbjct  400  EPKGDKTLLCRVGIRLPGGRRVQRNFLRTDPIQLLWSFCCSQLTEGETRPFRLTEAIPGA  459

Query  196  TSSLDFESNLTFEESGLANSMISVTWD  116
            + SLD++S LTFEESGLANSMISVTW+
Sbjct  460  SKSLDYDSQLTFEESGLANSMISVTWE  486



>gb|KJB30689.1| hypothetical protein B456_005G158000 [Gossypium raimondii]
Length=430

 Score =   239 bits (611),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 129/200 (65%), Positives = 154/200 (77%), Gaps = 5/200 (3%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSD-HVSLSHKRPRES---PQAPPlhkdd  536
            DPITGQKMRSW GMVQPE+LLEDL+ FMDG P D H +LSHKRPR S   PQ       D
Sbjct  232  DPITGQKMRSWFGMVQPESLLEDLVQFMDGGPRDYHATLSHKRPRGSSVTPQQKIKVSTD  291

Query  535  akeedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGDKN  356
               ED+E+L+A+AASME  K++ +   ++   S    +E  + KKP YPPLPEEPKGD+N
Sbjct  292  ETNEDKEMLRAIAASMENAKES-IKTTEDDKVSSTTEEEPCLTKKPAYPPLPEEPKGDRN  350

Query  355  LVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFE  176
            L+CRVG+RLPDGRR+QRNFLR+DPIQLLWSFC S L E ++KPFRLTQ IPGA+ SLD++
Sbjct  351  LLCRVGVRLPDGRRVQRNFLRTDPIQLLWSFCYSQLGEAESKPFRLTQPIPGASKSLDYD  410

Query  175  SNLTFEESGLANSMISVTWD  116
            S LTFEESGLANSMI V W+
Sbjct  411  SKLTFEESGLANSMILVAWE  430



>gb|KDP38216.1| hypothetical protein JCGZ_04859 [Jatropha curcas]
Length=454

 Score =   240 bits (613),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 123/201 (61%), Positives = 157/201 (78%), Gaps = 6/201 (3%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRESPQAPPlhkddake  527
            DPITGQKMR+W GM+QPE+LLEDL+PF+DG P +H ++LSHKRPR S QAP  +   +  
Sbjct  255  DPITGQKMRAWSGMIQPESLLEDLVPFLDGGPREHHLTLSHKRPRGSSQAPQKNTASSNA  314

Query  526  edee---llqalaASMEGMKDTNVDALKESSESDV-LGKETNVVKKPVYPPLPEEPKGDK  359
             ++E   + +ALAAS++GMKD+NV A      +    G++T  +KKP YPPLPEEPKGD 
Sbjct  315  TNKEDEEVQRALAASLDGMKDSNVMASDNKGATTAEKGEDTYSIKKPTYPPLPEEPKGDS  374

Query  358  NLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDF  179
            +L+CRVG+RLPDGRR+QR+FL++DP+QLLWSFC S LEE   +PFRLTQAIPGA  +LD+
Sbjct  375  SLMCRVGLRLPDGRRVQRHFLKTDPVQLLWSFCVSQLEEASRRPFRLTQAIPGA-KTLDY  433

Query  178  ESNLTFEESGLANSMISVTWD  116
            ES LTF ESGLANSM+ V W+
Sbjct  434  ESKLTFGESGLANSMMLVAWE  454



>gb|KJB30687.1| hypothetical protein B456_005G158000 [Gossypium raimondii]
 gb|KJB30691.1| hypothetical protein B456_005G158000 [Gossypium raimondii]
Length=453

 Score =   240 bits (612),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 129/200 (65%), Positives = 154/200 (77%), Gaps = 5/200 (3%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSD-HVSLSHKRPRES---PQAPPlhkdd  536
            DPITGQKMRSW GMVQPE+LLEDL+ FMDG P D H +LSHKRPR S   PQ       D
Sbjct  255  DPITGQKMRSWFGMVQPESLLEDLVQFMDGGPRDYHATLSHKRPRGSSVTPQQKIKVSTD  314

Query  535  akeedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGDKN  356
               ED+E+L+A+AASME  K++ +   ++   S    +E  + KKP YPPLPEEPKGD+N
Sbjct  315  ETNEDKEMLRAIAASMENAKES-IKTTEDDKVSSTTEEEPCLTKKPAYPPLPEEPKGDRN  373

Query  355  LVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFE  176
            L+CRVG+RLPDGRR+QRNFLR+DPIQLLWSFC S L E ++KPFRLTQ IPGA+ SLD++
Sbjct  374  LLCRVGVRLPDGRRVQRNFLRTDPIQLLWSFCYSQLGEAESKPFRLTQPIPGASKSLDYD  433

Query  175  SNLTFEESGLANSMISVTWD  116
            S LTFEESGLANSMI V W+
Sbjct  434  SKLTFEESGLANSMILVAWE  453



>gb|KDO53546.1| hypothetical protein CISIN_1g013325mg [Citrus sinensis]
Length=248

 Score =   233 bits (594),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 126/198 (64%), Positives = 153/198 (77%), Gaps = 2/198 (1%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSD-HVSLSHKRPRESPQAPPlhkdda-k  530
            DPITGQKMRSW GMVQPE+LLEDL+PFMDG P + H  +SHKRPR S   P     D   
Sbjct  51   DPITGQKMRSWCGMVQPESLLEDLVPFMDGGPREQHAKVSHKRPRGSSTTPQQKNKDKPD  110

Query  529  eedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGDKNLV  350
             E+EELLQALAASME +KD +  +  ++  +     E +  +KP YP LPEEPK D++L+
Sbjct  111  IENEELLQALAASMETIKDASGVSSSDTDVASTDKDEASATEKPAYPILPEEPKVDRSLL  170

Query  349  CRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFESN  170
            CRVG+RLPDGRR+QRNFLR+DPIQLLWS+C S LE ++ KPFRLT AIPGAT SLD++S 
Sbjct  171  CRVGVRLPDGRRMQRNFLRTDPIQLLWSYCYSQLEGSEMKPFRLTHAIPGATKSLDYDSK  230

Query  169  LTFEESGLANSMISVTWD  116
            LTFE+SGLAN+MISVTW+
Sbjct  231  LTFEDSGLANAMISVTWE  248



>ref|XP_007045357.1| UBX domain-containing protein isoform 2 [Theobroma cacao]
 gb|EOY01189.1| UBX domain-containing protein isoform 2 [Theobroma cacao]
Length=454

 Score =   239 bits (609),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 130/200 (65%), Positives = 154/200 (77%), Gaps = 4/200 (2%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSD-HVSLSHKRPRES---PQAPPlhkdd  536
            DPITGQKMR W GMVQPE+LLEDL+ FMDG P D H +LSHKRPR S   PQ       D
Sbjct  255  DPITGQKMRFWCGMVQPESLLEDLVQFMDGGPRDYHATLSHKRPRGSSVTPQQKVKVSTD  314

Query  535  akeedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGDKN  356
               EDEE+L+A+AASME +KD    A  +   S++  +E  + KKP YPPLPEEPKGD++
Sbjct  315  ETIEDEEMLRAVAASMENVKDFCKTASGDKVLSNIDKEEPCLTKKPTYPPLPEEPKGDRS  374

Query  355  LVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFE  176
            L+CRVG+RLPDGRR+QRNFLR+D IQLLWSFC + L E ++KPFRLTQ IPGA+ SLDF+
Sbjct  375  LLCRVGVRLPDGRRVQRNFLRTDSIQLLWSFCCAQLGEAESKPFRLTQPIPGASKSLDFD  434

Query  175  SNLTFEESGLANSMISVTWD  116
            S LTFEESGLANSMISV W+
Sbjct  435  SKLTFEESGLANSMISVAWE  454



>ref|XP_007045359.1| UBX domain-containing protein isoform 4, partial [Theobroma cacao]
 gb|EOY01191.1| UBX domain-containing protein isoform 4, partial [Theobroma cacao]
Length=429

 Score =   238 bits (607),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 130/200 (65%), Positives = 154/200 (77%), Gaps = 4/200 (2%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSD-HVSLSHKRPRES---PQAPPlhkdd  536
            DPITGQKMR W GMVQPE+LLEDL+ FMDG P D H +LSHKRPR S   PQ       D
Sbjct  230  DPITGQKMRFWCGMVQPESLLEDLVQFMDGGPRDYHATLSHKRPRGSSVTPQQKVKVSTD  289

Query  535  akeedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGDKN  356
               EDEE+L+A+AASME +KD    A  +   S++  +E  + KKP YPPLPEEPKGD++
Sbjct  290  ETIEDEEMLRAVAASMENVKDFCKTASGDKVLSNIDKEEPCLTKKPTYPPLPEEPKGDRS  349

Query  355  LVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFE  176
            L+CRVG+RLPDGRR+QRNFLR+D IQLLWSFC + L E ++KPFRLTQ IPGA+ SLDF+
Sbjct  350  LLCRVGVRLPDGRRVQRNFLRTDSIQLLWSFCCAQLGEAESKPFRLTQPIPGASKSLDFD  409

Query  175  SNLTFEESGLANSMISVTWD  116
            S LTFEESGLANSMISV W+
Sbjct  410  SKLTFEESGLANSMISVAWE  429



>ref|XP_007045356.1| UBX domain-containing protein isoform 1 [Theobroma cacao]
 gb|EOY01188.1| UBX domain-containing protein isoform 1 [Theobroma cacao]
Length=479

 Score =   239 bits (609),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 130/200 (65%), Positives = 154/200 (77%), Gaps = 4/200 (2%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSD-HVSLSHKRPRES---PQAPPlhkdd  536
            DPITGQKMR W GMVQPE+LLEDL+ FMDG P D H +LSHKRPR S   PQ       D
Sbjct  280  DPITGQKMRFWCGMVQPESLLEDLVQFMDGGPRDYHATLSHKRPRGSSVTPQQKVKVSTD  339

Query  535  akeedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGDKN  356
               EDEE+L+A+AASME +KD    A  +   S++  +E  + KKP YPPLPEEPKGD++
Sbjct  340  ETIEDEEMLRAVAASMENVKDFCKTASGDKVLSNIDKEEPCLTKKPTYPPLPEEPKGDRS  399

Query  355  LVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFE  176
            L+CRVG+RLPDGRR+QRNFLR+D IQLLWSFC + L E ++KPFRLTQ IPGA+ SLDF+
Sbjct  400  LLCRVGVRLPDGRRVQRNFLRTDSIQLLWSFCCAQLGEAESKPFRLTQPIPGASKSLDFD  459

Query  175  SNLTFEESGLANSMISVTWD  116
            S LTFEESGLANSMISV W+
Sbjct  460  SKLTFEESGLANSMISVAWE  479



>ref|XP_006470883.1| PREDICTED: UBX domain-containing protein 2-like [Citrus sinensis]
Length=444

 Score =   237 bits (605),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 127/198 (64%), Positives = 155/198 (78%), Gaps = 2/198 (1%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSD-HVSLSHKRPRESPQAPPlhkdda-k  530
            DPITGQKMRSW GMVQPE+LLEDL+PFMDG P + H  +SHKRPR S   P     D   
Sbjct  247  DPITGQKMRSWCGMVQPESLLEDLVPFMDGGPREQHAKVSHKRPRGSSTTPQQKNKDKPD  306

Query  529  eedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGDKNLV  350
             E+EELLQALAASME +KD +  +  ++  +    +ET+  +KP YP LPEEPK D++L+
Sbjct  307  IENEELLQALAASMETIKDASGVSSSDTDVASTDKEETSATEKPAYPALPEEPKVDRSLL  366

Query  349  CRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFESN  170
            CRVG+RLPDGRR+QRNFLR+DPIQLLWS+C S LE ++ KPFRLT AIPGAT SLD++S 
Sbjct  367  CRVGVRLPDGRRMQRNFLRTDPIQLLWSYCYSQLEGSEMKPFRLTHAIPGATKSLDYDSK  426

Query  169  LTFEESGLANSMISVTWD  116
            LTFE+SGLAN+MISVTW+
Sbjct  427  LTFEDSGLANAMISVTWE  444



>ref|XP_003531952.1| PREDICTED: UBX domain-containing protein 7-like isoform 1 [Glycine 
max]
Length=468

 Score =   238 bits (606),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 124/203 (61%), Positives = 155/203 (76%), Gaps = 7/203 (3%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRESPQAPPlhkddake  527
            DPITGQKMRSW GMVQPE+LLE LL F+D  P DH ++LSHKRPR S   P        +
Sbjct  266  DPITGQKMRSWIGMVQPESLLEGLLAFLDAGPKDHHITLSHKRPRGSSSPPKSKALVESD  325

Query  526  edeel----lqalaASMEGMKDTNVDALKESSESDV--LGKETNVVKKPVYPPLPEEPKG  365
            E++E      +ALAASME MK++ V   +++ ++DV   G++T + K+P+YP LPEEPK 
Sbjct  326  ENKEEDEEVQRALAASMESMKESTVMTGRDNIDTDVAVYGQQTTLAKRPIYPALPEEPKV  385

Query  364  DKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSL  185
            ++NL+CRVG+RLPDG R+QRNFLR+DPIQLLWSF S+ L E + KPFRLT AIPGA+  L
Sbjct  386  ERNLLCRVGVRLPDGHRIQRNFLRTDPIQLLWSFISAQLGEDERKPFRLTHAIPGASKIL  445

Query  184  DFESNLTFEESGLANSMISVTWD  116
            D+ESN TF+ESGLANSMISVTWD
Sbjct  446  DYESNSTFQESGLANSMISVTWD  468



>gb|KDO53545.1| hypothetical protein CISIN_1g013325mg [Citrus sinensis]
Length=342

 Score =   233 bits (595),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 126/198 (64%), Positives = 153/198 (77%), Gaps = 2/198 (1%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSD-HVSLSHKRPRESPQAPPlhkdda-k  530
            DPITGQKMRSW GMVQPE+LLEDL+PFMDG P + H  +SHKRPR S   P     D   
Sbjct  145  DPITGQKMRSWCGMVQPESLLEDLVPFMDGGPREQHAKVSHKRPRGSSTTPQQKNKDKPD  204

Query  529  eedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGDKNLV  350
             E+EELLQALAASME +KD +  +  ++  +     E +  +KP YP LPEEPK D++L+
Sbjct  205  IENEELLQALAASMETIKDASGVSSSDTDVASTDKDEASATEKPAYPILPEEPKVDRSLL  264

Query  349  CRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFESN  170
            CRVG+RLPDGRR+QRNFLR+DPIQLLWS+C S LE ++ KPFRLT AIPGAT SLD++S 
Sbjct  265  CRVGVRLPDGRRMQRNFLRTDPIQLLWSYCYSQLEGSEMKPFRLTHAIPGATKSLDYDSK  324

Query  169  LTFEESGLANSMISVTWD  116
            LTFE+SGLAN+MISVTW+
Sbjct  325  LTFEDSGLANAMISVTWE  342



>ref|XP_010680042.1| PREDICTED: UBX domain-containing protein 2 [Beta vulgaris subsp. 
vulgaris]
Length=454

 Score =   236 bits (601),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 132/200 (66%), Positives = 153/200 (77%), Gaps = 5/200 (3%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRESPQAP-Plhkddak  530
            DPITGQKMRSW GMV P+ LLEDLLPFMDG P +H  SLSHKRPRES  A  P  + +  
Sbjct  256  DPITGQKMRSWSGMVHPDRLLEDLLPFMDGGPKNHHTSLSHKRPRESSHAAAPKVQVETN  315

Query  529  eedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGDKNLV  350
            EEDEEL +ALAASME   D      K +  +D + KET   KKPVY PLPEEPKGD+N++
Sbjct  316  EEDEELQRALAASMEKHPDEVASEEKNAVAAD-MEKETCSTKKPVYLPLPEEPKGDRNIL  374

Query  349  CRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQA--IPGATSSLDFE  176
            CRVG RLPDGRR+QRNFLR+DPIQLLWSFCSS L E + +PFRLT A  IPG   SL+++
Sbjct  375  CRVGFRLPDGRRVQRNFLRTDPIQLLWSFCSSQLGEAETRPFRLTHAIGIPGPAKSLEYD  434

Query  175  SNLTFEESGLANSMISVTWD  116
            S LTFEESG++NSMISVTW+
Sbjct  435  SKLTFEESGVSNSMISVTWE  454



>gb|EYU30237.1| hypothetical protein MIMGU_mgv1a006061mg [Erythranthe guttata]
Length=459

 Score =   234 bits (598),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 125/203 (62%), Positives = 155/203 (76%), Gaps = 10/203 (5%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRESPQAPPlhkddake  527
            DPITGQK+ +WRGMVQPE LLEDL+PFMDGSPSDH VSLSHKRPR   +AP  H   A  
Sbjct  260  DPITGQKLHAWRGMVQPENLLEDLVPFMDGSPSDHHVSLSHKRPRVHTEAPVHHIQSAAA  319

Query  526  edeel------lqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKG  365
            E+ +        +ALAASM   K+ +    KE +E++   ++    KKP Y PLPEEPKG
Sbjct  320  ENHDEDEEEELQRALAASMVDTKEIDEGDSKEVTEANNAEEKE---KKPSYLPLPEEPKG  376

Query  364  DKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSL  185
            D++L+CRVG+RLPDGRR+QRNFLR+DP+QLLWSFC S ++E D+KPFR+TQAIPGA+ SL
Sbjct  377  DRSLLCRVGVRLPDGRRVQRNFLRTDPVQLLWSFCYSEMKEIDSKPFRITQAIPGASRSL  436

Query  184  DFESNLTFEESGLANSMISVTWD  116
            D++   TF ESGLANSM+SVTW+
Sbjct  437  DYDVTSTFAESGLANSMVSVTWE  459



>gb|EYU30238.1| hypothetical protein MIMGU_mgv1a006061mg [Erythranthe guttata]
Length=458

 Score =   234 bits (598),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 125/203 (62%), Positives = 155/203 (76%), Gaps = 10/203 (5%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRESPQAPPlhkddake  527
            DPITGQK+ +WRGMVQPE LLEDL+PFMDGSPSDH VSLSHKRPR   +AP  H   A  
Sbjct  259  DPITGQKLHAWRGMVQPENLLEDLVPFMDGSPSDHHVSLSHKRPRVHTEAPVHHIQSAAA  318

Query  526  edeel------lqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKG  365
            E+ +        +ALAASM   K+ +    KE +E++   ++    KKP Y PLPEEPKG
Sbjct  319  ENHDEDEEEELQRALAASMVDTKEIDEGDSKEVTEANNAEEKE---KKPSYLPLPEEPKG  375

Query  364  DKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSL  185
            D++L+CRVG+RLPDGRR+QRNFLR+DP+QLLWSFC S ++E D+KPFR+TQAIPGA+ SL
Sbjct  376  DRSLLCRVGVRLPDGRRVQRNFLRTDPVQLLWSFCYSEMKEIDSKPFRITQAIPGASRSL  435

Query  184  DFESNLTFEESGLANSMISVTWD  116
            D++   TF ESGLANSM+SVTW+
Sbjct  436  DYDVTSTFAESGLANSMVSVTWE  458



>gb|EYU30239.1| hypothetical protein MIMGU_mgv1a006061mg [Erythranthe guttata]
Length=458

 Score =   234 bits (598),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 126/202 (62%), Positives = 155/202 (77%), Gaps = 9/202 (4%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRESPQAPPlhkddake  527
            DPITGQK+ +WRGMVQPE LLEDL+PFMDGSPSDH VSLSHKRPR   +AP  H   A E
Sbjct  260  DPITGQKLHAWRGMVQPENLLEDLVPFMDGSPSDHHVSLSHKRPRVHTEAPVHHIQSAAE  319

Query  526  edeel-----lqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGD  362
              +E       +ALAASM   K+ +    KE +E++   ++    KKP Y PLPEEPKGD
Sbjct  320  NHDEDEEEELQRALAASMVDTKEIDEGDSKEVTEANNAEEKE---KKPSYLPLPEEPKGD  376

Query  361  KNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLD  182
            ++L+CRVG+RLPDGRR+QRNFLR+DP+QLLWSFC S ++E D+KPFR+TQAIPGA+ SLD
Sbjct  377  RSLLCRVGVRLPDGRRVQRNFLRTDPVQLLWSFCYSEMKEIDSKPFRITQAIPGASRSLD  436

Query  181  FESNLTFEESGLANSMISVTWD  116
            ++   TF ESGLANSM+SVTW+
Sbjct  437  YDVTSTFAESGLANSMVSVTWE  458



>gb|KDO53544.1| hypothetical protein CISIN_1g013325mg [Citrus sinensis]
Length=445

 Score =   234 bits (597),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 126/198 (64%), Positives = 153/198 (77%), Gaps = 2/198 (1%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSD-HVSLSHKRPRESPQAPPlhkdda-k  530
            DPITGQKMRSW GMVQPE+LLEDL+PFMDG P + H  +SHKRPR S   P     D   
Sbjct  248  DPITGQKMRSWCGMVQPESLLEDLVPFMDGGPREQHAKVSHKRPRGSSTTPQQKNKDKPD  307

Query  529  eedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGDKNLV  350
             E+EELLQALAASME +KD +  +  ++  +     E +  +KP YP LPEEPK D++L+
Sbjct  308  IENEELLQALAASMETIKDASGVSSSDTDVASTDKDEASATEKPAYPILPEEPKVDRSLL  367

Query  349  CRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFESN  170
            CRVG+RLPDGRR+QRNFLR+DPIQLLWS+C S LE ++ KPFRLT AIPGAT SLD++S 
Sbjct  368  CRVGVRLPDGRRMQRNFLRTDPIQLLWSYCYSQLEGSEMKPFRLTHAIPGATKSLDYDSK  427

Query  169  LTFEESGLANSMISVTWD  116
            LTFE+SGLAN+MISVTW+
Sbjct  428  LTFEDSGLANAMISVTWE  445



>gb|KDO53543.1| hypothetical protein CISIN_1g013325mg [Citrus sinensis]
Length=444

 Score =   234 bits (596),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 126/198 (64%), Positives = 153/198 (77%), Gaps = 2/198 (1%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSD-HVSLSHKRPRESPQAPPlhkdda-k  530
            DPITGQKMRSW GMVQPE+LLEDL+PFMDG P + H  +SHKRPR S   P     D   
Sbjct  247  DPITGQKMRSWCGMVQPESLLEDLVPFMDGGPREQHAKVSHKRPRGSSTTPQQKNKDKPD  306

Query  529  eedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGDKNLV  350
             E+EELLQALAASME +KD +  +  ++  +     E +  +KP YP LPEEPK D++L+
Sbjct  307  IENEELLQALAASMETIKDASGVSSSDTDVASTDKDEASATEKPAYPILPEEPKVDRSLL  366

Query  349  CRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFESN  170
            CRVG+RLPDGRR+QRNFLR+DPIQLLWS+C S LE ++ KPFRLT AIPGAT SLD++S 
Sbjct  367  CRVGVRLPDGRRMQRNFLRTDPIQLLWSYCYSQLEGSEMKPFRLTHAIPGATKSLDYDSK  426

Query  169  LTFEESGLANSMISVTWD  116
            LTFE+SGLAN+MISVTW+
Sbjct  427  LTFEDSGLANAMISVTWE  444



>ref|XP_002521873.1| UBX domain-containing protein, putative [Ricinus communis]
 gb|EEF40509.1| UBX domain-containing protein, putative [Ricinus communis]
Length=452

 Score =   232 bits (591),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 133/210 (63%), Positives = 161/210 (77%), Gaps = 17/210 (8%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRESPQAP---------  554
            DPITGQKMR+W GMVQPE LLEDL+P+MDG P DH V+LSHKRPR S QA          
Sbjct  246  DPITGQKMRAWSGMVQPECLLEDLVPYMDGGPRDHHVTLSHKRPRGSSQALQKNKGKLGL  305

Query  553  -PlhkddakeedeellqalaASMEGMKDTN---VDALKESSESDVLGKETNVVKKPVYPP  386
             P   ++  EEDEE+L+ALAASMEGMKD+N    D  KE++ +D   K  +  K   YPP
Sbjct  306  LPAFTNETNEEDEEMLRALAASMEGMKDSNRMPSDG-KEAASADEDEKSCST-KILAYPP  363

Query  385  LPEEPKGDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAI  206
            LPEEPKG+++++CRVG+RLPDGRR+QRNFL++DPIQLLWSFC+S LEE   +PFRLTQAI
Sbjct  364  LPEEPKGERSILCRVGLRLPDGRRIQRNFLKTDPIQLLWSFCTSQLEEAGTRPFRLTQAI  423

Query  205  PGATSSLDFESNLTFEESGLANSMISVTWD  116
            PGA  SLD++S +TF ESGLANSMISV W+
Sbjct  424  PGA-KSLDYDSKVTFGESGLANSMISVAWE  452



>gb|KHN06997.1| UBX domain-containing protein 7 [Glycine soja]
Length=494

 Score =   233 bits (594),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 123/203 (61%), Positives = 154/203 (76%), Gaps = 7/203 (3%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRESPQAPPlhkddake  527
            DPITGQKMRSW GMVQPE+LLE LL F+D  P DH ++LSHKRPR S   P        +
Sbjct  292  DPITGQKMRSWIGMVQPESLLEGLLAFLDAGPKDHHITLSHKRPRGSSSPPKSKALVESD  351

Query  526  edeel----lqalaASMEGMKDTNVDALKESSESDV--LGKETNVVKKPVYPPLPEEPKG  365
            E++E      +ALAASME MK++ V   +++ ++DV   G++T + K+ +YP LPEEPK 
Sbjct  352  ENKEEDEEVQRALAASMESMKESTVMTGRDNIDTDVAVYGQQTTLAKRLIYPALPEEPKV  411

Query  364  DKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSL  185
            ++NL+CRVG+RLPDG R+QRNFLR+DPIQLLWSF S+ L E + KPFRLT AIPGA+  L
Sbjct  412  ERNLLCRVGVRLPDGHRIQRNFLRTDPIQLLWSFISAQLGEDERKPFRLTHAIPGASKIL  471

Query  184  DFESNLTFEESGLANSMISVTWD  116
            D+ESN TF+ESGLANSMISVTWD
Sbjct  472  DYESNSTFQESGLANSMISVTWD  494



>ref|XP_003547850.1| PREDICTED: UBX domain-containing protein 7-like isoform 1 [Glycine 
max]
 gb|KHN44547.1| UBX domain-containing protein 7 [Glycine soja]
Length=467

 Score =   232 bits (591),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 124/203 (61%), Positives = 152/203 (75%), Gaps = 7/203 (3%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRESPQAPPlhkddak-  530
            DPITGQKMRSW GMVQPE+LLE LL F+D  P DH +++SHKRPR S   P         
Sbjct  265  DPITGQKMRSWIGMVQPESLLEGLLAFLDAGPKDHHITMSHKRPRGSSSPPKSKALVESD  324

Query  529  ---eedeellqalaASMEGMKDTNVDALKESSESDVL--GKETNVVKKPVYPPLPEEPKG  365
               EE EE+ +ALAASME MK++   A +++ ++DV   G+ET + K+P YP LPEEPK 
Sbjct  325  ENKEEYEEVQRALAASMESMKESTAMAGRDNKDADVAVNGQETPMAKRPTYPTLPEEPKV  384

Query  364  DKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSL  185
            ++NL+CRVG+RLPDGRR+QRNFLR+DPIQLLWSF S+ L E +   FRLT AIPGA+  L
Sbjct  385  ERNLLCRVGVRLPDGRRVQRNFLRTDPIQLLWSFISAQLGEDETNSFRLTHAIPGASKIL  444

Query  184  DFESNLTFEESGLANSMISVTWD  116
            D+E N TF+ESGLANSMISVTWD
Sbjct  445  DYEINSTFQESGLANSMISVTWD  467



>ref|XP_007156392.1| hypothetical protein PHAVU_003G282600g [Phaseolus vulgaris]
 gb|ESW28386.1| hypothetical protein PHAVU_003G282600g [Phaseolus vulgaris]
Length=461

 Score =   229 bits (585),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 127/204 (62%), Positives = 159/204 (78%), Gaps = 8/204 (4%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRESPQAPP----lhkd  539
            DPITGQKMRSW GMV PE+LLE LL F+D  P DH ++LSHKRPR S   P     +  +
Sbjct  258  DPITGQKMRSWIGMVPPESLLEGLLAFLDAGPKDHHITLSHKRPRGSSSPPKPKALVESN  317

Query  538  dakeedeellqalaASMEGMKD-TNVDALKESSESDVL--GKETNVVKKPVYPPLPEEPK  368
            + KEEDEE+ +ALAASME MK+ T +    ++ ++DV   G+ET + K+P YPPLPEEPK
Sbjct  318  ENKEEDEEVQRALAASMESMKESTAMAGGGDNKDADVAVNGQETKLAKRPTYPPLPEEPK  377

Query  367  GDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSS  188
             ++NL+CRVG+RLP G+R+QRNFLR+DPIQLLWSF S+ L E + KPFRLT AIPGA+ +
Sbjct  378  AERNLLCRVGVRLPGGQRVQRNFLRTDPIQLLWSFISTQLGEDETKPFRLTHAIPGASKN  437

Query  187  LDFESNLTFEESGLANSMISVTWD  116
            LD+ESN TF++SGLANSMISVTWD
Sbjct  438  LDYESNSTFQDSGLANSMISVTWD  461



>ref|XP_004509607.1| PREDICTED: UBX domain-containing protein 7-like [Cicer arietinum]
Length=460

 Score =   229 bits (584),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 128/203 (63%), Positives = 156/203 (77%), Gaps = 7/203 (3%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVS-LSHKRPRESPQAPPlhkd----  539
            DPITGQKMRSW GMVQPE+LLE LL F+D  P DH S LSHKRPR S   P         
Sbjct  258  DPITGQKMRSWSGMVQPESLLEGLLTFLDVGPKDHHSTLSHKRPRGSSSPPKTKAIVDSD  317

Query  538  dakeedeellqalaASMEGMKDTNVDALKESSESDVLGK--ETNVVKKPVYPPLPEEPKG  365
             +KEEDEE+ +ALAAS+E MK+ +  A  ++ +++V GK  ET + K+PVYP LPEEPK 
Sbjct  318  ASKEEDEEVQRALAASLENMKELSAIAGGDNKDANVAGKLQETALSKRPVYPTLPEEPKA  377

Query  364  DKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSL  185
            ++NL+CRVG+RLPDGRR+QRNFLRSDPIQLLWSF +  L E + K F+LT AIPGA+ +L
Sbjct  378  ERNLLCRVGLRLPDGRRVQRNFLRSDPIQLLWSFIAVQLGEDETKAFKLTHAIPGASKNL  437

Query  184  DFESNLTFEESGLANSMISVTWD  116
            D+ESN TF+ESGLANSMISVTW+
Sbjct  438  DYESNSTFDESGLANSMISVTWE  460



>ref|XP_011025166.1| PREDICTED: UBX domain-containing protein 7-like [Populus euphratica]
Length=455

 Score =   226 bits (576),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 126/203 (62%), Positives = 151/203 (74%), Gaps = 8/203 (4%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRESPQAP-----Plhk  542
            DPITGQKM SW GMVQPE+LLEDL+PFMDG P DH  +LSHKR R S   P     P+  
Sbjct  254  DPITGQKMHSWVGMVQPESLLEDLVPFMDGGPRDHHKTLSHKRLRGSSLTPQKSKAPVPA  313

Query  541  ddakeedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKK-PVYPPLPEEPKG  365
             +  EED+E+ +ALAASME MK+++  A  +  E+    +E     + P+YPPLPEEP G
Sbjct  314  YETNEEDKEVQKALAASMESMKESSAVASNDKDEASTTQEEEKCSSRMPMYPPLPEEPSG  373

Query  364  DKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSL  185
            DK+L+CRVGIRLPDGRR+QRNFL++DPIQLLWSFC S LEE   K FRLT+AIPGA   L
Sbjct  374  DKSLLCRVGIRLPDGRRVQRNFLKTDPIQLLWSFCYSQLEEAGTKLFRLTEAIPGA-KRL  432

