BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF028L06

Length=421
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP03295.1|  unnamed protein product                                139   7e-35   Coffea canephora [robusta coffee]
ref|XP_006341271.1|  PREDICTED: uncharacterized protein LOC102605018    133   1e-33   Solanum tuberosum [potatoes]
ref|XP_004242940.2|  PREDICTED: uncharacterized protein LOC101252095    128   5e-32   
ref|XP_009766667.1|  PREDICTED: uncharacterized protein LOC104217988    127   2e-31   Nicotiana sylvestris
gb|EPS69637.1|  hypothetical protein M569_05128                         110   1e-26   Genlisea aurea
ref|XP_011078295.1|  PREDICTED: uncharacterized protein LOC105162074    112   5e-26   Sesamum indicum [beniseed]
ref|XP_009600209.1|  PREDICTED: uncharacterized protein LOC104095723    111   2e-25   Nicotiana tomentosiformis
ref|XP_011078293.1|  PREDICTED: uncharacterized protein LOC105162073    111   2e-25   Sesamum indicum [beniseed]
ref|XP_003516476.1|  PREDICTED: uncharacterized protein LOC100797716    105   2e-23   Glycine max [soybeans]
ref|XP_004513017.1|  PREDICTED: uncharacterized protein LOC101505637    104   4e-23   Cicer arietinum [garbanzo]
ref|XP_003630749.1|  Galactose oxidase                                  104   4e-23   
ref|XP_010656292.1|  PREDICTED: galactose oxidase                       103   7e-23   Vitis vinifera
emb|CBI28031.3|  unnamed protein product                                104   8e-23   Vitis vinifera
ref|XP_010107380.1|  hypothetical protein L484_003656                   103   1e-22   Morus notabilis
gb|EYU32954.1|  hypothetical protein MIMGU_mgv1a002908mg                102   2e-22   Erythranthe guttata [common monkey flower]
ref|XP_008362947.1|  PREDICTED: galactose oxidase-like                  102   3e-22   
ref|XP_004503455.1|  PREDICTED: uncharacterized protein LOC101501825    102   3e-22   Cicer arietinum [garbanzo]
ref|XP_009336933.1|  PREDICTED: galactose oxidase-like                  101   5e-22   Pyrus x bretschneideri [bai li]
ref|XP_009352508.1|  PREDICTED: galactose oxidase-like                  100   1e-21   Pyrus x bretschneideri [bai li]
ref|XP_007160315.1|  hypothetical protein PHAVU_002G311300g             100   1e-21   Phaseolus vulgaris [French bean]
ref|XP_007152887.1|  hypothetical protein PHAVU_004G168600g             100   2e-21   Phaseolus vulgaris [French bean]
ref|XP_008367891.1|  PREDICTED: galactose oxidase-like                99.0    4e-21   
gb|KHN16621.1|  Galactose oxidase                                     94.7    1e-19   Glycine soja [wild soybean]
ref|XP_006584818.1|  PREDICTED: uncharacterized protein LOC100808336  94.7    1e-19   Glycine max [soybeans]
ref|XP_006833409.1|  hypothetical protein AMTR_s00109p00131490        94.4    2e-19   
ref|XP_007203106.1|  hypothetical protein PRUPE_ppa023837mg           94.4    2e-19   Prunus persica
gb|KDO36610.1|  hypothetical protein CISIN_1g043381mg                 91.3    2e-19   Citrus sinensis [apfelsine]
gb|KDO66474.1|  hypothetical protein CISIN_1g042303mg                 92.8    5e-19   Citrus sinensis [apfelsine]
ref|XP_003620657.1|  Galactose oxidase                                92.8    6e-19   Medicago truncatula
ref|XP_006475694.1|  PREDICTED: galactose oxidase-like                92.8    6e-19   Citrus sinensis [apfelsine]
ref|XP_004288880.2|  PREDICTED: uncharacterized protein LOC101300395  92.0    1e-18   Fragaria vesca subsp. vesca
ref|XP_008242563.1|  PREDICTED: uncharacterized protein LOC103340881  91.7    2e-18   Prunus mume [ume]
ref|XP_006451231.1|  hypothetical protein CICLE_v10010756mg           90.9    3e-18   
ref|XP_009381768.1|  PREDICTED: uncharacterized protein LOC103969853  90.1    4e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002281387.1|  PREDICTED: uncharacterized protein LOC100256065  90.1    5e-18   
emb|CDX96101.1|  BnaA07g26300D                                        90.1    5e-18   
emb|CDY01797.1|  BnaC06g28370D                                        90.1    5e-18   
gb|KDO54103.1|  hypothetical protein CISIN_1g039705mg                 89.7    5e-18   Citrus sinensis [apfelsine]
ref|XP_006420316.1|  hypothetical protein CICLE_v10006853mg           90.1    6e-18   
ref|XP_010254463.1|  PREDICTED: galactose oxidase                     90.1    6e-18   Nelumbo nucifera [Indian lotus]
ref|XP_008220102.1|  PREDICTED: uncharacterized protein LOC103320236  89.4    8e-18   Prunus mume [ume]
ref|XP_009105271.1|  PREDICTED: galactose oxidase                     89.4    1e-17   Brassica rapa
ref|XP_006342231.1|  PREDICTED: galactose oxidase-like                89.0    1e-17   Solanum tuberosum [potatoes]
ref|XP_006451228.1|  hypothetical protein CICLE_v10010177mg           89.0    1e-17   Citrus clementina [clementine]
gb|KDO66471.1|  hypothetical protein CISIN_1g035640mg                 89.0    1e-17   Citrus sinensis [apfelsine]
ref|XP_006475693.1|  PREDICTED: galactose oxidase-like                89.0    1e-17   Citrus sinensis [apfelsine]
ref|XP_007226541.1|  hypothetical protein PRUPE_ppa024999mg           89.0    1e-17   Prunus persica
ref|XP_010051583.1|  PREDICTED: galactose oxidase-like                88.6    2e-17   Eucalyptus grandis [rose gum]
ref|XP_009367501.1|  PREDICTED: uncharacterized protein LOC103957133  86.3    2e-17   
ref|XP_009600286.1|  PREDICTED: galactose oxidase-like                88.2    2e-17   Nicotiana tomentosiformis
ref|XP_010061025.1|  PREDICTED: galactose oxidase-like                87.8    3e-17   Eucalyptus grandis [rose gum]
ref|XP_009607831.1|  PREDICTED: galactose oxidase-like                87.4    4e-17   Nicotiana tomentosiformis
gb|KHN45905.1|  Galactose oxidase                                     87.0    5e-17   Glycine soja [wild soybean]
ref|XP_003523554.1|  PREDICTED: galactose oxidase-like                87.0    5e-17   Glycine max [soybeans]
emb|CDY12635.1|  BnaA02g13030D                                        83.2    5e-17   Brassica napus [oilseed rape]
ref|XP_009797024.1|  PREDICTED: galactose oxidase-like                87.0    6e-17   Nicotiana sylvestris
ref|XP_008367692.1|  PREDICTED: uncharacterized protein LOC103431321  85.5    7e-17   
ref|XP_006381726.1|  hypothetical protein POPTR_0006s16390g           86.7    8e-17   Populus trichocarpa [western balsam poplar]
ref|XP_009367892.1|  PREDICTED: uncharacterized protein LOC103957460  86.3    1e-16   Pyrus x bretschneideri [bai li]
ref|XP_008460895.1|  PREDICTED: galactose oxidase                     86.3    1e-16   Cucumis melo [Oriental melon]
ref|XP_011009462.1|  PREDICTED: galactose oxidase-like                85.9    1e-16   Populus euphratica
ref|XP_004139435.1|  PREDICTED: galactose oxidase-like                85.9    1e-16   Cucumis sativus [cucumbers]
ref|XP_009367481.1|  PREDICTED: uncharacterized protein LOC103957109  85.5    2e-16   Pyrus x bretschneideri [bai li]
ref|XP_009791893.1|  PREDICTED: galactose oxidase-like                85.1    2e-16   Nicotiana sylvestris
ref|XP_007136064.1|  hypothetical protein PHAVU_009G014800g           85.1    2e-16   Phaseolus vulgaris [French bean]
ref|XP_006580892.1|  PREDICTED: uncharacterized protein LOC102660794  82.4    2e-16   
emb|CBI19807.3|  unnamed protein product                              84.7    3e-16   Vitis vinifera
ref|XP_011069750.1|  PREDICTED: galactose oxidase-like                85.1    3e-16   Sesamum indicum [beniseed]
gb|KHN09108.1|  Galactose oxidase                                     82.0    3e-16   Glycine soja [wild soybean]
ref|XP_002280559.1|  PREDICTED: galactose oxidase                     84.7    4e-16   Vitis vinifera
ref|XP_002518913.1|  Galactose oxidase precursor, putative            84.7    4e-16   Ricinus communis
gb|AET97563.1|  galactose oxidase                                     84.7    4e-16   Ziziphus jujuba [Chinese jujube]
ref|XP_006342711.1|  PREDICTED: galactose oxidase-like                84.3    4e-16   Solanum tuberosum [potatoes]
ref|XP_011092656.1|  PREDICTED: galactose oxidase-like                84.0    6e-16   Sesamum indicum [beniseed]
ref|XP_004238618.1|  PREDICTED: galactose oxidase-like                84.0    7e-16   Solanum lycopersicum
ref|XP_004238617.1|  PREDICTED: galactose oxidase-like                83.6    9e-16   Solanum lycopersicum
ref|XP_004252835.1|  PREDICTED: galactose oxidase-like                83.6    1e-15   Solanum lycopersicum
ref|XP_006287335.1|  hypothetical protein CARUB_v10000533mg           83.6    1e-15   Capsella rubella
ref|XP_002873953.1|  hypothetical protein ARALYDRAFT_488852           83.6    1e-15   
ref|XP_009625411.1|  PREDICTED: LOW QUALITY PROTEIN: galactose ox...  83.2    1e-15   Nicotiana tomentosiformis
ref|XP_011069718.1|  PREDICTED: galactose oxidase-like                83.2    1e-15   Sesamum indicum [beniseed]
ref|XP_006342230.1|  PREDICTED: galactose oxidase-like                83.2    1e-15   Solanum tuberosum [potatoes]
ref|XP_010263908.1|  PREDICTED: galactose oxidase-like                83.2    1e-15   Nelumbo nucifera [Indian lotus]
ref|XP_011048365.1|  PREDICTED: galactose oxidase                     83.2    1e-15   Populus euphratica
ref|XP_004238324.1|  PREDICTED: galactose oxidase-like                83.2    1e-15   Solanum lycopersicum
ref|NP_001170492.1|  hypothetical protein precursor                   83.2    1e-15   Zea mays [maize]
ref|XP_010454240.1|  PREDICTED: galactose oxidase-like                83.2    1e-15   Camelina sativa [gold-of-pleasure]
ref|XP_008801460.1|  PREDICTED: galactose oxidase-like                83.2    1e-15   Phoenix dactylifera
gb|KDP25206.1|  hypothetical protein JCGZ_20362                       82.8    2e-15   Jatropha curcas
ref|XP_009797022.1|  PREDICTED: galactose oxidase-like                82.8    2e-15   Nicotiana sylvestris
emb|CDY51183.1|  BnaC02g45610D                                        82.8    2e-15   Brassica napus [oilseed rape]
ref|XP_009127543.1|  PREDICTED: galactose oxidase-like                82.8    2e-15   Brassica rapa
ref|XP_010271448.1|  PREDICTED: galactose oxidase-like                82.4    2e-15   Nelumbo nucifera [Indian lotus]
ref|XP_002324431.2|  hypothetical protein POPTR_0018s09110g           82.8    2e-15   
ref|XP_011083592.1|  PREDICTED: galactose oxidase-like                82.4    2e-15   Sesamum indicum [beniseed]
ref|XP_002456130.1|  hypothetical protein SORBIDRAFT_03g031030        82.8    2e-15   Sorghum bicolor [broomcorn]
ref|XP_008347351.1|  PREDICTED: galactose oxidase-like                82.4    2e-15   
ref|XP_009794042.1|  PREDICTED: galactose oxidase-like                82.4    2e-15   Nicotiana sylvestris
gb|KJB38605.1|  hypothetical protein B456_006G262900                  82.4    2e-15   Gossypium raimondii
ref|XP_004292851.1|  PREDICTED: uncharacterized protein LOC101303486  82.4    3e-15   Fragaria vesca subsp. vesca
gb|KGN60010.1|  hypothetical protein Csa_3G865940                     82.0    3e-15   Cucumis sativus [cucumbers]
ref|XP_009337669.1|  PREDICTED: galactose oxidase-like                82.0    3e-15   Pyrus x bretschneideri [bai li]
ref|XP_011026783.1|  PREDICTED: galactose oxidase-like                82.0    3e-15   Populus euphratica
ref|XP_004147870.1|  PREDICTED: galactose oxidase-like                82.0    3e-15   Cucumis sativus [cucumbers]
ref|XP_010493033.1|  PREDICTED: galactose oxidase-like                82.0    4e-15   Camelina sativa [gold-of-pleasure]
ref|XP_009614398.1|  PREDICTED: galactose oxidase-like                81.6    4e-15   Nicotiana tomentosiformis
ref|XP_003527766.1|  PREDICTED: galactose oxidase-like                81.6    4e-15   Glycine max [soybeans]
ref|XP_009774595.1|  PREDICTED: galactose oxidase-like                81.6    4e-15   Nicotiana sylvestris
ref|XP_011069751.1|  PREDICTED: galactose oxidase-like                81.6    5e-15   Sesamum indicum [beniseed]
gb|KJB38607.1|  hypothetical protein B456_006G263100                  81.3    5e-15   Gossypium raimondii
ref|XP_009337676.1|  PREDICTED: galactose oxidase-like                81.3    6e-15   Pyrus x bretschneideri [bai li]
ref|XP_009408991.1|  PREDICTED: galactose oxidase-like                81.3    6e-15   
gb|AAL84955.1|  AT5g19580/T20D1_100                                   81.3    6e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004291825.1|  PREDICTED: galactose oxidase-like                81.3    6e-15   Fragaria vesca subsp. vesca
ref|XP_010670846.1|  PREDICTED: galactose oxidase-like                80.9    6e-15   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_197459.1|  glyoxal oxidase-related protein                     81.3    6e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008357159.1|  PREDICTED: galactose oxidase-like                80.1    7e-15   
ref|XP_009603236.1|  PREDICTED: galactose oxidase-like                80.9    7e-15   Nicotiana tomentosiformis
gb|KJB38606.1|  hypothetical protein B456_006G263000                  80.9    8e-15   Gossypium raimondii
ref|XP_008466667.1|  PREDICTED: galactose oxidase-like                80.9    9e-15   Cucumis melo [Oriental melon]
ref|XP_008377179.1|  PREDICTED: galactose oxidase-like                80.5    9e-15   Malus domestica [apple tree]
ref|XP_008221409.1|  PREDICTED: galactose oxidase-like                80.5    9e-15   Prunus mume [ume]
gb|KFK26190.1|  hypothetical protein AALP_AA8G214300                  80.9    9e-15   Arabis alpina [alpine rockcress]
ref|XP_006342232.1|  PREDICTED: galactose oxidase-like                80.5    1e-14   Solanum tuberosum [potatoes]
ref|XP_007222145.1|  hypothetical protein PRUPE_ppa004709mg           80.1    1e-14   
ref|XP_006473606.1|  PREDICTED: galactose oxidase-like                80.1    1e-14   Citrus sinensis [apfelsine]
ref|XP_007225625.1|  hypothetical protein PRUPE_ppa003824mg           80.1    1e-14   Prunus persica
gb|KDO84767.1|  hypothetical protein CISIN_1g009420mg                 80.1    1e-14   Citrus sinensis [apfelsine]
ref|XP_008377171.1|  PREDICTED: galactose oxidase-like                80.1    1e-14   
ref|XP_010916153.1|  PREDICTED: galactose oxidase-like                80.1    1e-14   Elaeis guineensis
ref|XP_010061250.1|  PREDICTED: galactose oxidase-like                80.1    1e-14   Eucalyptus grandis [rose gum]
ref|XP_010424026.1|  PREDICTED: galactose oxidase-like                80.1    1e-14   
ref|XP_010420764.1|  PREDICTED: galactose oxidase-like isoform X1     80.1    1e-14   Camelina sativa [gold-of-pleasure]
ref|XP_010271447.1|  PREDICTED: galactose oxidase-like                80.1    1e-14   Nelumbo nucifera [Indian lotus]
ref|XP_004291826.1|  PREDICTED: galactose oxidase-like                80.1    2e-14   Fragaria vesca subsp. vesca
ref|XP_006435123.1|  hypothetical protein CICLE_v10003275mg           79.7    2e-14   
ref|XP_006342233.1|  PREDICTED: galactose oxidase-like                79.7    2e-14   Solanum tuberosum [potatoes]
ref|XP_009336713.1|  PREDICTED: galactose oxidase-like                79.7    2e-14   Pyrus x bretschneideri [bai li]
ref|XP_002510488.1|  Galactose oxidase precursor, putative            79.7    2e-14   
ref|XP_002876427.1|  hypothetical protein ARALYDRAFT_907231           79.7    2e-14   Arabidopsis lyrata subsp. lyrata
emb|CDM83959.1|  unnamed protein product                              79.7    2e-14   Triticum aestivum [Canadian hard winter wheat]
gb|EEC71262.1|  hypothetical protein OsI_03252                        79.7    2e-14   Oryza sativa Indica Group [Indian rice]
ref|NP_191321.1|  glyoxal oxidase-related protein                     79.3    2e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006391296.1|  hypothetical protein EUTSA_v10018300mg           79.7    2e-14   Eutrema salsugineum [saltwater cress]
ref|XP_003569556.2|  PREDICTED: uncharacterized protein LOC100835848  79.3    2e-14   
emb|CDY44816.1|  BnaCnng11720D                                        79.3    3e-14   Brassica napus [oilseed rape]
ref|XP_008221311.1|  PREDICTED: galactose oxidase-like                79.3    3e-14   Prunus mume [ume]
ref|XP_004969528.1|  PREDICTED: uncharacterized protein LOC101774211  79.3    3e-14   Setaria italica
ref|XP_010516382.1|  PREDICTED: galactose oxidase-like                79.0    3e-14   Camelina sativa [gold-of-pleasure]
ref|XP_004500954.1|  PREDICTED: galactose oxidase-like                79.0    3e-14   Cicer arietinum [garbanzo]
ref|XP_009119411.1|  PREDICTED: galactose oxidase                     79.0    4e-14   Brassica rapa