Query  184  DFESNLTFEESGLANSMISVTWD  116
            D++S +TF ESGLANSMISV WD
Sbjct  433  DYDSKMTFGESGLANSMISVAWD  455



>ref|XP_006855568.1| hypothetical protein AMTR_s00044p00018360 [Amborella trichopoda]
 gb|ERN17035.1| hypothetical protein AMTR_s00044p00018360 [Amborella trichopoda]
Length=442

 Score =   224 bits (572),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 120/202 (59%), Positives = 147/202 (73%), Gaps = 6/202 (3%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVSLSHKRPRESPQAPPlhkddakee  524
            DP+TGQKMR W GMV P+ LLEDL+P+MD  P DH  + HKRPRE+  A      D   E
Sbjct  241  DPVTGQKMRGWSGMVGPDRLLEDLVPYMDKGPMDHHPIPHKRPRETTPAAKATLQDKHTE  300

Query  523  de--ellqalaASMEGMKD----TNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGD  362
            DE  E+ +A AAS+EGMK+    +N    +E+     + +      KP YPPLPEEPKGD
Sbjct  301  DEDEEIQRAFAASLEGMKEPMVPSNGGDNRETDSEAKVEQTCPSTTKPSYPPLPEEPKGD  360

Query  361  KNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLD  182
            ++L+CRVG+RLPDGRRLQRNFLR DPIQLLWSFC S ++E + +PF+LTQAIPGA+  LD
Sbjct  361  RSLLCRVGVRLPDGRRLQRNFLRKDPIQLLWSFCCSEVKEANIQPFKLTQAIPGASKYLD  420

Query  181  FESNLTFEESGLANSMISVTWD  116
            + SNLTFEESGL NSMIS+TWD
Sbjct  421  YNSNLTFEESGLLNSMISLTWD  442



>ref|XP_002311564.2| hypothetical protein POPTR_0008s14230g [Populus trichocarpa]
 gb|EEE88931.2| hypothetical protein POPTR_0008s14230g [Populus trichocarpa]
Length=455

 Score =   225 bits (573),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 126/203 (62%), Positives = 151/203 (74%), Gaps = 8/203 (4%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRESPQAP-----Plhk  542
            DPITGQKM SW GMVQPE+LLEDL+PFMDG P DH  +LSHKR R S   P     P+  
Sbjct  254  DPITGQKMHSWVGMVQPESLLEDLVPFMDGGPRDHHKTLSHKRLRGSSLTPQKSKAPVPA  313

Query  541  ddakeedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKK-PVYPPLPEEPKG  365
             +  EEDEE+ +ALAASME MK+++  A  +  E+    +E N   + P+YPPLPEEP G
Sbjct  314  YETNEEDEEVQRALAASMESMKESSAVASNDKDEASTTQEEENCSSRMPMYPPLPEEPSG  373

Query  364  DKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSL  185
            DK+L+CRVGIRLPDG R+QRNFL++DPIQLLWSFC S LEE   K FRLT+AIPG +  L
Sbjct  374  DKSLLCRVGIRLPDGHRVQRNFLKTDPIQLLWSFCYSQLEEAGTKLFRLTEAIPG-SKRL  432

Query  184  DFESNLTFEESGLANSMISVTWD  116
            D++S +TF ESGLANSMISV WD
Sbjct  433  DYDSKMTFGESGLANSMISVAWD  455



>ref|XP_010654914.1| PREDICTED: UBX domain-containing protein 2 isoform X3 [Vitis 
vinifera]
Length=453

 Score =   225 bits (573),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 135/199 (68%), Positives = 153/199 (77%), Gaps = 3/199 (2%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRESPQAPPlhkddake  527
            DPITGQKMRSW GM+QPE LLEDLLPFMDG P DH V+LSHKRPRES   PP    D   
Sbjct  255  DPITGQKMRSWCGMIQPERLLEDLLPFMDGGPKDHHVTLSHKRPRESSLTPPQKIQDETN  314

Query  526  ed-eellqalaASMEGMKDTNVDALKESSESDVLGKETNV-VKKPVYPPLPEEPKGDKNL  353
            E+ EE+  ALAASM  MKD +    KE   +    KE     KKP YPPLPEEPKGD+NL
Sbjct  315  EEDEEVQLALAASMASMKDPSGLTSKEKDVTTTDKKEEMCSAKKPEYPPLPEEPKGDRNL  374

Query  352  VCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFES  173
            +CRVG+RLPDGRR+QRNFLR+DPIQLLWSFC S LEE  ++PF LTQAIPGA+ +LD++ 
Sbjct  375  LCRVGVRLPDGRRIQRNFLRTDPIQLLWSFCYSQLEEVVSRPFHLTQAIPGASQNLDYDR  434

Query  172  NLTFEESGLANSMISVTWD  116
             LTFEESGLANSMISVTW+
Sbjct  435  ELTFEESGLANSMISVTWE  453



>ref|XP_003631347.1| PREDICTED: UBX domain-containing protein 2 isoform X1 [Vitis 
vinifera]
 emb|CBI27509.3| unnamed protein product [Vitis vinifera]
Length=456

 Score =   224 bits (572),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 134/202 (66%), Positives = 151/202 (75%), Gaps = 6/202 (3%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRESPQAPPlhkddake  527
            DPITGQKMRSW GM+QPE LLEDLLPFMDG P DH V+LSHKRPRES   PP     A +
Sbjct  255  DPITGQKMRSWCGMIQPERLLEDLLPFMDGGPKDHHVTLSHKRPRESSLTPPQKIQVAAD  314

Query  526  edeel----lqalaASMEGMKDTNVDALKESSESDVLGKETNV-VKKPVYPPLPEEPKGD  362
            E  E       ALAASM  MKD +    KE   +    KE     KKP YPPLPEEPKGD
Sbjct  315  ETNEEDEEVQLALAASMASMKDPSGLTSKEKDVTTTDKKEEMCSAKKPEYPPLPEEPKGD  374

Query  361  KNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLD  182
            +NL+CRVG+RLPDGRR+QRNFLR+DPIQLLWSFC S LEE  ++PF LTQAIPGA+ +LD
Sbjct  375  RNLLCRVGVRLPDGRRIQRNFLRTDPIQLLWSFCYSQLEEVVSRPFHLTQAIPGASQNLD  434

Query  181  FESNLTFEESGLANSMISVTWD  116
            ++  LTFEESGLANSMISVTW+
Sbjct  435  YDRELTFEESGLANSMISVTWE  456



>ref|XP_010654910.1| PREDICTED: UBX domain-containing protein 2 isoform X2 [Vitis 
vinifera]
Length=454

 Score =   224 bits (572),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 134/202 (66%), Positives = 151/202 (75%), Gaps = 6/202 (3%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRESPQAPPlhkddake  527
            DPITGQKMRSW GM+QPE LLEDLLPFMDG P DH V+LSHKRPRES   PP     A +
Sbjct  253  DPITGQKMRSWCGMIQPERLLEDLLPFMDGGPKDHHVTLSHKRPRESSLTPPQKIQVAAD  312

Query  526  edeel----lqalaASMEGMKDTNVDALKESSESDVLGKETNV-VKKPVYPPLPEEPKGD  362
            E  E       ALAASM  MKD +    KE   +    KE     KKP YPPLPEEPKGD
Sbjct  313  ETNEEDEEVQLALAASMASMKDPSGLTSKEKDVTTTDKKEEMCSAKKPEYPPLPEEPKGD  372

Query  361  KNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLD  182
            +NL+CRVG+RLPDGRR+QRNFLR+DPIQLLWSFC S LEE  ++PF LTQAIPGA+ +LD
Sbjct  373  RNLLCRVGVRLPDGRRIQRNFLRTDPIQLLWSFCYSQLEEVVSRPFHLTQAIPGASQNLD  432

Query  181  FESNLTFEESGLANSMISVTWD  116
            ++  LTFEESGLANSMISVTW+
Sbjct  433  YDRELTFEESGLANSMISVTWE  454



>ref|XP_011463491.1| PREDICTED: UBX domain-containing protein 2 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=486

 Score =   225 bits (573),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 125/202 (62%), Positives = 152/202 (75%), Gaps = 9/202 (4%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRES--PQAPPlhkdda  533
            DPITGQKMRSW GMV PE LLEDLL FMD  P DH ++LS+KRPRES  PQ P    +  
Sbjct  288  DPITGQKMRSWNGMVHPERLLEDLLLFMDSGPRDHHLALSNKRPRESSLPQ-PQNTNEQT  346

Query  532  keedeellqalaASMEGMKDTNVDALKESSESDVLG---KETNVVKKPVYPPLPEEPKGD  362
             EEDEE+ +ALAASM  MK+T+    K+  E +++    +ET++ KKP YPPLPEEP GD
Sbjct  347  NEEDEEVQRALAASMGSMKETSGTISKD--EGEIITDKEEETSLPKKPTYPPLPEEPSGD  404

Query  361  KNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLD  182
            K+ +CRVG+RLPDGRR QRNFLR DPIQLLWSFC S L+E + +P RLT A+PGAT  LD
Sbjct  405  KSRICRVGVRLPDGRRAQRNFLRVDPIQLLWSFCYSQLKEAETRPIRLTHAVPGATKCLD  464

Query  181  FESNLTFEESGLANSMISVTWD  116
            ++   TFEESGL N+M+SVTW+
Sbjct  465  YDCESTFEESGLPNTMVSVTWE  486



>ref|XP_004297788.1| PREDICTED: UBX domain-containing protein 2 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=489

 Score =   224 bits (572),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 124/204 (61%), Positives = 152/204 (75%), Gaps = 10/204 (5%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRES----PQAPPlhkd  539
            DPITGQKMRSW GMV PE LLEDLL FMD  P DH ++LS+KRPRES    PQ   +  +
Sbjct  288  DPITGQKMRSWNGMVHPERLLEDLLLFMDSGPRDHHLALSNKRPRESSLPQPQNTNVVAE  347

Query  538  dakeedeellqalaASMEGMKDTNVDALKESSESDVLG---KETNVVKKPVYPPLPEEPK  368
               EEDEE+ +ALAASM  MK+T+    K+  E +++    +ET++ KKP YPPLPEEP 
Sbjct  348  QTNEEDEEVQRALAASMGSMKETSGTISKD--EGEIITDKEEETSLPKKPTYPPLPEEPS  405

Query  367  GDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSS  188
            GDK+ +CRVG+RLPDGRR QRNFLR DPIQLLWSFC S L+E + +P RLT A+PGAT  
Sbjct  406  GDKSRICRVGVRLPDGRRAQRNFLRVDPIQLLWSFCYSQLKEAETRPIRLTHAVPGATKC  465

Query  187  LDFESNLTFEESGLANSMISVTWD  116
            LD++   TFEESGL N+M+SVTW+
Sbjct  466  LDYDCESTFEESGLPNTMVSVTWE  489



>gb|EYU30240.1| hypothetical protein MIMGU_mgv1a006061mg [Erythranthe guttata]
Length=437

 Score =   223 bits (567),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 119/198 (60%), Positives = 150/198 (76%), Gaps = 10/198 (5%)
 Frame = -2

Query  688  QKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRESPQAPPlhkddakeedeel  512
            +K+ +WRGMVQPE LLEDL+PFMDGSPSDH VSLSHKRPR   +AP  H   A  E+ + 
Sbjct  243  KKLHAWRGMVQPENLLEDLVPFMDGSPSDHHVSLSHKRPRVHTEAPVHHIQSAAAENHDE  302

Query  511  ------lqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGDKNLV  350
                   +ALAASM   K+ +    KE +E++   ++    KKP Y PLPEEPKGD++L+
Sbjct  303  DEEEELQRALAASMVDTKEIDEGDSKEVTEANNAEEKE---KKPSYLPLPEEPKGDRSLL  359

Query  349  CRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFESN  170
            CRVG+RLPDGRR+QRNFLR+DP+QLLWSFC S ++E D+KPFR+TQAIPGA+ SLD++  
Sbjct  360  CRVGVRLPDGRRVQRNFLRTDPVQLLWSFCYSEMKEIDSKPFRITQAIPGASRSLDYDVT  419

Query  169  LTFEESGLANSMISVTWD  116
             TF ESGLANSM+SVTW+
Sbjct  420  STFAESGLANSMVSVTWE  437



>ref|XP_003628976.1| UBX domain-containing protein [Medicago truncatula]
 ref|XP_003636613.1| UBX domain-containing protein [Medicago truncatula]
 gb|AET03452.1| structural constituent of ribosome protein, putative [Medicago 
truncatula]
Length=461

 Score =   222 bits (565),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 151/202 (75%), Gaps = 6/202 (3%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHV-SLSHKRPRESPQAPPlhkd----  539
            DPITGQKMR+W GMVQP++LLE LLPF D  P DH  +LSHKRPR S   P         
Sbjct  260  DPITGQKMRAWGGMVQPDSLLEGLLPFFDAGPKDHHNTLSHKRPRGSSSPPKPKATLDSD  319

Query  538  dakeedeellqalaASMEGMKDTNVDALKESSESDVLGK-ETNVVKKPVYPPLPEEPKGD  362
              KEEDEE+ +ALAAS+E +K+++  A  +  E++V G  +   + +P YP LPEEPK +
Sbjct  320  ANKEEDEEVQRALAASLESVKESSEMAEGDDKEANVAGNVQETALPRPAYPTLPEEPKAE  379

Query  361  KNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLD  182
            +NL+CRVG+RLPDGRR+QRNFLRS+PIQLLWSF +  L E + KPF+LT AIPGAT +LD
Sbjct  380  RNLLCRVGVRLPDGRRVQRNFLRSEPIQLLWSFIAVQLGEDETKPFKLTHAIPGATKNLD  439

Query  181  FESNLTFEESGLANSMISVTWD  116
            +ESN TFEESGLA SMISVTWD
Sbjct  440  YESNSTFEESGLAYSMISVTWD  461



>ref|XP_009351644.1| PREDICTED: UBX domain-containing protein 2 isoform X3 [Pyrus 
x bretschneideri]
Length=452

 Score =   221 bits (563),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 131/198 (66%), Positives = 158/198 (80%), Gaps = 3/198 (2%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRESPQAPPlhkddake  527
            DPITGQKMRSW GMV P+ LLEDLL F+D  P DH V+LS+KRPRE+ Q P   KD   E
Sbjct  256  DPITGQKMRSWNGMVHPDRLLEDLLLFLDSGPRDHHVTLSNKRPRETAQ-PQKTKDGTNE  314

Query  526  edeellqalaASMEGMKDTNVDALKESSESDVLGKE-TNVVKKPVYPPLPEEPKGDKNLV  350
            EDEE+ +ALAASMEGMK+T+    K+  ES    +E T+ +K P YPPLPEEPKGD++L+
Sbjct  315  EDEEVQRALAASMEGMKETSRTTSKDKDESITEKEEGTSSIKMPTYPPLPEEPKGDRSLL  374

Query  349  CRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFESN  170
            CRVG+RLPDGRR+QRNFLR DPIQLLWSFC S L+E +A+PF LTQAIPGA+ +LD++  
Sbjct  375  CRVGVRLPDGRRVQRNFLRVDPIQLLWSFCYSQLKEAEARPFHLTQAIPGASKNLDYDCQ  434

Query  169  LTFEESGLANSMISVTWD  116
             TFEESGLANSM+SVTW+
Sbjct  435  STFEESGLANSMVSVTWE  452



>ref|XP_010527852.1| PREDICTED: UBX domain-containing protein 2 isoform X2 [Tarenaya 
hassleriana]
Length=405

 Score =   219 bits (557),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 120/202 (59%), Positives = 150/202 (74%), Gaps = 6/202 (3%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRESPQAPPlhkdd--a  533
            DP TGQKMR W GM+ PE LLEDL+PFMDG P +H V+LS KRPR S   P         
Sbjct  204  DPTTGQKMRLWCGMIDPERLLEDLVPFMDGGPREHLVALSKKRPRASSLTPHSKAKVDIT  263

Query  532  keedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKK---PVYPPLPEEPKGD  362
             EEDEEL +ALAAS+E M++++ +A     ++  L ++         P YPPLPEEPKGD
Sbjct  264  NEEDEELQRALAASLENMEESSEEAAIPEEQTSTLPEKDETFSSNAMPTYPPLPEEPKGD  323

Query  361  KNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLD  182
            ++++CRVG+RLPDGRRLQRNFL++DPIQLLWSFC S +E  + KPF+LTQAIPG  ++LD
Sbjct  324  RSILCRVGVRLPDGRRLQRNFLKTDPIQLLWSFCYSQMEGWERKPFKLTQAIPGTANTLD  383

Query  181  FESNLTFEESGLANSMISVTWD  116
            +ES LTFE+SGLANSMISVTW+
Sbjct  384  YESILTFEQSGLANSMISVTWE  405



>ref|XP_008389122.1| PREDICTED: UBX domain-containing protein 2-like isoform X3 [Malus 
domestica]
Length=440

 Score =   219 bits (557),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 128/198 (65%), Positives = 157/198 (79%), Gaps = 3/198 (2%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRESPQAPPlhkddake  527
            DPITGQKMRSW GMV P+  LEDLL F+D  P DH V+LS+KRPRE+   P   K++  E
Sbjct  244  DPITGQKMRSWNGMVHPDRFLEDLLLFLDSGPRDHHVTLSNKRPRETAH-PQKTKEETNE  302

Query  526  edeellqalaASMEGMKDTNVDALKESSESDV-LGKETNVVKKPVYPPLPEEPKGDKNLV  350
            EDEE+ +ALAASMEGMK+T+    K+  E      +ET+ +K P YPPLPEEPKGD+NL+
Sbjct  303  EDEEMQRALAASMEGMKETSGTISKDKDEIITDKEEETSSIKMPTYPPLPEEPKGDRNLL  362

Query  349  CRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFESN  170
            CRVG+RLPDGRR+QRNFLR DPIQLLWSFC S L+E +A+PF+LTQAIPGA+ +LD++  
Sbjct  363  CRVGVRLPDGRRVQRNFLRIDPIQLLWSFCYSQLKEAEARPFQLTQAIPGASKNLDYDCQ  422

Query  169  LTFEESGLANSMISVTWD  116
             TFEESGLANSM+SVTW+
Sbjct  423  STFEESGLANSMVSVTWE  440



>ref|XP_010527851.1| PREDICTED: UBX domain-containing protein 2 isoform X1 [Tarenaya 
hassleriana]
Length=459

 Score =   219 bits (559),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 120/202 (59%), Positives = 150/202 (74%), Gaps = 6/202 (3%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRESPQAPPlhkdd--a  533
            DP TGQKMR W GM+ PE LLEDL+PFMDG P +H V+LS KRPR S   P         
Sbjct  258  DPTTGQKMRLWCGMIDPERLLEDLVPFMDGGPREHLVALSKKRPRASSLTPHSKAKVDIT  317

Query  532  keedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKK---PVYPPLPEEPKGD  362
             EEDEEL +ALAAS+E M++++ +A     ++  L ++         P YPPLPEEPKGD
Sbjct  318  NEEDEELQRALAASLENMEESSEEAAIPEEQTSTLPEKDETFSSNAMPTYPPLPEEPKGD  377

Query  361  KNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLD  182
            ++++CRVG+RLPDGRRLQRNFL++DPIQLLWSFC S +E  + KPF+LTQAIPG  ++LD
Sbjct  378  RSILCRVGVRLPDGRRLQRNFLKTDPIQLLWSFCYSQMEGWERKPFKLTQAIPGTANTLD  437

Query  181  FESNLTFEESGLANSMISVTWD  116
            +ES LTFE+SGLANSMISVTW+
Sbjct  438  YESILTFEQSGLANSMISVTWE  459



>ref|XP_010554359.1| PREDICTED: UBX domain-containing protein 2-like [Tarenaya hassleriana]
Length=463

 Score =   219 bits (559),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 121/200 (61%), Positives = 151/200 (76%), Gaps = 5/200 (3%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHV-SLSHKRPRESPQAPPlhkdda--  533
            DP TGQKMR W G+++PETLLEDL+PFMDG P DH+ SLS KRPR S   P         
Sbjct  261  DPTTGQKMRLWCGVIEPETLLEDLVPFMDGGPRDHLASLSKKRPRGSSLTPHSKTKADVP  320

Query  532  keedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKK--PVYPPLPEEPKGDK  359
             +E+EEL +ALAAS+E M++++  A  E   S +  KE   +    P +PPLPEEPKG+ 
Sbjct  321  NDEEEELQRALAASLENMEESSDKATAEEKTSTMPEKEGTDLSNSMPSFPPLPEEPKGNP  380

Query  358  NLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDF  179
            +++CRVGIRLP+G+RLQRNFL++DPIQLLWSFC+S LEE + KPF+LTQ  PGA  +LD+
Sbjct  381  SVLCRVGIRLPNGKRLQRNFLKTDPIQLLWSFCNSQLEEPERKPFKLTQPFPGAAKTLDY  440

Query  178  ESNLTFEESGLANSMISVTW  119
            ESNLTFE+SGLANSMISVTW
Sbjct  441  ESNLTFEQSGLANSMISVTW  460



>ref|XP_009351643.1| PREDICTED: UBX domain-containing protein 2 isoform X2 [Pyrus 
x bretschneideri]
Length=454

 Score =   218 bits (555),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 129/199 (65%), Positives = 156/199 (78%), Gaps = 3/199 (2%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRESPQ-APPlhkddak  530
            DPITGQKMRSW GMV P+ LLEDLL F+D  P DH V+LS+KRPRE+ Q       D   
Sbjct  256  DPITGQKMRSWNGMVHPDRLLEDLLLFLDSGPRDHHVTLSNKRPRETAQPQKTKVADGTN  315

Query  529  eedeellqalaASMEGMKDTNVDALKESSESDVLGKE-TNVVKKPVYPPLPEEPKGDKNL  353
            EEDEE+ +ALAASMEGMK+T+    K+  ES    +E T+ +K P YPPLPEEPKGD++L
Sbjct  316  EEDEEVQRALAASMEGMKETSRTTSKDKDESITEKEEGTSSIKMPTYPPLPEEPKGDRSL  375

Query  352  VCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFES  173
            +CRVG+RLPDGRR+QRNFLR DPIQLLWSFC S L+E +A+PF LTQAIPGA+ +LD++ 
Sbjct  376  LCRVGVRLPDGRRVQRNFLRVDPIQLLWSFCYSQLKEAEARPFHLTQAIPGASKNLDYDC  435

Query  172  NLTFEESGLANSMISVTWD  116
              TFEESGLANSM+SVTW+
Sbjct  436  QSTFEESGLANSMVSVTWE  454



>ref|XP_006378421.1| hypothetical protein POPTR_0010s10910g [Populus trichocarpa]
 gb|ERP56218.1| hypothetical protein POPTR_0010s10910g [Populus trichocarpa]
Length=451

 Score =   218 bits (555),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 120/205 (59%), Positives = 141/205 (69%), Gaps = 14/205 (7%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRESPQAPPlhkddake  527
            DPITGQKM SW GMVQPE+LLEDL+PFMDG P DH  +LSHKR R S   PP  K++ +E
Sbjct  252  DPITGQKMHSWVGMVQPESLLEDLVPFMDGGPRDHHKTLSHKRQRGSSLTPPKSKEEDEE  311

Query  526  edeellqalaASMEGMKDTNVDALKESS--------ESDVLGKETNVVKKPVYPPLPEEP  371
                L      SME MKD++V A  +           S   G+E    K   YPPLPEEP
Sbjct  312  VLRALAA----SMESMKDSSVIASNKKDIASNDKDDASTAKGEEKCSTKTLTYPPLPEEP  367

Query  370  KGDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATS  191
             GDK+L+CRVGIRLPDGRR+QRNFL++DPI+LLWSFC S LEE   K F L +AIPGA  
Sbjct  368  SGDKSLLCRVGIRLPDGRRVQRNFLKTDPIRLLWSFCYSQLEEAGTKLFCLKEAIPGA-K  426

Query  190  SLDFESNLTFEESGLANSMISVTWD  116
             LD++S +TF ESGLANSMISV W+
Sbjct  427  RLDYDSTMTFGESGLANSMISVAWE  451



>ref|XP_002315828.1| UBX domain-containing family protein [Populus trichocarpa]
 gb|EEF01999.1| UBX domain-containing family protein [Populus trichocarpa]
Length=444

 Score =   218 bits (554),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 120/205 (59%), Positives = 141/205 (69%), Gaps = 14/205 (7%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRESPQAPPlhkddake  527
            DPITGQKM SW GMVQPE+LLEDL+PFMDG P DH  +LSHKR R S   PP  K++ +E
Sbjct  245  DPITGQKMHSWVGMVQPESLLEDLVPFMDGGPRDHHKTLSHKRQRGSSLTPPKSKEEDEE  304

Query  526  edeellqalaASMEGMKDTNVDALKESS--------ESDVLGKETNVVKKPVYPPLPEEP  371
                L      SME MKD++V A  +           S   G+E    K   YPPLPEEP
Sbjct  305  VLRALAA----SMESMKDSSVIASNKKDIASNDKDDASTAKGEEKCSTKTLTYPPLPEEP  360

Query  370  KGDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATS  191
             GDK+L+CRVGIRLPDGRR+QRNFL++DPI+LLWSFC S LEE   K F L +AIPGA  
Sbjct  361  SGDKSLLCRVGIRLPDGRRVQRNFLKTDPIRLLWSFCYSQLEEAGTKLFCLKEAIPGA-K  419

Query  190  SLDFESNLTFEESGLANSMISVTWD  116
             LD++S +TF ESGLANSMISV W+
Sbjct  420  RLDYDSTMTFGESGLANSMISVAWE  444



>ref|XP_009351642.1| PREDICTED: UBX domain-containing protein 2 isoform X1 [Pyrus 
x bretschneideri]
Length=457

 Score =   217 bits (552),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 129/202 (64%), Positives = 156/202 (77%), Gaps = 6/202 (3%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRESPQ----APPlhkd  539
            DPITGQKMRSW GMV P+ LLEDLL F+D  P DH V+LS+KRPRE+ Q          D
Sbjct  256  DPITGQKMRSWNGMVHPDRLLEDLLLFLDSGPRDHHVTLSNKRPRETAQPQKTKDASVAD  315

Query  538  dakeedeellqalaASMEGMKDTNVDALKESSESDVLGKE-TNVVKKPVYPPLPEEPKGD  362
               EEDEE+ +ALAASMEGMK+T+    K+  ES    +E T+ +K P YPPLPEEPKGD
Sbjct  316  GTNEEDEEVQRALAASMEGMKETSRTTSKDKDESITEKEEGTSSIKMPTYPPLPEEPKGD  375

Query  361  KNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLD  182
            ++L+CRVG+RLPDGRR+QRNFLR DPIQLLWSFC S L+E +A+PF LTQAIPGA+ +LD
Sbjct  376  RSLLCRVGVRLPDGRRVQRNFLRVDPIQLLWSFCYSQLKEAEARPFHLTQAIPGASKNLD  435

Query  181  FESNLTFEESGLANSMISVTWD  116
            ++   TFEESGLANSM+SVTW+
Sbjct  436  YDCQSTFEESGLANSMVSVTWE  457



>ref|XP_008389121.1| PREDICTED: UBX domain-containing protein 2-like isoform X2 [Malus 
domestica]
Length=442

 Score =   216 bits (549),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 126/199 (63%), Positives = 155/199 (78%), Gaps = 3/199 (2%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRESPQ-APPlhkddak  530
            DPITGQKMRSW GMV P+  LEDLL F+D  P DH V+LS+KRPRE+         ++  
Sbjct  244  DPITGQKMRSWNGMVHPDRFLEDLLLFLDSGPRDHHVTLSNKRPRETAHPQKTKVAEETN  303

Query  529  eedeellqalaASMEGMKDTNVDALKESSESDV-LGKETNVVKKPVYPPLPEEPKGDKNL  353
            EEDEE+ +ALAASMEGMK+T+    K+  E      +ET+ +K P YPPLPEEPKGD+NL
Sbjct  304  EEDEEMQRALAASMEGMKETSGTISKDKDEIITDKEEETSSIKMPTYPPLPEEPKGDRNL  363

Query  352  VCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFES  173
            +CRVG+RLPDGRR+QRNFLR DPIQLLWSFC S L+E +A+PF+LTQAIPGA+ +LD++ 
Sbjct  364  LCRVGVRLPDGRRVQRNFLRIDPIQLLWSFCYSQLKEAEARPFQLTQAIPGASKNLDYDC  423

Query  172  NLTFEESGLANSMISVTWD  116
              TFEESGLANSM+SVTW+
Sbjct  424  QSTFEESGLANSMVSVTWE  442



>ref|XP_008389120.1| PREDICTED: UBX domain-containing protein 2-like isoform X1 [Malus 
domestica]
Length=445

 Score =   215 bits (548),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 128/202 (63%), Positives = 157/202 (78%), Gaps = 6/202 (3%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRES--PQAP--Plhkd  539
            DPITGQKMRSW GMV P+  LEDLL F+D  P DH V+LS+KRPRE+  PQ        +
Sbjct  244  DPITGQKMRSWNGMVHPDRFLEDLLLFLDSGPRDHHVTLSNKRPRETAHPQKTKDASVAE  303

Query  538  dakeedeellqalaASMEGMKDTNVDALKESSESDV-LGKETNVVKKPVYPPLPEEPKGD  362
            +  EEDEE+ +ALAASMEGMK+T+    K+  E      +ET+ +K P YPPLPEEPKGD
Sbjct  304  ETNEEDEEMQRALAASMEGMKETSGTISKDKDEIITDKEEETSSIKMPTYPPLPEEPKGD  363

Query  361  KNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLD  182
            +NL+CRVG+RLPDGRR+QRNFLR DPIQLLWSFC S L+E +A+PF+LTQAIPGA+ +LD
Sbjct  364  RNLLCRVGVRLPDGRRVQRNFLRIDPIQLLWSFCYSQLKEAEARPFQLTQAIPGASKNLD  423

Query  181  FESNLTFEESGLANSMISVTWD  116
            ++   TFEESGLANSM+SVTW+
Sbjct  424  YDCQSTFEESGLANSMVSVTWE  445



>ref|XP_007052064.1| UBX domain-containing protein [Theobroma cacao]
 gb|EOX96221.1| UBX domain-containing protein [Theobroma cacao]
Length=431

 Score =   214 bits (545),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 114/198 (58%), Positives = 139/198 (70%), Gaps = 15/198 (8%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSD-HVSLSHKRPRESPQAPPlhkddake  527
            DPITG+KMRS  GMV+PE+LLEDL+ FMDG P D H +LS KRPR S   P         
Sbjct  247  DPITGEKMRSRCGMVEPESLLEDLVRFMDGGPRDYHATLSLKRPRGSSVTP---------  297

Query  526  edeellqalaASMEGMKDTNVDALKESSESDVLGKETNV-VKKPVYPPLPEEPKGDKNLV  350
                  +   ++ E M+D  +     +S  +V  KE     KKP YPPLPEEPKGD++L+
Sbjct  298  ----QQRVKMSTDETMEDEEMLRAVAASLENVKDKEEPCSTKKPTYPPLPEEPKGDRSLL  353

Query  349  CRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFESN  170
            CRVG+RLP GRR+QRNFLR+D IQLLWSFC + L E ++KPFRLTQ IPGA+ SLD++S 
Sbjct  354  CRVGVRLPGGRRVQRNFLRTDSIQLLWSFCYAQLGEAESKPFRLTQPIPGASKSLDYDSK  413

Query  169  LTFEESGLANSMISVTWD  116
            LTFEESGLANSMISV W+
Sbjct  414  LTFEESGLANSMISVAWE  431



>ref|XP_010043889.1| PREDICTED: UBX domain-containing protein 2 isoform X2 [Eucalyptus 
grandis]
 gb|KCW85907.1| hypothetical protein EUGRSUZ_B02622 [Eucalyptus grandis]
Length=453

 Score =   213 bits (543),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 126/200 (63%), Positives = 154/200 (77%), Gaps = 5/200 (3%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRESPQAPPlhkdda--  533
            DPITGQKMRSW GM+QPE+LLE+LL F++G P DH VS SHKRPRE    PP    D   
Sbjct  255  DPITGQKMRSWTGMIQPESLLENLLLFLEGGPKDHHVSSSHKRPREKSATPPQKVKDEMP  314

Query  532  keedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKK-PVYPPLPEEPKGDKN  356
            KEEDEEL  AL AS+E +++  +    E  ++D   +E  +  K P YPPLPEEPKGD++
Sbjct  315  KEEDEELQAALEASLENIEEP-IKTNGEDGKTDTSKEEETITGKIPAYPPLPEEPKGDRS  373

Query  355  LVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFE  176
            L+CRVG+RLPDGRR+QRNFLR+DPIQLLWSFC S LEE +++PFRL QAIPGA+ SLD+ 
Sbjct  374  LLCRVGVRLPDGRRVQRNFLRTDPIQLLWSFCRSQLEEAESRPFRLAQAIPGASKSLDYN  433

Query  175  SNLTFEESGLANSMISVTWD  116
            S LTF+ESGLANSMIS+ W+
Sbjct  434  SKLTFQESGLANSMISLAWE  453



>ref|XP_010043888.1| PREDICTED: UBX domain-containing protein 2 isoform X1 [Eucalyptus 
grandis]
Length=459

 Score =   213 bits (542),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 116/205 (57%), Positives = 151/205 (74%), Gaps = 9/205 (4%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRESPQAPPlhkddake  527
            DPITGQKMRSW GM+QPE+LLE+LL F++G P DH VS SHKRPRE    PP    DA  
Sbjct  255  DPITGQKMRSWTGMIQPESLLENLLLFLEGGPKDHHVSSSHKRPREKSATPPQKVKDAWI  314

Query  526  edeellqalaASMEGMKDTNVDALKE-------SSESDVLGKETNVVKK-PVYPPLPEEP  371
            + +E+ +     ++   + +++ ++E         ++D   +E  +  K P YPPLPEEP
Sbjct  315  DADEMPKEEDEELQAALEASLENIEEPIKTNGEDGKTDTSKEEETITGKIPAYPPLPEEP  374

Query  370  KGDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATS  191
            KGD++L+CRVG+RLPDGRR+QRNFLR+DPIQLLWSFC S LEE +++PFRL QAIPGA+ 
Sbjct  375  KGDRSLLCRVGVRLPDGRRVQRNFLRTDPIQLLWSFCRSQLEEAESRPFRLAQAIPGASK  434

Query  190  SLDFESNLTFEESGLANSMISVTWD  116
            SLD+ S LTF+ESGLANSMIS+ W+
Sbjct  435  SLDYNSKLTFQESGLANSMISLAWE  459



>ref|XP_011021683.1| PREDICTED: UBX domain-containing protein 2-like [Populus euphratica]
Length=457

 Score =   212 bits (540),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 119/210 (57%), Positives = 142/210 (68%), Gaps = 15/210 (7%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRESPQAPPlhkddake  527
            DPITGQKM SW GMVQPE LLEDL+PFMDG P DH  +L HKR R S   PP  K     
Sbjct  249  DPITGQKMHSWVGMVQPENLLEDLVPFMDGGPRDHHKTLPHKRQRGSSPTPPKSKALVSA  308

Query  526  edeell-----qalaASMEGMKDTNVDALKESS--------ESDVLGKETNVVKKPVYPP  386
             + +       +ALAASME MKD++V A  +           S   G+E  + + P YPP
Sbjct  309  YETKEEDEEVLRALAASMESMKDSSVIASNKKDIASNDKDDASTAKGEEKCLTRTPTYPP  368

Query  385  LPEEPKGDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAI  206
            LPEEP GDK+L+CRVGIRLPDG R+QRNFL++DPIQLLWSFC S LEE   K F L +AI
Sbjct  369  LPEEPSGDKSLLCRVGIRLPDGLRVQRNFLKTDPIQLLWSFCYSLLEEAGTKLFFLKEAI  428

Query  205  PGATSSLDFESNLTFEESGLANSMISVTWD  116
            PGA   LD+++ +TF +SGLANSMISV W+
Sbjct  429  PGA-KRLDYDNTMTFGDSGLANSMISVAWE  457



>gb|AFK35082.1| unknown [Medicago truncatula]
Length=195

 Score =   203 bits (516),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 115/195 (59%), Positives = 143/195 (73%), Gaps = 6/195 (3%)
 Frame = -2

Query  682  MRSWRGMVQPETLLEDLLPFMDGSPSDHV-SLSHKRPRESPQAPPlhkd----dakeede  518
            MR+W GMVQP++LLE LLPF D  P DH  +LSHKRPR S   P           KEEDE
Sbjct  1    MRAWGGMVQPDSLLEGLLPFFDAGPKDHHNTLSHKRPRGSSSPPKPKATLDSDANKEEDE  60

Query  517  ellqalaASMEGMKDTNVDALKESSESDVLGK-ETNVVKKPVYPPLPEEPKGDKNLVCRV  341
            E+ +ALAAS+E +K+++  A  +  E++V G  +   + +P YP LPEEPK ++NL+CRV
Sbjct  61   EVQRALAASLESVKESSEMAEGDDKEANVAGNVQETALPRPAYPTLPEEPKAERNLLCRV  120

Query  340  GIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFESNLTF  161
            G+RLPDGRR+QRN LRS+PIQLLWSF +  L E + KPF+LT AIPGAT +LD+ESN TF
Sbjct  121  GVRLPDGRRVQRNSLRSEPIQLLWSFIAVQLGEDETKPFKLTHAIPGATKNLDYESNSTF  180

Query  160  EESGLANSMISVTWD  116
            EESGLA SMISVTWD
Sbjct  181  EESGLAYSMISVTWD  195



>ref|XP_008804300.1| PREDICTED: UBX domain-containing protein 7 [Phoenix dactylifera]
Length=443

 Score =   210 bits (534),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 113/220 (51%), Positives = 138/220 (63%), Gaps = 42/220 (19%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVS-LSHKRPRESPQAPPlhkddake  527
            DPITGQKMR+W GMVQPE LLEDLLP++D  P +H + L  KRPRE  +           
Sbjct  242  DPITGQKMRAWSGMVQPERLLEDLLPYLDKGPKEHHAILPQKRPREMAK-----------  290

Query  526  edeellqalaASMEGMKDTNV-----DALKESSES--DVLG----------------KET  416
                      A   GM D  +     + L+++S S  D  G                 ET
Sbjct  291  -------DSKAHTSGMPDKTLVPKYPETLQKTSASLEDTEGPIRSLATNDEPKHEKVAET  343

Query  415  NVVKKPVYPPLPEEPKGDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETD  236
            +   KP+YPPLPEEPKG + L+CRVGIRLPDGRRLQRNFLR DP++ LWSFC S LE+  
Sbjct  344  SSSGKPIYPPLPEEPKGSRELLCRVGIRLPDGRRLQRNFLRKDPVKFLWSFCCSKLEDGG  403

Query  235  AKPFRLTQAIPGATSSLDFESNLTFEESGLANSMISVTWD  116
             +PFR TQAIPGA+  L++ESNLTFEE+GL+NSMIS+ WD
Sbjct  404  TRPFRFTQAIPGASKVLNYESNLTFEEAGLSNSMISLAWD  443



>emb|CDY69105.1| BnaCnng61890D [Brassica napus]
Length=454

 Score =   208 bits (530),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 118/205 (58%), Positives = 150/205 (73%), Gaps = 9/205 (4%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRES----PQAPPlhkd  539
            DP TGQKMR W GMV+PETLLEDL+PFMDG P +H  SLS KRPR S    P + P    
Sbjct  250  DPTTGQKMRMWSGMVEPETLLEDLVPFMDGGPREHFASLSKKRPRGSFSLAPHSKPKEVA  309

Query  538  dakeedeellqalaASMEG--MKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKG  365
               EE+EEL +ALAAS+E   MK+++ D    + E +V  +       P +PPLPEEPKG
Sbjct  310  AKDEEEEELQRALAASLEDNDMKESSDDKSAITPEEEVAVEAVTTTVLPTFPPLPEEPKG  369

Query  364  -DKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETD-AKPFRLTQAIPGATS  191
             D+++ CRVGIRLP+G+R+QRNFL++D IQLLWSFC S LEE++  KP +LTQAIPG + 
Sbjct  370  GDRSVQCRVGIRLPNGQRVQRNFLKTDSIQLLWSFCYSQLEESERKKPLKLTQAIPGESK  429

Query  190  SLDFESNLTFEESGLANSMISVTWD  116
            +L++ESNLT E+SG+ANSMIS TW+
Sbjct  430  TLEYESNLTLEQSGVANSMISATWE  454



>ref|XP_010935374.1| PREDICTED: UBX domain-containing protein 2 isoform X1 [Elaeis 
guineensis]
Length=444

 Score =   208 bits (529),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 109/203 (54%), Positives = 140/203 (69%), Gaps = 8/203 (4%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVS-LSHKRPRESPQAPPlhkdda--  533
            DPITGQKMR+W GMVQPE LLEDLLP++D  P +H + L  KRPRE  +    H      
Sbjct  243  DPITGQKMRAWSGMVQPERLLEDLLPYLDKGPKEHHAILPQKRPREMVKDSTAHTSGMPD  302

Query  532  keedeellqalaASMEGMKDTNVDALKESSESDV----LGKETNVVKKPVYPPLPEEPKG  365
            K    +   A+  +   ++DT    ++  + +DV       ET+   KP+YPPLPEEPKG
Sbjct  303  KTLVPKSADAVQKTSATLEDTG-GPIRSHATNDVPKHDKVAETSSSGKPIYPPLPEEPKG  361

Query  364  DKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSL  185
             + L+CRVGIRLPDGRRLQRNFLR DP++ LWSFC S LE+ + +PF  TQAIPGA+  L
Sbjct  362  SRELLCRVGIRLPDGRRLQRNFLRKDPVKFLWSFCCSKLEDGETRPFHFTQAIPGASKVL  421

Query  184  DFESNLTFEESGLANSMISVTWD  116
            ++ESNLTFE++GL+NSMIS+ WD
Sbjct  422  NYESNLTFEDAGLSNSMISLAWD  444



>emb|CDY45269.1| BnaA06g09390D [Brassica napus]
Length=467

 Score =   206 bits (525),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 118/205 (58%), Positives = 149/205 (73%), Gaps = 9/205 (4%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRES----PQAPPlhkd  539
            DP TGQKMR W GMV+PETLLEDL+PFMDG P +H  SLS KRPR S    P + P    
Sbjct  263  DPTTGQKMRMWSGMVEPETLLEDLVPFMDGGPREHFASLSKKRPRGSFSLAPHSKPKEVV  322

Query  538  dakeedeellqalaASMEG--MKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKG  365
               EE+EEL +ALAAS+E   MK+++ D      E +V  +       P +PPLPEEPKG
Sbjct  323  AKDEEEEELQRALAASLEDNDMKESSDDKSAIIPEEEVAVEAVTTTVLPTFPPLPEEPKG  382

Query  364  -DKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETD-AKPFRLTQAIPGATS  191
             D+++ CRVGIRLP+G+R+QRNFL++D IQLLWSFC S LEE++  KP +LTQAIPG + 
Sbjct  383  GDRSVQCRVGIRLPNGQRVQRNFLKTDSIQLLWSFCYSQLEESERKKPLKLTQAIPGESK  442

Query  190  SLDFESNLTFEESGLANSMISVTWD  116
            +L++ESNLT E+SG+ANSMIS TW+
Sbjct  443  TLEYESNLTLEQSGVANSMISATWE  467



>ref|XP_006307428.1| hypothetical protein CARUB_v10009052mg [Capsella rubella]
 gb|EOA40326.1| hypothetical protein CARUB_v10009052mg [Capsella rubella]
Length=468

 Score =   205 bits (521),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 120/205 (59%), Positives = 151/205 (74%), Gaps = 10/205 (5%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRES----PQAPPlhkd  539
            DP TGQ+MR W GMV+PE LLEDL+PFMDG P +H VSLS KRPR S    P + P    
Sbjct  265  DPTTGQRMRMWSGMVEPENLLEDLVPFMDGGPREHFVSLSKKRPRGSFSLTPHSKPKDDV  324

Query  538  dakeedeellqalaASME--GMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKG  365
               EE+EEL +ALAAS+E   MKD++ D    + +   +   T+ V  P +PPLPEEPKG
Sbjct  325  AKDEEEEELQRALAASLEDNNMKDSSDDQSTITPDEVAVEAVTSAVL-PTFPPLPEEPKG  383

Query  364  -DKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETD-AKPFRLTQAIPGATS  191
             D+++ CRVGIRLP+G+RLQRNFL++D IQLLWSFC S LEE+D  KP +LTQAIPG + 
Sbjct  384  GDRSVQCRVGIRLPNGQRLQRNFLKTDTIQLLWSFCYSQLEESDRKKPLKLTQAIPGESK  443

Query  190  SLDFESNLTFEESGLANSMISVTWD  116
            +L++ESNLT E+SG+ANSMIS TW+
Sbjct  444  TLEYESNLTLEQSGVANSMISATWE  468



>gb|EPS73806.1| hypothetical protein M569_00949, partial [Genlisea aurea]
Length=451

 Score =   204 bits (520),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 121/209 (58%), Positives = 149/209 (71%), Gaps = 23/209 (11%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVSL-SHKRPRESPQA----PPlhkd  539
            DP+TGQK+R+WRGMV+PE+LLEDLLPFMDGSPSD+ S+ S+KRPRES       P    D
Sbjct  253  DPLTGQKLRTWRGMVEPESLLEDLLPFMDGSPSDNHSIASNKRPRESSDVQFLRPHRASD  312

Query  538  dakeedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKP------VYPPLPE  377
               +ED+EL +ALAAS+E  +          S  D    E  V KKP       Y PLPE
Sbjct  313  KTTDEDDELRRALAASLENFE----------SPHDPKPDENIVEKKPDKSAAVAYLPLPE  362

Query  376  EPKGDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETD--AKPFRLTQAIP  203
            E KGDKNL+CR+G+RLP+GRR+QRNFLRSDP+QLLWSFC   + E D   +PFRLTQAIP
Sbjct  363  ESKGDKNLLCRIGLRLPNGRRVQRNFLRSDPVQLLWSFCLQQITEIDNNNRPFRLTQAIP  422

Query  202  GATSSLDFESNLTFEESGLANSMISVTWD  116
            GA+ +LD++   TFEESGL N+M+SVTW+
Sbjct  423  GASRTLDYDVESTFEESGLDNTMVSVTWE  451



>ref|XP_002890064.1| UBX domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66323.1| UBX domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=472

 Score =   205 bits (521),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 120/205 (59%), Positives = 150/205 (73%), Gaps = 10/205 (5%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRES----PQAPPlhkd  539
            DP TGQ+MR W GMV+PE LLEDL+PFMDG P +H  SLS KRPR S    P + P    
Sbjct  269  DPTTGQRMRIWSGMVEPENLLEDLVPFMDGGPREHFASLSKKRPRGSFSLAPHSKPKEDV  328

Query  538  dakeedeellqalaASME--GMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKG  365
               EE+EEL +ALAAS+E   MK+++ D    + E   +   T+ V  P +PPLPEEPKG
Sbjct  329  AKDEEEEELQRALAASLEDNSMKESSDDQSTMTPEEVAVEAVTSAVL-PTFPPLPEEPKG  387

Query  364  -DKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETD-AKPFRLTQAIPGATS  191
             D++L CRVGIRLP+G+RLQRNFL++D IQLLWSFC S LEE++  KP +LTQAIPG + 
Sbjct  388  GDRSLQCRVGIRLPNGQRLQRNFLKTDTIQLLWSFCYSQLEESERKKPLKLTQAIPGESK  447

Query  190  SLDFESNLTFEESGLANSMISVTWD  116
            +LD+ESNLT E+SG+ANSMIS TW+
Sbjct  448  TLDYESNLTLEQSGVANSMISATWE  472



>ref|NP_001077535.1| UBX domain-containing protein [Arabidopsis thaliana]
 ref|NP_001077536.1| UBX domain-containing protein [Arabidopsis thaliana]
 gb|AEE29184.1| UBX domain-containing protein [Arabidopsis thaliana]
 gb|AEE29185.1| UBX domain-containing protein [Arabidopsis thaliana]
Length=447

 Score =   202 bits (513),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 122/210 (58%), Positives = 151/210 (72%), Gaps = 20/210 (10%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRES----PQAPPlhkd  539
            DP TGQ+MR W GMV PE LLEDL+PFMDG P +H  SLS KRPR S    P + P    
Sbjct  244  DPTTGQRMRMWTGMVDPENLLEDLVPFMDGGPREHFASLSKKRPRGSFSLTPHSKPKEDV  303

Query  538  dakeedeellqalaASMEGMKDTNVDALKESS--ESDVLGKETNV-----VKKPVYPPLP  380
               EE+EEL +ALAAS+E   D N   +KESS  +S ++ +E  V        P +PPLP
Sbjct  304  AKDEEEEELQRALAASLE---DNN---MKESSDDQSTIIPEEVAVEAVTSAVLPTFPPLP  357

Query  379  EEPKG-DKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETD-AKPFRLTQAI  206
            EEPKG D++L CRVGIRLP+G+RLQRNFL++D IQLLWSFC S LEE++  KP +LTQAI
Sbjct  358  EEPKGGDRSLQCRVGIRLPNGQRLQRNFLKTDTIQLLWSFCYSQLEESERKKPLKLTQAI  417

Query  205  PGATSSLDFESNLTFEESGLANSMISVTWD  116
            PG + +L++ESNLT E+SG+ANSMIS TW+
Sbjct  418  PGESKTLEYESNLTLEQSGVANSMISATWE  447



>emb|CDY68911.1| BnaAnng28760D [Brassica napus]
Length=385

 Score =   200 bits (508),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 110/199 (55%), Positives = 138/199 (69%), Gaps = 7/199 (4%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRESPQAPPlhkddake  527
            DP TGQKMR W GMV+PETLLE L+PF+DG P  H  SLS K PR S    P  K   +E
Sbjct  191  DPTTGQKMRMWSGMVEPETLLESLVPFLDGGPGTHFASLSKKHPRGSFSLAPHSKPKEEE  250

Query  526  edeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKG-DKNLV  350
                L   L  +  GMK+++ D     +  +    E  V+  P YPPLPEEPKG D+++ 
Sbjct  251  LQRALAATLENN--GMKESSSDDTSPITTPEEAAVEATVL--PTYPPLPEEPKGGDRSVQ  306

Query  349  CRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDA-KPFRLTQAIPGATSSLDFES  173
            CRVGIRLP+G+RLQRNFL++D IQLLWSFC S LEE++  KP +LTQAIPG + +L++ES
Sbjct  307  CRVGIRLPNGQRLQRNFLKTDSIQLLWSFCYSQLEESEGEKPLKLTQAIPGESKTLEYES  366

Query  172  NLTFEESGLANSMISVTWD  116
            NLT E+SG+ANSMIS TW+
Sbjct  367  NLTLEQSGVANSMISATWE  385



>ref|NP_563954.1| UBX domain-containing protein [Arabidopsis thaliana]
 ref|NP_973827.1| UBX domain-containing protein [Arabidopsis thaliana]
 gb|AAK43884.1|AF370507_1 Unknown protein [Arabidopsis thaliana]
 gb|AAL47388.1| unknown protein [Arabidopsis thaliana]
 dbj|BAH19997.1| AT1G14570 [Arabidopsis thaliana]
 gb|AEE29182.1| UBX domain-containing protein [Arabidopsis thaliana]
 gb|AEE29183.1| UBX domain-containing protein [Arabidopsis thaliana]
Length=468

 Score =   201 bits (512),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 122/210 (58%), Positives = 151/210 (72%), Gaps = 20/210 (10%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRES----PQAPPlhkd  539
            DP TGQ+MR W GMV PE LLEDL+PFMDG P +H  SLS KRPR S    P + P    
Sbjct  265  DPTTGQRMRMWTGMVDPENLLEDLVPFMDGGPREHFASLSKKRPRGSFSLTPHSKPKEDV  324

Query  538  dakeedeellqalaASMEGMKDTNVDALKESS--ESDVLGKETNV-----VKKPVYPPLP  380
               EE+EEL +ALAAS+E   D N   +KESS  +S ++ +E  V        P +PPLP
Sbjct  325  AKDEEEEELQRALAASLE---DNN---MKESSDDQSTIIPEEVAVEAVTSAVLPTFPPLP  378

Query  379  EEPKG-DKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETD-AKPFRLTQAI  206
            EEPKG D++L CRVGIRLP+G+RLQRNFL++D IQLLWSFC S LEE++  KP +LTQAI
Sbjct  379  EEPKGGDRSLQCRVGIRLPNGQRLQRNFLKTDTIQLLWSFCYSQLEESERKKPLKLTQAI  438

Query  205  PGATSSLDFESNLTFEESGLANSMISVTWD  116
            PG + +L++ESNLT E+SG+ANSMIS TW+
Sbjct  439  PGESKTLEYESNLTLEQSGVANSMISATWE  468



>ref|XP_010458959.1| PREDICTED: UBX domain-containing protein 2-like [Camelina sativa]
 ref|XP_010458960.1| PREDICTED: UBX domain-containing protein 2-like [Camelina sativa]
 ref|XP_010458961.1| PREDICTED: UBX domain-containing protein 2-like [Camelina sativa]
Length=457

 Score =   201 bits (511),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 118/205 (58%), Positives = 148/205 (72%), Gaps = 15/205 (7%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRES----PQAPPlhkd  539
            DP TGQ+MR W GMV+PE LLEDL+PFMDG P +H  SLS KRPR S    P + P    
Sbjct  259  DPTTGQRMRMWSGMVEPENLLEDLVPFMDGGPREHFASLSKKRPRGSFSLTPHSKPKEDV  318

Query  538  dakeedeellqalaASME--GMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKG  365
               EE+EEL +ALAAS+E   MKD++ D      +S +  +       P +PPLPEEPKG
Sbjct  319  AKDEEEEELRRALAASLEDNNMKDSSDD------QSTITPEAFTSAVLPAFPPLPEEPKG  372

Query  364  -DKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETD-AKPFRLTQAIPGATS  191
             D++L CRVGIRLP+G+RLQRNFL++D IQLLWSFC S LEE++  KP +LTQAIPG + 
Sbjct  373  GDRSLQCRVGIRLPNGQRLQRNFLKTDTIQLLWSFCYSQLEESERKKPLKLTQAIPGESK  432

Query  190  SLDFESNLTFEESGLANSMISVTWD  116
            +L++ESNLT E+SG+ANSMIS TW+
Sbjct  433  TLEYESNLTLEQSGVANSMISATWE  457



>ref|XP_010496241.1| PREDICTED: UBX domain-containing protein 2-like [Camelina sativa]
 ref|XP_010496249.1| PREDICTED: UBX domain-containing protein 2-like [Camelina sativa]
Length=463

 Score =   201 bits (511),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 119/205 (58%), Positives = 148/205 (72%), Gaps = 10/205 (5%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRES----PQAPPlhkd  539
            DP TGQ+MR W GMV+PE LLEDL+PFMDG P +H  SLS KRPR S    P + P    
Sbjct  260  DPTTGQRMRMWSGMVEPENLLEDLVPFMDGGPREHFASLSKKRPRGSFSLTPHSKPKEDV  319

Query  538  dakeedeellqalaASME--GMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKG  365
               EE+EEL +ALAAS+E   MKD++ D    + E   +   T+ V  P +PPLPEEPKG
Sbjct  320  AKDEEEEELRRALAASLEDNNMKDSSDDQSTITPEEVAVEAVTSAVL-PTFPPLPEEPKG  378

Query  364  -DKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETD-AKPFRLTQAIPGATS  191
             D+N  CRVGIRLP+G+R QRNFL++D IQLLWSFC S LEE++  KP +LTQAIPG + 
Sbjct  379  GDRNAQCRVGIRLPNGQRRQRNFLKTDTIQLLWSFCYSQLEESERKKPLKLTQAIPGESK  438

Query  190  SLDFESNLTFEESGLANSMISVTWD  116
            +L++ESNLT E+SG+ANSMIS TW+
Sbjct  439  TLEYESNLTLEQSGVANSMISATWE  463



>ref|XP_009148836.1| PREDICTED: UBX domain-containing protein 2 [Brassica rapa]
Length=466

 Score =   201 bits (510),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 119/205 (58%), Positives = 150/205 (73%), Gaps = 9/205 (4%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRES----PQAPPlhkd  539
            DP TGQKMR W GMV+PETLLEDL+PFMDG P +H  SLS KRPR S    P + P    
Sbjct  262  DPTTGQKMRMWSGMVEPETLLEDLVPFMDGGPREHFASLSKKRPRGSFSLAPHSKPKEVV  321

Query  538  dakeedeellqalaASMEG--MKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKG  365
               EE+EEL +ALAAS+E   MK+++ D      E +V+ +       P +PPLPEEPKG
Sbjct  322  AKDEEEEELQRALAASLEDNDMKESSDDKSAIIPEEEVVVEAVTTTVLPTFPPLPEEPKG  381

Query  364  -DKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETD-AKPFRLTQAIPGATS  191
             D+++ CRVGIRLP+G+R+QRNFL++D IQLLWSFC S LEE++  KP +LTQAIPG + 
Sbjct  382  GDRSVQCRVGIRLPNGQRVQRNFLKTDSIQLLWSFCYSQLEESERKKPLKLTQAIPGESK  441

Query  190  SLDFESNLTFEESGLANSMISVTWD  116
            +L+FESNLT E+SG+ANSMIS TW+
Sbjct  442  TLEFESNLTLEQSGVANSMISATWE  466



>ref|XP_006416998.1| hypothetical protein EUTSA_v10007578mg [Eutrema salsugineum]
 gb|ESQ35351.1| hypothetical protein EUTSA_v10007578mg [Eutrema salsugineum]
Length=462

 Score =   199 bits (506),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 118/205 (58%), Positives = 149/205 (73%), Gaps = 10/205 (5%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRES----PQAPPlhkd  539
            DP TGQKMR W GMV+PETLLEDL+PFMDG P +H  SLS KRPR S    P +      
Sbjct  259  DPTTGQKMRMWCGMVEPETLLEDLVPFMDGGPREHFASLSKKRPRGSFSLTPHSKSKEDA  318

Query  538  dakeedeellqalaASME--GMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKG  365
                E+EEL +ALAAS+E  GMK ++ D    + E+  +   T+ V  P +PPLPEEPKG
Sbjct  319  AKDGEEEELRRALAASLEDNGMKVSSDDKSPITPEAVAVEAVTSTVL-PTFPPLPEEPKG  377

Query  364  -DKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETD-AKPFRLTQAIPGATS  191
             D ++ CRVGIRLP+G+R+QRNFL++D IQLLWSFC S LEE++  KP +LTQAIPG + 
Sbjct  378  GDPSVRCRVGIRLPNGQRIQRNFLKTDAIQLLWSFCYSQLEESERKKPLKLTQAIPGESK  437

Query  190  SLDFESNLTFEESGLANSMISVTWD  116
            +L++ESNLT E+SG+ANSMIS TW+
Sbjct  438  TLEYESNLTLEQSGVANSMISATWE  462



>emb|CDX84023.1| BnaC08g16220D [Brassica napus]
Length=458

 Score =   199 bits (505),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 111/200 (56%), Positives = 142/200 (71%), Gaps = 6/200 (3%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHV-SLSHKRPRES-PQAPPlhkddak  530
            DP +GQKMR W GMV+PETLL+ L+PF+DG P  H  SLS K PR S   AP     D +
Sbjct  261  DPTSGQKMRMWCGMVEPETLLQYLVPFLDGGPGTHFDSLSKKHPRGSFSLAPHSKPKDEE  320

Query  529  eedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKG-DKNL  353
            EE+ +   A +    GMK+++ D     +  +    E  V+  P YPPLPEEPKG D+++
Sbjct  321  EEELQRALAASLENNGMKESSDDDTSPITTPEEAAVEATVL--PTYPPLPEEPKGGDRSV  378

Query  352  VCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETD-AKPFRLTQAIPGATSSLDFE  176
             CRVGIRLP+G+RLQRNFLR+DPIQLLWSFC S LEE++  KP +LTQAIPG + +L++E
Sbjct  379  QCRVGIRLPNGQRLQRNFLRTDPIQLLWSFCYSQLEESEREKPLKLTQAIPGESKTLEYE  438

Query  175  SNLTFEESGLANSMISVTWD  116
            SNLT E+SG+ANSMIS TW+
Sbjct  439  SNLTLEQSGVANSMISATWE  458



>ref|XP_009110537.1| PREDICTED: UBX domain-containing protein 2-like [Brassica rapa]
Length=443

 Score =   198 bits (503),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 111/200 (56%), Positives = 140/200 (70%), Gaps = 6/200 (3%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRES-PQAPPlhkddak  530
            DP TGQKMR W GMV+PETLLE L+PF+DG P  H  SLS K PR S   AP     D +
Sbjct  246  DPTTGQKMRMWSGMVEPETLLESLVPFLDGGPGTHFASLSRKHPRGSFSLAPHSKPKDEE  305

Query  529  eedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKG-DKNL  353
            EE+ +   A +    GMK+++ D     +  +    E  V+  P YPPLPEEPKG D+++
Sbjct  306  EEETQQALAASLENNGMKESSSDDTSPITTPEEAAVEATVL--PTYPPLPEEPKGGDRSV  363

Query  352  VCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETD-AKPFRLTQAIPGATSSLDFE  176
             CRVGIRLP+G+RLQRNFL++D IQLLWSFC S LEE++  KP +LTQAIPG + +L+ E
Sbjct  364  QCRVGIRLPNGQRLQRNFLKTDSIQLLWSFCYSQLEESEREKPLKLTQAIPGESKTLEDE  423

Query  175  SNLTFEESGLANSMISVTWD  116
            SNLT E+SG+ANSMIS TW+
Sbjct  424  SNLTLEQSGVANSMISATWE  443



>gb|AAF63167.1|AC010657_3 T5E21.7 [Arabidopsis thaliana]
Length=514

 Score =   199 bits (506),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 115/206 (56%), Positives = 145/206 (70%), Gaps = 17/206 (8%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRESPQAPPlhkddake  527
            DP TGQ+MR W GMV PE LLEDL+PFMDG P +H  SLS KRPR S    P  K   +E
Sbjct  316  DPTTGQRMRMWTGMVDPENLLEDLVPFMDGGPREHFASLSKKRPRGSFSLTPHSKPKDEE  375

Query  526  edeellqalaASMEGMKDTNVDALKESS--ESDVLGKETNV-----VKKPVYPPLPEEPK  368
            E+E      A+    ++D N   +KESS  +S ++ +E  V        P +PPLPEEPK
Sbjct  376  EEELQRALAAS----LEDNN---MKESSDDQSTIIPEEVAVEAVTSAVLPTFPPLPEEPK  428

Query  367  G-DKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETD-AKPFRLTQAIPGAT  194
            G D++L CRVGIRLP+G+RLQRNFL++D IQLLWSFC S LEE++  KP +LTQAIPG +
Sbjct  429  GGDRSLQCRVGIRLPNGQRLQRNFLKTDTIQLLWSFCYSQLEESERKKPLKLTQAIPGES  488

Query  193  SSLDFESNLTFEESGLANSMISVTWD  116
             +L++ESNLT E+SG+ANSMIS TW+
Sbjct  489  KTLEYESNLTLEQSGVANSMISATWE  514



>ref|XP_010476513.1| PREDICTED: UBX domain-containing protein 2-like [Camelina sativa]
Length=464