gb|KFK35620.1|  hypothetical protein AALP_AA4G014800                  79.0    4e-14   Arabis alpina [alpine rockcress]
ref|XP_010541740.1|  PREDICTED: galactose oxidase-like                79.0    4e-14   Tarenaya hassleriana [spider flower]
emb|CDY58964.1|  BnaC09g38100D                                        79.0    4e-14   Brassica napus [oilseed rape]
ref|XP_008221312.1|  PREDICTED: galactose oxidase-like                79.0    4e-14   Prunus mume [ume]
ref|XP_007136065.1|  hypothetical protein PHAVU_009G014900g           79.0    4e-14   Phaseolus vulgaris [French bean]
emb|CDX92518.1|  BnaA10g15570D                                        78.6    4e-14   
ref|XP_006400519.1|  hypothetical protein EUTSA_v10012975mg           79.0    4e-14   
ref|XP_006400518.1|  hypothetical protein EUTSA_v10012975mg           79.0    4e-14   Eutrema salsugineum [saltwater cress]
emb|CDY62245.1|  BnaC01g42480D                                        78.6    5e-14   Brassica napus [oilseed rape]
ref|XP_008352131.1|  PREDICTED: LOW QUALITY PROTEIN: galactose ox...  77.8    5e-14   
ref|XP_010688268.1|  PREDICTED: uncharacterized protein LOC104902254  78.2    6e-14   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB27141.1|  hypothetical protein B456_004G281100                  78.6    6e-14   Gossypium raimondii
ref|NP_001043851.1|  Os01g0677000                                     78.6    6e-14   
gb|KDP38596.1|  hypothetical protein JCGZ_04521                       78.2    6e-14   Jatropha curcas
gb|KJB27158.1|  hypothetical protein B456_004G281200                  78.6    6e-14   Gossypium raimondii
gb|KHG10828.1|  galactose oxidase                                     78.2    7e-14   Gossypium arboreum [tree cotton]
ref|XP_007013099.1|  Glyoxal oxidase-related protein, putative        78.2    7e-14   
ref|XP_007030653.1|  Glyoxal oxidase-related protein                  78.2    7e-14   
ref|XP_008350494.1|  PREDICTED: galactose oxidase-like                78.2    7e-14   Malus domestica [apple tree]
gb|EMS66740.1|  hypothetical protein TRIUR3_22174                     73.2    8e-14   Triticum urartu
ref|XP_004238325.1|  PREDICTED: galactose oxidase-like                77.8    8e-14   Solanum lycopersicum
ref|XP_010670864.1|  PREDICTED: galactose oxidase-like                78.2    8e-14   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008367966.1|  PREDICTED: galactose oxidase-like                77.8    9e-14   
ref|XP_008338258.1|  PREDICTED: galactose oxidase-like                77.8    9e-14   
ref|XP_010504696.1|  PREDICTED: galactose oxidase-like                77.8    1e-13   Camelina sativa [gold-of-pleasure]
ref|NP_176897.1|  glyoxal oxidase-related protein                     77.8    1e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002888587.1|  hypothetical protein ARALYDRAFT_475824           77.8    1e-13   
gb|KJB27159.1|  hypothetical protein B456_004G281300                  77.8    1e-13   Gossypium raimondii
ref|XP_004963606.1|  PREDICTED: galactose oxidase-like                77.8    1e-13   Setaria italica
ref|XP_009797023.1|  PREDICTED: galactose oxidase-like                77.4    1e-13   Nicotiana sylvestris
ref|XP_009388162.1|  PREDICTED: galactose oxidase-like                77.0    1e-13   
emb|CDP07430.1|  unnamed protein product                              77.0    2e-13   Coffea canephora [robusta coffee]
dbj|BAL41451.1|  glyoxal oxidase 2                                    77.4    2e-13   Linum grandiflorum
gb|EYU38846.1|  hypothetical protein MIMGU_mgv1a027114mg              76.6    2e-13   Erythranthe guttata [common monkey flower]
ref|XP_009335425.1|  PREDICTED: galactose oxidase-like                77.0    2e-13   
gb|EPS72896.1|  hypothetical protein M569_01859                       76.6    2e-13   Genlisea aurea
ref|XP_010532465.1|  PREDICTED: galactose oxidase-like                76.6    2e-13   Tarenaya hassleriana [spider flower]
ref|XP_008813838.1|  PREDICTED: galactose oxidase-like                76.6    2e-13   Phoenix dactylifera
ref|XP_010924630.1|  PREDICTED: uncharacterized protein LOC105047413  76.6    2e-13   Elaeis guineensis
ref|XP_007017716.1|  Glyoxal oxidase-related protein                  76.6    2e-13   
ref|XP_007039386.1|  Glyoxal oxidase-related protein                  76.6    2e-13   
ref|XP_011457694.1|  PREDICTED: galactose oxidase-like                76.6    2e-13   Fragaria vesca subsp. vesca
ref|XP_011074991.1|  PREDICTED: galactose oxidase-like                76.3    3e-13   
ref|XP_008387970.1|  PREDICTED: galactose oxidase-like                76.3    3e-13   
ref|XP_008350495.1|  PREDICTED: galactose oxidase-like                76.3    3e-13   
ref|XP_004239377.1|  PREDICTED: galactose oxidase-like                76.3    3e-13   Solanum lycopersicum
gb|EYU23055.1|  hypothetical protein MIMGU_mgv1a021812mg              76.3    3e-13   Erythranthe guttata [common monkey flower]
gb|KHG29502.1|  galactose oxidase                                     75.9    3e-13   Gossypium arboreum [tree cotton]
ref|XP_010670858.1|  PREDICTED: galactose oxidase-like                76.3    3e-13   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002299426.2|  hypothetical protein POPTR_0001s11390g           76.3    3e-13   
gb|KJB27154.1|  hypothetical protein B456_004G281000                  76.3    4e-13   Gossypium raimondii
gb|KHG16412.1|  galactose oxidase                                     75.5    4e-13   Gossypium arboreum [tree cotton]
ref|XP_010535983.1|  PREDICTED: galactose oxidase-like                75.9    4e-13   Tarenaya hassleriana [spider flower]
ref|XP_004289629.1|  PREDICTED: galactose oxidase-like                75.9    4e-13   Fragaria vesca subsp. vesca
ref|XP_006290310.1|  hypothetical protein CARUB_v10019204mg           75.9    4e-13   Capsella rubella
ref|XP_010105253.1|  hypothetical protein L484_019396                 75.5    6e-13   Morus notabilis
ref|XP_006382737.1|  glyoxal oxidase-related family protein           75.1    6e-13   Populus trichocarpa [western balsam poplar]
ref|XP_008218222.1|  PREDICTED: galactose oxidase                     75.1    7e-13   Prunus mume [ume]
ref|XP_002514260.1|  Galactose oxidase precursor, putative            75.5    7e-13   Ricinus communis
ref|XP_004499224.1|  PREDICTED: galactose oxidase-like                75.1    7e-13   Cicer arietinum [garbanzo]
gb|KEH36231.1|  glyoxal oxidase amino-terminal protein                75.1    7e-13   Medicago truncatula
ref|XP_007208189.1|  hypothetical protein PRUPE_ppa020922mg           75.1    7e-13   
ref|XP_006471853.1|  PREDICTED: galactose oxidase-like                75.1    7e-13   Citrus sinensis [apfelsine]
ref|XP_006433075.1|  hypothetical protein CICLE_v10000768mg           75.1    8e-13   
ref|XP_010470629.1|  PREDICTED: galactose oxidase-like isoform X1     75.1    8e-13   
ref|XP_009606830.1|  PREDICTED: galactose oxidase                     75.1    8e-13   Nicotiana tomentosiformis
emb|CDP08591.1|  unnamed protein product                              74.7    9e-13   Coffea canephora [robusta coffee]
ref|XP_004489989.1|  PREDICTED: uncharacterized protein LOC101500908  75.1    9e-13   Cicer arietinum [garbanzo]
emb|CDY44928.1|  BnaA02g04330D                                        74.7    1e-12   Brassica napus [oilseed rape]
ref|XP_004152661.1|  PREDICTED: galactose oxidase-like                74.7    1e-12   
ref|XP_009392205.1|  PREDICTED: galactose oxidase-like                74.3    1e-12   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT23870.1|  hypothetical protein F775_01170                       74.3    1e-12   
emb|CDY42279.1|  BnaC02g08850D                                        74.7    1e-12   Brassica napus [oilseed rape]
gb|KGN62661.1|  hypothetical protein Csa_2G365680                     74.7    1e-12   Cucumis sativus [cucumbers]
ref|XP_009126377.1|  PREDICTED: galactose oxidase-like                74.7    1e-12   Brassica rapa
ref|XP_006392509.1|  hypothetical protein EUTSA_v10023396mg           74.3    1e-12   Eutrema salsugineum [saltwater cress]
ref|XP_006389311.1|  glyoxal oxidase-related family protein           74.3    1e-12   
ref|XP_007160695.1|  hypothetical protein PHAVU_001G009200g           74.3    1e-12   Phaseolus vulgaris [French bean]
ref|XP_004164439.1|  PREDICTED: galactose oxidase-like                74.3    1e-12   
ref|XP_009779182.1|  PREDICTED: galactose oxidase-like                74.3    2e-12   Nicotiana sylvestris
ref|XP_006838081.1|  hypothetical protein AMTR_s00225p00021580        73.9    2e-12   
ref|XP_010660091.1|  PREDICTED: galactose oxidase                     73.9    2e-12   Vitis vinifera
ref|XP_011003791.1|  PREDICTED: galactose oxidase-like                73.9    2e-12   Populus euphratica
emb|CBI34230.3|  unnamed protein product                              73.6    2e-12   Vitis vinifera
ref|XP_008444780.1|  PREDICTED: galactose oxidase-like                73.9    2e-12   Cucumis melo [Oriental melon]
gb|KJB59770.1|  hypothetical protein B456_009G270800                  73.9    2e-12   Gossypium raimondii
ref|XP_009393211.1|  PREDICTED: galactose oxidase-like                73.6    2e-12   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007209012.1|  hypothetical protein PRUPE_ppa023406mg           73.6    2e-12   
ref|XP_006357288.1|  PREDICTED: galactose oxidase-like                73.6    3e-12   Solanum tuberosum [potatoes]
ref|XP_003527665.1|  PREDICTED: galactose oxidase-like                73.2    3e-12   Glycine max [soybeans]
gb|KDO66470.1|  hypothetical protein CISIN_1g042680mg                 73.2    3e-12   Citrus sinensis [apfelsine]
ref|XP_008775019.1|  PREDICTED: galactose oxidase-like                73.2    4e-12   Phoenix dactylifera
ref|XP_002512263.1|  Galactose oxidase precursor, putative            73.2    4e-12   
ref|XP_006451227.1|  hypothetical protein CICLE_v10007862mg           73.2    4e-12   Citrus clementina [clementine]
gb|EYU36763.1|  hypothetical protein MIMGU_mgv1a004035mg              72.8    4e-12   Erythranthe guttata [common monkey flower]
ref|XP_008245383.1|  PREDICTED: galactose oxidase-like                72.8    4e-12   Prunus mume [ume]
ref|XP_004304717.1|  PREDICTED: galactose oxidase                     72.4    6e-12   Fragaria vesca subsp. vesca
emb|CDY43429.1|  BnaC07g14960D                                        72.4    6e-12   Brassica napus [oilseed rape]
ref|NP_177692.1|  glyoxal oxidase-related protein                     72.4    6e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003589379.1|  Galactose oxidase                                72.4    7e-12   Medicago truncatula
emb|CDY01390.1|  BnaA07g11630D                                        72.0    8e-12   
ref|XP_009801814.1|  PREDICTED: galactose oxidase                     72.0    9e-12   Nicotiana sylvestris
ref|XP_006654771.1|  PREDICTED: uncharacterized protein LOC102716970  72.0    9e-12   
ref|XP_003553749.1|  PREDICTED: galactose oxidase-like                72.0    9e-12   Glycine max [soybeans]
gb|KHN43222.1|  Galactose oxidase                                     71.6    9e-12   Glycine soja [wild soybean]
gb|KJB37454.1|  hypothetical protein B456_006G205600                  72.0    1e-11   Gossypium raimondii
gb|KEH24796.1|  glyoxal oxidase amino-terminal protein                71.6    1e-11   Medicago truncatula
gb|KJB58134.1|  hypothetical protein B456_009G196400                  71.6    1e-11   Gossypium raimondii
ref|XP_006343542.1|  PREDICTED: galactose oxidase-like                71.6    1e-11   Solanum tuberosum [potatoes]
ref|XP_009782130.1|  PREDICTED: galactose oxidase-like                71.6    1e-11   Nicotiana sylvestris
gb|KHN39443.1|  Galactose oxidase                                     68.9    1e-11   Glycine soja [wild soybean]
ref|XP_009594288.1|  PREDICTED: uncharacterized protein LOC104090813  71.2    1e-11   Nicotiana tomentosiformis
gb|EAY98991.1|  hypothetical protein OsI_20949                        71.2    2e-11   Oryza sativa Indica Group [Indian rice]
ref|NP_001056298.1|  Os05g0559000                                     71.2    2e-11   
ref|XP_008387971.1|  PREDICTED: galactose oxidase-like                71.2    2e-11   Malus domestica [apple tree]
ref|XP_003567916.1|  PREDICTED: galactose oxidase-like                71.2    2e-11   Brachypodium distachyon [annual false brome]
ref|XP_007147126.1|  hypothetical protein PHAVU_006G098100g           70.9    2e-11   Phaseolus vulgaris [French bean]
ref|XP_009337697.1|  PREDICTED: galactose oxidase-like                70.9    2e-11   Pyrus x bretschneideri [bai li]
ref|XP_009103375.1|  PREDICTED: galactose oxidase-like                70.9    2e-11   Brassica rapa
ref|XP_009337677.1|  PREDICTED: galactose oxidase-like                70.5    2e-11   Pyrus x bretschneideri [bai li]
ref|XP_010532190.1|  PREDICTED: galactose oxidase                     70.5    3e-11   Tarenaya hassleriana [spider flower]
gb|KDP33710.1|  hypothetical protein JCGZ_07281                       70.9    3e-11   Jatropha curcas
ref|XP_011010793.1|  PREDICTED: galactose oxidase                     70.5    3e-11   Populus euphratica
ref|XP_002889034.1|  hypothetical protein ARALYDRAFT_895435           70.5    3e-11   Arabidopsis lyrata subsp. lyrata
ref|XP_010511646.1|  PREDICTED: galactose oxidase-like                70.5    3e-11   Camelina sativa [gold-of-pleasure]
ref|XP_002440240.1|  hypothetical protein SORBIDRAFT_09g028310        70.5    3e-11   Sorghum bicolor [broomcorn]
ref|XP_009103376.1|  PREDICTED: galactose oxidase-like                70.5    3e-11   Brassica rapa
ref|XP_010111102.1|  hypothetical protein L484_008478                 70.1    3e-11   Morus notabilis
emb|CDY01391.1|  BnaA07g11640D                                        70.1    4e-11   
gb|KJB29631.1|  hypothetical protein B456_005G111300                  70.1    4e-11   
ref|XP_006349488.1|  PREDICTED: galactose oxidase-like                70.1    4e-11   
ref|XP_010105252.1|  hypothetical protein L484_019394                 70.1    4e-11   
ref|XP_008649992.1|  PREDICTED: uncharacterized protein LOC103630723  70.1    4e-11   
gb|ACG29670.1|  glyoxal oxidase                                       70.1    4e-11   
gb|KFK44114.1|  hypothetical protein AALP_AA1G217400                  67.4    4e-11   
ref|XP_009619752.1|  PREDICTED: galactose oxidase-like                70.1    4e-11   
ref|XP_010471676.1|  PREDICTED: galactose oxidase-like isoform X2     70.1    4e-11   
ref|XP_010471675.1|  PREDICTED: galactose oxidase-like isoform X1     70.1    4e-11   
ref|XP_010535981.1|  PREDICTED: galactose oxidase-like                69.7    5e-11   
ref|XP_010416450.1|  PREDICTED: galactose oxidase-like isoform X1     69.7    5e-11   
ref|XP_009110252.1|  PREDICTED: galactose oxidase-like                69.7    5e-11   
ref|XP_006304793.1|  hypothetical protein CARUB_v10012343mg           69.7    5e-11   
ref|XP_010416451.1|  PREDICTED: galactose oxidase-like isoform X2     69.7    5e-11   
ref|XP_010535982.1|  PREDICTED: galactose oxidase-like                69.7    5e-11   
gb|KHN04050.1|  Galactose oxidase                                     69.3    6e-11   
gb|KDP33711.1|  hypothetical protein JCGZ_07282                       69.7    6e-11   
ref|XP_004309580.1|  PREDICTED: galactose oxidase-like                69.7    6e-11   
gb|KFK37635.1|  hypothetical protein AALP_AA3G008700                  69.7    6e-11   
ref|XP_009360496.1|  PREDICTED: LOW QUALITY PROTEIN: galactose ox...  69.7    6e-11   
ref|XP_010041767.1|  PREDICTED: galactose oxidase                     69.3    6e-11   
emb|CDY62590.1|  BnaA08g31280D                                        69.3    7e-11   
ref|XP_006577272.1|  PREDICTED: galactose oxidase-like                69.3    8e-11   
ref|XP_010533609.1|  PREDICTED: galactose oxidase-like                69.3    8e-11   
ref|XP_004298452.1|  PREDICTED: galactose oxidase-like                69.3    8e-11   
ref|XP_006416454.1|  hypothetical protein EUTSA_v10007284mg           68.9    9e-11   
emb|CDX83737.1|  BnaC08g19080D                                        66.6    9e-11   
ref|XP_010674901.1|  PREDICTED: galactose oxidase                     68.9    1e-10   
ref|XP_010242442.1|  PREDICTED: galactose oxidase                     68.9    1e-10   
ref|XP_009335433.1|  PREDICTED: galactose oxidase-like                68.6    1e-10   