 Score =   197 bits (502),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 117/205 (57%), Positives = 148/205 (72%), Gaps = 10/205 (5%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRES----PQAPPlhkd  539
            DP TGQ+MR W GMV+PE LLEDL+PFMDG P +H  SLS KRPR S    P + P    
Sbjct  261  DPTTGQRMRMWSGMVEPENLLEDLVPFMDGGPREHFASLSKKRPRGSFSLTPHSKPKEDV  320

Query  538  dakeedeellqalaASME--GMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKG  365
               EE+EEL +ALAAS+E   MKD++ D    + E+  +         P +PPLPEEPKG
Sbjct  321  AKDEEEEELRRALAASLEDNNMKDSSGDQSTITPEAVAV-AAVTSAVLPTFPPLPEEPKG  379

Query  364  -DKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETD-AKPFRLTQAIPGATS  191
             D+++ CRVGIRLP+G+RLQRNFL++D IQLLWSFC S LEE++  KP +LTQAIPG + 
Sbjct  380  GDRSVQCRVGIRLPNGQRLQRNFLKTDTIQLLWSFCYSQLEESERKKPLKLTQAIPGESK  439

Query  190  SLDFESNLTFEESGLANSMISVTWD  116
            +L++ESNLT E+SG+ANSMIS TW+
Sbjct  440  TLEYESNLTLEQSGVANSMISATWE  464



>ref|XP_009599661.1| PREDICTED: UBX domain-containing protein 7 homolog [Nicotiana 
tomentosiformis]
Length=367

 Score =   192 bits (488),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 97/197 (49%), Positives = 123/197 (62%), Gaps = 34/197 (17%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVS-LSHKRPRESPQAPPlhkddake  527
            DPITGQKMRSW GMVQPE LLED+  F+D SPS++ + L HKR R++P+           
Sbjct  204  DPITGQKMRSWNGMVQPENLLEDITSFIDLSPSEYYANLLHKRSRKNPRDEIKED-----  258

Query  526  edeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGDKNLVC  347
                         EG++ +N               E   V K  YPPL EEPKGDKNL+C
Sbjct  259  -------------EGIQQSN---------------EIKEVMKIFYPPLSEEPKGDKNLIC  290

Query  346  RVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFESNL  167
            RV IRL DGRR+QRNFL++D I+LLWS+C    EE + +PFR  Q  PG+   L+++SNL
Sbjct  291  RVAIRLFDGRRIQRNFLKTDSIKLLWSYCCVEFEEAETRPFRFRQVFPGSVKFLEYDSNL  350

Query  166  TFEESGLANSMISVTWD  116
            TFEES L NS++SVTW+
Sbjct  351  TFEESDLNNSIVSVTWE  367



>ref|XP_010253434.1| PREDICTED: UBX domain-containing protein 7-like [Nelumbo nucifera]
Length=361

 Score =   191 bits (485),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 101/196 (52%), Positives = 129/196 (66%), Gaps = 24/196 (12%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHV-SLSHKRPRESPQAPPlhkddake  527
            DPITGQ MRSW G+V+ ETLL DL+ FMD  P+++  SL +KR   S Q+          
Sbjct  186  DPITGQMMRSWSGVVEAETLLMDLVHFMDYGPNNYPPSLVYKRKARSHQS----------  235

Query  526  edeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGDKNLVC  347
                    L  S E     + + +  S+E+     ET++++K +YPPLP EPK +K+L+C
Sbjct  236  --------LVYSQETEVAKHEEMMLASTET-----ETSLIEKTIYPPLPGEPKCEKSLLC  282

Query  346  RVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFESNL  167
            RV +R PDGRR+QRNFLR DPIQLLWSFC S LEET A+PFRL QAIPG +  LD+ + L
Sbjct  283  RVAVRFPDGRRVQRNFLRKDPIQLLWSFCYSQLEETGARPFRLVQAIPGDSKQLDYATEL  342

Query  166  TFEESGLANSMISVTW  119
            TFEESG+ NSMI V W
Sbjct  343  TFEESGINNSMILVDW  358



>ref|XP_009401234.1| PREDICTED: UBX domain-containing protein 2 [Musa acuminata subsp. 
malaccensis]
Length=439

 Score =   192 bits (489),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 114/199 (57%), Positives = 139/199 (70%), Gaps = 4/199 (2%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVS-LSHKRPRESPQAPPlhk--dda  533
            DPITGQKMR+W GMV PE LLEDLLPF+D  P +H + L  KRPR +  + P +    +A
Sbjct  242  DPITGQKMRAWSGMVHPERLLEDLLPFLDKGPKEHHTFLPQKRPRVAHDSAPNNILDKEA  301

Query  532  keedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGDKNL  353
             EED E+LQA+AASME  K      + +         ET+      YPPLPEEPKG K L
Sbjct  302  VEEDVEVLQAIAASMEDAKSPPRPPVTDDDPKPEKDGETSSNGNLTYPPLPEEPKGSKEL  361

Query  352  VCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFES  173
             CRVGIRLPDG R+QR FLR+DPI+LLWSFCSS LE+   +PF  TQAIPGA+ SL++ES
Sbjct  362  -CRVGIRLPDGCRIQRKFLRTDPIKLLWSFCSSKLEDGQRRPFHFTQAIPGASKSLEYES  420

Query  172  NLTFEESGLANSMISVTWD  116
            N  FEE+GL+NSMI++ WD
Sbjct  421  NSNFEEAGLSNSMITLVWD  439



>ref|XP_009759130.1| PREDICTED: UBX domain-containing protein 7-like [Nicotiana sylvestris]
Length=377

 Score =   190 bits (483),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 96/197 (49%), Positives = 122/197 (62%), Gaps = 34/197 (17%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSD-HVSLSHKRPRESPQAPPlhkddake  527
            DPITGQK+ SW GMVQPE LL+D+  F+D SPS+ H +L HKR R++P+           
Sbjct  214  DPITGQKVHSWNGMVQPEILLKDITSFIDLSPSEYHANLLHKRSRKNPRDEIKED-----  268

Query  526  edeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGDKNLVC  347
                         EG++ TN               E   V K  YP LPEEP+GD+NL+C
Sbjct  269  -------------EGVQQTN---------------EIKEVMKICYPTLPEEPEGDRNLIC  300

Query  346  RVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFESNL  167
            RV IRLPDGRR+QRNFL+ D I+LLWS+C    EE + +PFR  Q IPGA   L+++SNL
Sbjct  301  RVAIRLPDGRRIQRNFLKIDSIKLLWSYCCVEFEEAETRPFRFRQVIPGAVKFLEYDSNL  360

Query  166  TFEESGLANSMISVTWD  116
             FEES L NS++SVTW+
Sbjct  361  NFEESDLNNSIVSVTWE  377



>ref|NP_001054216.1| Os04g0670800 [Oryza sativa Japonica Group]
 dbj|BAF16130.1| Os04g0670800, partial [Oryza sativa Japonica Group]
Length=331

 Score =   182 bits (462),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 104/205 (51%), Positives = 140/205 (68%), Gaps = 12/205 (6%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVSLS-HKRPRESPQ--------APP  551
            DPITGQKMR W GM+ P+ LLEDL+P++D  P +H +    KRPR+  Q          P
Sbjct  130  DPITGQKMRGWNGMIHPDRLLEDLMPYLDKGPKEHHAAQPQKRPRKVDQETSIGKQGKTP  189

Query  550  lhkddakeedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEP  371
            +     ++EDEEL +A+AAS+E  K +  D  +E  E +V   E ++  K  YPPLPEEP
Sbjct  190  VPVVATEDEDEELARAVAASLEESKGS--DTSEEKIEPEV-ENEPSLSAKLNYPPLPEEP  246

Query  370  KGDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATS  191
            KG + L+CRV IRLPDGRR+QRNFL +DPI+LLWSFC   +E+ D K F   Q IP A++
Sbjct  247  KGSRELLCRVAIRLPDGRRIQRNFLHTDPIKLLWSFCYPQVEDGDKKAFHFVQPIPRAST  306

Query  190  SLDFESNLTFEESGLANSMISVTWD  116
            +L++ES+ TF+E+GLANSMI++ WD
Sbjct  307  NLEYESDKTFKEAGLANSMINLLWD  331



>ref|XP_006653862.1| PREDICTED: UBX domain-containing protein 2-like [Oryza brachyantha]
Length=380

 Score =   182 bits (462),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 104/205 (51%), Positives = 138/205 (67%), Gaps = 10/205 (5%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRE-------SPQAPPl  548
            DPITGQKMR W GMV P+ LLEDL+P++D  P +H  +   KRPR+         Q    
Sbjct  177  DPITGQKMRGWNGMVHPDRLLEDLMPYLDKGPKEHHAAQPQKRPRKVDHETSAGKQGKTP  236

Query  547  hkddakeedeellqalaASMEGMKDTN-VDALKESSESDVLGKETNVVKKPVYPPLPEEP  371
                 ++EDEEL +A+AAS+E  K  +  DA  E +E +V   E ++  K  YPPLPEEP
Sbjct  237  VPVAVEDEDEELARAVAASLEESKGVDGSDATDEKTEPEV-ENEPSLSVKLNYPPLPEEP  295

Query  370  KGDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATS  191
            KG + L+CRV IRLPDGRR+QRNFL +DP++LLWSFC   +E+   K F   Q IPG++ 
Sbjct  296  KGSRELLCRVAIRLPDGRRIQRNFLHTDPVKLLWSFCYPQVEDGGKKAFHFVQFIPGSSK  355

Query  190  SLDFESNLTFEESGLANSMISVTWD  116
            +LD+ES+ TF+E+GLANSMI++ WD
Sbjct  356  NLDYESDKTFKEAGLANSMINLLWD  380



>ref|XP_008801336.1| PREDICTED: UBX domain-containing protein 2-like [Phoenix dactylifera]
Length=340

 Score =   181 bits (458),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 95/200 (48%), Positives = 128/200 (64%), Gaps = 30/200 (15%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVSLSHKRPRESPQAPPlhkddakee  524
            DPITGQKMRSW GM   + LLEDLLPF+DG P +H  +  ++  +S QA  L        
Sbjct  165  DPITGQKMRSWSGMRTADALLEDLLPFVDGGPKEHHDVLSRK--QSVQATEL--------  214

Query  523  deellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPV-----YPPLPEEPKGDK  359
                         G+++    + + +S  D +G + ++++  +     Y  L EEPKG+K
Sbjct  215  -------------GLREAA--STEGTSAGDRIGADIDIMEASMNAKLEYLHLLEEPKGEK  259

Query  358  NLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDF  179
             + CRV IRLPDGRRLQRNFLRSDPI+LLWSFCSS +EE + + FR  Q  PG ++SL++
Sbjct  260  GVTCRVAIRLPDGRRLQRNFLRSDPIKLLWSFCSSGMEEGNMRRFRFVQTTPGGSNSLEY  319

Query  178  ESNLTFEESGLANSMISVTW  119
            ESNLTFEE+G +NSMIS+ W
Sbjct  320  ESNLTFEEAGFSNSMISMVW  339



>gb|AEV40978.1| putative UBX domain-containing protein [Oryza punctata]
Length=463

 Score =   184 bits (466),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 106/206 (51%), Positives = 139/206 (67%), Gaps = 11/206 (5%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRESPQ--------APP  551
            DPITGQKMR W GMV P+ LLEDL+P++D  P +H  +   KRPR+  Q          P
Sbjct  259  DPITGQKMRGWNGMVHPDRLLEDLMPYLDKGPKEHHAAQPQKRPRKVDQETSIGKQGKTP  318

Query  550  lhkddakeedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEP  371
            +     ++EDEEL +A+AAS+E  K        E  E +V   E ++  K  YPPLPEEP
Sbjct  319  VPPIATEDEDEELARAVAASLEESKGVGGSDTSEKIEPEV-ENEPSLSAKLNYPPLPEEP  377

Query  370  KGDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGA-T  194
            KG++ L+CRV IRLPDGRR+QRNFL +DPI+LLWSFC   +E+ D K F   Q IPGA T
Sbjct  378  KGNRELLCRVAIRLPDGRRIQRNFLHTDPIKLLWSFCCPQVEDGDKKAFHFVQPIPGAST  437

Query  193  SSLDFESNLTFEESGLANSMISVTWD  116
            ++L++ES+ TF+E+GLANSMI++ WD
Sbjct  438  TNLEYESDKTFKEAGLANSMINLLWD  463



>gb|AEV41122.1| putative UBX domain-containing protein [Oryza officinalis]
Length=464

 Score =   183 bits (465),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 106/205 (52%), Positives = 139/205 (68%), Gaps = 10/205 (5%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRE-------SPQAPPl  548
            DPITGQKMR W GMV P+ LLEDL+P++D  P +H  +   KRPR+         Q    
Sbjct  261  DPITGQKMRGWNGMVHPDRLLEDLMPYLDKGPKEHHAAQPQKRPRKVDQETSIGKQGKTP  320

Query  547  hkddakeedeellqalaASMEGMKDTN-VDALKESSESDVLGKETNVVKKPVYPPLPEEP  371
                 ++EDEEL +A+AAS+E  K     DA +E  E +V   E ++  K  YPPLPEEP
Sbjct  321  VPVTTEDEDEELARAVAASLEESKGVGGSDASEEKIEPEV-EIEPSLSAKLNYPPLPEEP  379

Query  370  KGDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATS  191
            KG + L+CRV IRLPDGRR+QRNFL +DPI+LLWSFC   +E+ D K F   Q IPGA++
Sbjct  380  KGSRELLCRVAIRLPDGRRIQRNFLHTDPIKLLWSFCYPQVEDGDKKVFHFVQPIPGAST  439

Query  190  SLDFESNLTFEESGLANSMISVTWD  116
            +L++ES+ TF+E+GLANSMI++ WD
Sbjct  440  NLEYESDKTFKEAGLANSMINLLWD  464



>gb|AIE88273.1| hypothetical protein OG_BBa0063K01.4 [Oryza glaberrima]
Length=540

 Score =   184 bits (467),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 105/205 (51%), Positives = 141/205 (69%), Gaps = 12/205 (6%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRESPQ--------APP  551
            DPITGQKMR W GM+ P+ LLEDL+P++D  P +H  +   KRPR+  Q          P
Sbjct  339  DPITGQKMRGWNGMIHPDRLLEDLMPYLDKGPKEHHAAQPQKRPRKVDQETSIGKQGKTP  398

Query  550  lhkddakeedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEP  371
            +     ++EDEEL +A+AAS+E  K +  D  +E  E +V   ET++  K  YPPLPEEP
Sbjct  399  VPVVATEDEDEELARAVAASLEESKGS--DTSEEKIEPEV-ENETSLSAKLNYPPLPEEP  455

Query  370  KGDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATS  191
            KG + L+CRV IRLPDGRR+QRNFL +DPI+LLWSFC   +E+ D K F   Q IP A++
Sbjct  456  KGSRELLCRVAIRLPDGRRIQRNFLHTDPIKLLWSFCYPQVEDGDKKAFHFVQPIPRAST  515

Query  190  SLDFESNLTFEESGLANSMISVTWD  116
            +L++ES+ TF+E+GLANSMI++ WD
Sbjct  516  NLEYESDKTFKEAGLANSMINLLWD  540



>emb|CAE02831.2| OSJNBa0043A12.36 [Oryza sativa Japonica Group]
 emb|CAH67698.1| H0624F09.6 [Oryza sativa Indica Group]
 dbj|BAG93324.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC78226.1| hypothetical protein OsI_17866 [Oryza sativa Indica Group]
Length=459

 Score =   182 bits (461),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 104/205 (51%), Positives = 140/205 (68%), Gaps = 12/205 (6%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRESPQ--------APP  551
            DPITGQKMR W GM+ P+ LLEDL+P++D  P +H  +   KRPR+  Q          P
Sbjct  258  DPITGQKMRGWNGMIHPDRLLEDLMPYLDKGPKEHHAAQPQKRPRKVDQETSIGKQGKTP  317

Query  550  lhkddakeedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEP  371
            +     ++EDEEL +A+AAS+E  K +  D  +E  E +V   E ++  K  YPPLPEEP
Sbjct  318  VPVVATEDEDEELARAVAASLEESKGS--DTSEEKIEPEV-ENEPSLSAKLNYPPLPEEP  374

Query  370  KGDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATS  191
            KG + L+CRV IRLPDGRR+QRNFL +DPI+LLWSFC   +E+ D K F   Q IP A++
Sbjct  375  KGSRELLCRVAIRLPDGRRIQRNFLHTDPIKLLWSFCYPQVEDGDKKAFHFVQPIPRAST  434

Query  190  SLDFESNLTFEESGLANSMISVTWD  116
            +L++ES+ TF+E+GLANSMI++ WD
Sbjct  435  NLEYESDKTFKEAGLANSMINLLWD  459



>gb|AEV41029.1| putative UBX domain-containing protein [Oryza minuta]
Length=463

 Score =   180 bits (457),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 105/206 (51%), Positives = 138/206 (67%), Gaps = 11/206 (5%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRESPQ--------APP  551
            DPITGQKM  W GMV P+ LLEDL+P++D  P +H  +   KRPR+  Q          P
Sbjct  259  DPITGQKMCGWNGMVHPDRLLEDLMPYLDKGPKEHHAAQPQKRPRKVDQETSIGKQGKTP  318

Query  550  lhkddakeedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEP  371
            +     ++EDEEL +A+AAS+E  K        E  E +V   E ++  K  YPPLPEEP
Sbjct  319  VPPIATEDEDEELARAVAASLEESKGVGGSDTSEKIEPEV-ENEPSLSAKLNYPPLPEEP  377

Query  370  KGDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGA-T  194
            KG++ L+CRV IRLPDGRR+QRNFL +DPI+LLWSFC   +E+ D K F   Q IPGA T
Sbjct  378  KGNRELLCRVAIRLPDGRRIQRNFLHTDPIKLLWSFCCPQVEDGDKKAFHFVQPIPGAST  437

Query  193  SSLDFESNLTFEESGLANSMISVTWD  116
            ++L++ES+ TF+E+GLANSMI++ WD
Sbjct  438  TNLEYESDKTFKEAGLANSMINLLWD  463



>gb|AEV41076.1| putative UBX domain-containing protein [Oryza minuta]
Length=402

 Score =   178 bits (452),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 105/205 (51%), Positives = 138/205 (67%), Gaps = 10/205 (5%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRE-------SPQAPPl  548
            DPITGQKMR W GMV P+ LLEDL+P++D  P +H  +   KRPR+         Q    
Sbjct  199  DPITGQKMRGWNGMVHPDRLLEDLMPYLDKGPKEHHAAQPQKRPRKVDQETSIGKQGKTP  258

Query  547  hkddakeedeellqalaASMEGMKDTN-VDALKESSESDVLGKETNVVKKPVYPPLPEEP  371
                 ++EDEEL +A+AAS+E  K     DA +E  E +V   E ++  K  YPPLPEEP
Sbjct  259  VPVTTEDEDEELARAVAASLEESKGVGGSDASEEKIEPEV-EIEPSLSAKLNYPPLPEEP  317

Query  370  KGDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATS  191
            KG + L+CRV IRLPDGRR+QRNFL +DPI+LLWSFC   +E+ D K F   Q IPGA++
Sbjct  318  KGSRELLCRVAIRLPDGRRIQRNFLHTDPIKLLWSFCYPQVEDGDKKVFHFVQPIPGAST  377

Query  190  SLDFESNLTFEESGLANSMISVTWD  116
            +L++ES+ TF+E+GLANSMI++  D
Sbjct  378  NLEYESDKTFKEAGLANSMINLLCD  402



>ref|XP_004960126.1| PREDICTED: UBX domain-containing protein 2-like [Setaria italica]
Length=456

 Score =   177 bits (449),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 103/207 (50%), Positives = 140/207 (68%), Gaps = 15/207 (7%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRESPQAPPlhkd---d  536
            DPITGQKMR W GMV P+ LLEDLLP++D  P +H  +   KRPR+  Q   + K     
Sbjct  254  DPITGQKMRGWNGMVHPDRLLEDLLPYLDKGPKEHHAAQPQKRPRKVDQESSMAKQGKPT  313

Query  535  akeedeellqalaASMEGMKDTNVDALKESSESDVLGK-------ETNVVKKPVYPPLPE  377
             ++EDEEL +A+AAS+EG K+      +ES  +D + +       E ++  K  YPPLPE
Sbjct  314  VEDEDEELARAVAASLEGSKEV----AEESGATDDMAEAEPEEDNEPSLNIKLDYPPLPE  369

Query  376  EPKGDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGA  197
            EP G ++L+CRV IRLP+ RR+QRNFL +DPI+LLWSFC+  +EE + + F   Q IPGA
Sbjct  370  EPTGSRDLLCRVAIRLPNNRRIQRNFLHTDPIKLLWSFCAPEVEEGEKRAFHFVQPIPGA  429

Query  196  TSSLDFESNLTFEESGLANSMISVTWD  116
            +  L+F S+LTF+E+ LANSMI++ WD
Sbjct  430  SQKLEFASDLTFKEARLANSMINLLWD  456



>ref|XP_002447303.1| hypothetical protein SORBIDRAFT_06g032400 [Sorghum bicolor]
 gb|EES11631.1| hypothetical protein SORBIDRAFT_06g032400 [Sorghum bicolor]
Length=463

 Score =   177 bits (448),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 98/203 (48%), Positives = 137/203 (67%), Gaps = 7/203 (3%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVSLS-HKRPRESPQAPPlhkddake  527
            DP+TGQKM +W GMV P+ LLEDLLP++D  P +H +    KRPR+  Q     K     
Sbjct  261  DPVTGQKMHAWNGMVHPDRLLEDLLPYLDKGPKEHHAAQPQKRPRKVDQEASTGKQGKIA  320

Query  526  ed---eellqalaASMEGMKDT--NVDALKESSESD-VLGKETNVVKKPVYPPLPEEPKG  365
             +   EEL +A+AAS+E  K+     DA  + +E++  +  E ++  KP YPPLPEEP G
Sbjct  321  VEDEDEELARAVAASLEEGKEIIEASDASDDMAEAEPQVDNEPSLNIKPDYPPLPEEPTG  380

Query  364  DKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSL  185
             ++ +CRV IRLP+ RR+QRNFL +DPI+LLWSFC+  +E+ + + F   QAIPGA+  L
Sbjct  381  SRDRLCRVAIRLPNNRRIQRNFLHTDPIKLLWSFCAPQVEDGEKRAFHFVQAIPGASQKL  440

Query  184  DFESNLTFEESGLANSMISVTWD  116
            +F S+ TF+E+GLANSMI++ WD
Sbjct  441  EFRSDQTFKEAGLANSMINLLWD  463



>ref|XP_003580790.1| PREDICTED: UBX domain-containing protein 2 isoform X1 [Brachypodium 
distachyon]
Length=457

 Score =   176 bits (447),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 94/205 (46%), Positives = 131/205 (64%), Gaps = 14/205 (7%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVSLS-HKRPRESPQAPPlhkddake  527
            DPITGQKM +W GMV P+ LLEDL+P++D  P +H +    KRPR+  Q   + +     
Sbjct  258  DPITGQKMCAWTGMVYPDRLLEDLMPYLDKGPKEHHAAQPQKRPRKIDQETSMGRQGRTT  317

Query  526  edeellqalaASMEGMKDTNVDALKESSESDVLGKETN--------VVKKPVYPPLPEEP  371
             ++E  +   A    +++      K   +SD    +TN        +  K  YPPLPEEP
Sbjct  318  VEDEDEELARAVAASLEEN-----KGFEQSDATNDKTNPEEENEPSLSVKLEYPPLPEEP  372

Query  370  KGDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATS  191
            K  ++L+CRV IRLPDGRR+QRNFL +DPI+LLWSFCS  LE+ D + F   + IPGA++
Sbjct  373  KVSRDLLCRVAIRLPDGRRIQRNFLHTDPIKLLWSFCSPQLEDGDKRAFHFVKPIPGASN  432

Query  190  SLDFESNLTFEESGLANSMISVTWD  116
            +L +ES+ TF+E+GLANSMI++ WD
Sbjct  433  NLGYESDQTFKEAGLANSMINLLWD  457



>ref|XP_010325366.1| PREDICTED: LOW QUALITY PROTEIN: UBX domain-containing protein 
7-like [Solanum lycopersicum]
Length=375

 Score =   173 bits (438),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 92/198 (46%), Positives = 124/198 (63%), Gaps = 36/198 (18%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVSLSHKRPRESPQAPPlhkddakee  524
            DPITGQKMRSW GMVQPE LL D++ F+D +PS++ S   +   E               
Sbjct  208  DPITGQKMRSWNGMVQPERLLADVMTFIDRTPSEYHSDLIRNQLE---------------  252

Query  523  deellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKG----DKN  356
                           + T+ D  +ESS+++   KE  ++   +Y PLPEEP G    DKN
Sbjct  253  ---------------RLTHRDRTEESSDTNHEPKE--MIVSCIYLPLPEEPNGSLICDKN  295

Query  355  LVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFE  176
            LVCR+ IRLPDGRR+QRNF+++DPI+LLWSFCS+  EE   + FR  QA+PG T+  +++
Sbjct  296  LVCRIAIRLPDGRRIQRNFMKTDPIKLLWSFCSTQFEEAKTRAFRFRQAMPGPTNFWNYD  355

Query  175  SNLTFEESGLANSMISVT  122
            SNLTFEESGL NS+I++ 
Sbjct  356  SNLTFEESGLDNSIIALV  373



>gb|EMT10976.1| hypothetical protein F775_30110 [Aegilops tauschii]
Length=396

 Score =   172 bits (435),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 94/201 (47%), Positives = 131/201 (65%), Gaps = 5/201 (2%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVSLS-HKRPRESPQAPPlhkddake  527
            DPITGQKMR W GMV P++LLEDL+P+++  P +H +    KRPR+  Q   + +     
Sbjct  196  DPITGQKMRGWSGMVYPDSLLEDLMPYLEKGPKEHHAAQPQKRPRKVDQETSMVRQGKTA  255

Query  526  edee---llqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGDKN  356
             + E   L +A+AAS+E  K        +   + V   E ++  K  YPPLPEEPK  ++
Sbjct  256  VESEDEELARAVAASLEENKGAGGSGAADEKSNPVEETEPSLSVKIEYPPLPEEPKVSRD  315

Query  355  LVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGAT-SSLDF  179
            L+CRV +RLPDGRR+QRNFL +DPI+LLWSFCSS +++ + + F   Q IPGA  + L +
Sbjct  316  LLCRVAVRLPDGRRIQRNFLHADPIKLLWSFCSSQVDDGEKRAFHFGQPIPGAAINKLQY  375

Query  178  ESNLTFEESGLANSMISVTWD  116
             S  TF+E+GLANSMI++ WD
Sbjct  376  SSEQTFKEAGLANSMINLLWD  396



>ref|NP_001170636.1| uncharacterized protein LOC100384688 [Zea mays]
 gb|ACR34298.1| unknown [Zea mays]
 gb|AFW59832.1| hypothetical protein ZEAMMB73_017157 [Zea mays]
Length=459

 Score =   172 bits (435),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 96/202 (48%), Positives = 132/202 (65%), Gaps = 9/202 (4%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSP-SDHVSLSHKRPRESPQAPPlhkddake  527
            DP+TGQK+ +W GMV P+ LLEDLLP++D  P   H +   KRPR+  Q     K     
Sbjct  259  DPVTGQKVHAWNGMVHPDRLLEDLLPYLDKGPKGHHAAQPQKRPRKVDQEASTGKQGKIA  318

Query  526  ed---eellqalaASMEGM---KDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKG  365
             +   EEL +A+AAS+E +    D + D + E+   +      N+  KP YPPLPEEPKG
Sbjct  319  VEDEDEELARAIAASLEVVIEASDASDDDMAEAEPEEENEPSLNI--KPDYPPLPEEPKG  376

Query  364  DKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSL  185
             + L+CRV IRLP+ +R+QRNFL +DPI+LLWSFC+  +E+ + + F   QAIPGA+  L
Sbjct  377  SRELLCRVAIRLPNNQRIQRNFLHTDPIKLLWSFCAPQVEDGEKRAFHFVQAIPGASQKL  436

Query  184  DFESNLTFEESGLANSMISVTW  119
             F S+LTF ++GLANSMI++ W
Sbjct  437  QFGSDLTFRKAGLANSMINLLW  458



>dbj|BAK05667.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=453

 Score =   171 bits (434),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 100/201 (50%), Positives = 133/201 (66%), Gaps = 8/201 (4%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVSLS-HKRPRESPQAPPlhkddak-  530
            DPITGQKMR W GMV P++LLEDL+P+++  P +H +    KRPR+  Q   + +     
Sbjct  256  DPITGQKMRGWNGMVYPDSLLEDLMPYLEKGPKEHHAAQPQKRPRKVDQETSVVRQGKTG  315

Query  529  --eedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGDKN  356
               EDEEL +A+AAS+E  K +  D      E +   KE ++  K  YPPLPEEPK  + 
Sbjct  316  IENEDEELARAVAASLEEKKGSGDDETNPKPEEE---KEPSLSAKMEYPPLPEEPKVSRE  372

Query  355  LVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGAT-SSLDF  179
            LVCRV +RLP GRR+QRNFL +DPI+LLWS CSS +E+ + + F   Q IPGA  + L +
Sbjct  373  LVCRVAVRLPGGRRIQRNFLHTDPIKLLWSLCSSEVEDGEKRAFHFGQPIPGAAINKLQY  432

Query  178  ESNLTFEESGLANSMISVTWD  116
            ES  TF+E+GLANSMI++ WD
Sbjct  433  ESEQTFKEAGLANSMINLLWD  453



>tpg|DAA35438.1| TPA: hypothetical protein ZEAMMB73_856149 [Zea mays]
Length=426

 Score =   169 bits (429),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 93/203 (46%), Positives = 130/203 (64%), Gaps = 7/203 (3%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRE-SPQAPPlhkddak  530
            DP+TGQKM +W GMV P+ LLEDLLP++D  P +H  +   KRPR+  P+A    +    
Sbjct  224  DPVTGQKMHAWNGMVHPDRLLEDLLPYLDKGPKEHHAAQPQKRPRKVDPEASTGKQGKIA  283

Query  529  eedeellqalaASMEGMKDTNVDALKESSESDVLGKET-----NVVKKPVYPPLPEEPKG  365
             EDE+   A A +    +   V    ++S+  V  +        +  KP YPPLPEEP G
Sbjct  284  VEDEDEELARAVAASLEESKEVIEASDASDDMVEAEPEEENEPTLNTKPDYPPLPEEPTG  343

Query  364  DKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSL  185
             ++L+CRV IRLP+ RR+QRNFL +DPI+LLWSFC+  +E+ + + F   QAIPGA+  L
Sbjct  344  SRDLLCRVAIRLPNNRRIQRNFLHTDPIKLLWSFCAPQVEDGERRAFHFVQAIPGASQKL  403

Query  184  DFESNLTFEESGLANSMISVTWD  116
            +  S+LTF+E+GLANSMI++  D
Sbjct  404  ELGSDLTFKEAGLANSMINLLLD  426



>tpg|DAA35439.1| TPA: hypothetical protein ZEAMMB73_856149 [Zea mays]
Length=461

 Score =   170 bits (430),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 93/203 (46%), Positives = 130/203 (64%), Gaps = 7/203 (3%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRE-SPQAPPlhkddak  530
            DP+TGQKM +W GMV P+ LLEDLLP++D  P +H  +   KRPR+  P+A    +    
Sbjct  259  DPVTGQKMHAWNGMVHPDRLLEDLLPYLDKGPKEHHAAQPQKRPRKVDPEASTGKQGKIA  318

Query  529  eedeellqalaASMEGMKDTNVDALKESSESDVLGKET-----NVVKKPVYPPLPEEPKG  365
             EDE+   A A +    +   V    ++S+  V  +        +  KP YPPLPEEP G
Sbjct  319  VEDEDEELARAVAASLEESKEVIEASDASDDMVEAEPEEENEPTLNTKPDYPPLPEEPTG  378

Query  364  DKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSL  185
             ++L+CRV IRLP+ RR+QRNFL +DPI+LLWSFC+  +E+ + + F   QAIPGA+  L
Sbjct  379  SRDLLCRVAIRLPNNRRIQRNFLHTDPIKLLWSFCAPQVEDGERRAFHFVQAIPGASQKL  438

Query  184  DFESNLTFEESGLANSMISVTWD  116
            +  S+LTF+E+GLANSMI++  D
Sbjct  439  ELGSDLTFKEAGLANSMINLLLD  461



>ref|XP_010935375.1| PREDICTED: UBX domain-containing protein 5 isoform X2 [Elaeis 
guineensis]
Length=413

 Score =   167 bits (424),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 92/198 (46%), Positives = 121/198 (61%), Gaps = 42/198 (21%)
 Frame = -2

Query  637  DLLPFMDGSPSDHVS-LSHKRPRESPQAPPlhkddakeedeellqalaASMEGMKDTNV-  464
            DLLP++D  P +H + L  KRPRE                  +++   A   GM D  + 
Sbjct  234  DLLPYLDKGPKEHHAILPQKRPRE------------------MVKDSTAHTSGMPDKTLV  275

Query  463  ----DALKESSES--DVLG----------------KETNVVKKPVYPPLPEEPKGDKNLV  350
                DA++++S +  D  G                 ET+   KP+YPPLPEEPKG + L+
Sbjct  276  PKSADAVQKTSATLEDTGGPIRSHATNDVPKHDKVAETSSSGKPIYPPLPEEPKGSRELL  335

Query  349  CRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFESN  170
            CRVGIRLPDGRRLQRNFLR DP++ LWSFC S LE+ + +PF  TQAIPGA+  L++ESN
Sbjct  336  CRVGIRLPDGRRLQRNFLRKDPVKFLWSFCCSKLEDGETRPFHFTQAIPGASKVLNYESN  395

Query  169  LTFEESGLANSMISVTWD  116
            LTFE++GL+NSMIS+ WD
Sbjct  396  LTFEDAGLSNSMISLAWD  413



>ref|XP_008668717.1| PREDICTED: UBX domain-containing protein 2-like [Zea mays]
Length=542

 Score =   169 bits (429),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 93/205 (45%), Positives = 132/205 (64%), Gaps = 11/205 (5%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRE-SPQAPPlhkddak  530
            DP+TGQKM +W GMV P+ LLEDLLP++D  P +H  +   KRPR+  P+A        K
Sbjct  340  DPVTGQKMHAWNGMVHPDRLLEDLLPYLDKGPKEHHAAQPQKRPRKVDPEA--STGKQGK  397

Query  529  eedeellqalaASMEGMKDTNVDALKESSESDVL-------GKETNVVKKPVYPPLPEEP  371
               E+  + LA ++    + + + ++ S  SD +         E  +  KP YPPLPEEP
Sbjct  398  IAVEDEDEELARAVAASLEESKEVIEASDASDDMVEAEPEEENEPTLNTKPDYPPLPEEP  457

Query  370  KGDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATS  191
             G ++L+CRV IRLP+ RR+QRNFL +DPI+LLWSFC+  +E+ + + F   QAIPGA+ 
Sbjct  458  TGSRDLLCRVAIRLPNNRRIQRNFLHTDPIKLLWSFCAPQVEDGERRAFHFVQAIPGASQ  517

Query  190  SLDFESNLTFEESGLANSMISVTWD  116
             L+  S+LTF+E+GLANSMI++  D
Sbjct  518  KLELGSDLTFKEAGLANSMINLLLD  542



>gb|EMS63720.1| UBX domain-containing protein 7 [Triticum urartu]
Length=454

 Score =   167 bits (423),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 97/201 (48%), Positives = 133/201 (66%), Gaps = 5/201 (2%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVSLS-HKRPRESPQAPP---lhkdd  536
            DPITGQKMR W GMV P++LLEDL+P+++  P +H +    KRPR+  Q        K  
Sbjct  254  DPITGQKMRGWSGMVYPDSLLEDLMPYLEKGPKEHHAAQPQKRPRKVDQETSMDRQGKTA  313

Query  535  akeedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGDKN  356
             + EDEEL +A+AAS+E  K        +   + V   E ++  K  YPPLPEEPK  ++
Sbjct  314  VESEDEELARAVAASLEENKGAGGSDGADEKSNPVEETEPSLSVKMEYPPLPEEPKVSRD  373

Query  355  LVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGAT-SSLDF  179
            L+CRV +RLPDG+R+QRNFL +DPI+LLWSFCSS +E+ + + F   Q IPGA  + L +
Sbjct  374  LLCRVAVRLPDGQRIQRNFLHTDPIKLLWSFCSSRVEDGEKRAFHFGQPIPGAAINKLQY  433

Query  178  ESNLTFEESGLANSMISVTWD  116
             S  TF+E+G+ANSMI++ WD
Sbjct  434  SSEQTFKEAGVANSMINLLWD  454



>ref|XP_006343881.1| PREDICTED: UBX domain-containing protein 7-like [Solanum tuberosum]
Length=424

 Score =   165 bits (418),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 96/208 (46%), Positives = 125/208 (60%), Gaps = 41/208 (20%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVS--LSHKRPRESPQAPPlhkddak  530
            DPITGQ MRSW GMVQPETLLED + F+D +PS++ S  LS +  R +P+          
Sbjct  242  DPITGQNMRSWNGMVQPETLLEDAMTFIDRTPSEYHSDLLSKQFDRLTPRDRIE------  295

Query  529  eedeellqalaASMEGMKDTNVDALKES-SESDVLGKETNVVKKPVYPPLPEEPK-----  368
                             + TN +  KE  ++ + L   TN++    Y PLPEEP      
Sbjct  296  -----------------ESTNHEESKEEENDQNELSMNTNMI----YLPLPEEPNRSLIS  334

Query  367  -GDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPG---  200
              DKNLVCR+ IRLPDGRR+QRNF+++DPI+LLWSFCS+  EE   K FR  QA+PG   
Sbjct  335  NCDKNLVCRIAIRLPDGRRIQRNFMKTDPIKLLWSFCSTQFEEAKTKAFRFRQAMPGPTK  394

Query  199  --ATSSLDFESNLTFEESGLANSMISVT  122
              A++    +SNLTFEESGL NS+I++ 
Sbjct  395  FWASNFWTCDSNLTFEESGLDNSIIALV  422



>ref|XP_010519525.1| PREDICTED: UBX domain-containing protein 2-like [Tarenaya hassleriana]
Length=324

 Score =   162 bits (411),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 91/201 (45%), Positives = 115/201 (57%), Gaps = 43/201 (21%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSD--HVSLSHKRPRESPQAPPlhkddak  530
            DP TGQ+M  W G + P   LEDL+PFMD  P +    S+S KRPR  P           
Sbjct  162  DPTTGQQMHLWSGKIDPRAFLEDLVPFMDHGPRECSSSSVSRKRPRMDPMVAKQV-----  216

Query  529  eedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGDKN--  356
                                  D+L+            N+  + V+PPLPEEP+G  N  
Sbjct  217  ---------------------TDSLR------------NMTLEAVFPPLPEEPQGSSNGG  243

Query  355  LVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFE  176
             +CRVG+RLPDGRRL R+F +SDPIQLLWSFC S LE  + KP +L  AIPGA+ +L++ 
Sbjct  244  FLCRVGVRLPDGRRLVRSFNKSDPIQLLWSFCYSELEGWEGKPLKLRLAIPGASKTLEYG  303

Query  175  SNLTFEESGLANSMISV-TWD  116
            SNLTFE+SGL NS+I+V TWD
Sbjct  304  SNLTFEQSGLENSLITVTTWD  324



>ref|XP_006414754.1| hypothetical protein EUTSA_v10027144mg, partial [Eutrema salsugineum]
 gb|ESQ56207.1| hypothetical protein EUTSA_v10027144mg, partial [Eutrema salsugineum]
Length=388

 Score =   163 bits (412),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 88/202 (44%), Positives = 127/202 (63%), Gaps = 20/202 (10%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVS--LSHKRPRESPQAPPlhkddak  530
            DPITGQKM SW G+++ ++ LEDL  +MD  P +HV+   S+KR +       +  +  +
Sbjct  201  DPITGQKMHSWSGVIEAKSFLEDLAKYMDSGPHEHVASLTSNKRIK----TEKVCYESDQ  256

Query  529  eedeellqalaASMEGMKDTNVD-ALKESSESDV-LGKETNVVKKPVYPPLPEEPKGD--  362
                + +     +       N+D  L ES E D  LG          +P L EEPKGD  
Sbjct  257  TSTCQDMSTFWDNFFEESSNNIDHILFESVEDDTFLG----------FPVLTEEPKGDCD  306

Query  361  KNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLD  182
            +++VC + IR PDGRR QRNFL+++P+QLLWSFC S +EE++   F+L QAIPG++ +LD
Sbjct  307  RSVVCSLCIRFPDGRRKQRNFLKTEPVQLLWSFCYSQMEESEKNAFKLVQAIPGSSKTLD  366

Query  181  FESNLTFEESGLANSMISVTWD  116
            + +N TF++SGLANS+ISVTW+
Sbjct  367  YGANATFDQSGLANSLISVTWE  388



>ref|XP_009398016.1| PREDICTED: UBX domain-containing protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=434

 Score =   160 bits (405),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 95/198 (48%), Positives = 130/198 (66%), Gaps = 3/198 (2%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVS-LSHKRPRESPQ-APPlhkddak  530
            DPITGQKMR W  MV PE LLE+LLPF+D  P++H + L  KRPR +   A     D   
Sbjct  238  DPITGQKMRGWSNMVHPERLLEELLPFLDKGPNEHHAILPQKRPRVTHNSALNNILDKEV  297

Query  529  eedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGDKNLV  350
            E+DE L++A+AAS+E  K  +   + +         ET++  + +YPPLPEEPK  + L 
Sbjct  298  EDDEVLMRAIAASLEDGKGASWPPVIDDEPKPEKDSETSLNGEMIYPPLPEEPKSSREL-  356

Query  349  CRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFESN  170
            C++ IRLPDGRR++RNFL +D  +LLWS CSS L +   +PF   +AIPG   SL++ +N
Sbjct  357  CKIAIRLPDGRRIRRNFLPTDSTKLLWSLCSSQLADGQKRPFHFAEAIPGTLKSLEYANN  416

Query  169  LTFEESGLANSMISVTWD  116
            LTFEE+GL+N MI++  D
Sbjct  417  LTFEEAGLSNKMITLILD  434



>ref|XP_002868299.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44558.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=694

 Score =   163 bits (412),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 92/213 (43%), Positives = 130/213 (61%), Gaps = 27/213 (13%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHV-SLSHKRPRESPQAPPlhkddake  527
            DP+TGQKMR W GM++P+  LEDL+ +MD  P +HV SLS+KR +    + P +  D + 
Sbjct  160  DPVTGQKMRMWSGMIEPQGFLEDLMKYMDAGPHEHVASLSNKRIKTEKISFPSNNADDQV  219

Query  526  edeellqalaASMEGMKDTNVDALKESSESDVL----GKETNVVKKPV------------  395
            +            + +++    A  E  E+ V+    G+E   +K               
Sbjct  220  DMATFWG------DDIEEEKTVAKDEKEENLVVAPSWGQEFEDIKTLSDHEEETCLSSDL  273

Query  394  --YPPLPEEPK--GDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKP  227
              +P L EEPK   D+++VC + +R PDGRR QR FL+S+PIQLLWSFC SH+EE++ K 
Sbjct  274  FEFPVLTEEPKEDCDRSIVCSLCVRFPDGRRKQRKFLKSEPIQLLWSFCYSHMEESEKKA  333

Query  226  FRLTQAIPGATSSLDFESNLTFEESGLANSMIS  128
            FRL QAIPGA+ +LD+ +N+TF+ SGLANSMIS
Sbjct  334  FRLVQAIPGASKTLDYGANVTFDHSGLANSMIS  366


 Score =   126 bits (317),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 77/96 (80%), Gaps = 2/96 (2%)
 Frame = -2

Query  397  VYPPLPEEPKGD--KNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPF  224
            V+P L EEP GD  ++ VC + +R PDGRR QR FL+S+ IQLLWSFC S ++E++ + F
Sbjct  599  VFPVLAEEPNGDCDRSFVCSLCVRFPDGRRKQRRFLKSERIQLLWSFCYSLMDESEKRSF  658

Query  223  RLTQAIPGATSSLDFESNLTFEESGLANSMISVTWD  116
            +L QAIPGA+ +LD+E++ TF++SGLANSMISVTW+
Sbjct  659  KLVQAIPGASKTLDYEADTTFDQSGLANSMISVTWE  694


 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHV-SLSHKRPRESPQA  557
            +PITGQKMR W G+++P++ +EDL+ F D  P +++ SL+  R  E+ + 
Sbjct  465  NPITGQKMRMWSGVIEPDSFVEDLMMFRDAGPHENIASLTRNRRTETTET  514



>gb|KJB30688.1| hypothetical protein B456_005G158000 [Gossypium raimondii]
Length=408

 Score =   159 bits (401),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 92/151 (61%), Positives = 112/151 (74%), Gaps = 7/151 (5%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSD-HVSLSHKRPRES---PQAPPlhkdd  536
            DPITGQKMRSW GMVQPE+LLEDL+ FMDG P D H +LSHKRPR S   PQ       D
Sbjct  255  DPITGQKMRSWFGMVQPESLLEDLVQFMDGGPRDYHATLSHKRPRGSSVTPQQKIKVSTD  314

Query  535  akeedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGDKN  356
               ED+E+L+A+AASME  K++ +   ++   S    +E  + KKP YPPLPEEPKGD+N
Sbjct  315  ETNEDKEMLRAIAASMENAKES-IKTTEDDKVSSTTEEEPCLTKKPAYPPLPEEPKGDRN  373

Query  355  LVCRVGIRLPDGRRLQRNFLRSDPIQ--LLW  269
            L+CRVG+RLPDGRR+QRNFLR+DPIQ  +LW
Sbjct  374  LLCRVGVRLPDGRRVQRNFLRTDPIQVSILW  404



>ref|XP_010450084.1| PREDICTED: UBX domain-containing protein 7-like [Camelina sativa]
Length=373

 Score =   157 bits (397),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 85/218 (39%), Positives = 120/218 (55%), Gaps = 49/218 (22%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVS--LSHKRPRESPQAPPlhkddak  530
            DPITGQKMR+W GM++    LEDL+ + D  P +HV+   S+KR +              
Sbjct  183  DPITGQKMRTWSGMIEAHDFLEDLMKYRDVGPHEHVASLTSNKRIK--------------  228

Query  529  eedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKP----------------  398
                          E +   +  A  +  +      +  VV  P                
Sbjct  229  -------------TEKIWFVSSQAYDDHHDMSTFWDDDRVVTTPPSWGIEFEETCLSSDD  275

Query  397  --VYPPLPEEPKGD--KNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAK  230
               +P L EEPKGD  ++L+C + IR PDGRR+QR FL+S+PIQLLWSFC SH+EE++ +
Sbjct  276  MFEFPVLTEEPKGDCDRSLLCSLCIRFPDGRRMQRKFLKSEPIQLLWSFCYSHMEESEKR  335

Query  229  PFRLTQAIPGATSSLDFESNLTFEESGLANSMISVTWD  116
             F+L QAIPGAT +LD+ +  TF++SG+ NSM+SVTW+
Sbjct  336  AFKLVQAIPGATKTLDYGAKATFDQSGIDNSMVSVTWE  373



>ref|XP_010519462.1| PREDICTED: UBX domain-containing protein 2-like [Tarenaya hassleriana]
Length=357

 Score =   156 bits (394),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 85/198 (43%), Positives = 128/198 (65%), Gaps = 22/198 (11%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVSLSHKRPRESPQAPPlhkddakee  524
            DPITGQKMR W GMV+ E LLE+L+PFMD  P   +     R ++ P +    +  + E 
Sbjct  178  DPITGQKMRLWYGMVEGEILLEELVPFMDDGPKQQL----LRKKQHPTSTTEEQKPSLET  233

Query  523  deellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEP-KGDKNLVC  347
            ++ L +   AS+E +       L E  +++ +         P++PPLP+EP  GD  ++C
Sbjct  234  EKPLSETATASLETL------TLSEKDQANAM---------PMFPPLPQEPITGDPRVLC  278

Query  346  RVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAK-PFRLTQA-IPGATSSLDFES  173
            RVG R PDGRRL R FL+++PIQLLWSFC + ++E++ K PF+L +   PG+++++D+ S
Sbjct  279  RVGFRFPDGRRLMRTFLKTEPIQLLWSFCYAQIQESEMKQPFKLVETRTPGSSNAIDYGS  338

Query  172  NLTFEESGLANSMISVTW  119
            N TFE+SGLANS+I ++W
Sbjct  339  NQTFEQSGLANSIIFLSW  356



>ref|NP_193161.3| UBX domain-containing pseudogene [Arabidopsis thaliana]
 gb|AEE83401.1| structural constituent of ribosome [Arabidopsis thaliana]
Length=821

 Score =   159 bits (402),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 93/222 (42%), Positives = 131/222 (59%), Gaps = 33/222 (15%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVS--LSHKRPR------ESPQAPPl  548
            DPITGQKMR W G+++P+  LEDL+ +MD  P +HV+   S+KR +       S  A   
Sbjct  165  DPITGQKMRMWSGVIEPQGFLEDLMKYMDSGPHEHVASLTSNKRMKTEKISCSSNNADDQ  224

Query  547  hkddakeedeellqalaASMEGMKDT----------------NVDALKESSESDVLGKET  416
                      E  + +  S  G ++T                ++  L E  E   L    
Sbjct  225  DMATFWGNAIEEEKTVIKS--GKEETFTSDRVVAPSWGPEFEDIMTLSEHEEETCLS--C  280

Query  415  NVVKKPVYPPLPEEPKG--DKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEE  242
            ++++ PV   L EEPK   D+++VC + +R PDGRR QR FL+S+PIQLLWSFC SH+EE
Sbjct  281  DLLEFPV---LTEEPKADCDRSVVCSICVRFPDGRRKQRKFLKSEPIQLLWSFCYSHMEE  337

Query  241  TDAKPFRLTQAIPGATSSLDFESNLTFEESGLANSMISVTWD  116
            ++ K F+L QAIPGA+ +LD+ +  TF++SG+ANSMISVTWD
Sbjct  338  SEKKEFKLVQAIPGASKTLDYGAKATFDQSGIANSMISVTWD  379


 Score =   152 bits (385),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 88/229 (38%), Positives = 137/229 (60%), Gaps = 33/229 (14%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHV-SLSHKRPRESPQA---------P  554
            +PITGQKM  W G+++ E+++EDL+ F D  P +++ SL+  R  E+ +           
Sbjct  593  NPITGQKMHMWSGVIEAESIVEDLMMFWDAGPHENIASLTRNRRTETAETCLSSYNFYET  652

Query  553  PlhkddakeedeellqalaASMEGMKDTNVDALKESSESDVLGKETNV------------  410
            P      + E+E+   + + + + +  T    L+E  E ++    ++             
Sbjct  653  PAPSWGEEFEEEDNWSSRSNNNQVVAPTWEKELEEQDEWEIWSSRSDTDDFVPPFMGDEY  712

Query  409  -----VKKP----VYPPLPEEPKGD--KNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSF  263
                 VK+     V+P L EEPKGD  +++VC + +R PDGRR QR FL+S+PIQLLWSF
Sbjct  713  EDPDEVKEEEICLVFPVLTEEPKGDCDRSVVCSLCVRFPDGRRKQRKFLKSEPIQLLWSF  772

Query  262  CSSHLEETDAKPFRLTQAIPGATSSLDFESNLTFEESGLANSMISVTWD  116
            C SH++E++ K F+L QAIPGA+ +LD E++ TF++SGLANS+ISVTW+
Sbjct  773  CYSHIDESEKKAFKLVQAIPGASKTLDCEADATFDQSGLANSLISVTWE  821



>ref|NP_001190727.1| UBX domain-containing pseudogene [Arabidopsis thaliana]
 gb|AEE83402.1| structural constituent of ribosome [Arabidopsis thaliana]
Length=815

 Score =   159 bits (402),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 93/222 (42%), Positives = 131/222 (59%), Gaps = 33/222 (15%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVS--LSHKRPR------ESPQAPPl  548
            DPITGQKMR W G+++P+  LEDL+ +MD  P +HV+   S+KR +       S  A   
Sbjct  159  DPITGQKMRMWSGVIEPQGFLEDLMKYMDSGPHEHVASLTSNKRMKTEKISCSSNNADDQ  218

Query  547  hkddakeedeellqalaASMEGMKDT----------------NVDALKESSESDVLGKET  416
                      E  + +  S  G ++T                ++  L E  E   L    
Sbjct  219  DMATFWGNAIEEEKTVIKS--GKEETFTSDRVVAPSWGPEFEDIMTLSEHEEETCLS--C  274

Query  415  NVVKKPVYPPLPEEPKG--DKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEE  242
            ++++ PV   L EEPK   D+++VC + +R PDGRR QR FL+S+PIQLLWSFC SH+EE
Sbjct  275  DLLEFPV---LTEEPKADCDRSVVCSICVRFPDGRRKQRKFLKSEPIQLLWSFCYSHMEE  331

Query  241  TDAKPFRLTQAIPGATSSLDFESNLTFEESGLANSMISVTWD  116
            ++ K F+L QAIPGA+ +LD+ +  TF++SG+ANSMISVTWD
Sbjct  332  SEKKEFKLVQAIPGASKTLDYGAKATFDQSGIANSMISVTWD  373


 Score =   152 bits (384),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 88/229 (38%), Positives = 137/229 (60%), Gaps = 33/229 (14%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHV-SLSHKRPRESPQA---------P  554
            +PITGQKM  W G+++ E+++EDL+ F D  P +++ SL+  R  E+ +           
Sbjct  587  NPITGQKMHMWSGVIEAESIVEDLMMFWDAGPHENIASLTRNRRTETAETCLSSYNFYET  646

Query  553  PlhkddakeedeellqalaASMEGMKDTNVDALKESSESDVLGKETNV------------  410
            P      + E+E+   + + + + +  T    L+E  E ++    ++             
Sbjct  647  PAPSWGEEFEEEDNWSSRSNNNQVVAPTWEKELEEQDEWEIWSSRSDTDDFVPPFMGDEY  706

Query  409  -----VKKP----VYPPLPEEPKGD--KNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSF  263
                 VK+     V+P L EEPKGD  +++VC + +R PDGRR QR FL+S+PIQLLWSF
Sbjct  707  EDPDEVKEEEICLVFPVLTEEPKGDCDRSVVCSLCVRFPDGRRKQRKFLKSEPIQLLWSF  766

Query  262  CSSHLEETDAKPFRLTQAIPGATSSLDFESNLTFEESGLANSMISVTWD  116
            C SH++E++ K F+L QAIPGA+ +LD E++ TF++SGLANS+ISVTW+
Sbjct  767  CYSHIDESEKKAFKLVQAIPGASKTLDCEADATFDQSGLANSLISVTWE  815



>emb|CAB10204.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB78467.1| hypothetical protein [Arabidopsis thaliana]
Length=724

 Score =   158 bits (399),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 93/222 (42%), Positives = 130/222 (59%), Gaps = 33/222 (15%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVS--LSHKRPR------ESPQAPPl  548
            DPITGQKMR W G+++P+  LEDL+ +MD  P +HV+   S+KR +       S  A   
Sbjct  167  DPITGQKMRMWSGVIEPQGFLEDLMKYMDSGPHEHVASLTSNKRMKTEKISCSSNNADDQ  226

Query  547  hkddakeedeellqalaASMEGMKDT----------------NVDALKESSESDVLGKET  416
                      E  + +  S  G ++T                ++  L E  E   L    
Sbjct  227  DMATFWGNAIEEEKTVIKS--GKEETFTSDRVVAPSWGPEFEDIMTLSEHEEETCLS--C  282

Query  415  NVVKKPVYPPLPEEPKG--DKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEE  242
            ++++ PV   L EEPK   D+++VC + +R PDGRR QR FL+S+PIQLLWSFC SH+EE
Sbjct  283  DLLEFPV---LTEEPKADCDRSVVCSICVRFPDGRRKQRKFLKSEPIQLLWSFCYSHMEE  339

Query  241  TDAKPFRLTQAIPGATSSLDFESNLTFEESGLANSMISVTWD  116
            ++ K F+L QAIPGA+ +LD+ +  TF +SG+ANSMISVTWD
Sbjct  340  SEKKEFKLVQAIPGASKTLDYGAKATFVQSGIANSMISVTWD  381


 Score =   152 bits (385),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 88/229 (38%), Positives = 137/229 (60%), Gaps = 33/229 (14%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHV-SLSHKRPRESPQA---------P  554
            +PITGQKM  W G+++ E+++EDL+ F D  P +++ SL+  R  E+ +           
Sbjct  496  NPITGQKMHMWSGVIEAESIVEDLMMFWDAGPHENIASLTRNRRTETAETCLSSYNFYET  555

Query  553  PlhkddakeedeellqalaASMEGMKDTNVDALKESSESDVLGKETNV------------  410
            P      + E+E+   + + + + +  T    L+E  E ++    ++             
Sbjct  556  PAPSWGEEFEEEDNWSSRSNNNQVVAPTWEKELEEQDEWEIWSSRSDTDDFVPPFMGDEY  615

Query  409  -----VKKP----VYPPLPEEPKGD--KNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSF  263
                 VK+     V+P L EEPKGD  +++VC + +R PDGRR QR FL+S+PIQLLWSF
Sbjct  616  EDPDEVKEEEICLVFPVLTEEPKGDCDRSVVCSLCVRFPDGRRKQRKFLKSEPIQLLWSF  675

Query  262  CSSHLEETDAKPFRLTQAIPGATSSLDFESNLTFEESGLANSMISVTWD  116
            C SH++E++ K F+L QAIPGA+ +LD E++ TF++SGLANS+ISVTW+
Sbjct  676  CYSHIDESEKKAFKLVQAIPGASKTLDCEADATFDQSGLANSLISVTWE  724



>gb|EYU24728.1| hypothetical protein MIMGU_mgv1a025994mg, partial [Erythranthe 
guttata]
Length=320

 Score =   152 bits (385),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 90/149 (60%), Positives = 110/149 (74%), Gaps = 10/149 (7%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRESPQAPPlhkddake  527
            DPITGQK+ +WRGMVQPE LLEDL+PFMDGSPSDH VSLSHKRPR   +AP  H   A  
Sbjct  175  DPITGQKLHAWRGMVQPENLLEDLVPFMDGSPSDHHVSLSHKRPRVHTEAPVHHIQSAAA  234

Query  526  edeel------lqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKG  365
            E+ +        +ALAASM   K+ +    KE +E++   +ET   KKP Y PLPEEPKG
Sbjct  235  ENHDEDEEEELQRALAASMVDTKEIDEGDSKEVTEANN-AEETE--KKPSYLPLPEEPKG  291

Query  364  DKNLVCRVGIRLPDGRRLQRNFLRSDPIQ  278
            D++L+CRVG+RLPDGRR+QRNFLR+DP+Q
Sbjct  292  DRSLLCRVGVRLPDGRRVQRNFLRTDPVQ  320



>emb|CDY12748.1| BnaC04g28930D [Brassica napus]
Length=351

 Score =   152 bits (383),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 83/226 (37%), Positives = 127/226 (56%), Gaps = 32/226 (14%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVSLSHKRPRESPQAPPlhkddakee  524
            DPITGQ MRSW G ++    +EDL+ +MD  P  +++ S +  R                
Sbjct  137  DPITGQNMRSWSGAIEAHGFVEDLMKYMDDGPHQYMASSTRNKR----------------  180

Query  523  deellqalaASMEGMKDTNVD-----------ALKESSESDVLGKETNVVKKPVYPPLPE  377
             +    +  +S  GM +   +            L+    ++V  +E   ++   YP L E
Sbjct  181  MKTDKISSESSQTGMPELARNQTISHIVVPSWGLEFEKSAEVKQEEETCLR---YPDLTE  237

Query  376  EPKGD--KNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIP  203
            EP GD  ++LVC + +R PDGRR QR FL+++PIQLLWSFC S + E++ K F+L QAIP
Sbjct  238  EPNGDCDRSLVCSLCVRFPDGRRKQRKFLKTEPIQLLWSFCYSQMVESEKKAFKLVQAIP  297

Query  202  GATSSLDFESNLTFEESGLANSMISVTWD*SKMITVCFSSM*NARI  65
            GA+ +L++  N TF++SGLANSMIS+TW+    I +  + + + +I
Sbjct  298  GASKTLEYGPNATFDQSGLANSMISITWELYIYIYIFHNYLGSTKI  343



>ref|XP_009139539.1| PREDICTED: UBX domain-containing protein 2-like [Brassica rapa]
Length=387

 Score =   152 bits (384),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 79/200 (40%), Positives = 119/200 (60%), Gaps = 14/200 (7%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHV-SLSHKRPRESPQAPPlhkddake  527
            DPITG KMRSW G+++ ++ ++DL+ +    P +H+ SL+ K P              + 
Sbjct  198  DPITGFKMRSWSGVIEAQSFIDDLMNYTKSGPHEHIASLTRKEP----------VLCNET  247

Query  526  edeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPV-YPPLPEEPKGD--KN  356
                      +  E    TN D + E+ E+  L       +  + +P L EEP+GD  ++
Sbjct  248  NQTSDDVVTPSGAETCSSTNCDDVVETIETKTLPTHDEEEETCLEFPVLTEEPRGDCDRS  307

Query  355  LVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFE  176
            LVC + +R PDGRR QR FL+++PIQLLWSFC S + E++ K F+L QAIPGA+ +LD+ 
Sbjct  308  LVCSLCVRFPDGRRKQRKFLKTEPIQLLWSFCYSQMVESEKKAFKLVQAIPGASKTLDYG  367

Query  175  SNLTFEESGLANSMISVTWD  116
            ++ TF +SGLANSM+ V W+
Sbjct  368  ADATFGQSGLANSMVLVAWE  387



>ref|XP_001758899.1| predicted protein [Physcomitrella patens]
 gb|EDQ76405.1| predicted protein [Physcomitrella patens]
Length=450

 Score =   153 bits (387),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 84/200 (42%), Positives = 114/200 (57%), Gaps = 13/200 (7%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVSLS---HKRPRESPQAPPlhkdda  533
            DPITGQKMRSW GM+  E LLEDL+ +MD  P D   +    HKRPRE+ +         
Sbjct  260  DPITGQKMRSWEGMISAERLLEDLVRYMDMGPLDKQPIGFPPHKRPREAAKDANQPFKGH  319

Query  532  keedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGDKNL  353
                   +++       +    VDA       DV+    + V++ VYP L EEP+     
Sbjct  320  SLSGSRHMESSMEPSGALSGEKVDA-------DVVA--ASAVQQIVYPSLSEEPENKAPG  370

Query  352  VCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEET-DAKPFRLTQAIPGATSSLDFE  176
             CRVG+R PDG R  R FL SD ++ LWSFCSS ++E  D +PF L Q IPGA  +L + 
Sbjct  371  TCRVGVRFPDGSRSNRRFLMSDSVKQLWSFCSSKVKEAEDGRPFHLNQMIPGANRTLVYS  430

Query  175  SNLTFEESGLANSMISVTWD  116
            S+ + EE+G+AN+M+S+ WD
Sbjct  431  SDASMEEAGVANAMLSMVWD  450



>ref|XP_006285858.1| hypothetical protein CARUB_v10007353mg, partial [Capsella rubella]
 gb|EOA18756.1| hypothetical protein CARUB_v10007353mg, partial [Capsella rubella]
Length=348