ref|XP_006646198.1|  PREDICTED: uncharacterized protein LOC102719070  68.6    1e-10   
ref|XP_010536365.1|  PREDICTED: galactose oxidase-like                68.6    1e-10   
ref|XP_006300296.1|  hypothetical protein CARUB_v10021300mg           68.6    1e-10   
ref|XP_010652487.1|  PREDICTED: galactose oxidase                     68.6    1e-10   
ref|XP_003544396.1|  PREDICTED: uncharacterized protein LOC100791340  68.6    1e-10   
ref|XP_006344285.1|  PREDICTED: galactose oxidase-like                68.6    1e-10   
ref|XP_010536366.1|  PREDICTED: galactose oxidase-like                68.6    1e-10   
ref|XP_011073112.1|  PREDICTED: galactose oxidase                     68.2    2e-10   
ref|XP_010541897.1|  PREDICTED: galactose oxidase-like                68.2    2e-10   
gb|AFG64084.1|  hypothetical protein 2_2702_01                        64.7    2e-10   
emb|CDP06561.1|  unnamed protein product                              67.8    2e-10   
ref|XP_010096335.1|  hypothetical protein L484_021082                 67.8    2e-10   
gb|AFG64082.1|  hypothetical protein 2_2702_01                        64.3    2e-10   
gb|KJB50703.1|  hypothetical protein B456_008G183000                  67.8    3e-10   
dbj|BAL41454.1|  glyoxal oxidase 5                                    67.8    3e-10   
gb|KFK44113.1|  hypothetical protein AALP_AA1G217400                  67.4    3e-10   
gb|AEW08193.1|  hypothetical protein 2_2702_01                        63.9    3e-10   
ref|XP_008348975.1|  PREDICTED: galactose oxidase-like                67.4    3e-10   
emb|CDY43432.1|  BnaC07g14990D                                        67.0    3e-10   
ref|XP_010536368.1|  PREDICTED: galactose oxidase-like                67.4    3e-10   
gb|KEH28959.1|  glyoxal oxidase amino-terminal protein                67.4    4e-10   
gb|AFG64090.1|  hypothetical protein 2_2702_01                        63.5    4e-10   
gb|KCW65018.1|  hypothetical protein EUGRSUZ_G02553                   67.0    4e-10   
ref|XP_010256224.1|  PREDICTED: galactose oxidase                     67.0    4e-10   
ref|XP_004237211.1|  PREDICTED: galactose oxidase-like                67.0    4e-10   
gb|AEW08192.1|  hypothetical protein 2_2702_01                        63.5    5e-10   
ref|XP_004249644.1|  PREDICTED: galactose oxidase                     67.0    5e-10   
ref|XP_003626387.1|  Galactose oxidase                                67.0    5e-10   
dbj|BAL41452.1|  glyoxal oxidase 3                                    67.0    5e-10   
gb|KJB45029.1|  hypothetical protein B456_007G286100                  66.6    5e-10   
ref|XP_004494672.1|  PREDICTED: galactose oxidase-like                66.6    5e-10   
ref|XP_006849171.1|  hypothetical protein AMTR_s00027p00177380        66.6    6e-10   
ref|XP_010477216.1|  PREDICTED: galactose oxidase-like                66.6    6e-10   
ref|XP_010088559.1|  hypothetical protein L484_016951                 66.6    6e-10   
ref|XP_006383732.1|  hypothetical protein POPTR_0005s25680g           66.6    6e-10   
ref|XP_011071032.1|  PREDICTED: galactose oxidase-like                66.6    7e-10   
ref|XP_003519774.1|  PREDICTED: galactose oxidase-like                66.6    7e-10   
ref|XP_007134016.1|  hypothetical protein PHAVU_010G012100g           66.2    8e-10   
ref|XP_009774166.1|  PREDICTED: galactose oxidase                     66.2    8e-10   
emb|CDP00283.1|  unnamed protein product                              65.9    1e-09   
ref|XP_004984953.1|  PREDICTED: galactose oxidase-like                65.9    1e-09   
ref|XP_008389005.1|  PREDICTED: galactose oxidase                     65.9    1e-09   
ref|XP_006429215.1|  hypothetical protein CICLE_v10011448mg           65.9    1e-09   
gb|KDP29261.1|  hypothetical protein JCGZ_16650                       63.5    1e-09   
ref|XP_010462699.1|  PREDICTED: galactose oxidase-like                63.2    1e-09   
ref|XP_009364601.1|  PREDICTED: galactose oxidase                     65.9    1e-09   
ref|XP_008464498.1|  PREDICTED: uncharacterized protein LOC103502362  65.9    1e-09   
ref|XP_010459669.1|  PREDICTED: galactose oxidase-like                65.9    1e-09   
gb|EAY89314.1|  hypothetical protein OsI_10817                        65.5    1e-09   
ref|XP_004507195.1|  PREDICTED: galactose oxidase-like                65.5    1e-09   
ref|NP_001049609.1|  Os03g0258900                                     65.5    1e-09   
ref|XP_008466509.1|  PREDICTED: galactose oxidase-like                65.5    1e-09   
ref|XP_004486272.1|  PREDICTED: galactose oxidase-like                65.5    1e-09   
ref|XP_011028961.1|  PREDICTED: galactose oxidase-like                65.5    1e-09   
ref|XP_002893079.1|  hypothetical protein ARALYDRAFT_472215           65.5    1e-09   
ref|XP_006390288.1|  hypothetical protein EUTSA_v10018361mg           65.5    1e-09   
ref|XP_006480899.1|  PREDICTED: galactose oxidase-like                65.5    2e-09   
ref|XP_003516307.1|  PREDICTED: galactose oxidase-like                65.5    2e-09   
ref|XP_008340335.1|  PREDICTED: uncharacterized protein LOC103403295  65.9    2e-09   
ref|XP_003561804.1|  PREDICTED: galactose oxidase-like                65.1    2e-09   
ref|XP_010428587.1|  PREDICTED: galactose oxidase-like                65.1    2e-09   
gb|KDO52701.1|  hypothetical protein CISIN_1g048136mg                 65.1    2e-09   
ref|XP_004243010.2|  PREDICTED: galactose oxidase                     65.1    2e-09   
ref|XP_010498415.1|  PREDICTED: galactose oxidase                     65.1    2e-09   
ref|XP_009149487.1|  PREDICTED: galactose oxidase                     65.1    2e-09   
ref|XP_007017718.1|  Glyoxal oxidase-related protein                  65.1    2e-09   
emb|CDY29385.1|  BnaA06g14110D                                        64.7    2e-09   
ref|XP_007046239.1|  Glyoxal oxidase-related protein, putative        65.1    2e-09   
ref|XP_006301879.1|  hypothetical protein CARUB_v10022352mg           65.1    2e-09   
ref|XP_006437613.1|  hypothetical protein CICLE_v10033514mg           64.7    3e-09   
ref|XP_004147869.1|  PREDICTED: galactose oxidase-like                64.7    3e-09   
gb|KGN60011.1|  hypothetical protein Csa_3G866440                     64.7    3e-09   
emb|CDY39045.1|  BnaA02g17340D                                        64.7    3e-09   
ref|XP_010251352.1|  PREDICTED: uncharacterized protein LOC104593293  64.7    3e-09   
ref|XP_011045139.1|  PREDICTED: galactose oxidase-like                64.3    3e-09   
gb|KJB36661.1|  hypothetical protein B456_006G169500                  64.3    4e-09   
ref|XP_011006630.1|  PREDICTED: galactose oxidase                     63.9    4e-09   
gb|KDO57956.1|  hypothetical protein CISIN_1g044265mg                 63.9    4e-09   
ref|XP_001763031.1|  predicted protein                                63.9    4e-09   
ref|XP_006849170.1|  hypothetical protein AMTR_s00027p00175370        63.9    4e-09   
ref|XP_002322929.1|  glyoxal oxidase-related family protein           63.9    4e-09   
gb|KDP29259.1|  hypothetical protein JCGZ_16648                       63.9    5e-09   
ref|XP_002468154.1|  hypothetical protein SORBIDRAFT_01g040550        63.9    5e-09   
ref|XP_009602919.1|  PREDICTED: galactose oxidase                     63.9    5e-09   
gb|KDP29262.1|  hypothetical protein JCGZ_16651                       63.9    5e-09   
emb|CDP00282.1|  unnamed protein product                              63.5    6e-09   
ref|XP_010476497.1|  PREDICTED: galactose oxidase-like                63.5    6e-09   
ref|XP_002301997.2|  glyoxal oxidase-related family protein           63.5    6e-09   
gb|AFK44665.1|  unknown                                               60.8    7e-09   
ref|XP_004305171.1|  PREDICTED: galactose oxidase                     63.5    7e-09   
ref|XP_008359690.1|  PREDICTED: LOW QUALITY PROTEIN: galactose ox...  63.5    7e-09   
emb|CDY13556.1|  BnaC02g23670D                                        63.5    7e-09   
gb|KFK41129.1|  hypothetical protein AALP_AA2G089900                  63.5    8e-09   
ref|XP_010674911.1|  PREDICTED: uncharacterized protein LOC104890981  63.2    8e-09   
emb|CDP12684.1|  unnamed protein product                              63.2    8e-09   
ref|XP_008240187.1|  PREDICTED: galactose oxidase                     63.2    9e-09   
gb|KDP24540.1|  hypothetical protein JCGZ_25104                       63.2    9e-09   
ref|XP_003520957.1|  PREDICTED: uncharacterized protein LOC100776515  63.2    9e-09   
gb|AAG12543.1|AC007797_3  Unknown Protein                             62.8    9e-09   
ref|XP_002973684.1|  hypothetical protein SELMODRAFT_413959           63.2    1e-08   
ref|XP_007026880.1|  Glyoxal oxidase-related protein                  63.2    1e-08   
ref|XP_010540180.1|  PREDICTED: galactose oxidase-like                62.8    1e-08   
ref|XP_003613586.1|  hypothetical protein MTR_5g038410                62.8    1e-08   
ref|XP_007227672.1|  hypothetical protein PRUPE_ppa026498mg           62.4    1e-08   
gb|EYU17749.1|  hypothetical protein MIMGU_mgv1a003984mg              62.4    1e-08   
emb|CBI30475.3|  unnamed protein product                              62.0    1e-08   
emb|CDX73183.1|  BnaC06g36310D                                        62.4    1e-08   
gb|KHN14867.1|  Galactose oxidase                                     61.6    2e-08   
ref|XP_007017717.1|  Glyoxal oxidase-related protein                  62.4    2e-08   
ref|NP_173419.1|  glyoxal oxidase-related protein                     62.4    2e-08   
emb|CDX81637.1|  BnaC08g39640D                                        62.4    2e-08   
ref|XP_009117902.1|  PREDICTED: galactose oxidase-like                62.0    2e-08   
emb|CDY53551.1|  BnaA09g57100D                                        62.0    2e-08   
gb|EPS61181.1|  glyoxal oxidase                                       62.0    2e-08   
gb|KJB51134.1|  hypothetical protein B456_008G202800                  62.0    2e-08   
ref|XP_008221748.1|  PREDICTED: galactose oxidase                     62.0    2e-08   
ref|XP_006649773.1|  PREDICTED: galactose oxidase-like                62.0    2e-08   
ref|XP_001771865.1|  predicted protein                                61.6    3e-08   
ref|XP_008442498.1|  PREDICTED: LOW QUALITY PROTEIN: galactose ox...  61.6    3e-08   
ref|XP_010686035.1|  PREDICTED: uncharacterized protein LOC104900331  62.0    3e-08   
ref|XP_009106213.1|  PREDICTED: galactose oxidase isoform X2          61.6    3e-08   
ref|XP_003528130.2|  PREDICTED: uncharacterized protein LOC100814200  61.6    3e-08   
emb|CDY47509.1|  BnaAnng09070D                                        61.6    3e-08   
emb|CDY62624.1|  BnaC08g46830D                                        58.2    3e-08   
gb|ACV49897.1|  glyoxal oxidase                                       61.6    3e-08   
ref|XP_004501852.1|  PREDICTED: uncharacterized protein LOC101503410  62.0    3e-08   
gb|ABA42922.1|  glyoxal oxidase                                       61.6    3e-08   
gb|ACV49899.1|  glyoxal oxidase                                       61.6    3e-08   
ref|XP_002274763.1|  PREDICTED: galactose oxidase                     61.6    3e-08   
gb|ACV49898.1|  glyoxal oxidase                                       61.2    3e-08   
ref|XP_007208466.1|  hypothetical protein PRUPE_ppa003992mg           61.6    3e-08   
ref|XP_001762682.1|  predicted protein                                61.2    3e-08   
gb|EMT01589.1|  hypothetical protein F775_04099                       61.2    4e-08   
ref|XP_006378160.1|  glyoxal oxidase-related family protein           61.2    4e-08   
ref|XP_010044010.1|  PREDICTED: galactose oxidase                     61.2    4e-08   
ref|XP_009128116.1|  PREDICTED: galactose oxidase-like                60.8    4e-08   
ref|XP_001778975.1|  predicted protein                                60.8    5e-08   
ref|XP_010539855.1|  PREDICTED: galactose oxidase-like                60.8    5e-08   
ref|XP_009378871.1|  PREDICTED: galactose oxidase                     60.8    6e-08   
ref|XP_004137754.1|  PREDICTED: galactose oxidase-like                60.5    6e-08   
ref|XP_010496071.1|  PREDICTED: galactose oxidase-like                60.5    6e-08   
ref|XP_002972585.1|  hypothetical protein SELMODRAFT_97196            60.5    6e-08   
ref|XP_002972039.1|  hypothetical protein SELMODRAFT_441651           60.5    6e-08   
gb|EYU22441.1|  hypothetical protein MIMGU_mgv1a024085mg              60.5    6e-08   
gb|EYU41788.1|  hypothetical protein MIMGU_mgv1a004290mg              60.5    7e-08   
ref|XP_010458940.1|  PREDICTED: galactose oxidase-like                60.5    7e-08   
gb|KJB16941.1|  hypothetical protein B456_002G255700                  60.1    8e-08   
ref|XP_004298451.2|  PREDICTED: galactose oxidase-like                60.5    8e-08   
ref|XP_010100623.1|  hypothetical protein L484_011554                 60.1    8e-08   
gb|KHN07971.1|  E3 ubiquitin-protein ligase RGLG2                     60.5    9e-08   
ref|XP_004138264.1|  PREDICTED: uncharacterized protein LOC101204692  60.1    1e-07   
ref|XP_009106212.1|  PREDICTED: galactose oxidase isoform X1          60.1    1e-07   
gb|KDP21232.1|  hypothetical protein JCGZ_21703                       59.7    1e-07   
ref|XP_011464174.1|  PREDICTED: uncharacterized protein LOC101293...  59.7    1e-07   
ref|XP_011464173.1|  PREDICTED: uncharacterized protein LOC101293...  59.3    2e-07   
ref|XP_001754066.1|  predicted protein                                59.3    2e-07   
ref|XP_004301024.2|  PREDICTED: uncharacterized protein LOC101293...  59.3    2e-07   
ref|XP_011464176.1|  PREDICTED: uncharacterized protein LOC101293...  59.3    2e-07   
ref|XP_006290869.1|  hypothetical protein CARUB_v10016978mg           59.3    2e-07   
emb|CDY45256.1|  BnaA06g09260D                                        55.8    2e-07   
ref|XP_002520142.1|  conserved hypothetical protein                   59.3    2e-07   
ref|XP_002975736.1|  hypothetical protein SELMODRAFT_232564           58.9    2e-07   
dbj|BAL41453.1|  glyoxal oxidase 4                                    58.9    2e-07   
ref|XP_004299160.2|  PREDICTED: uncharacterized protein LOC101293...  58.9    2e-07   
tpg|DAA44472.1|  TPA: glyoxal oxidase                                 58.9    2e-07   
ref|XP_011094925.1|  PREDICTED: galactose oxidase                     58.9    2e-07   
ref|NP_001149941.1|  glyoxal oxidase precursor                        58.9    2e-07   
tpg|DAA44471.1|  TPA: hypothetical protein ZEAMMB73_122663            58.9    2e-07   
ref|XP_010930930.1|  PREDICTED: uncharacterized protein LOC105051966  58.5    3e-07   
ref|XP_002970607.1|  hypothetical protein SELMODRAFT_411320           58.5    3e-07   
emb|CDY39312.1|  BnaC05g10670D                                        55.1    3e-07   
ref|XP_006403635.1|  hypothetical protein EUTSA_v100109141mg          56.2    3e-07   
ref|XP_002968444.1|  hypothetical protein SELMODRAFT_231119           58.5    3e-07   
gb|KEH35019.1|  glyoxal oxidase amino-terminal protein                58.2    3e-07   
ref|XP_002446737.1|  hypothetical protein SORBIDRAFT_06g021520        58.2    4e-07   
emb|CAN73409.1|  hypothetical protein VITISV_024374                   57.8    4e-07   
ref|XP_001771982.1|  predicted protein                                58.2    4e-07   
ref|XP_008811510.1|  PREDICTED: galactose oxidase                     57.8    5e-07   
dbj|BAL41448.1|  glyoxal oxidase 1                                    58.2    5e-07   
ref|XP_011045140.1|  PREDICTED: galactose oxidase-like                57.8    5e-07   
ref|XP_001757263.1|  predicted protein                                57.8    5e-07   
ref|XP_006850437.1|  hypothetical protein AMTR_s00165p00057230        57.8    6e-07   
ref|XP_009394071.1|  PREDICTED: uncharacterized protein LOC103979627  57.4    7e-07   
ref|XP_006383733.1|  hypothetical protein POPTR_0005s25690g           57.4    7e-07   
ref|XP_010553274.1|  PREDICTED: galactose oxidase                     57.4    7e-07   
ref|XP_010102932.1|  hypothetical protein L484_018951                 57.4    8e-07   
ref|XP_006438575.1|  hypothetical protein CICLE_v10031195mg           57.4    8e-07   
ref|XP_010262660.1|  PREDICTED: galactose oxidase                     57.4    8e-07   
ref|XP_001774105.1|  predicted protein                                57.0    9e-07   
ref|XP_007157402.1|  hypothetical protein PHAVU_002G066900g           57.0    1e-06   



>emb|CDP03295.1| unnamed protein product [Coffea canephora]
Length=897

 Score =   139 bits (349),  Expect = 7e-35, Method: Composition-based stats.
 Identities = 62/100 (62%), Positives = 74/100 (74%), Gaps = 0/100 (0%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTS  240
            P IVE  S  EL YG+ F ++   DD  D S IKVTMYPPPFTTHG+ + QR+ +LGLT 
Sbjct  494  PVIVEDASDKELKYGQQFVVNINLDDQVDASDIKVTMYPPPFTTHGFSQSQRLLVLGLTQ  553

Query  239  VAKDTISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
            V    I+AVAP SGK APPGYY++FV HRGVPS+G+WVHI
Sbjct  554  VTNQQITAVAPPSGKIAPPGYYMLFVVHRGVPSRGMWVHI  593



>ref|XP_006341271.1| PREDICTED: uncharacterized protein LOC102605018 [Solanum tuberosum]
Length=547

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 74/100 (74%), Gaps = 0/100 (0%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTS  240
            PQI+E  +  E+ YG+NF I+ K D+  D + IKVTMY PPFTTHGY +GQR+ IL L +
Sbjct  446  PQILENGANKEMKYGQNFKINIKLDEVVDETDIKVTMYAPPFTTHGYSQGQRLLILKLQA  505

Query  239  VAKDTISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
            V    +S VAP SG+ APPGYYL+FV HRGVPS+G+WV I
Sbjct  506  VTNQEVSVVAPPSGRIAPPGYYLLFVVHRGVPSRGMWVRI  545



>ref|XP_004242940.2| PREDICTED: uncharacterized protein LOC101252095 [Solanum lycopersicum]
Length=558

 Score =   128 bits (322),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 73/100 (73%), Gaps = 0/100 (0%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTS  240
            P I+E  +  E+ YG+NF I+ K D+  D + IKVTMY PPFTTHGY +GQR+ IL L +
Sbjct  457  PLILENGANKEMKYGQNFKINIKLDEFVDETDIKVTMYAPPFTTHGYSQGQRLLILKLQA  516

Query  239  VAKDTISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
            V    ++ VAP SG+ APPGYYL+FV HR VPS+G+WVHI
Sbjct  517  VTNQEVTVVAPPSGRIAPPGYYLLFVVHRSVPSRGMWVHI  556



>ref|XP_009766667.1| PREDICTED: uncharacterized protein LOC104217988 [Nicotiana sylvestris]
Length=624

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 72/100 (72%), Gaps = 0/100 (0%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTS  240
            PQI+E  +  E+ YG+ F+++ K D+  D + IKVTMY PPFTTHGY +GQR+ IL L S
Sbjct  523  PQILENGANKEMRYGQEFSVNIKLDEVVDETDIKVTMYAPPFTTHGYSQGQRLLILQLKS  582

Query  239  VAKDTISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
                 ++ VAP SGK APPGYYL+FV HRGVPS G+WV I
Sbjct  583  ATNQQVAVVAPPSGKLAPPGYYLLFVVHRGVPSHGMWVRI  622



>gb|EPS69637.1| hypothetical protein M569_05128, partial [Genlisea aurea]
Length=206

 Score =   110 bits (274),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 66/99 (67%), Gaps = 1/99 (1%)
 Frame = -3

Query  413  IVEKLSQTELVYGKNFNIHFK-XDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTSV  237
            IVE  S  +L YG+   I  +  +   +   IKVTMY PPFTTHGY   QR+ +L +  +
Sbjct  108  IVEGESDKQLKYGREMRIQVEPRNRRMNRRGIKVTMYSPPFTTHGYSMNQRLLVLKVKEL  167

Query  236  AKDTISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
                I+AVAP SG+ APPGYYL+FV HRGVPS+G+WVHI
Sbjct  168  ENGLITAVAPPSGRLAPPGYYLLFVNHRGVPSRGMWVHI  206



>ref|XP_011078295.1| PREDICTED: uncharacterized protein LOC105162074 [Sesamum indicum]
Length=630

 Score =   112 bits (281),  Expect = 5e-26, Method: Composition-based stats.
 Identities = 54/100 (54%), Positives = 69/100 (69%), Gaps = 1/100 (1%)
 Frame = -3

Query  416  QIVEKLSQTELVYGKNFNIHF-KXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTS  240
            +I+E+ S  +L YG  FN+   + ++    S+IKVTMY PPFTTHGY   QR+ +L +  
Sbjct  529  EILEEESDKQLKYGGEFNVAIGQTEENVKQSNIKVTMYSPPFTTHGYSMNQRLLVLKMKE  588

Query  239  VAKDTISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
            VAK  IS VAP SG  APPG+YL+FV H GVPS G+WVHI
Sbjct  589  VAKGHISVVAPPSGTLAPPGHYLLFVVHHGVPSHGMWVHI  628



>ref|XP_009600209.1| PREDICTED: uncharacterized protein LOC104095723 [Nicotiana tomentosiformis]
Length=619

 Score =   111 bits (277),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 73/100 (73%), Gaps = 0/100 (0%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTS  240
            PQI+E  +  E+ YG++F+++ K D   D + IKVTMY PPFTTHGY +GQR+ +L L S
Sbjct  518  PQILENGANKEMRYGQDFSLNIKLDQVVDKTDIKVTMYAPPFTTHGYSQGQRLLLLQLKS  577

Query  239  VAKDTISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
                 ++ VAP SGK +PPGYYL+FV HRGVPS+G+WV I
Sbjct  578  ATNQQVTVVAPPSGKLSPPGYYLLFVVHRGVPSRGMWVRI  617



>ref|XP_011078293.1| PREDICTED: uncharacterized protein LOC105162073 [Sesamum indicum]
Length=630

 Score =   111 bits (277),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 68/100 (68%), Gaps = 1/100 (1%)
 Frame = -3

Query  416  QIVEKLSQTELVYGKNFNIHF-KXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTS  240
            +I+E+ S  +L YG  FN+   +       S++KVTMY PPFTTHGY   QR+ IL +  
Sbjct  529  EILEEQSNKQLKYGGEFNVAIGQTKGKIKKSNVKVTMYSPPFTTHGYSMNQRLLILKVKE  588

Query  239  VAKDTISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
            VA   IS VAP SG  APPG+YL+FV HRGVPS+G+WVHI
Sbjct  589  VANRHISVVAPPSGTLAPPGHYLLFVVHRGVPSQGMWVHI  628



>ref|XP_003516476.1| PREDICTED: uncharacterized protein LOC100797716 [Glycine max]
 gb|KHN13139.1| Galactose oxidase [Glycine soja]
Length=600

 Score =   105 bits (262),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 72/108 (67%), Gaps = 9/108 (8%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDM---SSIKVTMYPPPFTTHGYXEGQRMXILG  249
            PQIVE+ S+ +L+YGKNF   FK  D         IKV+MY PPFTTHGY   QR+  L 
Sbjct  493  PQIVEESSEKKLMYGKNFETQFKLQDTNQKLTKQDIKVSMYFPPFTTHGYSMNQRLLFLK  552

Query  248  LTSVAKDT-----ISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
             T +A+++     +++ AP+  + APPGYYL+F+ HRGVPSKG+WV I
Sbjct  553  -TFIAQNSEGTYKVTSKAPTFREVAPPGYYLLFIVHRGVPSKGMWVQI  599



>ref|XP_004513017.1| PREDICTED: uncharacterized protein LOC101505637 [Cicer arietinum]
Length=595

 Score =   104 bits (260),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 69/111 (62%), Gaps = 10/111 (9%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNF--NIHFKXD---DAXDMSSIKVTMYPPPFTTHGYXEGQRMXI  255
            PQIVE+ S   L YGKNF   I  + D   +    S IKVTMY PPFTTHG+   QR+ +
Sbjct  484  PQIVEETSAKRLKYGKNFVTKITMQQDGINEGLSKSDIKVTMYFPPFTTHGFSMSQRLLV  543

Query  254  LGLTSVAKDT-----ISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
            L +  +  D      I + AP  G+ AP GYY++FV HRGVPSKG+WVHIK
Sbjct  544  LKIKKILSDVKGSYDIKSEAPPFGEVAPSGYYILFVVHRGVPSKGMWVHIK  594