 Score =   150 bits (379),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 83/202 (41%), Positives = 123/202 (61%), Gaps = 16/202 (8%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVS--LSHKRPRESPQAPPlhkddak  530
            DPITGQKM +W GM++ +  L++L+ ++D  P +HV+   S+KR +  P           
Sbjct  156  DPITGQKMHTWAGMIEAQAFLQELMTYLDVGPHEHVASLTSNKRIKTEP---------IW  206

Query  529  eedeellqalaASMEGMKDTNV-DALKESSESDV-LGKETNVVKKPV-YPPLPEEPKGDK  359
                +        M    D  + D+++E+  S   L +E  ++     +P L EEPK D 
Sbjct  207  FSSSQAYNGGDQDMSTFADPPLPDSIEETLMSLTELDEEARLLSDLFEFPALTEEPKEDC  266

Query  358  N--LVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSL  185
            +  L+C + +R PDGRR QR FL+S+P+QLLWSFC S +EE++ K F+L QAIPGAT +L
Sbjct  267  DPSLLCSLCVRFPDGRRKQRKFLKSEPVQLLWSFCFSLMEESEEKAFKLVQAIPGATKTL  326

Query  184  DFESNLTFEESGLANSMISVTW  119
            D+ +  TF +SG+ANSM+SVTW
Sbjct  327  DYGAEATFGQSGIANSMVSVTW  348



>ref|XP_006470475.1| PREDICTED: UBX domain-containing protein 7-like [Citrus sinensis]
Length=397

 Score =   150 bits (378),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 86/197 (44%), Positives = 111/197 (56%), Gaps = 49/197 (25%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVSLSHKRPRESPQAPPlhkddakee  524
            DPITG+KMR W GMV P +LLEDLL FM+  P D +  + K   + P  PP+H+      
Sbjct  220  DPITGEKMRKWCGMVDPVSLLEDLLSFMESGPRDQLERATKT--QLPPYPPVHE------  271

Query  523  deellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEP-KGDKNLVC  347
                                                   + P YP +PEEP +  +NLVC
Sbjct  272  ---------------------------------------QMPAYPAVPEEPLQVARNLVC  292

Query  346  RVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETD-AKPFRLTQAIPGATSSLDFESN  170
            R+G+RLPDGR ++RNFL +DP+QLLWSFC S LEE +  + FRLT+  PGA   LD+ S 
Sbjct  293  RIGVRLPDGRMIRRNFLLTDPVQLLWSFCFSQLEEANQTRQFRLTRPDPGAPKPLDYNSK  352

Query  169  LTFEESGLANSMISVTW  119
            +TF+ESGL NS+I VTW
Sbjct  353  MTFQESGLNNSVILVTW  369



>emb|CDY01207.1| BnaA04g06120D [Brassica napus]
Length=789

 Score =   153 bits (386),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 80/205 (39%), Positives = 122/205 (60%), Gaps = 9/205 (4%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHV-SLSHKRP----RESPQAPPlhkd  539
            DPITG KMRSW G+++ ++ ++DL+ +    P +H+ SL+ K P    + +  +  +   
Sbjct  585  DPITGFKMRSWSGVIEAQSFIDDLMNYTKSGPHEHIASLTRKEPVLCNKTNQTSDDVVTP  644

Query  538  dakeedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVY--PPLPEEPKG  365
               E             E    TN + + E+ E+  L       ++  +  P L EEPKG
Sbjct  645  SGAETCSSSNHIDHVVAETCSSTNCNDVVETIETKTLPTHEEKEEETCFEFPVLTEEPKG  704

Query  364  D--KNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATS  191
            D  ++LVC + +R PDGRR QR FL+++PIQLLWSFC S + E++ K F+L QAIPGA+ 
Sbjct  705  DCDRSLVCSLCVRFPDGRRKQRKFLKTEPIQLLWSFCHSQMVESEKKAFKLVQAIPGASK  764

Query  190  SLDFESNLTFEESGLANSMISVTWD  116
            +LD+ ++ TF +SGLANSM+ V W+
Sbjct  765  TLDYGADATFGQSGLANSMVLVAWE  789


 Score =   151 bits (382),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 92/249 (37%), Positives = 140/249 (56%), Gaps = 22/249 (9%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVSLS--HKRPRESPQAPPlhkddak  530
            DPITGQ MRSW G ++    +EDL+ +MD  P  +++ S  +KR +    +    +    
Sbjct  171  DPITGQNMRSWSGAIEAHGFVEDLMKYMDDGPHQYMASSTRNKRMKTEKISSESSQTGMP  230

Query  529  eedeellqalaASMEGMKDTNVDALK-------ESSESDVLGKETNVVKKPVYPPLPEEP  371
            E  E L           ++  +  +        E  +S  + +E   V+   +P L EEP
Sbjct  231  ELAESLETKEEEETCSSRNQTISHIGLPLPWGPEFEKSAEVKQEETCVE---FPDLTEEP  287

Query  370  KGD--KNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGA  197
            KGD  K+LVC + +R PDGRR QR FL+++PIQLLWSFC S +  ++ K F+L QAIPGA
Sbjct  288  KGDCDKSLVCSLCVRFPDGRRKQRKFLKTEPIQLLWSFCHSQIVGSEKKAFKLVQAIPGA  347

Query  196  TSSLDFESNLTFEESGLANSMISVTWD*SKMITVCFSSM*NARIFIFVSAASCH------  35
            + +L++ ++ TF++SGLANSMISVTWD   ++ +  +   N   ++F S  S H      
Sbjct  348  SKTLEYGASATFDQSGLANSMISVTWD-YNVLLIQATLFDNDGYYLFSSRLSNHQHDKLI  406

Query  34   -IMCIIQIV  11
             +  ++QIV
Sbjct  407  LVHSLLQIV  415



>ref|XP_009139538.1| PREDICTED: UBX domain-containing protein 2 [Brassica rapa]
Length=427

 Score =   149 bits (375),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 86/207 (42%), Positives = 125/207 (60%), Gaps = 14/207 (7%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVSLSHKRPR--------ESPQAP-P  551
            DPITGQ MRSW G ++    +EDL+ +MD  P  +++ S +  R        ES Q   P
Sbjct  224  DPITGQNMRSWSGAIEAHGFVEDLMKYMDDGPHQYMASSTRNKRMKTDKISSESSQTGMP  283

Query  550  lhkddakeedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEP  371
               +  + ++EE   +      G     +    E  +S  + +E   V+   +P L EEP
Sbjct  284  ELAESLETKEEEETCSSRNQTIGHIGLPLSWGPEFEKSAEVKQEEICVE---FPDLTEEP  340

Query  370  KGD--KNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGA  197
            KGD  K+LVC + +R PDGRR QR FL+++PIQLLWSFC S +  ++ K F+L QAIPGA
Sbjct  341  KGDCDKSLVCSLCVRFPDGRRKQRKFLKTEPIQLLWSFCHSQIVGSEKKAFKLVQAIPGA  400

Query  196  TSSLDFESNLTFEESGLANSMISVTWD  116
            + +L++ ++ TF++SGLANSMISVTW+
Sbjct  401  SKTLEYGASATFDQSGLANSMISVTWE  427



>ref|XP_010490003.1| PREDICTED: UBX domain-containing protein 2-like [Camelina sativa]
Length=320

 Score =   145 bits (367),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 81/202 (40%), Positives = 119/202 (59%), Gaps = 18/202 (9%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVS--LSHKRPRESPQAPPlhkddak  530
            DPITGQKMR W GM++    LEDL+ + D  P +HV+   S+KR +           +  
Sbjct  131  DPITGQKMRKWSGMIEAHGFLEDLMKYKDVGPHEHVASLTSNKRIK----------TEKI  180

Query  529  eedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVY--PPLPEEPKGD--  362
                  +      M    D +      S   +   +ET +    V+  P L EEPKGD  
Sbjct  181  CFLSSQVDDDHQDMSTFWDNDRVVTPPSWGKEF--EETCLSSDDVFEFPVLTEEPKGDCD  238

Query  361  KNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLD  182
            ++L+C + IR PDGRR QR FL+S+P+QLLWSFC  ++E+++ + F+L QAIPGAT +LD
Sbjct  239  RSLLCSLCIRFPDGRRKQRKFLKSEPVQLLWSFCYFNMEDSEKRAFKLVQAIPGATKTLD  298

Query  181  FESNLTFEESGLANSMISVTWD  116
            + +  TF++SG+ NS++SVTW+
Sbjct  299  YGAKATFDQSGIDNSIVSVTWE  320



>gb|KFK22408.1| hypothetical protein AALP_AAs65522U000100 [Arabis alpina]
Length=377

 Score =   147 bits (370),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 85/203 (42%), Positives = 123/203 (61%), Gaps = 7/203 (3%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVS--LSHKRPR-ESPQAPPlhkdda  533
            DP TGQKMR W GM+Q  + +EDL  +M+  P+ +++   S KR R E     P +K   
Sbjct  175  DPFTGQKMRMWSGMIQAHSFVEDLKKYMESGPNQYIASLTSKKRTRTEMVNCLPSNKRLK  234

Query  532  keedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPV-YPPLPEEPKGD--  362
             E+               ++++ DAL    E +   ++T +      +  L EEPKGD  
Sbjct  235  TEKTSCSPSNYTVQDMYTEESSEDALFVEEEEEEEEEDTCLSSDMFEFLVLTEEPKGDCD  294

Query  361  KNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETD-AKPFRLTQAIPGATSSL  185
            ++LVC + +R PDGRR  R FL+S+PIQLLWSFC +H+EE++  K F+L QAIPGA+ +L
Sbjct  295  RSLVCSLCVRFPDGRRKPRKFLKSEPIQLLWSFCYAHMEESERNKAFKLVQAIPGASKTL  354

Query  184  DFESNLTFEESGLANSMISVTWD  116
            ++ +N TFEESGL  +MISV W+
Sbjct  355  EYGTNATFEESGLDKAMISVIWE  377



>ref|XP_010436606.1| PREDICTED: UBX domain-containing protein 2-like [Camelina sativa]
Length=358

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 82/198 (41%), Positives = 123/198 (62%), Gaps = 8/198 (4%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHV-SLSHKRPRESPQAPPlhkddake  527
            DPITGQKM  W G+++ ++L E+L+ F D  P +++ SL   R  E+ +        +  
Sbjct  163  DPITGQKMGMWSGVIEYDSLYEELMKFTDAGPHEYIASLIRDRRTETTET----CLSSNI  218

Query  526  edeellqalaASMEGMKDTNVDALKESSESD-VLGKETNVVKKPVYPPLPEEPKGDKN--  356
              E    +     +G +DT   +   +  +D  L +E +      +P L EE KGD +  
Sbjct  219  AYEIPAPSWGEEFDGKEDTWSSSNNNNQVADPSLEQEESDEACLEFPVLTEELKGDCDPS  278

Query  355  LVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFE  176
            ++C + IR PDGRR  R FL+S+PIQLLWSFC SH++E++ K F+L QAIPGA+ +LD+ 
Sbjct  279  VLCSLCIRFPDGRRKPRKFLKSEPIQLLWSFCYSHMDESEKKAFKLVQAIPGASKTLDYG  338

Query  175  SNLTFEESGLANSMISVT  122
            +++TF++SGLANSMISVT
Sbjct  339  ADITFDQSGLANSMISVT  356



>emb|CDY12747.1| BnaC04g28940D [Brassica napus]
Length=385

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 79/200 (40%), Positives = 120/200 (60%), Gaps = 13/200 (7%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHV-SLSHKRPRESPQAPPlhkddake  527
            DPITG K+RSW G+++ ++ ++DL+ +    P +H+ SL  K P       P    +   
Sbjct  195  DPITGFKIRSWSGVIEAQSFIDDLMNYTKSGPHEHIASLRRKEP-----IKPDILCNETN  249

Query  526  edeellqalaASMEGMKDTN-VDALKESSESDVLGKETNVVKKPVYPPLPEEPKGD--KN  356
            +    +   ++ +E    +N +D +   +      +ET       +P L E P+GD  ++
Sbjct  250  QTSHRIVTPSSGVETCSSSNHIDHVVAKTLPTHEEEETCFE----FPALTEVPRGDCDRS  305

Query  355  LVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFE  176
            LVC V +R PDG R QR FL+S+PIQLLWSFC S + E++ K F+L QAIPGA+ +LD+ 
Sbjct  306  LVCSVCVRFPDGTRKQRRFLKSEPIQLLWSFCHSQIVESEKKAFKLVQAIPGASKTLDYG  365

Query  175  SNLTFEESGLANSMISVTWD  116
            +N TFE+SGLANSM+ V W+
Sbjct  366  ANATFEQSGLANSMVLVAWE  385



>gb|AGH62811.1| UBX1 [Brassica napus]
Length=386

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 79/200 (40%), Positives = 120/200 (60%), Gaps = 13/200 (7%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHV-SLSHKRPRESPQAPPlhkddake  527
            DPITG K+RSW G+++ ++ ++DL+ +    P +H+ SL  K P       P    +   
Sbjct  196  DPITGFKIRSWGGVIEAQSFIDDLMNYTKSGPHEHIASLRRKEP-----IKPDILCNETN  250

Query  526  edeellqalaASMEGMKDTN-VDALKESSESDVLGKETNVVKKPVYPPLPEEPKGD--KN  356
            +    +   ++ +E    +N +D +   +      +ET       +P L E P+GD  ++
Sbjct  251  QTSHRIVTPSSGVETCSSSNHIDHVVAKTLPTHEEEETCFE----FPALTEVPRGDCDRS  306

Query  355  LVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFE  176
            LVC V +R PDG R QR FL+S+PIQLLWSFC S + E++ K F+L QAIPGA+ +LD+ 
Sbjct  307  LVCSVCVRFPDGTRKQRRFLKSEPIQLLWSFCHSQIVESEKKAFKLVQAIPGASKTLDYG  366

Query  175  SNLTFEESGLANSMISVTWD  116
            +N TFE+SGLANSM+ V W+
Sbjct  367  ANATFEQSGLANSMVLVAWE  386



>gb|EEE61882.1| hypothetical protein OsJ_16574 [Oryza sativa Japonica Group]
Length=421

 Score =   146 bits (368),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 88/184 (48%), Positives = 123/184 (67%), Gaps = 12/184 (7%)
 Frame = -2

Query  640  EDLLPFMDGSPSDH-VSLSHKRPRESPQ--------APPlhkddakeedeellqalaASM  488
            +DL+P++D  P +H  +   KRPR+  Q          P+     ++EDEEL +A+AAS+
Sbjct  241  KDLMPYLDKGPKEHHAAQPQKRPRKVDQETSIGKQGKTPVPVVATEDEDEELARAVAASL  300

Query  487  EGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGDKNLVCRVGIRLPDGRRLQ  308
            E  K +  D  +E  E +V   E ++  K  YPPLPEEPKG + L+CRV IRLPDGRR+Q
Sbjct  301  EESKGS--DTSEEKIEPEV-ENEPSLSAKLNYPPLPEEPKGSRELLCRVAIRLPDGRRIQ  357

Query  307  RNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFESNLTFEESGLANSMIS  128
            RNFL +DPI+LLWSFC   +E+ D K F   Q IP A+++L++ES+ TF+E+GLANSMI+
Sbjct  358  RNFLHTDPIKLLWSFCYPQVEDGDKKAFHFVQPIPRASTNLEYESDKTFKEAGLANSMIN  417

Query  127  VTWD  116
            + WD
Sbjct  418  LLWD  421



>ref|XP_006446591.1| hypothetical protein CICLE_v10017670mg [Citrus clementina]
 gb|ESR59831.1| hypothetical protein CICLE_v10017670mg [Citrus clementina]
Length=369

 Score =   144 bits (362),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 85/196 (43%), Positives = 109/196 (56%), Gaps = 49/196 (25%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVSLSHKRPRESPQAPPlhkddakee  524
            DPITG+KMR W GMV P +LLEDLL FM+  P D +  + K   + P  PP+H+      
Sbjct  219  DPITGEKMRKWCGMVDPVSLLEDLLSFMESGPRDQLERATKT--QLPPYPPVHE------  270

Query  523  deellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEP-KGDKNLVC  347
                                                   + P YP +PEEP +  +NLVC
Sbjct  271  ---------------------------------------QMPAYPAVPEEPLQVARNLVC  291

Query  346  RVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETD-AKPFRLTQAIPGATSSLDFESN  170
            R+GIRLPDGR ++RNFL +DP+QLLWSFC S LEE +  + FRLT+  PGA   LD+ S 
Sbjct  292  RIGIRLPDGRMIRRNFLLTDPVQLLWSFCFSQLEEANQTRQFRLTRPDPGAPKPLDYNSK  351

Query  169  LTFEESGLANSMISVT  122
            +TF+ES L NS+I VT
Sbjct  352  MTFQESELNNSVILVT  367



>ref|XP_009139540.1| PREDICTED: UBX domain-containing protein 7-like [Brassica rapa]
Length=412

 Score =   142 bits (359),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 86/210 (41%), Positives = 120/210 (57%), Gaps = 22/210 (10%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHV-SLSHKRPRESPQAPPlhkddake  527
            DP+TGQKM  W G+V  ++ +EDL  F++  P +HV SL   R  E+ +       +  +
Sbjct  211  DPVTGQKMGMWSGVVDAQSFVEDLSRFLEAGPHEHVASLIRDRYPETEEDQTCSASNNND  270

Query  526  edeellqalaASME-----------GMKDTNVDALKESSESDVLGKETNVVKKPVYPPLP  380
            +            E           G +  NV     SS +D       +V+   +P L 
Sbjct  271  QVPVPSWGEEFEKEDDWSSSKGPSWGEEFENVVETCSSSNND-----DGIVE---FPDLT  322

Query  379  EEPKGD--KNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAI  206
            EEPKGD  K+LVC + +R PDGRR QR FL+++PIQLLWSFC S + +++ K F+L QAI
Sbjct  323  EEPKGDCDKSLVCSLCVRFPDGRRKQRKFLKTEPIQLLWSFCYSQMVDSEKKTFKLVQAI  382

Query  205  PGATSSLDFESNLTFEESGLANSMISVTWD  116
            PGA+ +LD+    TFEESGLANSMISV ++
Sbjct  383  PGASKTLDYGLYATFEESGLANSMISVLYN  412



>ref|XP_006414812.1| hypothetical protein EUTSA_v10027208mg, partial [Eutrema salsugineum]
 gb|ESQ56265.1| hypothetical protein EUTSA_v10027208mg, partial [Eutrema salsugineum]
Length=394

 Score =   140 bits (354),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 84/200 (42%), Positives = 118/200 (59%), Gaps = 32/200 (16%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSL-SHKRPRESPQAPPlhkddak  530
            DPITGQKMRSW G+++ ++ LEDL+ +MD  P +H  SL S+KR +       +  +  +
Sbjct  223  DPITGQKMRSWSGVIEAKSFLEDLVKYMDSGPHEHNASLTSNKRIK----TEKVCYESDQ  278

Query  529  eedeellqalaASMEGMKDTNVD-ALKESSESDV-LGKETNVVKKPVYPPLPEEPKGDKN  356
                + +     +       N+D  L ES E D  LG          +P L EEPK    
Sbjct  279  TSTCQDMSTFWDNFFEESSNNIDHILFESVEDDTFLG----------FPVLTEEPK----  324

Query  355  LVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFE  176
                      DGRR QRNFL+++P+QLLWSFC S + E++ K F+L QAIPGA+ +LD+ 
Sbjct  325  ----------DGRRKQRNFLKTEPVQLLWSFCYSQMGESEKKAFKLVQAIPGASKTLDYG  374

Query  175  SNLTFEESGLANSMISVTWD  116
            +N TF++SGLANS+ISVTW+
Sbjct  375  ANATFDQSGLANSLISVTWE  394



>ref|NP_176165.1| pseudo [Arabidopsis thaliana]
 gb|AAK62798.1|AC027036_19 hypothetical protein [Arabidopsis thaliana]
 gb|AEE33588.1| UBX domain-containing protein [Arabidopsis thaliana]
Length=307

 Score =   137 bits (344),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 71/188 (38%), Positives = 117/188 (62%), Gaps = 9/188 (5%)
 Frame = -2

Query  673  WRGMVQPETLLEDLLPFMDGSPSDHVSLSHKRPRESPQAPPlhkddakeedeellqalaA  494
            +RG ++ +  L+DL  ++D SP +H++ + +  R   +A  +   D ++       ++  
Sbjct  127  FRGEIKAKGFLKDLKKYIDASPHEHIASTARNMR--VKAEKICHSDQQDMGNLSSDSVVV  184

Query  493  SMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGD--KNLVCRVGIRLPDG  320
            S  G +  +V  L E  E   L  +        +P L +EPKGD  +++VC + +R P+G
Sbjct  185  SSCGREFDDVVTLSEDEEETCLSSDL-----FEFPVLTKEPKGDCDRSVVCSISVRFPNG  239

Query  319  RRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFESNLTFEESGLAN  140
            RR QR FL+S+P+QLLWSFC SH++E+D K F+L QAIPGA+ +LD+ +  +F++ G+AN
Sbjct  240  RRKQRKFLKSEPVQLLWSFCYSHMDESDNKAFKLVQAIPGASKTLDYGAEASFDQYGIAN  299

Query  139  SMISVTWD  116
            S+ISVTW+
Sbjct  300  SIISVTWE  307



>ref|XP_002886675.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62934.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=305

 Score =   133 bits (335),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 73/188 (39%), Positives = 115/188 (61%), Gaps = 9/188 (5%)
 Frame = -2

Query  673  WRGMVQPETLLEDLLPFMDGSPSDHVSLSHKRPRESPQAPPlhkddakeedeellqalaA  494
            + G ++ ++ LEDL  ++D +P ++ + S  R          H D            +++
Sbjct  125  FSGEIKAQSFLEDLKKYIDATPHEYFA-SMARNMRVKTKKICHLDRDMVNSPSDRVVVSS  183

Query  493  SMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGD--KNLVCRVGIRLPDG  320
            S +  +D  +  L E  E   L   +N+ K   +P L EEPKGD  +++VC + ++ P+G
Sbjct  184  SGQEFEDV-IMTLSEHEEETCLS--SNMFK---FPVLTEEPKGDCDRSVVCSISVQFPNG  237

Query  319  RRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFESNLTFEESGLAN  140
            RR QR FL+S+PIQLLWSFC SH+EE++ K F+L QAIPGA+ +L + +  TF++SG+AN
Sbjct  238  RRKQRKFLKSEPIQLLWSFCYSHMEESEKKAFKLVQAIPGASKTLHYGAKATFDQSGIAN  297

Query  139  SMISVTWD  116
            S+ISVTW+
Sbjct  298  SIISVTWE  305



>emb|CDY01206.1| BnaA04g06130D [Brassica napus]
Length=412

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 84/209 (40%), Positives = 117/209 (56%), Gaps = 20/209 (10%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVSLSHKRPRESPQAPPlhkddakee  524
            DP+TGQKM  W G+V  ++ +EDL  F++  P +HV+ S  R R            +   
Sbjct  211  DPVTGQKMGMWSGVVDAQSFVEDLSRFLEAGPHEHVA-SLIRDRYPETEDDQTCSASNNN  269

Query  523  deellqalaASMEGMKDTNVDALKESSESDVLGKE-TNVVKKPV----------YPPLPE  377
            D+  + +     E   D +      SS+    G+E  NVV+              P L E
Sbjct  270  DQVPVPSWGEEFEKEDDWS------SSKGPSWGEEFENVVETCSSSNNDDGIFELPDLTE  323

Query  376  EPK--GDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIP  203
            EP    DK+LVC + +R PDGRR QR FL+++ IQLLWSFC S + +++ K F+L QAIP
Sbjct  324  EPTVDCDKSLVCSLCVRFPDGRRKQRKFLKTEHIQLLWSFCHSQMVDSEKKTFKLVQAIP  383

Query  202  GATSSLDFESNLTFEESGLANSMISVTWD  116
            GA+ +LD+    TFEESGLANSMISV ++
Sbjct  384  GASKTLDYGLYATFEESGLANSMISVLYN  412



>ref|XP_002883438.1| hypothetical protein ARALYDRAFT_898874 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59697.1| hypothetical protein ARALYDRAFT_898874 [Arabidopsis lyrata subsp. 
lyrata]
Length=139

 Score =   125 bits (314),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 82/115 (71%), Gaps = 5/115 (4%)
 Frame = -2

Query  457  LKESSESDVLGKETNVVKKPVYPPLPEEPKGD--KNLVCRVGIRLPDGRRLQRNFLRSDP  284
              E SE++ +     V     +P LPEEP  D  ++++CR+ +RLPDGRR+QR+FL+S+ 
Sbjct  27   FSEESETETMTSSNAVFG---FPHLPEEPNRDLDQSVLCRIRVRLPDGRRIQRSFLKSES  83

Query  283  IQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFESNLTFEESGLANSMISVTW  119
            +QLLWSFC S ++E++ K F+L QA PG   +L F SN TFEESGLANS++SVTW
Sbjct  84   VQLLWSFCYSQIDESERKRFKLIQAFPGEYKNLYFGSNTTFEESGLANSLVSVTW  138



>gb|KFK22146.1| hypothetical protein AALP_AAs62910U000300 [Arabis alpina]
Length=408

 Score =   131 bits (329),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 77/95 (81%), Gaps = 2/95 (2%)
 Frame = -2

Query  394  YPPLPEEPKGD--KNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFR  221
            +P L EEPK D  ++ +C + +R PDGRR QR FL+S+PIQLLWSFC SH+E ++ K F+
Sbjct  314  FPDLTEEPKSDCDRSELCNICVRFPDGRRKQRKFLKSEPIQLLWSFCYSHMEGSERKVFK  373

Query  220  LTQAIPGATSSLDFESNLTFEESGLANSMISVTWD  116
            L QAIPGA+ +LD+E+N TF++SGLANSMISVTW+
Sbjct  374  LVQAIPGASKTLDYEANETFDQSGLANSMISVTWE  408



>ref|XP_006414811.1| hypothetical protein EUTSA_v10027532mg [Eutrema salsugineum]
 gb|ESQ56264.1| hypothetical protein EUTSA_v10027532mg [Eutrema salsugineum]
Length=448

 Score =   131 bits (330),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 78/95 (82%), Gaps = 2/95 (2%)
 Frame = -2

Query  394  YPPLPEEPKGD--KNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFR  221
            +P L EEPKGD  +++VC + +R PDGRR QR FL+S+P+QLLWSFC S +E ++ K F+
Sbjct  354  FPDLTEEPKGDCDRSIVCSLCVRFPDGRRKQRRFLKSEPVQLLWSFCYSLMETSEKKVFK  413

Query  220  LTQAIPGATSSLDFESNLTFEESGLANSMISVTWD  116
            L QAIPGA+ +LD+ +N+TF++SGLANSMISVTW+
Sbjct  414  LVQAIPGASKTLDYGANMTFDQSGLANSMISVTWE  448



>ref|XP_010436605.1| PREDICTED: uncharacterized protein LOC104720396 [Camelina sativa]
Length=327

 Score =   128 bits (322),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 77/206 (37%), Positives = 114/206 (55%), Gaps = 49/206 (24%)
 Frame = -2

Query  667  GMVQPETLLEDLLPFMDGSPSDHVS--LSHKRPR------ESPQAPPlhkddakeedeel  512
            GM++    LEDL+ + D  P +HV+   S+KR +      ES QA               
Sbjct  149  GMIEAHGFLEDLMKYRDVGPHEHVASLTSNKRIKTEKICFESSQA---------------  193

Query  511  lqalaASMEGMKDTNVDALKESSESD----------VLGKETNVVKKPVY--PPLPEEPK  368
                        D +   +    E D          +  +ET +    ++  P L EEPK
Sbjct  194  ------------DDDHHGMSTFWEDDRFVTPPPSWGIEFEETCLSSDDMFEFPVLTEEPK  241

Query  367  GD--KNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGAT  194
            GD  ++L+C + IR PDGRR+QR FL+S+PIQLLWSFC S++EE++ + F+L QAIPGAT
Sbjct  242  GDCDRSLLCSLCIRFPDGRRMQRKFLKSEPIQLLWSFCYSNMEESEKRAFKLVQAIPGAT  301

Query  193  SSLDFESNLTFEESGLANSMISVTWD  116
             +LD+ +  TF++SG+ NS++SVTW+
Sbjct  302  KTLDYGAKATFDQSGIDNSIVSVTWE  327



>gb|AAF79774.1|AC009317_33 T30E16.10 [Arabidopsis thaliana]
Length=268

 Score =   127 bits (318),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 52/95 (55%), Positives = 77/95 (81%), Gaps = 2/95 (2%)
 Frame = -2

Query  394  YPPLPEEPKGD--KNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFR  221
            +P L +EPKGD  +++VC + +R P+GRR QR FL+S+P+QLLWSFC SH++E+D K F+
Sbjct  174  FPVLTKEPKGDCDRSVVCSISVRFPNGRRKQRKFLKSEPVQLLWSFCYSHMDESDNKAFK  233

Query  220  LTQAIPGATSSLDFESNLTFEESGLANSMISVTWD  116
            L QAIPGA+ +LD+ +  +F++ G+ANS+ISVTW+
Sbjct  234  LVQAIPGASKTLDYGAEASFDQYGIANSIISVTWE  268



>ref|XP_010445452.1| PREDICTED: UBX domain-containing protein 7 [Camelina sativa]
Length=430

 Score =   128 bits (322),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 61/114 (54%), Positives = 87/114 (76%), Gaps = 5/114 (4%)
 Frame = -2

Query  454  KESSESDVLGKETNVVKKPVYPPLPEEPKGDKN--LVCRVGIRLPDGRRLQRNFLRSDPI  281
            +E +ESD + ++   ++ PV   L EEPKGD +  +VC + +R PDGRR  R FL+S+PI
Sbjct  319  EEYAESDEVKEDEACLEFPV---LTEEPKGDCDPIVVCSLCLRFPDGRRKPRKFLKSEPI  375

Query  280  QLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFESNLTFEESGLANSMISVTW  119
            QLLWSFC SH++E++ K F+L Q IPGA+ +LD+ +++TF++SGLANSMISVTW
Sbjct  376  QLLWSFCYSHMDESEKKAFKLVQTIPGASKTLDYGADITFDQSGLANSMISVTW  429



>emb|CDY12746.1| BnaC04g28950D [Brassica napus]
Length=421

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 84/214 (39%), Positives = 118/214 (55%), Gaps = 21/214 (10%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHV-SLSHKRPRESPQ-----------  560
            DP+TGQKM  W G++  ++ +EDL  F++  P +H+ SL   R  E+ +           
Sbjct  205  DPVTGQKMGMWSGVIDAQSFVEDLSWFLEAGPHEHIASLIRNRYPEAEEDQTCSTSNNND  264

Query  559  ---APPlhkddakeedeellqalaASMEGMKDTNVDALKESS---ESDVLGKETNVVKKP  398
                P   ++  K+ED      +     G +  NV+    SS   + D++   +   +  
Sbjct  265  QVPVPSWGEEFEKKEDWSSSNNVEGPSWGEEFENVEETCSSSNNDDDDIVDPSSGPGEHW  324

Query  397  V-YPPLPEEPK--GDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKP  227
            V  P L EEPK   DK+LVC + +R PDG R QR FL+S+P  LLWSFC S LEE++   
Sbjct  325  VELPDLTEEPKVDCDKSLVCSLSVRFPDGTRKQRRFLKSEPYLLLWSFCDSLLEESEINA  384

Query  226  FRLTQAIPGATSSLDFESNLTFEESGLANSMISV  125
            F+L  AIPG + +LD+    TFEESGLANSMISV
Sbjct  385  FKLVHAIPGDSKTLDYRLYATFEESGLANSMISV  418



>gb|KFK39659.1| hypothetical protein AALP_AA3G272700 [Arabis alpina]
Length=144

 Score =   120 bits (302),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 75/94 (80%), Gaps = 4/94 (4%)
 Frame = -2