>ref|XP_003630749.1| Galactose oxidase [Medicago truncatula]
 gb|AET05225.1| glyoxal oxidase amino-terminal protein [Medicago truncatula]
Length=633

 Score =   104 bits (260),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 70/108 (65%), Gaps = 7/108 (6%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSS--IKVTMYPPPFTTHGYXEGQRMXILGL  246
            PQI +  ++ EL YG  F  +F  +D   +++  IKVTMY PPFTTHG+  GQR+ IL +
Sbjct  526  PQINQGATKKELKYGNTFETNFSVEDGAGLTANDIKVTMYAPPFTTHGFSMGQRLIILKI  585

Query  245  TS-VAKD----TISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
               VA++    T+   AP SG  APPGYYL+FV HRG+PS G WV I+
Sbjct  586  DELVAQEPGSYTVRMAAPPSGAIAPPGYYLLFVVHRGIPSTGTWVRIE  633



>ref|XP_010656292.1| PREDICTED: galactose oxidase [Vitis vinifera]
Length=623

 Score =   103 bits (258),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 67/107 (63%), Gaps = 6/107 (6%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDD-AXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLT  243
            P I++  SQ  L YG+ F +         + + IKVTMY PPFTTHG+   QR+ ILG+ 
Sbjct  517  PVILQDFSQATLRYGQKFLVKINLSGWDVETTDIKVTMYAPPFTTHGFSMNQRLLILGMN  576

Query  242  SVAKD-----TISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
            +V +       I A AP SG  APPGYYL++V HRGVPS G+WVHI+
Sbjct  577  NVNQSFLGFYNIVATAPPSGTIAPPGYYLLYVVHRGVPSTGMWVHIQ  623



>emb|CBI28031.3| unnamed protein product [Vitis vinifera]
Length=900

 Score =   104 bits (260),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 58/125 (46%), Positives = 74/125 (59%), Gaps = 8/125 (6%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNF--NIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGL  246
            P I++  SQ  L YG+ F   I+    D  + + IKVTMY PPFTTHG+   QR+ ILG+
Sbjct  517  PVILQDFSQATLRYGQKFLVKINLSGWDV-ETTDIKVTMYAPPFTTHGFSMNQRLLILGM  575

Query  245  TSVAKD-----TISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK*NRIEDTGSLVQ  81
             +V +       I A AP SG  APPGYYL++V HRGVPS G+WVHI   R    G+ + 
Sbjct  576  NNVNQSFLGFYNIVATAPPSGTIAPPGYYLLYVVHRGVPSTGMWVHIHREREVSLGAAMG  635

Query  80   C*QYL  66
              Q L
Sbjct  636  SFQVL  640



>ref|XP_010107380.1| hypothetical protein L484_003656 [Morus notabilis]
 gb|EXC15869.1| hypothetical protein L484_003656 [Morus notabilis]
Length=636

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 68/107 (64%), Gaps = 6/107 (6%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMS-SIKVTMYPPPFTTHGYXEGQRMXILGLT  243
            P++V++ + TEL YG  F I FK       +  IKVTMY PPFTTHGY   QRM IL   
Sbjct  530  PELVKESTATELSYGSMFEIVFKLKGLRVRNGDIKVTMYSPPFTTHGYSMNQRMLILEKD  589

Query  242  SVAKDT-----ISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
             V + +     + A AP SG  APPGYYL+FV HRGVPS+G+WV IK
Sbjct  590  MVVRTSRGMYRVVATAPPSGVVAPPGYYLLFVVHRGVPSEGIWVRIK  636



>gb|EYU32954.1| hypothetical protein MIMGU_mgv1a002908mg [Erythranthe guttata]
Length=626

 Score =   102 bits (255),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 52/102 (51%), Positives = 66/102 (65%), Gaps = 2/102 (2%)
 Frame = -3

Query  416  QIVEKLSQTELVYGKNFNIHFKXDDA-XDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTS  240
            +I E  S  +L YG  F++  +  +       +KVTMY PPFTTHGY   QR+ IL +  
Sbjct  525  EIAEGRSDKKLSYGGEFSVAIEFGNGLIKKEEVKVTMYSPPFTTHGYSMNQRLLILKVRE  584

Query  239  V-AKDTISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
            V     I+ VAP SGK APPGYYL+FV HRGVPS+G+WVHI+
Sbjct  585  VDILGRITVVAPPSGKFAPPGYYLVFVVHRGVPSRGMWVHIQ  626



>ref|XP_008362947.1| PREDICTED: galactose oxidase-like [Malus domestica]
Length=655

 Score =   102 bits (254),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 70/106 (66%), Gaps = 6/106 (6%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFK-XDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILG--  249
            P I++K S  +L YGK FN+ F+  D+   ++ IKVTMY PPFTTHG+   QR+ ILG  
Sbjct  549  PAIMDKNSDIKLKYGKPFNVQFQLQDNPVAIADIKVTMYAPPFTTHGFSMNQRLVILGKN  608

Query  248  -LTSVAKDT--ISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
             L +VA+    +   AP S   APPGYYL+FV +RGVPS G+WV I
Sbjct  609  DLKNVARGVYKLQVAAPRSSVFAPPGYYLLFVAYRGVPSVGIWVQI  654



>ref|XP_004503455.1| PREDICTED: uncharacterized protein LOC101501825 [Cicer arietinum]
Length=622

 Score =   102 bits (253),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 53/110 (48%), Positives = 66/110 (60%), Gaps = 7/110 (6%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSS--IKVTMYPPPFTTHGYXEGQRMXILGL  246
            PQI E  S  EL YG  F   F  ++   +++  IKVTMY PPFTTHG+  GQR+ IL  
Sbjct  513  PQISEDASDKELTYGNLFETQFSVEEGDRLTTNDIKVTMYSPPFTTHGFSMGQRLIILKN  572

Query  245  TSVAKDT-----ISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK*N  111
              + +       +  VAP SG  APPGYYL+ V HRG+PS G WVHI+ N
Sbjct  573  DELIEQAQGVYRVRLVAPPSGIIAPPGYYLLSVVHRGIPSTGTWVHIQQN  622



>ref|XP_009336933.1| PREDICTED: galactose oxidase-like [Pyrus x bretschneideri]
Length=654

 Score =   101 bits (252),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 54/106 (51%), Positives = 70/106 (66%), Gaps = 6/106 (6%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFK-XDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILG--  249
            P I++K S  +L YGK FN+ F+  D+   ++ IKVTMY PPFTTHG+   QR+ ILG  
Sbjct  548  PAIMDKNSDIKLKYGKPFNVQFQLQDNPAAIADIKVTMYAPPFTTHGFSMNQRLVILGKN  607

Query  248  -LTSVAKDT--ISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
             L +VA+    +   AP S   APPGYYL+FV +RGVPS G+WV I
Sbjct  608  DLKNVARGVYKLQVAAPRSSMFAPPGYYLLFVAYRGVPSVGIWVQI  653



>ref|XP_009352508.1| PREDICTED: galactose oxidase-like [Pyrus x bretschneideri]
Length=672

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 69/107 (64%), Gaps = 6/107 (6%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDA-XDMSSIKVTMYPPPFTTHGYXEGQRMXILG--  249
            P I+ + S  +L YG+ FN+ F+  D     + IK+TMY PPFTTHGY   QR+ ILG  
Sbjct  566  PAIMVQNSGIKLKYGQPFNVQFQLQDKPVTKADIKLTMYAPPFTTHGYSMNQRLLILGKN  625

Query  248  -LTSVAKDT--ISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
             L  VA D   + AVAP S   APPGYYL+FV +RGVPS G+WV I+
Sbjct  626  DLKDVAPDVYMLQAVAPPSSVFAPPGYYLVFVVYRGVPSVGMWVQIR  672



>ref|XP_007160315.1| hypothetical protein PHAVU_002G311300g [Phaseolus vulgaris]
 gb|ESW32309.1| hypothetical protein PHAVU_002G311300g [Phaseolus vulgaris]
Length=615

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 65/108 (60%), Gaps = 7/108 (6%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMS--SIKVTMYPPPFTTHGYXEGQRMXILGL  246
            PQI E  S+ EL YG  F   F  +    +S   I+V+MY PPFTTHG+  GQR+  L +
Sbjct  508  PQINEDASEKELTYGGFFETSFTVEGGVGLSQSDIQVSMYSPPFTTHGFSMGQRLLFLRI  567

Query  245  TSVAKDT-----ISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
                 +T     +   AP S   APPGYYL+FV HRG+PSKG+WVHI+
Sbjct  568  DEFITETEGFYRVRLEAPLSNAVAPPGYYLLFVVHRGLPSKGIWVHIQ  615



>ref|XP_007152887.1| hypothetical protein PHAVU_004G168600g [Phaseolus vulgaris]
 gb|ESW24881.1| hypothetical protein PHAVU_004G168600g [Phaseolus vulgaris]
Length=618

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 71/108 (66%), Gaps = 7/108 (6%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDD---AXDMSSIKVTMYPPPFTTHGYXEGQRMXILG  249
            P+IV+  S+  L YG NF + FK  D   A +  +IKVTMY PPFTTHG+   QR+ +L 
Sbjct  511  PEIVQVPSEKMLTYGNNFQMQFKMQDMNQALNNRNIKVTMYFPPFTTHGFSMNQRLLLLQ  570

Query  248  LTSVAK-DTISAV---APSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
            + ++   D +  V   AP   + APPGYY+IFV +RGVPS+G+WVH++
Sbjct  571  IINIQNADGVYKVMSKAPPFREVAPPGYYIIFVVYRGVPSQGMWVHLQ  618



>ref|XP_008367891.1| PREDICTED: galactose oxidase-like [Malus domestica]
Length=662

 Score = 99.0 bits (245),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 69/107 (64%), Gaps = 6/107 (6%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDA-XDMSSIKVTMYPPPFTTHGYXEGQRMXILG--  249
            P I+ + S  +L YG+ F + F+  D     + IK+TMY PPFTTHGY   QR+ ILG  
Sbjct  556  PAIMVQNSGIKLKYGQPFXVQFQLQDKPVTKADIKLTMYAPPFTTHGYSMNQRLLILGKN  615

Query  248  -LTSVAKDT--ISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
             L +VA D   + AVAP S   APPGYYL+FV +RGVPS G+WV I+
Sbjct  616  DLKNVAPDVYMLQAVAPPSSVLAPPGYYLVFVVYRGVPSVGMWVQIR  662



>gb|KHN16621.1| Galactose oxidase [Glycine soja]
Length=583

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/110 (45%), Positives = 67/110 (61%), Gaps = 9/110 (8%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMS--SIKVTMYPPPFTTHGYXEGQRMXILGL  246
            PQI E  S+ EL YG  F   F  +D  +++  +IKV+MY PPFTTHG+  GQR+  L +
Sbjct  474  PQIDEDASEKELAYGGLFEASFSVEDGAELTKNNIKVSMYSPPFTTHGFSMGQRLLFLKI  533

Query  245  TSV------AKDTISAVAPSSGKXAPPGYYLIFVXHRGVP-SKGLWVHIK  117
              +          +   AP S   APPGYYL+FV +RG+P +KG+WVHI+
Sbjct  534  DELNVQGQEGSYRVRVEAPPSNAIAPPGYYLLFVVYRGLPAAKGMWVHIQ  583



>ref|XP_006584818.1| PREDICTED: uncharacterized protein LOC100808336 [Glycine max]
Length=631

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/110 (45%), Positives = 67/110 (61%), Gaps = 9/110 (8%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMS--SIKVTMYPPPFTTHGYXEGQRMXILGL  246
            PQI E  S+ EL YG  F   F  +D  +++  +IKV+MY PPFTTHG+  GQR+  L +
Sbjct  522  PQIDEDASEKELAYGGLFEASFSVEDGAELTKNNIKVSMYSPPFTTHGFSMGQRLLFLKI  581

Query  245  TSV------AKDTISAVAPSSGKXAPPGYYLIFVXHRGVP-SKGLWVHIK  117
              +          +   AP S   APPGYYL+FV +RG+P +KG+WVHI+
Sbjct  582  DELNVQGQEGSYRVRVEAPPSNAIAPPGYYLLFVVYRGLPAAKGMWVHIQ  631



>ref|XP_006833409.1| hypothetical protein AMTR_s00109p00131490 [Amborella trichopoda]
 gb|ERM98687.1| hypothetical protein AMTR_s00109p00131490 [Amborella trichopoda]
Length=603

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 61/107 (57%), Gaps = 6/107 (6%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSS-IKVTMYPPPFTTHGYXEGQRMXILGLT  243
            P I+ +L    L YG  F I     D     + + VTMY PPFTTH Y + QRM +L + 
Sbjct  497  PNILTELMPKALAYGGGFKIQISLSDQIVADTDLSVTMYAPPFTTHSYSQNQRMLVLRMN  556

Query  242  SVAKDT-----ISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
             V +       IS VAP S   APPGYYL+FV H GVPS+G+WVHI 
Sbjct  557  DVEQVAPGTYQISVVAPPSAVVAPPGYYLLFVVHFGVPSEGVWVHIN  603



>ref|XP_007203106.1| hypothetical protein PRUPE_ppa023837mg [Prunus persica]
 gb|EMJ04305.1| hypothetical protein PRUPE_ppa023837mg [Prunus persica]
Length=736

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 48/106 (45%), Positives = 65/106 (61%), Gaps = 6/106 (6%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFK-XDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLT  243
            P ++ + S  +L YG+ F + F+  D+    + IKVTMY PPFTTHGY   QR+ +LG  
Sbjct  629  PAVIAQTSDAKLKYGQPFTLQFQLQDNPVGKADIKVTMYSPPFTTHGYSMNQRLLVLGKN  688

Query  242  SVAKD-----TISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
             + +       +  VAP++   APPGYYL+FV HRGVPS G WV I
Sbjct  689  ELTEAGPGVYKLQVVAPATNVLAPPGYYLVFVVHRGVPSVGHWVQI  734



>gb|KDO36610.1| hypothetical protein CISIN_1g043381mg, partial [Citrus sinensis]
Length=286

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 62/106 (58%), Gaps = 6/106 (6%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDD-AXDMSSIKVTMYPPPFTTHGYXEGQRMXILG--  249
            P IV K     + YG+NF I FK D+    ++ +KVTMY PPFTTHG   GQR+ +L   
Sbjct  180  PSIVSKFKGKMVKYGQNFVIQFKLDELEVSLNDLKVTMYAPPFTTHGVSMGQRLLVLATK  239

Query  248  -LTSVAKD--TISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
             L  V      +S  AP + K APP +YL+FV +R VPS G WV I
Sbjct  240  ELIDVGSGIFQVSVTAPPTAKIAPPSFYLLFVVYRQVPSPGTWVQI  285



>gb|KDO66474.1| hypothetical protein CISIN_1g042303mg [Citrus sinensis]
Length=519

 Score = 92.8 bits (229),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 61/107 (57%), Gaps = 6/107 (6%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTS  240
            P+IV   S   + YG+  +I  K  +    S I++TMY P FTTHG    QR+ ILGL  
Sbjct  413  PEIVLDKSDCMVGYGQRISIQVKTTEGIKQSDIRITMYAPAFTTHGTSMNQRLVILGLVE  472

Query  239  VAKDT------ISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
            V  D       I A AP SG   PPGYYL++V ++GVPS G+W  IK
Sbjct  473  VRNDVAPGQHKIVAEAPPSGVITPPGYYLLYVVYKGVPSPGMWFQIK  519



>ref|XP_003620657.1| Galactose oxidase [Medicago truncatula]
 gb|AES76875.1| glyoxal oxidase amino-terminal protein [Medicago truncatula]
Length=586

 Score = 92.8 bits (229),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 68/110 (62%), Gaps = 9/110 (8%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKX----DDAXDMSSIKVTMYPPPFTTHGYXEGQRMXIL  252
            P I E  S   L YG      FK     ++    + IK+TMY PPFTTHGY   QR+ ++
Sbjct  476  PIIDEVFSTKNLKYGHKLETIFKLPQDINNNVAKNDIKITMYFPPFTTHGYSMSQRLVVI  535

Query  251  GLTSVAKD-----TISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
               ++ K+     +I ++AP SG+ APPGYY+++V HRGVPSKG+WV+I+
Sbjct  536  KSRTMFKNVQGLFSIESLAPPSGEVAPPGYYILYVVHRGVPSKGMWVNIE  585



>ref|XP_006475694.1| PREDICTED: galactose oxidase-like [Citrus sinensis]
Length=589

 Score = 92.8 bits (229),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 61/107 (57%), Gaps = 6/107 (6%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTS  240
            P+IV   S   + YG+  +I  K  +    S I++TMY P FTTHG    QR+ ILGL  
Sbjct  483  PEIVLDKSDCMVGYGQRISIQVKTTEGIKQSDIRITMYAPAFTTHGTSMNQRLVILGLVE  542

Query  239  VAKDT------ISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
            V  D       I A AP SG   PPGYYL++V ++GVPS G+W  IK
Sbjct  543  VINDVAPGQHKIVAEAPPSGVITPPGYYLLYVVYKGVPSPGMWFQIK  589



>ref|XP_004288880.2| PREDICTED: uncharacterized protein LOC101300395 [Fragaria vesca 
subsp. vesca]
Length=632

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 66/112 (59%), Gaps = 15/112 (13%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXD--MSSIKVTMYPPPFTTHGYXEGQRMXILGL  246
            P I    +  +L YG +FNI FK ++A     +  KV MY  PFTTHGY   QR+    L
Sbjct  524  PAIDAGATAKKLTYGADFNIQFKVNEADKPGKNDFKVHMYAVPFTTHGYSMNQRL----L  579

Query  245  TSVAKD---------TISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
            +   KD         +I+A+AP SG  APPG+YL+FV HRGVPS+G+WV + 
Sbjct  580  SLAKKDFKAVGGGVYSITALAPPSGNVAPPGFYLVFVVHRGVPSQGVWVQMN  631



>ref|XP_008242563.1| PREDICTED: uncharacterized protein LOC103340881 [Prunus mume]
Length=699

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 47/106 (44%), Positives = 65/106 (61%), Gaps = 6/106 (6%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFK-XDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLT  243
            P ++ + S  +L YG+ F + F+  D+    + IKVTMY PPFTTHGY   QR+ +LG  
Sbjct  592  PTVMAQNSDAKLKYGQPFTLQFQLQDNPVGKADIKVTMYSPPFTTHGYSMNQRLLVLGKN  651

Query  242  SVAKD-----TISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
             + +       +  VAP++   APPGYYL+FV +RGVPS G WV I
Sbjct  652  ELTEAGPGVYKLQVVAPATNVLAPPGYYLVFVVYRGVPSVGHWVQI  697



>ref|XP_006451231.1| hypothetical protein CICLE_v10010756mg, partial [Citrus clementina]
 gb|ESR64471.1| hypothetical protein CICLE_v10010756mg, partial [Citrus clementina]
Length=600

 Score = 90.9 bits (224),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 60/106 (57%), Gaps = 6/106 (6%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTS  240
            P+IV   S   + YG+  +I  K  +    S I++TMY P FTTHG    QR+ ILGL  
Sbjct  495  PEIVLDKSDCMVGYGQRISIQVKTTEGIKQSDIRITMYAPAFTTHGTSMNQRLVILGLVE  554

Query  239  VAKDT------ISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
            V  D       I A AP SG   PPGYYL++V ++GVPS G+W  I
Sbjct  555  VINDVAPGQHKIVAEAPPSGVITPPGYYLLYVVYKGVPSPGMWFQI  600



>ref|XP_009381768.1| PREDICTED: uncharacterized protein LOC103969853 [Musa acuminata 
subsp. malaccensis]
Length=570

 Score = 90.1 bits (222),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 44/106 (42%), Positives = 67/106 (63%), Gaps = 6/106 (6%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDD-AXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLT  243
            P+IV++L+ + + YG +F + F   D   +   +KVTMY PPFTTHG+   QR+ IL   
Sbjct  464  PRIVKELAPSSVTYGTSFQVVFDVADLGLESGDLKVTMYAPPFTTHGFSMNQRLLILSTV  523

Query  242  SVA-----KDTISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
             ++     + T++  AP SG  APPGYYL++V +R VP +G+WV +
Sbjct  524  ELSPAGLGRWTVAVTAPPSGVVAPPGYYLLYVVNRAVPGEGVWVQL  569



>ref|XP_002281387.1| PREDICTED: uncharacterized protein LOC100256065 [Vitis vinifera]
Length=584

 Score = 90.1 bits (222),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 61/107 (57%), Gaps = 7/107 (7%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDD--AXDMSSIKVTMYPPPFTTHGYXEGQRMXILGL  246
            P+I     +  + YGK   + FK        +S +KVTMY PPFTTHG+   QR+ IL  
Sbjct  477  PKIETNFKRKMVKYGKGLTVVFKLKTILRVKLSDLKVTMYAPPFTTHGFSMNQRLLILAK  536

Query  245  -----TSVAKDTISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
                 T   +  +S VAP S K APPGYYLIFV H+G+PS G+W  I
Sbjct  537  RQLINTGGGRFRVSVVAPPSAKVAPPGYYLIFVVHQGLPSPGVWTKI  583



>emb|CDX96101.1| BnaA07g26300D [Brassica napus]
Length=608

 Score = 90.1 bits (222),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 48/107 (45%), Positives = 62/107 (58%), Gaps = 8/107 (7%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNI--HFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGL  246
            P IV   +  ++ YG+ FNI  H    D     +IKVTM  PPFTTH      R+ ILG+
Sbjct  487  PSIVTTATPKQIRYGERFNIRIHLNQKDVTK-ENIKVTMSAPPFTTHAVSMNMRLLILGI  545

Query  245  TSVAKDT-----ISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
              + ++      I A+AP SGK APPGYYL+FV + GVPS G W+ I
Sbjct  546  FDIKREVRDLHQIHAIAPPSGKVAPPGYYLLFVVYNGVPSVGEWIQI  592



>emb|CDY01797.1| BnaC06g28370D [Brassica napus]
Length=593

 Score = 90.1 bits (222),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 62/107 (58%), Gaps = 8/107 (7%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNI--HFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGL  246
            P IV   +  ++ YG+ FNI  H    D     ++KVTM  PPFTTH      R+ ILG+
Sbjct  487  PTIVNTATPKQIRYGERFNIRIHLNQKDVTK-ENVKVTMLAPPFTTHAVSMNMRLLILGI  545

Query  245  TSVAKDT-----ISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
              + K+      I A+AP SGK APPGYYL+FV + GVPS G W+ I
Sbjct  546  FDIKKEVRDLHQIHAIAPPSGKVAPPGYYLLFVVYNGVPSVGEWIQI  592



>gb|KDO54103.1| hypothetical protein CISIN_1g039705mg [Citrus sinensis]
Length=539

 Score = 89.7 bits (221),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 62/106 (58%), Gaps = 6/106 (6%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDD-AXDMSSIKVTMYPPPFTTHGYXEGQRMXILG--  249
            P IV K     L YG+NF I FK D+    ++ +KVTMY PPFTTHG   GQR+ +    
Sbjct  433  PSIVSKFKGKMLKYGQNFVIQFKLDELEVSLNDLKVTMYAPPFTTHGVSMGQRLLVPATK  492

Query  248  -LTSVAKD--TISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
             L  V      +S +AP + K APP +YL+FV +R VPS G WV I
Sbjct  493  ELIDVGSGIFQVSVMAPPTAKIAPPSFYLLFVVYRQVPSPGTWVQI  538



>ref|XP_006420316.1| hypothetical protein CICLE_v10006853mg [Citrus clementina]
 gb|ESR33556.1| hypothetical protein CICLE_v10006853mg [Citrus clementina]
Length=593

 Score = 90.1 bits (222),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 50/106 (47%), Positives = 63/106 (59%), Gaps = 6/106 (6%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSS-IKVTMYPPPFTTHGYXEGQRMXILG--  249
            P IV K     + YG+NF I FK D+    S+ +KVTMY PPFTTHG   GQR+ +L   
Sbjct  487  PSIVSKFKGKMVKYGQNFVIQFKLDELEVSSNDLKVTMYAPPFTTHGVSMGQRLLVLATK  546

Query  248  -LTSVAKD--TISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
             L  V      +S +AP + K APP +YL+FV +R VPS G WV I
Sbjct  547  ELIDVGSGIFQVSVMAPPTAKIAPPSFYLLFVVYRQVPSPGTWVQI  592



>ref|XP_010254463.1| PREDICTED: galactose oxidase [Nelumbo nucifera]
Length=607

 Score = 90.1 bits (222),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 47/107 (44%), Positives = 61/107 (57%), Gaps = 6/107 (6%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAX-DMSSIKVTMYPPPFTTHGYXEGQRMXILGLT  243
            P IV++ +   + YG+ F           D + +KVTMY PPFTTHGY   QR+ +L + 
Sbjct  500  PTIVQESTPQAIKYGEEFTTMINLLAVKLDKTDLKVTMYAPPFTTHGYSMNQRLLVLAIR  559

Query  242  SVAKDTIS-----AVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
             V    I      A+AP +   APPGYYL+FV HRGVPS G+WV I 
Sbjct  560  EVVMAEIKTFRIKALAPPTSAVAPPGYYLLFVVHRGVPSHGVWVRIN  606



>ref|XP_008220102.1| PREDICTED: uncharacterized protein LOC103320236 [Prunus mume]
Length=575

 Score = 89.4 bits (220),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 60/106 (57%), Gaps = 6/106 (6%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDD-AXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLT  243
            P IV       + Y  NF I FK      +   +KVTMY PPFTTHG+  GQR+ +LG+ 
Sbjct  469  PTIVSDYKGILVKYQSNFVIEFKLKKYKVNQLDLKVTMYAPPFTTHGFSMGQRLLVLGIK  528

Query  242  SVAKD-----TISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
             +         +  VAP + K APPG+YL+FV H G+PS G+W+ I
Sbjct  529  GLENVGLGLFQVEVVAPPTAKIAPPGFYLVFVVHNGIPSSGIWLQI  574



>ref|XP_009105271.1| PREDICTED: galactose oxidase [Brassica rapa]
Length=593

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 62/107 (58%), Gaps = 8/107 (7%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNI--HFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGL  246
            P IV   +  ++ YG+ FNI  H    D     +IKVTM  PPFTTH      R+ ILG+
Sbjct  487  PSIVTTATPKQIRYGERFNIRIHLNQKDVTK-ENIKVTMSAPPFTTHAVSMNMRLLILGI  545

Query  245  TSVAKDT-----ISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
              + ++      I A+AP SGK APPGYYL+FV + GVPS G W+ I
Sbjct  546  FDIKREVRDLHQIHAIAPPSGKVAPPGYYLLFVVYNGVPSVGEWIQI  592



>ref|XP_006342231.1| PREDICTED: galactose oxidase-like [Solanum tuberosum]
Length=556

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 45/105 (43%), Positives = 62/105 (59%), Gaps = 5/105 (5%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILG---  249
            PQI+  +S+ +  YG+  NI F      + +SIKVTM  P F TH     QRM +L    
Sbjct  451  PQIISPVSRHKFNYGQRVNIQFSISGLLNKNSIKVTMVAPGFNTHSNTMNQRMLVLSNGV  510

Query  248  LTSVAKDT--ISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
            +  V K +  +S + P SG  APPGYYL+FV H+ +PS+G+WV I
Sbjct  511  VKQVGKSSYQMSCLFPKSGSLAPPGYYLLFVVHQDIPSEGIWVRI  555



>ref|XP_006451228.1| hypothetical protein CICLE_v10010177mg [Citrus clementina]
 gb|ESR64468.1| hypothetical protein CICLE_v10010177mg [Citrus clementina]
Length=596

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 65/112 (58%), Gaps = 11/112 (10%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDD--AXDMSSIKVTMYPPPFTTHGYXEGQRMXILGL  246
            P IV   S   + YG+ F++  K ++    +   +K+TMY P FTTHG    QR+ IL L
Sbjct  485  PSIVVDSSDKVIHYGQRFSVKVKSNELTVKNRDDLKLTMYAPAFTTHGISMNQRLLILSL  544

Query  245  TSVAKDT---------ISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
              V K+          I A+APSSG  APPGYYL++V ++GVPS  +WV IK
Sbjct  545  VKVIKNVGPATEGLHDIIALAPSSGAVAPPGYYLLYVVYKGVPSVAMWVQIK  596



>gb|KDO66471.1| hypothetical protein CISIN_1g035640mg [Citrus sinensis]
Length=596

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 65/112 (58%), Gaps = 11/112 (10%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDD--AXDMSSIKVTMYPPPFTTHGYXEGQRMXILGL  246
            P IV   S   + YG+ F++  K ++    +   +K+TMY P FTTHG    QR+ IL L
Sbjct  485  PSIVVDSSDKVIHYGQRFSVKVKSNELTVKNRDDLKLTMYAPAFTTHGISMNQRLLILSL  544

Query  245  TSVAKDT---------ISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
              V K+          I A+APSSG  APPGYYL++V ++GVPS  +WV IK
Sbjct  545  VKVIKNVGPATEGLHDIIALAPSSGAVAPPGYYLLYVVYKGVPSVAMWVQIK  596



>ref|XP_006475693.1| PREDICTED: galactose oxidase-like [Citrus sinensis]
Length=596

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 65/112 (58%), Gaps = 11/112 (10%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDD--AXDMSSIKVTMYPPPFTTHGYXEGQRMXILGL  246
            P IV   S   + YG+ F++  K ++    +   +K+TMY P FTTHG    QR+ IL L
Sbjct  485  PSIVVDSSDKVIHYGQRFSVKVKSNELTVKNRDDLKLTMYAPAFTTHGISMNQRLLILSL  544

Query  245  TSVAKDT---------ISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
              V K+          I A+APSSG  APPGYYL++V ++GVPS  +WV IK
Sbjct  545  VKVIKNVGPATEGLHDIIALAPSSGAVAPPGYYLLYVVYKGVPSVAMWVQIK  596



>ref|XP_007226541.1| hypothetical protein PRUPE_ppa024999mg [Prunus persica]
 gb|EMJ27740.1| hypothetical protein PRUPE_ppa024999mg [Prunus persica]
Length=575

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 59/106 (56%), Gaps = 6/106 (6%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDD-AXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLT  243
            P IV       + Y  NF I FK      +   +KVTMY PPFTTHG+  GQR+ +LG+ 
Sbjct  469  PTIVSDYKGIMVKYQSNFVIEFKLKKYKVNHLDLKVTMYAPPFTTHGFSMGQRLLVLGIK  528

Query  242  SVAKD-----TISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
             +         I  VAP   K APPG+YL+FV H G+PS G+W+ I
Sbjct  529  GLENVGLGLFQIEVVAPPMAKIAPPGFYLVFVVHNGIPSSGIWLQI  574



>ref|XP_010051583.1| PREDICTED: galactose oxidase-like [Eucalyptus grandis]
 gb|KCW82397.1| hypothetical protein EUGRSUZ_C03801 [Eucalyptus grandis]
Length=621