Query  394  YPPLPEEPKGD--KNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFR  221
            +P LPEEP  D  K+++CR+ +RLPDGRR++RNFL+++ +QLLWSFC S +++   KPF+
Sbjct  50   FPQLPEEPNRDLDKSVLCRICVRLPDGRRVERNFLKTESVQLLWSFCYSQIDQ--KKPFK  107

Query  220  LTQAIPGATSSLDFESNLTFEESGLANSMISVTW  119
            L QA PG+  +L + SN TFE+SGLANS++SVTW
Sbjct  108  LIQAFPGSYKTLHYGSNTTFEQSGLANSVVSVTW  141



>ref|XP_010450078.1| PREDICTED: UBX domain-containing protein 2-like [Camelina sativa]
Length=432

 Score =   125 bits (314),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 56/95 (59%), Positives = 77/95 (81%), Gaps = 2/95 (2%)
 Frame = -2

Query  394  YPPLPEEPKGDKN--LVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFR  221
            +P L EEPKGD +  ++C + IR PDGRR  R FL+S+PIQLLWSFC S+++E++ K F+
Sbjct  338  FPVLTEEPKGDCDPSVLCSLCIRFPDGRRKPRKFLKSEPIQLLWSFCYSNMDESEKKAFK  397

Query  220  LTQAIPGATSSLDFESNLTFEESGLANSMISVTWD  116
            L QAIPGA+ +LD+ ++ TF++SGLANSMISVTW+
Sbjct  398  LVQAIPGASKTLDYGADTTFDQSGLANSMISVTWE  432



>ref|XP_006406007.1| hypothetical protein EUTSA_v10021701mg [Eutrema salsugineum]
 gb|ESQ47460.1| hypothetical protein EUTSA_v10021701mg [Eutrema salsugineum]
Length=150

 Score =   119 bits (299),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 76/96 (79%), Gaps = 4/96 (4%)
 Frame = -2

Query  394  YPPLPEEPKG---DKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETD-AKP  227
            +P LPEEP     D++++CR+ +RLPDGRR+QR+FL+S+ +QLLWSFC S +++++  KP
Sbjct  54   FPELPEEPNNSDSDRSVLCRLCVRLPDGRRVQRSFLKSESVQLLWSFCYSQIDQSERIKP  113

Query  226  FRLTQAIPGATSSLDFESNLTFEESGLANSMISVTW  119
            F+L QA PG   +L + SN TFE+SGLANS+ISVTW
Sbjct  114  FKLIQAFPGEYKTLCYGSNTTFEQSGLANSLISVTW  149



>ref|XP_006285935.1| hypothetical protein CARUB_v10007447mg, partial [Capsella rubella]
 gb|EOA18833.1| hypothetical protein CARUB_v10007447mg, partial [Capsella rubella]
Length=436

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 72/94 (77%), Gaps = 2/94 (2%)
 Frame = -2

Query  394  YPPLPEEPKGDKN--LVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFR  221
            +P L EEPKGD +  LVC + +R PDGRR QR FL S+P+QLLWSFC S ++E++ K F 
Sbjct  342  FPVLTEEPKGDIDPSLVCNLCVRFPDGRRKQRKFLESEPVQLLWSFCYSQMDESEKKAFS  401

Query  220  LTQAIPGATSSLDFESNLTFEESGLANSMISVTW  119
            L QAIPGA+ +LD+  + TFE+S LANSMISVTW
Sbjct  402  LVQAIPGASKTLDYGDDATFEQSRLANSMISVTW  435



>ref|XP_006296631.1| hypothetical protein CARUB_v10014834mg [Capsella rubella]
 gb|EOA29529.1| hypothetical protein CARUB_v10014834mg [Capsella rubella]
Length=152

 Score =   117 bits (294),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 73/95 (77%), Gaps = 3/95 (3%)
 Frame = -2

Query  394  YPPLPEEPKG---DKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPF  224
            +P LPEEP     D++++CR+ +RLPDGR +QR+FL+S+ +QLLWSFC S ++E++ K F
Sbjct  57   FPNLPEEPSNRDCDRSVLCRIRVRLPDGRIIQRSFLKSESVQLLWSFCYSQIDESERKLF  116

Query  223  RLTQAIPGATSSLDFESNLTFEESGLANSMISVTW  119
            +L  A PG   +L + SN TFE+SGLANS++SVTW
Sbjct  117  KLIHAFPGECKTLHYGSNTTFEQSGLANSVVSVTW  151



>ref|XP_010466708.1| PREDICTED: uncharacterized protein LOC104746864 [Camelina sativa]
Length=156

 Score =   117 bits (292),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 74/95 (78%), Gaps = 3/95 (3%)
 Frame = -2

Query  394  YPPLPEEPKG---DKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPF  224
            +P LPEEP     D++++CR+ +RLPDGR  QR+FL+S+ +QLLWS+C+S ++E++ K F
Sbjct  61   FPNLPEEPTNRDFDQSVLCRIRVRLPDGRITQRSFLKSESVQLLWSYCNSQIDESERKLF  120

Query  223  RLTQAIPGATSSLDFESNLTFEESGLANSMISVTW  119
            +L QA PG   +L + SN TFE+SGLANS++SVTW
Sbjct  121  KLIQAFPGDYKTLHYGSNTTFEQSGLANSVVSVTW  155



>ref|XP_010514980.1| PREDICTED: uncharacterized protein LOC104790878 [Camelina sativa]
Length=155

 Score =   117 bits (292),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 74/95 (78%), Gaps = 3/95 (3%)
 Frame = -2

Query  394  YPPLPEEPKG---DKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPF  224
            +P LPEEP     D++++CR+ +RLPDGR  QR+FL+S+ +QLLWS+C+S ++E++ K F
Sbjct  60   FPHLPEEPTNHDFDQSVLCRIRVRLPDGRITQRSFLKSESVQLLWSYCNSQIDESERKLF  119

Query  223  RLTQAIPGATSSLDFESNLTFEESGLANSMISVTW  119
            +L QA PG   +L + SN TFE+SGLANS++SVTW
Sbjct  120  KLIQAFPGDYKTLHYGSNTTFEQSGLANSVVSVTW  154



>ref|XP_010488437.1| PREDICTED: uncharacterized protein LOC104766276 isoform X3 [Camelina 
sativa]
Length=155

 Score =   117 bits (292),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 74/95 (78%), Gaps = 3/95 (3%)
 Frame = -2

Query  394  YPPLPEEPKG---DKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPF  224
            +P LPEEP     D++++CR+ +RLPDGR  QR+FL+S+ +QLLWS+C+S ++E++ K F
Sbjct  60   FPHLPEEPTNRDFDQSVLCRIRVRLPDGRITQRSFLKSESVQLLWSYCNSQIDESERKLF  119

Query  223  RLTQAIPGATSSLDFESNLTFEESGLANSMISVTW  119
            +L QA PG   +L + SN TFE+SGLANS++SVTW
Sbjct  120  KLIQAFPGDYKTLHYGSNTTFEQSGLANSVVSVTW  154



>ref|XP_010488435.1| PREDICTED: uncharacterized protein LOC104766276 isoform X1 [Camelina 
sativa]
Length=157

 Score =   117 bits (292),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 74/95 (78%), Gaps = 3/95 (3%)
 Frame = -2

Query  394  YPPLPEEPKG---DKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPF  224
            +P LPEEP     D++++CR+ +RLPDGR  QR+FL+S+ +QLLWS+C+S ++E++ K F
Sbjct  62   FPHLPEEPTNRDFDQSVLCRIRVRLPDGRITQRSFLKSESVQLLWSYCNSQIDESERKLF  121

Query  223  RLTQAIPGATSSLDFESNLTFEESGLANSMISVTW  119
            +L QA PG   +L + SN TFE+SGLANS++SVTW
Sbjct  122  KLIQAFPGDYKTLHYGSNTTFEQSGLANSVVSVTW  156



>ref|XP_010488436.1| PREDICTED: uncharacterized protein LOC104766276 isoform X2 [Camelina 
sativa]
Length=157

 Score =   115 bits (288),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 50/95 (53%), Positives = 74/95 (78%), Gaps = 3/95 (3%)
 Frame = -2

Query  394  YPPLPEEPKG---DKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPF  224
            +P LPEEP     D++++CR+ +RLPDGR  QR+FL+S+ +QLLWS+C+S ++E++ K F
Sbjct  62   FPHLPEEPTNRDFDQSVLCRIRVRLPDGRITQRSFLKSESVQLLWSYCNSQIDESERKLF  121

Query  223  RLTQAIPGATSSLDFESNLTFEESGLANSMISVTW  119
            +L QA PG   +L + SN TFE+SGLANS++SV+W
Sbjct  122  KLIQAFPGDYKTLHYGSNTTFEQSGLANSVVSVSW  156



>ref|XP_009136068.1| PREDICTED: uncharacterized protein LOC103860231 [Brassica rapa]
Length=148

 Score =   114 bits (284),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/95 (56%), Positives = 74/95 (78%), Gaps = 3/95 (3%)
 Frame = -2

Query  394  YPPLPEEPKGD--KNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDA-KPF  224
            YP L EEP  D  ++++CR+ +RLPDGRR+QRNFL+S+ +QLLWSFC S +++++  KPF
Sbjct  53   YPELSEEPSSDWDRSVLCRICVRLPDGRRVQRNFLKSESVQLLWSFCYSQMDQSERNKPF  112

Query  223  RLTQAIPGATSSLDFESNLTFEESGLANSMISVTW  119
            +L QAIPG   +L +    +FE+SGLANS+ISVTW
Sbjct  113  KLFQAIPGYYKNLYYGYYTSFEQSGLANSLISVTW  147



>emb|CDY50464.1| BnaCnng19430D [Brassica napus]
Length=143

 Score =   112 bits (279),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 74/96 (77%), Gaps = 4/96 (4%)
 Frame = -2

Query  394  YPPLPEEPKGD--KNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETD--AKP  227
            +P L EEPK D  ++++CR+ +RLPDGR++QRNFLRS+ +QLLWSFC S ++E++   + 
Sbjct  47   FPELTEEPKSDSDRSVLCRLCVRLPDGRKVQRNFLRSESVQLLWSFCYSLMDESERRERS  106

Query  226  FRLTQAIPGATSSLDFESNLTFEESGLANSMISVTW  119
            F+L QA+PG   SL + S  +FE+SGLANS+ISV W
Sbjct  107  FKLIQAVPGEYKSLYYGSETSFEDSGLANSLISVIW  142



>ref|XP_009106587.1| PREDICTED: uncharacterized protein LOC103832346 [Brassica rapa]
Length=143

 Score =   112 bits (279),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 74/96 (77%), Gaps = 4/96 (4%)
 Frame = -2

Query  394  YPPLPEEPKGD--KNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETD--AKP  227
            +P L EEPK D  ++++CR+ +RLPDGR++QRNFLRS+ +QLLWSFC S ++E++   + 
Sbjct  47   FPELTEEPKSDSDRSVLCRLCVRLPDGRKVQRNFLRSESVQLLWSFCYSLMDESERRERS  106

Query  226  FRLTQAIPGATSSLDFESNLTFEESGLANSMISVTW  119
            F+L QA+PG   SL + S  +FE+SGLANS+ISV W
Sbjct  107  FKLIQAVPGEYRSLYYGSETSFEDSGLANSLISVIW  142



>ref|XP_006414759.1| hypothetical protein EUTSA_v10027233mg [Eutrema salsugineum]
 gb|ESQ56212.1| hypothetical protein EUTSA_v10027233mg [Eutrema salsugineum]
Length=418

 Score =   117 bits (292),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 71/219 (32%), Positives = 111/219 (51%), Gaps = 45/219 (21%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVSLSHKRPRESPQAPPlhkddakee  524
            DPITGQKMR W G ++ ++ +EDL  FM+     ++  S  +  ++P   P   ++ ++E
Sbjct  213  DPITGQKMRMWSGEIEAQSFVEDLSRFMEA----NIGFSSNKNDQAP--APSWVEEFEKE  266

Query  523  deellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEE-----PKGDK  359
            D          + G       +  E  + D     +N++++ V     EE     P    
Sbjct  267  DTCSSSNHINQVAG-------SSGEDFQKDNTWSSSNIIQQTVASSCVEEFENMEPWSSN  319

Query  358  N---------------------------LVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFC  260
            N                           L+C + +R PDGRR QR FL+S+P+QLLWSFC
Sbjct  320  NNYDHIVTPSWEPEFEDSSEVEEEESRILLCSLCVRFPDGRRKQRRFLKSEPVQLLWSFC  379

Query  259  SSHLEETDAKPFRLTQAIPGATSSLDFESNLTFEESGLA  143
             S +EE++ K F+L QAIPGA+ +LD+ +N TF++SGL+
Sbjct  380  YSQMEESEKKAFKLVQAIPGASKTLDYGANTTFDQSGLS  418



>ref|XP_010512639.1| PREDICTED: UBX domain-containing protein 1-like [Camelina sativa]
Length=159

 Score =   112 bits (280),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 48/95 (51%), Positives = 73/95 (77%), Gaps = 3/95 (3%)
 Frame = -2

Query  394  YPPLPEEPKG---DKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPF  224
            +P LP+EP     D++++CR+ +RLPDGR  QR+FL+S+ +QLLWS+C+S ++E++   F
Sbjct  64   FPNLPKEPTNRDFDQSVLCRIRVRLPDGRITQRSFLKSESVQLLWSYCNSQIDESERNLF  123

Query  223  RLTQAIPGATSSLDFESNLTFEESGLANSMISVTW  119
            +L QA PG   +L + SN TFE+SGLANS++SV+W
Sbjct  124  KLIQAFPGDYKTLHYGSNTTFEQSGLANSVVSVSW  158



>emb|CDY18108.1| BnaA01g23690D [Brassica napus]
Length=143

 Score =   111 bits (278),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 74/96 (77%), Gaps = 4/96 (4%)
 Frame = -2

Query  394  YPPLPEEPKGD--KNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETD--AKP  227
            +P L EEPK D  ++++CR+ +RLPDGR++QRNFLRS+ +QLLWSFC S ++E++   + 
Sbjct  47   FPELTEEPKSDSDRSVLCRLCVRLPDGRKVQRNFLRSESVQLLWSFCYSLMDESERRERS  106

Query  226  FRLTQAIPGATSSLDFESNLTFEESGLANSMISVTW  119
            F+L QA+PG   SL + S  +FE+SGLANS+ISV W
Sbjct  107  FKLIQAVPGDYRSLYYGSETSFEDSGLANSLISVIW  142



>gb|AAM66019.1| unknown [Arabidopsis thaliana]
Length=145

 Score =   110 bits (276),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 72/97 (74%), Gaps = 5/97 (5%)
 Frame = -2

Query  394  YPPLPEEPKGD--KNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDA---K  230
            +P LPEEP  D  ++++CR+ +RLPDGRR+QR+FL+S+ +QLLWSFC S + +  +   +
Sbjct  48   FPNLPEEPNRDMDQSVLCRICVRLPDGRRIQRSFLKSESVQLLWSFCYSQIGDESSERKR  107

Query  229  PFRLTQAIPGATSSLDFESNLTFEESGLANSMISVTW  119
             F+L Q  PG   +L F SN TFE+SGLANS++SVTW
Sbjct  108  RFKLIQGFPGDYKNLYFGSNTTFEQSGLANSLVSVTW  144



>ref|NP_566733.1| UBX domain-containing protein [Arabidopsis thaliana]
 dbj|BAB02779.1| unnamed protein product [Arabidopsis thaliana]
 dbj|BAD95135.1| hypothetical protein [Arabidopsis thaliana]
 gb|ABF59029.1| At3g23605 [Arabidopsis thaliana]
 gb|AEE76783.1| UBX domain-containing protein [Arabidopsis thaliana]
Length=152

 Score =   110 bits (276),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 72/97 (74%), Gaps = 5/97 (5%)
 Frame = -2

Query  394  YPPLPEEPKGD--KNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDA---K  230
            +P LPEEP  D  ++++CR+ +RLPDGRR+QR+FL+S+ +QLLWSFC S + +  +   +
Sbjct  55   FPNLPEEPNRDMDQSVLCRICVRLPDGRRIQRSFLKSESVQLLWSFCYSQIGDESSERKR  114

Query  229  PFRLTQAIPGATSSLDFESNLTFEESGLANSMISVTW  119
             F+L Q  PG   +L F SN TFE+SGLANS++SVTW
Sbjct  115  RFKLIQGFPGDYKNLYFGSNTTFEQSGLANSLVSVTW  151



>gb|KDO55137.1| hypothetical protein CISIN_1g036413mg [Citrus sinensis]
Length=346

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 68/195 (35%), Positives = 89/195 (46%), Gaps = 71/195 (36%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVSLSHKRPRESPQAPPlhkddakee  524
            DPITG+KMR W GMV P +LLEDLL FM+  P D +  + K   + P  PP+H+      
Sbjct  220  DPITGEKMRKWCGMVDPVSLLEDLLSFMESGPRDQLERATKT--QLPPYPPVHE------  271

Query  523  deellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEP-KGDKNLVC  347
                                                   + P YP +PEEP +  +NLVC
Sbjct  272  ---------------------------------------QMPAYPAVPEEPLQVARNLVC  292

Query  346  RVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFESNL  167
            R+G+RLPDG+                       E    + FRLT+  PGA   LD+ S +
Sbjct  293  RIGVRLPDGQ-----------------------EANQTRQFRLTRPDPGAPKPLDYNSKM  329

Query  166  TFEESGLANSMISVT  122
            TF+ESGL NS+I VT
Sbjct  330  TFQESGLNNSVILVT  344



>emb|CDX92988.1| BnaA03g37100D [Brassica napus]
Length=137

 Score = 89.4 bits (220),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 61/93 (66%), Gaps = 11/93 (12%)
 Frame = -2

Query  394  YPPLPEEPKGDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETD-AKPFRL  218
            YP L EEP  D +              LQRNFL+S+ +QLLWSFC S +++++  KPF+L
Sbjct  54   YPELSEEPNSDWD----------RSVLLQRNFLKSESVQLLWSFCYSQMDQSERNKPFKL  103

Query  217  TQAIPGATSSLDFESNLTFEESGLANSMISVTW  119
             QAIPG   +L + S  +FE+SGLANS+ISVTW
Sbjct  104  FQAIPGYYKNLYYGSYTSFEQSGLANSLISVTW  136



>emb|CDX94853.1| BnaC03g43350D [Brassica napus]
Length=140

 Score = 87.8 bits (216),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 60/93 (65%), Gaps = 11/93 (12%)
 Frame = -2

Query  394  YPPLPEEPKGDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETD-AKPFRL  218
            YP L  EP  D +              LQRNFL+S+ +QLLWSFC S +++++  KPF+L
Sbjct  57   YPELSAEPNSDWD----------RSVLLQRNFLKSESVQLLWSFCYSQMDQSERNKPFKL  106

Query  217  TQAIPGATSSLDFESNLTFEESGLANSMISVTW  119
             QAIPG   +L + S  +FE+SGLANS+ISVTW
Sbjct  107  FQAIPGYYKNLYYGSYTSFEQSGLANSLISVTW  139



>ref|XP_005643712.1| hypothetical protein COCSUDRAFT_59648 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE19168.1| hypothetical protein COCSUDRAFT_59648 [Coccomyxa subellipsoidea 
C-169]
Length=440

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 63/217 (29%), Positives = 102/217 (47%), Gaps = 24/217 (11%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVSL---SHKRPRESPQAPPlhkdda  533
            DP+TG   ++W G ++P+ L+E+L+PF+D    D  +L   SH + ++    PP    + 
Sbjct  224  DPVTGASPKAWTGAIEPQRLIEELVPFLDHDIHDPAALQLGSHLKRKKRSSPPPKGLTED  283

Query  532  keedeellqalaAS-----MEGMKDTNVDA-------LKESSESDVL------GKETNVV  407
            +E    L  +   +      E     + DA       + E ++ D+        K    V
Sbjct  284  EELAMALAMSAEDAHGSGPAEDAPSYSADASLSKAEPVTEDADDDIPEEAPMPSKSAADV  343

Query  406  KKPVYPPLPEEPKGDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDA-K  230
             K     LP EP       C V +R PDG+R QR F RS  + ++ +FC  H EE  A +
Sbjct  344  AKEAEEQLPPEPGAGDAAGCGVLVRFPDGQRRQRRFPRSASLDVVRAFCLVHSEEAAAGR  403

Query  229  PFRLTQAIPGATSSLDFESNLTFEESGLANSMISVTW  119
            PF + +++PG+    D     T EE+ LA +M+ + W
Sbjct  404  PFAIVESMPGSNPLEDMTK--TIEEANLAGAMLVMRW  438



>ref|XP_010274053.1| PREDICTED: homeobox-leucine zipper protein HOX7-like [Nelumbo 
nucifera]
Length=264

 Score = 82.4 bits (202),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 46/62 (74%), Gaps = 1/62 (2%)
 Frame = -2

Query  334  RLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFESNLTFEE  155
            + PDGRR+QRNFL  DPIQL WSF  SHLEET A+ FRL QAIPG +  LD+ + LTF E
Sbjct  160  QFPDGRRIQRNFLCKDPIQL-WSFYYSHLEETGARQFRLVQAIPGDSKQLDYVTKLTFVE  218

Query  154  SG  149
             G
Sbjct  219  FG  220



>gb|KDO53547.1| hypothetical protein CISIN_1g013325mg [Citrus sinensis]
Length=320

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 41/51 (80%), Gaps = 1/51 (2%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSD-HVSLSHKRPRESPQAP  554
            DPITGQKMRSW GMVQPE+LLEDL+PFMDG P + H  +SHKRPR S   P
Sbjct  247  DPITGQKMRSWCGMVQPESLLEDLVPFMDGGPREQHAKVSHKRPRGSSTTP  297



>ref|XP_006420698.1| hypothetical protein CICLE_v10005240mg [Citrus clementina]
 gb|ESR33938.1| hypothetical protein CICLE_v10005240mg [Citrus clementina]
Length=361

 Score = 79.7 bits (195),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 41/51 (80%), Gaps = 1/51 (2%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSD-HVSLSHKRPRESPQAP  554
            DPITGQKMRSW GMVQPE+LLEDL+PFMDG P + H  +SHKRPR S   P
Sbjct  247  DPITGQKMRSWCGMVQPESLLEDLVPFMDGGPREQHAKVSHKRPRGSSTTP  297



>gb|KEH28763.1| structural constituent of ribosome protein [Medicago truncatula]
Length=321

 Score = 78.6 bits (192),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = -2

Query  280  QLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFESNLTFEESGLANSMISVTWD  116
            QLLWSF +  L+E + KPF+LT  I GA+ +LD+ SN TFEESGLA SMISVTWD
Sbjct  267  QLLWSFIAVQLKEDETKPFKLTHEIHGASKNLDYRSNATFEESGLAGSMISVTWD  321


 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 33/43 (77%), Gaps = 1/43 (2%)
 Frame = -2

Query  700  PITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHV-SLSHKRP  575
            PITGQ M SW G+VQP+TLLE LL F+D +P DH  +LSHK P
Sbjct  201  PITGQNMHSWEGLVQPQTLLEGLLTFLDATPKDHHNTLSHKSP  243



>ref|XP_010270205.1| PREDICTED: uncharacterized protein LOC104606607 [Nelumbo nucifera]
Length=176

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -2

Query  334  RLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAI  206
            R PDGRR+QRNFL  DPIQLLWSFC S LEET A+ FRL Q+ 
Sbjct  94   RFPDGRRIQRNFLHKDPIQLLWSFCYSQLEETGARSFRLVQSY  136



>ref|XP_002874517.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50776.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=333

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 54/163 (33%), Positives = 74/163 (45%), Gaps = 47/163 (29%)
 Frame = -2

Query  703  DPITGQKMRSWRGMV------------------QPETLLEDLLPFMDGSPSDHV-SLSHK  581
            +P TGQ M+ W GMV                   PE LL    PFMD  P +H  SL+ K
Sbjct  195  NPTTGQAMKKWFGMVPPEWFGMVPPEALLREALLPEALLVFFYPFMDSGPREHFTSLAKK  254

Query  580  RPRESPQAPPlhkddakeedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKK  401
            +PR S  A                           D N   ++E+S+   +     VV  
Sbjct  255  QPRRSLAA------------------------SFDDYN---MEETSDDQSMISTEEVVLL  287

Query  400  PVYPPLPEEP-KGDKNLVCRVGIRLPDGRRLQRNFLRSDPIQL  275
            P +PPL EEP +G+ +  C VGI LP+G+R+ R FL++D IQ+
Sbjct  288  PKFPPLLEEPERGNFSSNCGVGIDLPNGQRIMRYFLKTDTIQV  330



>ref|XP_002891290.1| hypothetical protein ARALYDRAFT_891395 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67549.1| hypothetical protein ARALYDRAFT_891395 [Arabidopsis lyrata subsp. 
lyrata]
Length=134

 Score = 70.5 bits (171),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 50/80 (63%), Gaps = 14/80 (18%)
 Frame = -2

Query  349  CRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPG--ATSSLDFE  176
            C VGI LP+G R+ R FL++D IQ                P +LT+ IPG   T +L++E
Sbjct  67   CGVGIDLPNGERIMRYFLKTDTIQ------------RGRTPLKLTRVIPGQSKTITLEYE  114

Query  175  SNLTFEESGLANSMISVTWD  116
            SNLTFE+SG+ANS++  TW+
Sbjct  115  SNLTFEQSGVANSLVFATWE  134



>ref|XP_002900938.1| conserved hypothetical protein [Phytophthora infestans T30-4]
 gb|EEY59328.1| conserved hypothetical protein [Phytophthora infestans T30-4]
Length=455

 Score = 73.9 bits (180),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 56/195 (29%), Positives = 88/195 (45%), Gaps = 12/195 (6%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVSLSHKRPRESPQAPPlhkddakee  524
            DP TG+  + W G  +P+ + E L  F      D  S   K+  E    P +      ++
Sbjct  272  DPRTGETRQRWTGFHEPQDMTEKLSDFCCMHTLDTPSTEQKKEAE----PSIMDASEDDQ  327

Query  523  deellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGDKNLVCR  344
                + A   + EG    N D +++  E      +  VV+      L  EP      V R
Sbjct  328  LAAAIAASLQNGEGETKRNEDDMEQEEEGQEEKTQEPVVE------LTPEPDASAPGVTR  381

Query  343  VGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFESNLT  164
            V IR+PDG RL R FL++DP+ ++W+F    + E  A+ F L  A P   S++ +   ++
Sbjct  382  VQIRVPDGSRLTRRFLKNDPLAMVWAFVKDQIPEARARAFELRTAFP--PSAVAYNDTIS  439

Query  163  FEESGLANSMISVTW  119
             EE  L N+ + V W
Sbjct  440  IEEGKLENASLMVKW  454



>ref|XP_008915021.1| hypothetical protein PPTG_18885 [Phytophthora parasitica INRA-310]
 gb|ETM99642.1| hypothetical protein PPTG_18885 [Phytophthora parasitica INRA-310]
Length=441

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 54/195 (28%), Positives = 89/195 (46%), Gaps = 12/195 (6%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVSLSHKRPRESPQAPPlhkddakee  524
            DP TG+  + W G  +P+ + E L  F      D  S   K+  E    P +      ++
Sbjct  258  DPRTGEIRQRWTGFYEPQDMTEKLSDFCCMHTFDTPSTEIKKEAE----PDIMDASEDDQ  313

Query  523  deellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGDKNLVCR  344
                + A   +  G    + +A+++  ++D         ++PV    PE P      V R
Sbjct  314  LAAAIAASMQNGGGETKQDGNAMEQEEKND-----EEKAQEPVVDLTPE-PDAGAPGVTR  367

Query  343  VGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFESNLT  164
            V IR+PDG RL R FL+SDP+ ++W+F    + E   + F L  + P   S++ +   L+
Sbjct  368  VQIRVPDGSRLTRRFLKSDPLAMVWTFVKDQVSEARTRAFELRTSFP--PSAVAYNDTLS  425

Query  163  FEESGLANSMISVTW  119
             EE  L N+ + V W
Sbjct  426  IEEGKLENASLMVKW  440



>gb|ETI31731.1| hypothetical protein F443_21327 [Phytophthora parasitica P1569]
 gb|ETK72108.1| hypothetical protein L915_20730 [Phytophthora parasitica]
 gb|ETL25538.1| hypothetical protein L916_20613 [Phytophthora parasitica]
 gb|ETL78752.1| hypothetical protein L917_20475 [Phytophthora parasitica]
 gb|ETM32024.1| hypothetical protein L914_20483 [Phytophthora parasitica]
 gb|ETO60443.1| hypothetical protein F444_21350 [Phytophthora parasitica P1976]
 gb|ETP01531.1| hypothetical protein F441_21225 [Phytophthora parasitica CJ01A1]
 gb|ETP29704.1| hypothetical protein F442_21166 [Phytophthora parasitica P10297]
Length=455

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 54/195 (28%), Positives = 89/195 (46%), Gaps = 12/195 (6%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVSLSHKRPRESPQAPPlhkddakee  524
            DP TG+  + W G  +P+ + E L  F      D  S   K+  E    P +      ++
Sbjct  272  DPRTGEIRQRWTGFYEPQDMTEKLSDFCCMHTFDTPSTEIKKEAE----PDIMDASEDDQ  327

Query  523  deellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGDKNLVCR  344
                + A   +  G    + +A+++  ++D         ++PV    PE P      V R
Sbjct  328  LAAAIAASMQNGGGETKQDGNAMEQEEKND-----EEKAQEPVVDLTPE-PDAGAPGVTR  381

Query  343  VGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFESNLT  164
            V IR+PDG RL R FL+SDP+ ++W+F    + E   + F L  + P   S++ +   L+
Sbjct  382  VQIRVPDGSRLTRRFLKSDPLAMVWTFVKDQVSEARTRAFELRTSFP--PSAVAYNDTLS  439

Query  163  FEESGLANSMISVTW  119
             EE  L N+ + V W
Sbjct  440  IEEGKLENASLMVKW  454



>ref|XP_008915022.1| hypothetical protein, variant [Phytophthora parasitica INRA-310]
 gb|ETM99643.1| hypothetical protein, variant [Phytophthora parasitica INRA-310]
Length=440

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 53/195 (27%), Positives = 88/195 (45%), Gaps = 13/195 (7%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVSLSHKRPRESPQAPPlhkddakee  524
            DP TG+  + W G  +P+ + E L  F      D  S   K+       P +      ++
Sbjct  258  DPRTGEIRQRWTGFYEPQDMTEKLSDFCCMHTFDTPSTEIKKAE-----PDIMDASEDDQ  312

Query  523  deellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGDKNLVCR  344
                + A   +  G    + +A+++  ++D         ++PV    PE P      V R
Sbjct  313  LAAAIAASMQNGGGETKQDGNAMEQEEKND-----EEKAQEPVVDLTPE-PDAGAPGVTR  366

Query  343  VGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFESNLT  164
            V IR+PDG RL R FL+SDP+ ++W+F    + E   + F L  + P   S++ +   L+
Sbjct  367  VQIRVPDGSRLTRRFLKSDPLAMVWTFVKDQVSEARTRAFELRTSFP--PSAVAYNDTLS  424

Query  163  FEESGLANSMISVTW  119
             EE  L N+ + V W
Sbjct  425  IEEGKLENASLMVKW  439



>gb|ETI31732.1| hypothetical protein, variant 1 [Phytophthora parasitica P1569]
 gb|ETK72109.1| hypothetical protein, variant 1 [Phytophthora parasitica]
 gb|ETL25539.1| hypothetical protein, variant 1 [Phytophthora parasitica]
 gb|ETL78753.1| hypothetical protein, variant 1 [Phytophthora parasitica]
 gb|ETM32025.1| hypothetical protein, variant 1 [Phytophthora parasitica]
 gb|ETO60444.1| hypothetical protein, variant 1 [Phytophthora parasitica P1976]
 gb|ETP01532.1| hypothetical protein, variant 1 [Phytophthora parasitica CJ01A1]
 gb|ETP29705.1| hypothetical protein, variant 1 [Phytophthora parasitica P10297]
Length=454