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 47/108 (44%), Positives = 64/108 (59%), Gaps = 7/108 (6%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIK---VTMYPPPFTTHGYXEGQRMXILG  249
            P+IV +L+  ++ Y ++F + F+ +      S K   VTMY PPFTTHGY   QR+  L 
Sbjct  514  PEIVAELTDKKMRYNRSFYVKFRVNSNGRKVSKKDVMVTMYAPPFTTHGYSMNQRLLQLP  573

Query  248  LTSVAKDT----ISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
             T + K+     +   AP SG  APPG YL+FV HRGVPS G+W  I+
Sbjct  574  NTVLRKEGDVYHLDTKAPPSGTIAPPGDYLVFVVHRGVPSVGMWARIQ  621



>ref|XP_009367501.1| PREDICTED: uncharacterized protein LOC103957133 [Pyrus x bretschneideri]
Length=370

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 60/106 (57%), Gaps = 6/106 (6%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAX-DMSSIKVTMYPPPFTTHGYXEGQRMXILG--  249
            P I    +   + Y     + FK   A  D S +KVTMY PPFTTHG+  GQR+ +L   
Sbjct  264  PAITSNYNGKMVNYRGYIALEFKLKKAEVDQSDLKVTMYSPPFTTHGFSMGQRLLVLATK  323

Query  248  -LTSVAKD--TISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
             L +V  +   +   AP S + APPG+YLIFV H GVPS G+WV I
Sbjct  324  KLENVESEFFRVEVAAPPSAEIAPPGFYLIFVVHNGVPSSGIWVQI  369



>ref|XP_009600286.1| PREDICTED: galactose oxidase-like [Nicotiana tomentosiformis]
Length=554

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 45/106 (42%), Positives = 62/106 (58%), Gaps = 5/106 (5%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXIL---G  249
            PQI+   SQ ++ YG   NI F    +     +KVTM  P F TH +   QRM +L    
Sbjct  449  PQIISPASQRKVKYGGRVNIRFTVPGSVKRDLVKVTMVSPGFNTHSFTMNQRMLVLFSGN  508

Query  248  LTSVAKDT--ISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
            +T V K    I++V P+S   AP GYYL+FV H+G+PS+G+WV I+
Sbjct  509  VTRVGKSAYKINSVFPNSSNLAPAGYYLLFVVHQGIPSEGIWVRIR  554



>ref|XP_010061025.1| PREDICTED: galactose oxidase-like [Eucalyptus grandis]
Length=565

 Score = 87.8 bits (216),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 42/106 (40%), Positives = 63/106 (59%), Gaps = 5/106 (5%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTS  240
            P+I+   SQ ++ Y + F++ F       + ++ VTM  PPF TH +   QR+ ++G  +
Sbjct  460  PRIIYPTSQAKIGYSQKFSVRFTVTGNVSLDAVAVTMVAPPFNTHSFSMNQRLLVIGSGT  519

Query  239  VAKDTISA-----VAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
            V K   SA     VAP S   AP GYYL+FV H+G+PS+G+WV I+
Sbjct  520  VVKVGNSAYAAQAVAPGSHNLAPAGYYLLFVVHQGIPSEGIWVQIQ  565



>ref|XP_009607831.1| PREDICTED: galactose oxidase-like [Nicotiana tomentosiformis]
Length=558

 Score = 87.4 bits (215),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 44/105 (42%), Positives = 58/105 (55%), Gaps = 5/105 (5%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILG---  249
            PQI+   S+ +  YG+  NI F      +   IKVTM  P F TH +   QRM +L    
Sbjct  453  PQIISSTSRHKFKYGQGVNIQFTVSGLVNRDLIKVTMVAPGFNTHSFTMNQRMLVLSSGD  512

Query  248  --LTSVAKDTISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
              L       +S V P SGK APPGYY++FV H+ +PS+G+WV I
Sbjct  513  VRLIGKFVYQVSLVFPKSGKLAPPGYYMLFVVHQDIPSEGIWVRI  557



>gb|KHN45905.1| Galactose oxidase [Glycine soja]
Length=530

 Score = 87.0 bits (214),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 44/105 (42%), Positives = 60/105 (57%), Gaps = 5/105 (5%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILG---  249
            P IV   SQT+L YG+   + FK        S+ VTM  PPF TH +   QR+ +L    
Sbjct  425  PAIVSPASQTKLKYGQTLRLRFKVSATLVGDSVSVTMLAPPFNTHSFSMNQRLLVLKPHH  484

Query  248  LTSVAKDT--ISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
            L+ V + T  +   AP+S   APPG+YL+FV H+ VPS G+WV +
Sbjct  485  LSGVGESTHEVEVTAPASAVLAPPGFYLLFVVHQEVPSHGIWVQM  529



>ref|XP_003523554.1| PREDICTED: galactose oxidase-like [Glycine max]
Length=530

 Score = 87.0 bits (214),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 44/105 (42%), Positives = 60/105 (57%), Gaps = 5/105 (5%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILG---  249
            P IV   SQT+L YG+   + FK        S+ VTM  PPF TH +   QR+ +L    
Sbjct  425  PAIVSPASQTKLKYGQTLRLRFKVSATLVGDSVSVTMLAPPFNTHSFSMNQRLLVLKPHH  484

Query  248  LTSVAKDT--ISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
            L+ V + T  +   AP+S   APPG+YL+FV H+ VPS G+WV +
Sbjct  485  LSGVGESTHEVEVTAPASAVLAPPGFYLLFVVHQEVPSHGIWVQM  529



>emb|CDY12635.1| BnaA02g13030D [Brassica napus]
Length=160

 Score = 83.2 bits (204),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 61/106 (58%), Gaps = 6/106 (6%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAX-DMSSIKVTMYPPPFTTHGYXEGQRMXILGLT  243
            P+IV   +  ++ +G+ FN+  +   A     ++ VTM  PPFTTH      R+ +LG++
Sbjct  54   PKIVNTDTPKQIKFGQTFNVKIELKQANVAKENVMVTMLAPPFTTHAVSMNMRLLLLGIS  113

Query  242  SVAKD-----TISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
             V K+      I AVAP SG  APPGYYL++  + GVPS G W+ I
Sbjct  114  DVKKEHGDVHQIQAVAPPSGNVAPPGYYLLYAVYNGVPSVGEWIQI  159



>ref|XP_009797024.1| PREDICTED: galactose oxidase-like [Nicotiana sylvestris]
Length=558

 Score = 87.0 bits (214),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 44/105 (42%), Positives = 58/105 (55%), Gaps = 5/105 (5%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILG---  249
            PQI+   S+ +  YG+  NI F      +   IKVTM  P F TH +   QRM +L    
Sbjct  453  PQIISPTSRHKFKYGQRVNIQFTVSGLLNRDLIKVTMVAPGFNTHSFTMNQRMLVLSSGD  512

Query  248  --LTSVAKDTISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
              L       +S V P SGK APPGYY++FV H+ +PS+G+WV I
Sbjct  513  VRLIGKFVYQVSLVFPKSGKLAPPGYYMLFVVHQDIPSEGIWVRI  557



>ref|XP_008367692.1| PREDICTED: uncharacterized protein LOC103431321, partial [Malus 
domestica]
Length=394

 Score = 85.5 bits (210),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 55/87 (63%), Gaps = 6/87 (7%)
 Frame = -3

Query  362  IHFKXDDAX-DMSSIKVTMYPPPFTTHGYXEGQRMXILG---LTSVAKD--TISAVAPSS  201
            + FK   A  D S +KVTMY PPFTTHG+  GQR+ IL    L +V  +   +  VAP S
Sbjct  307  VEFKLKKAEVDQSDLKVTMYSPPFTTHGFSMGQRLLILAIKKLXNVESEFFRVEVVAPPS  366

Query  200  GKXAPPGYYLIFVXHRGVPSKGLWVHI  120
             + APPG+YLIFV H  VPS G+WV I
Sbjct  367  AEIAPPGFYLIFVVHBXVPSSGIWVQI  393



>ref|XP_006381726.1| hypothetical protein POPTR_0006s16390g [Populus trichocarpa]
 gb|ERP59523.1| hypothetical protein POPTR_0006s16390g [Populus trichocarpa]
Length=609

 Score = 86.7 bits (213),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 61/109 (56%), Gaps = 8/109 (7%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAX-DMSSIKVTMYPPPFTTHGYXEGQRMXILGLT  243
            P IV   +  ++ Y + F +  K      +   IKVTMY P FTTHG    QR+  LGL 
Sbjct  501  PVIVTDKAPEKISYDETFQLQIKSTAVKVEKKDIKVTMYAPAFTTHGVSMNQRLLDLGLE  560

Query  242  SVAKD-------TISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
             V  +       TI+ V+P SGK APPGYY++FV H+GVPS   WV IK
Sbjct  561  DVIAENAFLGIHTITVVSPPSGKVAPPGYYMLFVVHQGVPSVSTWVQIK  609



>ref|XP_009367892.1| PREDICTED: uncharacterized protein LOC103957460 [Pyrus x bretschneideri]
Length=583

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 55/87 (63%), Gaps = 6/87 (7%)
 Frame = -3

Query  362  IHFKXDDAX-DMSSIKVTMYPPPFTTHGYXEGQRMXILG---LTSVAKD--TISAVAPSS  201
            + FK   A  D S +KVTMY PPFTTHG+  GQR+ +L    L +V  +   +   AP S
Sbjct  496  VEFKLKKAEVDQSDLKVTMYSPPFTTHGFSMGQRLLVLAIKKLENVESEFFRVEVAAPPS  555

Query  200  GKXAPPGYYLIFVXHRGVPSKGLWVHI  120
             + APPG+YLIFV H GVPS G+WV I
Sbjct  556  AEIAPPGFYLIFVVHNGVPSSGIWVQI  582



>ref|XP_008460895.1| PREDICTED: galactose oxidase [Cucumis melo]
Length=613

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 65/109 (60%), Gaps = 8/109 (7%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKX--DDAXDMSS-IKVTMYPPPFTTHGYXEGQRMXILG  249
            P I     + +  YG++F ++F    D   D  + I+V +YPPPFTTHGY   QR+ +L 
Sbjct  505  PAIQVNQLEAKWQYGQDFVVNFNLIIDGVLDRENDIRVNIYPPPFTTHGYSMNQRLVVLP  564

Query  248  LTSVAKD-----TISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
            +  +A+      + + VAP SG  APPGYY++FV +RG+PS   W+ IK
Sbjct  565  IREIAETGAGIFSATVVAPPSGIIAPPGYYMLFVVYRGIPSVAAWIQIK  613



>ref|XP_011009462.1| PREDICTED: galactose oxidase-like [Populus euphratica]
Length=609

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 61/109 (56%), Gaps = 8/109 (7%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAX-DMSSIKVTMYPPPFTTHGYXEGQRMXILGLT  243
            P IV   +  ++ Y + F +  K      +   I VTMY P FTTHG    QR+  LGL 
Sbjct  501  PVIVTDKAPEQISYDETFQLQIKSTAVKVEKKDIIVTMYAPAFTTHGVSMNQRLLDLGLE  560

Query  242  SVAKD-------TISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
             V  +       TI+AV+P SGK APPGYY++FV H+GVPS   WV IK
Sbjct  561  DVIAENAFLGIHTITAVSPPSGKVAPPGYYMLFVVHQGVPSVSTWVQIK  609



>ref|XP_004139435.1| PREDICTED: galactose oxidase-like [Cucumis sativus]
 ref|XP_004166928.1| PREDICTED: galactose oxidase-like [Cucumis sativus]
 gb|KGN60602.1| hypothetical protein Csa_2G003050 [Cucumis sativus]
Length=614

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 62/96 (65%), Gaps = 8/96 (8%)
 Frame = -3

Query  380  YGKNFNIHFKX--DDAXDMSS-IKVTMYPPPFTTHGYXEGQRMXILGLTSVAKD-----T  225
            YGK+F ++F    D   D  + ++VT+YPPPFTTHG+   QR+ +L +  +A+      +
Sbjct  519  YGKDFVVNFNLVPDGIFDRENDVRVTIYPPPFTTHGFSMNQRLVVLPIREIAETGAGIFS  578

Query  224  ISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
             + VAP SG  APPGYY++FV +RG+PS   W+ IK
Sbjct  579  ATVVAPPSGIIAPPGYYMLFVVYRGIPSVAAWIQIK  614



>ref|XP_009367481.1| PREDICTED: uncharacterized protein LOC103957109 [Pyrus x bretschneideri]
Length=583

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 54/87 (62%), Gaps = 6/87 (7%)
 Frame = -3

Query  362  IHFKXDDAX-DMSSIKVTMYPPPFTTHGYXEGQRMXILGLTSVAKDT-----ISAVAPSS  201
            + F+   A  D S++KVTMY PPFTTHG+  GQR+ +L +  +         +   AP S
Sbjct  496  VEFRLKKAEVDQSNLKVTMYSPPFTTHGFSMGQRLLVLAIKKLENVEPEFFRVEVAAPPS  555

Query  200  GKXAPPGYYLIFVXHRGVPSKGLWVHI  120
             + APPG+YLIFV H GVPS G+WV I
Sbjct  556  AEIAPPGFYLIFVVHNGVPSSGIWVQI  582



>ref|XP_009791893.1| PREDICTED: galactose oxidase-like [Nicotiana sylvestris]
Length=545

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 42/106 (40%), Positives = 61/106 (58%), Gaps = 5/106 (5%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTS  240
            PQI+   S+ +  YGK+ NI F      +   +KVTM  P F TH     QRM +L    
Sbjct  440  PQIISPASRHKTKYGKSVNIRFTVSGLLNTDLVKVTMVAPGFNTHSNTMNQRMLVLSSGK  499

Query  239  V-----AKDTISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
            V     +   I+ + P+SGK APPGYY++FV H+ +PS+G+W+ I+
Sbjct  500  VRRIGKSSYQINLIFPNSGKLAPPGYYMLFVVHQEIPSEGIWIKIQ  545



>ref|XP_007136064.1| hypothetical protein PHAVU_009G014800g [Phaseolus vulgaris]
 gb|ESW08058.1| hypothetical protein PHAVU_009G014800g [Phaseolus vulgaris]
Length=568

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 43/109 (39%), Positives = 63/109 (58%), Gaps = 5/109 (5%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXIL---G  249
            P IV   SQT++ YG+   + F+   + +  S+ VTM  PPF TH +   QR+ +L    
Sbjct  443  PTIVSPSSQTKVKYGETLKVGFEVIASLNNDSVSVTMLAPPFATHSFSMNQRLLVLEPQN  502

Query  248  LTSVAKDT--ISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK*NR  108
            L+ V + T  +   AP S   APPG+YL+FV HR +PS G+WV +  +R
Sbjct  503  LSKVGESTYEVEVTAPGSSVLAPPGFYLLFVVHREIPSHGIWVRMGKSR  551



>ref|XP_006580892.1| PREDICTED: uncharacterized protein LOC102660794 [Glycine max]
Length=235

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/108 (43%), Positives = 60/108 (56%), Gaps = 18/108 (17%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTS  240
            PQI E  S+ EL YG  F            +S  V+MY PPFTTHG+  GQR+  L +  
Sbjct  139  PQINEDASEKELTYGGFFE-----------TSFSVSMYSPPFTTHGFSMGQRLLFLKIDE  187

Query  239  VAKDT------ISAVAPSSGKXAPPGYYLIFVXHRGVP-SKGLWVHIK  117
            +  +       +   AP S   APPGYYL+FV  RG+P +KG+WVHI+
Sbjct  188  LIVEAQEGFYRVRVEAPPSNAIAPPGYYLLFVVPRGLPAAKGIWVHIQ  235