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 53/195 (27%), Positives = 88/195 (45%), Gaps = 13/195 (7%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVSLSHKRPRESPQAPPlhkddakee  524
            DP TG+  + W G  +P+ + E L  F      D  S   K+       P +      ++
Sbjct  272  DPRTGEIRQRWTGFYEPQDMTEKLSDFCCMHTFDTPSTEIKKAE-----PDIMDASEDDQ  326

Query  523  deellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGDKNLVCR  344
                + A   +  G    + +A+++  ++D         ++PV    PE P      V R
Sbjct  327  LAAAIAASMQNGGGETKQDGNAMEQEEKND-----EEKAQEPVVDLTPE-PDAGAPGVTR  380

Query  343  VGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFESNLT  164
            V IR+PDG RL R FL+SDP+ ++W+F    + E   + F L  + P   S++ +   L+
Sbjct  381  VQIRVPDGSRLTRRFLKSDPLAMVWTFVKDQVSEARTRAFELRTSFP--PSAVAYNDTLS  438

Query  163  FEESGLANSMISVTW  119
             EE  L N+ + V W
Sbjct  439  IEEGKLENASLMVKW  453



>ref|XP_008383892.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103446532 
[Malus domestica]
Length=64

 Score = 65.9 bits (159),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 37/48 (77%), Gaps = 2/48 (4%)
 Frame = -2

Query  367  GDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPF  224
             D+NL+CRV IRL D RR+QRNFL +  +QLLWSFC S L+E  A+PF
Sbjct  10   NDRNLLCRVRIRLLDDRRVQRNFLXA--LQLLWSFCYSQLKEAKARPF  55



>ref|XP_010497037.1| PREDICTED: UBX domain-containing protein 7-like, partial [Camelina 
sativa]
Length=310

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 47/155 (30%), Positives = 67/155 (43%), Gaps = 49/155 (32%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVS--LSHKRPRESPQAPPlhkddak  530
            DPITGQKMR+W GM++    LEDL+ + D  P +HV+   S+KR +              
Sbjct  183  DPITGQKMRTWSGMIEAHDFLEDLMKYRDVGPHEHVASLTSNKRIK--------------  228

Query  529  eedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKP----------------  398
                          E +   +  A  +  +      +  VV  P                
Sbjct  229  -------------TEKIWFVSSQAYDDHHDMSTFWDDDRVVTTPPSWGIEFEETCLSSDD  275

Query  397  --VYPPLPEEPKG--DKNLVCRVGIRLPDGRRLQR  305
               +P L EEPKG  D++L+C + IR PDGRR+QR
Sbjct  276  MFEFPVLTEEPKGDCDRSLLCSLCIRFPDGRRMQR  310



>ref|XP_002872422.1| hypothetical protein ARALYDRAFT_911175 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48681.1| hypothetical protein ARALYDRAFT_911175 [Arabidopsis lyrata subsp. 
lyrata]
Length=63

 Score = 62.8 bits (151),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 30/57 (53%), Positives = 44/57 (77%), Gaps = 3/57 (5%)
 Frame = -2

Query  277  LLWSFCSSHLEETD-AKPFRLTQAIPG--ATSSLDFESNLTFEESGLANSMISVTWD  116
            +LWSFC S L +++  KP +LT+ IPG   T +L++ESNLTFE+SG+ANS++  TW+
Sbjct  7    ILWSFCYSRLTKSERKKPLKLTRLIPGQSKTITLEYESNLTFEQSGVANSLVFATWE  63



>ref|XP_009533837.1| hypothetical protein PHYSODRAFT_352438 [Phytophthora sojae]
 gb|EGZ11092.1| hypothetical protein PHYSODRAFT_352438 [Phytophthora sojae]
Length=459

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 52/97 (54%), Gaps = 3/97 (3%)
 Frame = -2

Query  409  VKKPVYPPLPEEPKGDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAK  230
             + PV    PE   G  + V RV IR+PDG RL R FL++DP+ ++W+F    + E   +
Sbjct  365  AQDPVVALTPEPDAGAPD-VTRVQIRVPDGTRLTRRFLKTDPLAMVWTFVKDQVPEARGR  423

Query  229  PFRLTQAIPGATSSLDFESNLTFEESGLANSMISVTW  119
             F L  A P   S++ +   L+ EE  L N+ + V W
Sbjct  424  AFELRTAFP--PSAVAYNDTLSIEEGKLENASLMVKW  458



>emb|CCI43060.1| unnamed protein product [Albugo candida]
Length=410

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 54/205 (26%), Positives = 90/205 (44%), Gaps = 39/205 (19%)
 Frame = -2

Query  700  PITGQKMRSWRGMVQPETLLEDLLPFM------DGSPSDHVSLSHKRPRESPQAPPlhkd  539
            P TG+ +  W G V+P  L+E +  F       +    + ++L  +  RES         
Sbjct  233  PRTGEILAQWNGFVEPTILVEKISDFCCQNILENTVEKETINLVEEESRES---------  283

Query  538  dakeedeellqalaASMEGMKDTNVDA-----LKESSESDVLGKETNVVKKPVYPPLPEE  374
                            ++  +D N+ A     L+E S+S +   +  +        LP E
Sbjct  284  ----------------LDENEDPNLAAAIAASLEEKSKS-MHDVDEEMKDDQSIDMLPTE  326

Query  373  PKGDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGAT  194
            P      V R+ IR PDG R+ R F +SDPI +L +F   +++E  A+PF L +A P A 
Sbjct  327  PSATDPNVTRIQIRCPDGTRMIRRFYKSDPISILRTFVKENVQEARARPFALRRAYPPA-  385

Query  193  SSLDFESNLTFEESGLANSMISVTW  119
             ++D   +    +  L N+++ V W
Sbjct  386  -AIDCNGSEALSDRNLENAVLHVDW  409



>gb|KDO48110.1| hypothetical protein CISIN_1g021440mg [Citrus sinensis]
Length=312

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 63/117 (54%), Gaps = 7/117 (6%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVSLSHKRPRESPQAPPlhkddakee  524
            DPITGQK+ SW GM+ P+ L E LLPFMD SP    ++  +R R S   P       +  
Sbjct  203  DPITGQKICSWCGMINPQPLGEMLLPFMDRSPRKCATIIIERQRASSTTP-------QRN  255

Query  523  deellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGDKNL  353
             ++   ALAASME +KDT   +  ++  +    + T+  +   YP LPEEP  D  L
Sbjct  256  IKDCCSALAASMETIKDTIGVSPSDADVTSADKEATSTTQGTAYPALPEEPNVDGKL  312



>emb|CDY51383.1| BnaC02g46180D [Brassica napus]
Length=150

 Score = 62.4 bits (150),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 39/50 (78%), Gaps = 2/50 (4%)
 Frame = -2

Query  394  YPPLPEEPKG--DKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSH  251
            YP   +EP    DK+++CR+ +RLPDGRR+Q++FL+S+ +QLL SFC+S 
Sbjct  46   YPEFSDEPNSHLDKSVLCRICVRLPDGRRVQKSFLKSESVQLLLSFCNSQ  95



>gb|KDO48111.1| hypothetical protein CISIN_1g021440mg [Citrus sinensis]
Length=305

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 43/117 (37%), Positives = 59/117 (50%), Gaps = 14/117 (12%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVSLSHKRPRESPQAPPlhkddakee  524
            DPITGQK+ SW GM+ P+ L E LLPFMD SP    ++  +R R S   P          
Sbjct  203  DPITGQKICSWCGMINPQPLGEMLLPFMDRSPRKCATIIIERQRASSTTP----------  252

Query  523  deellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGDKNL  353
                 + + ASME +KDT   +  ++  +    + T+  +   YP LPEEP  D  L
Sbjct  253  ----QRNIKASMETIKDTIGVSPSDADVTSADKEATSTTQGTAYPALPEEPNVDGKL  305



>ref|XP_008864408.1| hypothetical protein H310_02617 [Aphanomyces invadans]
 gb|ETW06333.1| hypothetical protein H310_02617 [Aphanomyces invadans]
Length=435

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 64/196 (33%), Positives = 87/196 (44%), Gaps = 22/196 (11%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVSL-SHKRPRESPQAPPlhkddake  527
            DP+TGQK+  W   ++P+T+ E L        SD   L S   P   P  P   +     
Sbjct  257  DPVTGQKVVEWHDYIEPQTMAEKL--------SDFACLNSPGAPVARPAEPSPPRSREWT  308

Query  526  edeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGDKNLVC  347
            ED+EL  A+AAS+E   D   D +K  +           V      PLP+EP  D   V 
Sbjct  309  EDDELAAAIAASLEQPSD---DGMKSEAAQAAPPPPPAFV------PLPDEPV-DGPTVT  358

Query  346  RVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFESNL  167
            RV IR   G RL R F ++ P+  LW F    L E   + F L    P AT +    S+ 
Sbjct  359  RVQIRTTAGSRLMRRFEKTAPVSDLWRFVQQELPEARTRRFELRTTYPPATLT---SSDT  415

Query  166  TFEESGLANSMISVTW  119
            T  E+ L N+ + + W
Sbjct  416  TLAEANLVNASLMMQW  431



>ref|XP_003604169.1| UBX domain-containing protein [Medicago truncatula]
 gb|AES86366.1| UBX domain protein [Medicago truncatula]
Length=320

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 36/45 (80%), Gaps = 1/45 (2%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSD-HVSLSHKRPR  572
            DPITG+KM SW GMV+P++LLE LL F+D  P+D H +LSHK PR
Sbjct  198  DPITGKKMCSWDGMVEPQSLLEGLLTFLDAGPTDHHNTLSHKLPR  242



>gb|KEH28537.1| UBX domain protein [Medicago truncatula]
Length=259

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 36/45 (80%), Gaps = 1/45 (2%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSD-HVSLSHKRPR  572
            DPITG+KM SW GMV+P++LLE LL F+D  P+D H +LSHK PR
Sbjct  198  DPITGKKMCSWDGMVEPQSLLEGLLTFLDAGPTDHHNTLSHKLPR  242



>gb|KEH28538.1| UBX domain protein [Medicago truncatula]
Length=305

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 36/45 (80%), Gaps = 1/45 (2%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSD-HVSLSHKRPR  572
            DPITG+KM SW GMV+P++LLE LL F+D  P+D H +LSHK PR
Sbjct  198  DPITGKKMCSWDGMVEPQSLLEGLLTFLDAGPTDHHNTLSHKLPR  242



>ref|XP_005843123.1| hypothetical protein CHLNCDRAFT_55386 [Chlorella variabilis]
 gb|EFN51021.1| hypothetical protein CHLNCDRAFT_55386 [Chlorella variabilis]
Length=324

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 49/90 (54%), Gaps = 5/90 (6%)
 Frame = -2

Query  385  LPEEPKGDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEET-DAKPFRLTQA  209
            LP+EP       CR+ +RLPDGRR QR F     +  ++ FC S  EE    + F L+Q 
Sbjct  237  LPQEPSDGSG--CRIAVRLPDGRRAQRRFPAGTALAAVYDFCLSQSEEAGGGRRFSLSQG  294

Query  208  IPGATSSLDFESNLTFEESGLANSMISVTW  119
             PGA  +LD +   T E +GL  +M+ + W
Sbjct  295  FPGA-PALD-DQQQTVEAAGLNGAMLVLKW  322



>gb|KDO22673.1| hypothetical protein SPRG_10988 [Saprolegnia parasitica CBS 223.65]
Length=426

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 51/102 (50%), Gaps = 3/102 (3%)
 Frame = -2

Query  424  KETNVVKKPVYPPLPEEPKGDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLE  245
            K + V   PV  P+PEEP  D   V R+ IR   G RL R F ++DP++LLW F    + 
Sbjct  324  KPSVVAAPPVLAPMPEEP-ADGPSVTRIQIRTATGGRLLRRFQKTDPLELLWRFVRHEIP  382

Query  244  ETDAKPFRLTQAIPGATSSLDFESNLTFEESGLANSMISVTW  119
            E   + F L  A P    + D  + L   ++ L N+ + + W
Sbjct  383  EAQTREFELRSAYPPKAVAFDTTTRLC--DAQLENASLMMNW  422



>gb|AFW86620.1| hypothetical protein ZEAMMB73_563531 [Zea mays]
Length=286

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 34/49 (69%), Gaps = 1/49 (2%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMD-GSPSDHVSLSHKRPRESPQ  560
            DP+TGQK+ +W GMV P+ LLEDLLP++D G    H S   KRPR+  Q
Sbjct  190  DPVTGQKVHAWNGMVHPDRLLEDLLPYLDKGLKGHHASQPQKRPRKVDQ  238



>ref|XP_002957220.1| hypothetical protein VOLCADRAFT_98325 [Volvox carteri f. nagariensis]
 gb|EFJ41718.1| hypothetical protein VOLCADRAFT_98325 [Volvox carteri f. nagariensis]
Length=516

 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 50/87 (57%), Gaps = 4/87 (5%)
 Frame = -2

Query  382  PEEPKGDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDA-KPFRLTQAI  206
            PE P GD    CRV +R+PDG R+ R+F R+D ++ L+  C +H+ E  A +   +T A 
Sbjct  429  PEPPAGDSE-ACRVALRMPDGSRVTRSFRRTDTVRALFDLCVAHVPEAAAGRSLVITLAA  487

Query  205  PGATSSLDFESNLTFEESGLANSMISV  125
            P     LD E   T   +G+A +M++V
Sbjct  488  PPGQPPLDPEQ--TIGAAGVAGAMLAV  512



>ref|XP_010240593.1| PREDICTED: UBX domain-containing protein 7 isoform X2 [Brachypodium 
distachyon]
Length=318

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 35/49 (71%), Gaps = 1/49 (2%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVSLS-HKRPRESPQ  560
            DPITGQKM +W GMV P+ LLEDL+P++D  P +H +    KRPR+  Q
Sbjct  258  DPITGQKMCAWTGMVYPDRLLEDLMPYLDKGPKEHHAAQPQKRPRKIDQ  306



>ref|XP_008617322.1| hypothetical protein SDRG_13017 [Saprolegnia diclina VS20]
 ref|XP_008617323.1| hypothetical protein, variant [Saprolegnia diclina VS20]
 gb|EQC29144.1| hypothetical protein SDRG_13017 [Saprolegnia diclina VS20]
 gb|EQC29145.1| hypothetical protein, variant [Saprolegnia diclina VS20]
Length=437

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 56/196 (29%), Positives = 88/196 (45%), Gaps = 6/196 (3%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMD-GSPSDHVSLSHKRPRESPQAPPlhkddake  527
            DP TGQK+  W   ++P T+ E L  F    S         +                  
Sbjct  244  DPRTGQKLVEWHNFIEPGTMTEKLSDFCCLNSMETTPPARPQAQAAPAPPARATSLYDAS  303

Query  526  edeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGDKNLVC  347
            E+E+L  A+AAS+EG    N D+  +  +  +  K + V   PV   +P+EP  D   V 
Sbjct  304  EEEQLAAAIAASLEG--GDNEDSDDDDDDMVIEEKPSVVAAPPVLASMPDEP-ADGPSVT  360

Query  346  RVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFESNL  167
            R+ IR   G RL R F ++DP++LLW F    + E   + F L  A P    ++ F++  
Sbjct  361  RIQIRTATGGRLLRRFQKTDPLELLWRFVRHEIPEAQTREFELRSAYP--PKAVAFDTTT  418

Query  166  TFEESGLANSMISVTW  119
               ++ L N+ + + W
Sbjct  419  RICDAQLENASLMMNW  434



>emb|CCA23196.1| conserved hypothetical protein [Albugo laibachii Nc14]
Length=443

 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/89 (33%), Positives = 48/89 (54%), Gaps = 2/89 (2%)
 Frame = -2

Query  385  LPEEPKGDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAI  206
            LP EP   ++ V R+ IR PDG ++ R F +S+ I +L +F   ++ E   +PF L  A 
Sbjct  356  LPCEPSASESNVTRIQIRCPDGTKIIRRFYKSESISILRTFVRENVHEARTRPFNLRTAY  415

Query  205  PGATSSLDFESNLTFEESGLANSMISVTW  119
            P    ++D  S+    +  L N+++ V W
Sbjct  416  PPV--AIDCNSSALLGDQNLENAVMHVHW  442



>ref|XP_011463688.1| PREDICTED: uncharacterized protein LOC105351367 [Fragaria vesca 
subsp. vesca]
Length=775

 Score = 57.0 bits (136),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 33/52 (63%), Gaps = 5/52 (10%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLL-PFMDGSPSDHVSLSHKRPRESPQAPP  551
            DPI G+ MRSW GMVQPE LL+DLL PFM+  P DH    H    ES Q  P
Sbjct  692  DPINGENMRSWYGMVQPECLLKDLLVPFMENRPKDH----HHPGEESSQPQP  739



>ref|NP_594518.1| UBX domain protein Ubx2 [Schizosaccharomyces pombe 972h-]
 sp|O14048.1|UBX2_SCHPO RecName: Full=UBX domain-containing protein 2 [Schizosaccharomyces 
pombe 972h-]
 emb|CAB16375.1| UBX domain protein Ubx2 [Schizosaccharomyces pombe]
Length=427

 Score = 55.8 bits (133),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 49/191 (26%), Positives = 86/191 (45%), Gaps = 7/191 (4%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVSLSHKRPRESPQAPPlhkddakee  524
            DP TG++++ W     P   +  L  F++G   D  S   K P  +    P+      E+
Sbjct  239  DPRTGERVKEWSKSFTPADFVIALNDFLEGCTLDETS-GRKNPLGAKSQKPVEAMSEDEQ  297

Query  523  deellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGDKNLVCR  344
              + + A   +     ++  ++  + +ES  +  +T V K        EEP    N V R
Sbjct  298  MHKAIAASLGNGNSTTESQGESSSQQAESHGVADDT-VHKIDSAECDAEEPSPGPN-VTR  355

Query  343  VGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFESNLT  164
            + IR+P+G R  R F  +DP+  ++++     E  D +PF LT       +SLD     T
Sbjct  356  IQIRMPNGARFIRRFSLTDPVSKVYAYVKGVAEGADKQPFSLTFQRKSLWTSLD----ST  411

Query  163  FEESGLANSMI  131
             +E+G+ N+ +
Sbjct  412  IKEAGIQNTAL  422



>ref|XP_003604178.1| UBX domain-containing protein [Medicago truncatula]
 gb|ACJ84042.1| unknown [Medicago truncatula]
 gb|AES86375.1| UBX domain protein [Medicago truncatula]
Length=286

 Score = 55.5 bits (132),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSP  608
            DPITGQK+RSW GM+QPE+L+E LL F+D  P
Sbjct  186  DPITGQKIRSWGGMIQPESLIEGLLTFLDAGP  217



>gb|EPY51977.1| UB Xdomain protein Ubx2 [Schizosaccharomyces cryophilus OY26]
Length=440

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 49/195 (25%), Positives = 90/195 (46%), Gaps = 14/195 (7%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVSLSHKRPRESPQAPPlhkddakee  524
            DP TG++++ W G + P   + +L  F+     +  +L   + R++P  P   K      
Sbjct  251  DPRTGERVKQWNGGITPTEFVIELNDFL-----ERCTLDETKDRKNPLGPKSQKPAEAMT  305

Query  523  deellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGDKNL---  353
            +EE +    A+  G++    ++  ESS+  +   E       V+    EE K ++     
Sbjct  306  EEEQMSKAIAASLGVEQERTESTGESSQP-IQEDEEEEQDNTVHKIKSEEGKDEEPSPGP  364

Query  352  -VCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFE  176
             V R+ IR+P G R  R F  SD ++ ++++     E  D++ F LT       +SLD  
Sbjct  365  GVTRIQIRMPTGARFIRRFYESDLVRKVYAYVKGVAEGADSQAFSLTFQRTSLWNSLD--  422

Query  175  SNLTFEESGLANSMI  131
               T +E+G+ N+ +
Sbjct  423  --KTIKEAGIQNTAL  435



>ref|XP_009844374.1| hypothetical protein H257_17329 [Aphanomyces astaci]
 ref|XP_009844375.1| hypothetical protein, variant [Aphanomyces astaci]
 gb|ETV66185.1| hypothetical protein H257_17329 [Aphanomyces astaci]
 gb|ETV66186.1| hypothetical protein, variant [Aphanomyces astaci]
Length=446

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 61/200 (31%), Positives = 89/200 (45%), Gaps = 17/200 (9%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVSLSHKRPRESPQAPPlhkddakee  524
            DP+TGQK+  W   ++P  + E L        SD   L+       P AP         E
Sbjct  257  DPLTGQKVVEWPDYIEPHAMAEKL--------SDFACLNPPGAAVRPVAPKPPPSRELTE  308

Query  523  deellqalaASMEGMKDT----NVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGDKN  356
            DEEL  A+AASME   D     +V  L + + +               P LP+EP  D  
Sbjct  309  DEELAAAIAASMEQQTDDDMGHDVKVLPQGAPTVHDDLPPPPSPVAAVPRLPDEP-ADGP  367

Query  355  LVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFE  176
             V RV IR   G RL R F +++P+ +L+ F    + E   + F L  + P AT      
Sbjct  368  TVTRVQIRTTTGSRLMRRFDKAEPVAVLFQFVQQEIPEARTRGFELRTSYPPATL---VS  424

Query  175  SNLT-FEESGLANSMISVTW  119
            S+LT   ++ L N+ +++ W
Sbjct  425  SDLTPLADANLVNASLNMQW  444



>ref|XP_006480636.1| PREDICTED: UBX domain-containing protein 7-like isoform X2 [Citrus 
sinensis]
Length=278

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVSLSHKRPRESPQAP  554
            DPITGQK+ SW GM+ P+ L E LLPFMD SP    ++  +R R S   P
Sbjct  222  DPITGQKICSWCGMINPQPLGEMLLPFMDRSPRKCATIIIERQRASSTTP  271



>ref|XP_006480635.1| PREDICTED: UBX domain-containing protein 7-like isoform X1 [Citrus 
sinensis]
Length=294

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVSLSHKRPRESPQAP  554
            DPITGQK+ SW GM+ P+ L E LLPFMD SP    ++  +R R S   P
Sbjct  222  DPITGQKICSWCGMINPQPLGEMLLPFMDRSPRKCATIIIERQRASSTTP  271



>ref|XP_006480637.1| PREDICTED: UBX domain-containing protein 7-like isoform X3 [Citrus 
sinensis]
Length=275

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVSLSHKRPRESPQAP  554
            DPITGQK+ SW GM+ P+ L E LLPFMD SP    ++  +R R S   P
Sbjct  203  DPITGQKICSWCGMINPQPLGEMLLPFMDRSPRKCATIIIERQRASSTTP  252



>ref|XP_001691879.1| hypothetical protein CHLREDRAFT_145485 [Chlamydomonas reinhardtii]
 gb|EDP04369.1| predicted protein [Chlamydomonas reinhardtii]
Length=523

 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 29/88 (33%), Positives = 48/88 (55%), Gaps = 3/88 (3%)
 Frame = -2

Query  385  LPEEPKGDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDA-KPFRLTQA  209
            +PEEP        RV +RLPDG RL R F +S+ ++ L+    + + E  A +   ++ A
Sbjct  434  VPEEPAEGDPAALRVALRLPDGGRLMRRFRKSEHVRCLYDLALAKVPEAAAGRSVTISHA  493

Query  208  IPGATSSLDFESNLTFEESGLANSMISV  125
             PG  +  D   + T E +G+A +M++V
Sbjct  494  TPGGAALTD--QDQTLEAAGVAGAMLAV  519



>emb|CDH49981.1| ubx domain protein [Lichtheimia corymbifera JMRC:FSU:9682]
Length=480

 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 51/93 (55%), Gaps = 5/93 (5%)
 Frame = -2

Query  397  VYPPLPEEPKGDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRL  218
            + P   +EP    N   R+ +R PDG+R+ R F ++DP++ L+ F  + L E+  +PF L
Sbjct  390  IQPIKRDEPTDPAN-TTRIQLRTPDGKRIVRKFSKTDPVRYLFEFVKAELPESQDRPFEL  448

Query  217  TQAIPGATSSLDFESNLTFEESGLANSMISVTW  119
                      LD E     +E+GLAN+ +++++
Sbjct  449  VFNRQQLIELLDKE----IQEAGLANAAVNLSF  477



>ref|XP_008812862.1| PREDICTED: uncharacterized protein LOC103723650 isoform X2 [Phoenix 
dactylifera]
Length=99

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/27 (78%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = -2

Query  403  KPVYPPLPEEPKGDKNLVCRVGIRLPD  323
            KPVYP LPEEPKG + L+C VGIRLPD
Sbjct  73   KPVYPALPEEPKGSRELLCTVGIRLPD  99



>ref|XP_011399212.1| UBX domain-containing protein 7 [Auxenochlorella protothecoides]
 gb|KFM26316.1| UBX domain-containing protein 7 [Auxenochlorella protothecoides]
Length=338

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 47/93 (51%), Gaps = 10/93 (11%)
 Frame = -2

Query  373  PKGDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDA-KPFRLTQAIP--  203
            PK +  L     +R PDG RLQR F ++ P++ L   C +   E  A +PF L  + P  
Sbjct  246  PKAESGLTSAGPVRCPDGSRLQRRFEQTAPLETLRDLCIASCPEAAAGRPFFLAPSFPGT  305

Query  202  -----GATSSLDFESNLTFEESGLANSMISVTW  119
                 GA   LD  ++LT   SG A+SM+ + W
Sbjct  306  LRLPGGAQPLLDMAADLT--TSGAADSMLVMKW  336



>emb|CDS04684.1| hypothetical protein LRAMOSA07234 [Absidia idahoensis var. thermophila]
Length=474

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 51/93 (55%), Gaps = 5/93 (5%)
 Frame = -2

Query  397  VYPPLPEEPKGDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRL  218
            + P   +EP    N   R+ +R PDG+R+ R FL++DP++ L+ F  + + E+  + F L
Sbjct  384  IQPIKRDEPTDPAN-TTRIQLRTPDGKRIVRRFLKTDPVRHLFEFVKAEIPESQDRQFEL  442

Query  217  TQAIPGATSSLDFESNLTFEESGLANSMISVTW  119
                      LD E     +E+GLAN+ +++++
Sbjct  443  VFNRQQLIELLDQE----IQEAGLANAAVNLSF  471



>gb|EPX70813.1| UB Xdomain protein Ubx2 [Schizosaccharomyces octosporus yFS286]
Length=437

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 48/200 (24%), Positives = 93/200 (47%), Gaps = 18/200 (9%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVSLSHKRPRESPQAPPlhkddakee  524
            DP TG++++ W   + P   + +L  F++       +L   + R++P  P  HK      
Sbjct  242  DPRTGERVKQWNSGITPTDFIIELNDFLE-----RCTLDETKGRKNPLGPKSHKPAEAMT  296

Query  523  deellqalaASMEGMKDTNVDALKESSE-----SDVLGKETNVVKKPVYPPLPEEPKGDK  359
            +EE +    A+  G++    + + ESS+      D   +E       +Y    EE K ++
Sbjct  297  EEEQMSKAIAASLGVEQEKNEDMGESSQPIQANEDEEEEEVETQDNTIYKINSEEAKDEE  356

Query  358  ----NLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATS  191
                  V R+ IRLP+G R  R F  +D ++ ++++   + E  +++PF LT       +
Sbjct  357  PSPGAGVTRIQIRLPNGARFIRRFYETDLVRKVYAYVKGNAEGAESQPFSLTFQRTSLWN  416

Query  190  SLDFESNLTFEESGLANSMI  131
             LD     T +++G+ N+ +
Sbjct  417  LLD----KTIKDAGIQNTAL  432



>ref|XP_006677415.1| hypothetical protein BATDEDRAFT_34588 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF82120.1| hypothetical protein BATDEDRAFT_34588 [Batrachochytrium dendrobatidis 
JAM81]
Length=468

 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 54/208 (26%), Positives = 94/208 (45%), Gaps = 21/208 (10%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMD-------GSPSDHVSLSHKRPRESPQAPPlh  545
            DP+TG++++ WR  + P   + +++ FMD         P+   ++S      +P      
Sbjct  263  DPLTGERIKLWRVQIDPSAFMVEVVEFMDRYQTHLSNEPTSSAAISGLNSASNPTTKQSS  322

Query  544  kddakeedeellqalaASMEGMKDTNVDALKESSESDVL-------GKETNVVKKPVYPP  386
            K     E+E+L  A++AS+   K  N D    +S  +V+        K    V K +   
Sbjct  323  KIIDLTEEEQLNLAISASLGEAKTGNRDMANTTSNLNVMPLPSKDDPKYALAVFKQIDAV  382

Query  385  LPEEPKGDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLW-SFCSSHLEETDAKPFRLTQA  209
               EP G  + + R+  RLP+G++    FL+SD ++ L+ S  ++H E T  + F L   
Sbjct  383  PYVEPTGSPDTITRIQFRLPNGQKSVYRFLKSDLVRRLFESIKAAHPEIT--QSFELLHF  440

Query  208  IPGATSSLDFESNLTFEESGLANSMISV  125
                   +D     T E++GL N  + V
Sbjct  441  RDTLLRKMD----QTIEQAGLVNVALVV  464



>ref|XP_002173242.1| UB Xdomain protein Ubx2 [Schizosaccharomyces japonicus yFS275]
 gb|EEB06949.1| UB Xdomain protein Ubx2 [Schizosaccharomyces japonicus yFS275]
Length=440

 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 44/170 (26%), Positives = 75/170 (44%), Gaps = 8/170 (5%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVSLSHKRPRESPQAPPlhkddakee  524
            DP TG+++++W     P  L+  L  F++    D  S  HK P       P+     +E+
Sbjct  243  DPRTGERLKAWNKGFTPAELVVALNDFLEQCSFDE-SNGHKNPLGPKAKKPVEAMSEEEQ  301

Query  523  deellqalaASMEG-----MKDTNVDALKESSESDVLGKET--NVVKKPVYPPLPEEPKG  365
              + + A   +  G     MKD N D ++   E +    E   N V       LP +   
Sbjct  302  LHKAIAASLGASAGSEDAVMKDNNEDEIEGDEEEEEDVVEQVPNTVNSINVSDLPTDEPA  361

Query  364  DKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLT  215
                  R+ +R+ +G R  R FL++DP++ +++F       ++ KPF LT
Sbjct  362  AGPATTRIQVRMANGSRFIRRFLKADPVRYVYAFAKQMAPGSEGKPFTLT  411



>ref|XP_010440502.1| PREDICTED: UBX domain-containing protein 7-like [Camelina sativa]
Length=300

 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 35/57 (61%), Gaps = 8/57 (14%)
 Frame = -2

Query  703  DPITGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVS--LSHKRPR------ESPQA  557
            DPITGQKM +W GM++    LEDL+ + D  P +HV+   S+KR +      ES QA
Sbjct  222  DPITGQKMHTWSGMIEAHGFLEDLMKYRDVGPHEHVASLTSNKRIKTEKIYFESSQA  278



>ref|XP_002461860.1| hypothetical protein SORBIDRAFT_02g009430 [Sorghum bicolor]
 gb|EER98381.1| hypothetical protein SORBIDRAFT_02g009430 [Sorghum bicolor]
Length=598

 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 43/81 (53%), Gaps = 5/81 (6%)
 Frame = -2

Query  352  VCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDA----KPFRLTQAIPGATSSL  185
            VC+V +RL DGR + + F     +  L+++C S L    A    KPFRL + +  AT  +
Sbjct  515  VCKVRVRLADGRVVTKEFGSQCAVAALFAYCRSMLGAGGAPPPEKPFRLMRFVGRATEEI  574

Query  184  -DFESNLTFEESGLANSMISV  125
             D   N +FE  GL  + +SV
Sbjct  575  GDHNQNASFESLGLHLTTVSV  595



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1193157586335