>emb|CBI19807.3| unnamed protein product [Vitis vinifera]
Length=486

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 59/106 (56%), Gaps = 5/106 (5%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTS  240
            P I+   SQ ++ YGK+  + F      D  ++ VTM  P FTTH     QR+ +LG  +
Sbjct  381  PTIISPTSQAKIGYGKDLTVRFSVTGTLDPDTVSVTMLAPSFTTHSLSMNQRLLVLGSGN  440

Query  239  VAKD-----TISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
            V         I+   P+S   AP GYY++FV H+G+PS+G+WV I+
Sbjct  441  VKNAEKSTFAIAVTTPASAILAPSGYYVLFVVHQGIPSEGIWVQIQ  486



>ref|XP_011069750.1| PREDICTED: galactose oxidase-like [Sesamum indicum]
Length=562

 Score = 85.1 bits (209),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 43/111 (39%), Positives = 63/111 (57%), Gaps = 10/111 (9%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTS  240
            P IV   S +++ YG+   I+FK     +   I VTM  PPFTTH +   QR+ +L  ++
Sbjct  452  PMIVSPASHSQIGYGQQLVINFKAQGRINRGFITVTMVAPPFTTHSFSMNQRLLVLTNST  511

Query  239  VAKDTISAVA----------PSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
                +++++           PSS   APPGYYL+FV +R VPS+G+WV IK
Sbjct  512  GISASVTSLGGSNYQVRVRTPSSNILAPPGYYLLFVVYREVPSQGIWVQIK  562



>gb|KHN09108.1| Galactose oxidase [Glycine soja]
Length=228

 Score = 82.0 bits (201),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 43/106 (41%), Positives = 62/106 (58%), Gaps = 6/106 (6%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDM-SSIKVTMYPPPFTTHGYXEGQRMXIL---  252
            P IV   SQT+L YG+   + F+   A  +  S+ VTM  PPF TH +   QRM +L   
Sbjct  122  PTIVFPASQTKLKYGQTLRLRFEVMSATLVGDSVSVTMLSPPFNTHSFSMNQRMLVLEPH  181

Query  251  GLTSVAKDT--ISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
             L+ V + T  +   AP S   APPG+YL+F+ H+ +PS+G+WV +
Sbjct  182  DLSKVGESTYEVEVTAPVSAVLAPPGFYLLFLVHQEIPSQGIWVQM  227



>ref|XP_002280559.1| PREDICTED: galactose oxidase [Vitis vinifera]
Length=553

 Score = 84.7 bits (208),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 59/106 (56%), Gaps = 5/106 (5%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTS  240
            P I+   SQ ++ YGK+  + F      D  ++ VTM  P FTTH     QR+ +LG  +
Sbjct  448  PTIISPTSQAKIGYGKDLTVRFSVTGTLDPDTVSVTMLAPSFTTHSLSMNQRLLVLGSGN  507

Query  239  VAKD-----TISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
            V         I+   P+S   AP GYY++FV H+G+PS+G+WV I+
Sbjct  508  VKNAEKSTFAIAVTTPASAILAPSGYYVLFVVHQGIPSEGIWVQIQ  553



>ref|XP_002518913.1| Galactose oxidase precursor, putative [Ricinus communis]
 gb|EEF43446.1| Galactose oxidase precursor, putative [Ricinus communis]
Length=546

 Score = 84.7 bits (208),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/98 (41%), Positives = 57/98 (58%), Gaps = 7/98 (7%)
 Frame = -3

Query  389  ELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGL-------TSVAK  231
             L Y + F++ F+  +  D  +I +TM  P FTTH +   QR+ +LGL        +  K
Sbjct  449  NLDYKQKFSMEFQLKNQEDPRNICITMVAPSFTTHSFAMNQRLLVLGLDNNGTKKVASGK  508

Query  230  DTISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
              ++  AP +   APPGYY +FV H GVPS+G+WVHIK
Sbjct  509  YVVNVNAPGTAALAPPGYYQLFVVHEGVPSRGIWVHIK  546



>gb|AET97563.1| galactose oxidase [Ziziphus jujuba]
Length=545

 Score = 84.7 bits (208),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 44/105 (42%), Positives = 57/105 (54%), Gaps = 5/105 (5%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTS  240
            P+IV   SQT+L Y +   + F          + VTM  P FTTH +   QR+ +LG  S
Sbjct  440  PRIVSPTSQTKLAYAQKLAVRFTVTGTVATKLVSVTMVSPSFTTHSFSMNQRLLVLGAES  499

Query  239  V---AKDT--ISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
            V    K T  +    PSSG  AP GYYL+FV H+ +PS G+WV I
Sbjct  500  VRNLGKTTYEVQVTTPSSGNLAPSGYYLLFVVHQEIPSLGIWVQI  544



>ref|XP_006342711.1| PREDICTED: galactose oxidase-like [Solanum tuberosum]
Length=568

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 41/106 (39%), Positives = 60/106 (57%), Gaps = 5/106 (5%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXIL----  252
            PQI+   SQ  + YG+   I FK     D++ + +TM  P F TH +   QR+ +L    
Sbjct  463  PQIISPASQYAIEYGQRMPIRFKVAGRVDINLVTITMVAPGFNTHSFTMNQRLLVLVSEN  522

Query  251  -GLTSVAKDTISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
              L       I+ V P++ K APPGYYL+FV H+ +PS+G+WV I+
Sbjct  523  VKLIGENAYQINVVTPNNAKLAPPGYYLLFVVHQDIPSEGIWVKIQ  568



>ref|XP_011092656.1| PREDICTED: galactose oxidase-like [Sesamum indicum]
Length=562

 Score = 84.0 bits (206),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 45/111 (41%), Positives = 61/111 (55%), Gaps = 10/111 (9%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXIL-GLT  243
            P IV   S +++ YG+   I+FK     +   I VTM  PPFTTH +   QR+ +L   T
Sbjct  452  PMIVSPASHSQIGYGQQLVINFKAQGRINRGFITVTMVAPPFTTHSFSMNQRLLVLTNST  511

Query  242  SVAKDTIS---------AVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
             ++   IS          + P S   APPGYYL+FV +R VPS+G+WV IK
Sbjct  512  GISASVISLGGSNYQVRVMTPGSNILAPPGYYLLFVVYREVPSQGIWVQIK  562



>ref|XP_004238618.1| PREDICTED: galactose oxidase-like [Solanum lycopersicum]
Length=553

 Score = 84.0 bits (206),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 41/105 (39%), Positives = 63/105 (60%), Gaps = 5/105 (5%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILG---  249
            PQI+   S+ ++ YG   NI F      + + +KVTM  P F TH +   QR+ +L    
Sbjct  449  PQIISPASRRKVKYGGQVNIRFIVPGPINRNLVKVTMVAPGFNTHSFTMNQRILVLSSGN  508

Query  248  LTSVAKDT--ISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
            +T V   T  I+++ P+S K APPGYY++FV H+ +PS+G+W+ I
Sbjct  509  VTQVGTSTYKINSIFPNSSKLAPPGYYMLFVVHQDIPSEGIWIRI  553



>ref|XP_004238617.1| PREDICTED: galactose oxidase-like [Solanum lycopersicum]
Length=557

 Score = 83.6 bits (205),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 42/105 (40%), Positives = 62/105 (59%), Gaps = 5/105 (5%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILG---  249
            PQI+  +S+ +  +G+  +I F      + +SIKVTM  P F TH     QRM +L    
Sbjct  452  PQIISPVSRHKFKHGQRVDIQFSISGLVNKNSIKVTMIAPGFNTHSNTMNQRMLVLTNGV  511

Query  248  LTSVAKDT--ISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
            +  V K +  ++ + P SG  APPGYYL+FV H+ +PS+G+WV I
Sbjct  512  VKQVGKSSYHMNCLFPKSGSLAPPGYYLLFVVHQDIPSEGIWVRI  556



>ref|XP_004252835.1| PREDICTED: galactose oxidase-like [Solanum lycopersicum]
Length=570

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 62/106 (58%), Gaps = 5/106 (5%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXIL---G  249
            PQI    SQ  + YG+   I FK     D++ + VTM  P F TH +   QR+ +L    
Sbjct  465  PQITSPASQHAIGYGQRVPIRFKVAGRVDINLVTVTMVAPGFNTHSFTMNQRLLVLVSEN  524

Query  248  LTSVAKDT--ISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
            +  + K+   I+ V P++ K APPGYYL+FV H+ +PS+G+WV I+
Sbjct  525  VKLIGKNAYQINVVTPNNAKLAPPGYYLLFVVHQDIPSEGIWVKIQ  570



>ref|XP_006287335.1| hypothetical protein CARUB_v10000533mg [Capsella rubella]
 gb|EOA20233.1| hypothetical protein CARUB_v10000533mg [Capsella rubella]
Length=593

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/105 (43%), Positives = 60/105 (57%), Gaps = 5/105 (5%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDD-AXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLT  243
            P+IV   +  ++ +G+ FN+    +       ++KVTM  P FTTH      RM ILG+ 
Sbjct  488  PKIVATGTPKQIRFGQFFNVKVDLNQKGATKDNLKVTMLAPAFTTHSISMNMRMLILGVA  547

Query  242  SV----AKDTISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
            +V    A   I AVAP +G  APPGYYLIF  H+GVPS G W+ I
Sbjct  548  NVKPAGAGYDIQAVAPPNGNIAPPGYYLIFAVHKGVPSTGEWIQI  592



>ref|XP_002873953.1| hypothetical protein ARALYDRAFT_488852 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50212.1| hypothetical protein ARALYDRAFT_488852 [Arabidopsis lyrata subsp. 
lyrata]
Length=596

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/105 (44%), Positives = 59/105 (56%), Gaps = 5/105 (5%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFK-XDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLT  243
            P+IV   +  ++ YG+ FN+            ++KVTM  P FTTH      RM ILG+ 
Sbjct  491  PKIVTTGTPKQIKYGQFFNVKVDLKQKGATKQNLKVTMLAPAFTTHSISMNMRMLILGVA  550

Query  242  SV----AKDTISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
            +V    A   I AVAP +G  APPGYYLIF  H+GVPS G W+ I
Sbjct  551  NVKPAGAGYDIQAVAPPNGNIAPPGYYLIFAIHKGVPSTGEWIQI  595



>ref|XP_009625411.1| PREDICTED: LOW QUALITY PROTEIN: galactose oxidase-like [Nicotiana 
tomentosiformis]
Length=550

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 43/105 (41%), Positives = 62/105 (59%), Gaps = 5/105 (5%)
 Frame = -3

Query  416  QIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILG---L  246
            QI+   S+ +  YG++ +I F      +   +KVTM  P F TH     QRM +L    +
Sbjct  446  QIISLASRHKTKYGQSVSIRFTVSGLLNTDLVKVTMVAPGFNTHSNTMNQRMLVLSSGKV  505

Query  245  TSVAKDT--ISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
              + K T  I+ + PSSGK APPGYY++FV H+ +PSKG+WV I+
Sbjct  506  RRIGKSTYHINLIFPSSGKLAPPGYYMLFVVHQDIPSKGIWVKIQ  550



>ref|XP_011069718.1| PREDICTED: galactose oxidase-like [Sesamum indicum]
Length=562

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 44/111 (40%), Positives = 61/111 (55%), Gaps = 10/111 (9%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXIL----  252
            P IV   S +++ YG+   I+FK     +   I VTM  PPFTTH +   QR+ +L    
Sbjct  452  PMIVSPASHSQIGYGQQLVINFKAQGRINRGFITVTMVAPPFTTHSFSMNQRLLVLTNST  511

Query  251  ----GLTSVAKDT--ISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
                 +TS+      +  + P S   APPGYYL+FV +R VPS+G+WV IK
Sbjct  512  GISASVTSLGGSNYQVRVMTPGSNILAPPGYYLLFVVYREVPSQGIWVQIK  562



>ref|XP_006342230.1| PREDICTED: galactose oxidase-like [Solanum tuberosum]
Length=553

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 42/107 (39%), Positives = 62/107 (58%), Gaps = 6/107 (6%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAX-DMSSIKVTMYPPPFTTHGYXEGQRMXILGLT  243
            PQI+   S   + YG+  NI F    +  + + IKVTM  P F TH     QRM +L   
Sbjct  447  PQIISPASHKTIKYGQRVNIRFTLSGSLLNTNLIKVTMVAPGFNTHSNTMNQRMLVLSSE  506

Query  242  SVAKD-----TISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
             + K       IS++ P+SGK APPGYY++FV ++ +PS+G+W+ I+
Sbjct  507  KIKKTGIFTYQISSIFPNSGKLAPPGYYMLFVVNQDIPSEGIWIKIQ  553



>ref|XP_010263908.1| PREDICTED: galactose oxidase-like [Nelumbo nucifera]
Length=550

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 63/106 (59%), Gaps = 5/106 (5%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILG---  249
            P+I+   SQ +L YG+  ++ F    A +   + VTM  P FTTH +   QR+ +L    
Sbjct  445  PKILSPGSQAQLSYGQRLSVRFSVSGALNDKWVSVTMVSPSFTTHSFSMNQRLLVLDGGK  504

Query  248  LTSVAKDT--ISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
            +T V+     +   AP+SG  AP GYYL+FV H+ +PS+G+WV+IK
Sbjct  505  VTPVSSSVYDVEVTAPNSGFLAPSGYYLLFVVHQEIPSEGIWVNIK  550



>ref|XP_011048365.1| PREDICTED: galactose oxidase [Populus euphratica]
Length=606

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 51/80 (64%), Gaps = 7/80 (9%)
 Frame = -3

Query  335  DMSSIKVTMYPPPFTTHGYXEGQRMXILGLTSVAKD-------TISAVAPSSGKXAPPGY  177
            +   IKVTMY P FTTHG    QR+  LGL  V  +       TI+AV+P SGK APPGY
Sbjct  527  EKKDIKVTMYAPAFTTHGVSMNQRLLDLGLEDVITENAFLGIHTITAVSPPSGKVAPPGY  586

Query  176  YLIFVXHRGVPSKGLWVHIK  117
            Y++FV H+GVPS   WV IK
Sbjct  587  YMLFVVHQGVPSVSSWVQIK  606



>ref|XP_004238324.1| PREDICTED: galactose oxidase-like [Solanum lycopersicum]
Length=545

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 44/107 (41%), Positives = 63/107 (59%), Gaps = 6/107 (6%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDA-XDMSSIKVTMYPPPFTTHGYXEGQRMXILGLT  243
            PQI+   S  ++ YG+  NI F    +  + + IKVTM  P F TH     QRM +L   
Sbjct  439  PQIISPGSHKKIKYGQRLNIRFTLSGSLVNTNLIKVTMVAPGFNTHSNTMNQRMLLLSNE  498

Query  242  SVAKDTI-----SAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
             V K  I     S++ P+SGK APPGYYL+FV ++ +PS+G+W+ I+
Sbjct  499  KVKKIGILTYQVSSIFPNSGKLAPPGYYLLFVVNQDIPSEGIWIKIQ  545



>ref|NP_001170492.1| hypothetical protein precursor [Zea mays]
 gb|ACR33858.1| unknown [Zea mays]
 tpg|DAA58142.1| TPA: hypothetical protein ZEAMMB73_943613 [Zea mays]
Length=618

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 42/94 (45%), Positives = 55/94 (59%), Gaps = 5/94 (5%)
 Frame = -3

Query  386  LVYGKNFNIHFKXD-DAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTSVAKD----TI  222
            + YG  F   F     A     +KVTMY PPFTTHGY   QR+ +L +T+ A +    TI
Sbjct  523  MAYGAKFTFQFSTPVQAVAEPDLKVTMYAPPFTTHGYSMNQRLLVLSVTAFAANGQRYTI  582

Query  221  SAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
            +  AP   + APPGYYL++V  +GVPSK  WV +
Sbjct  583  TVDAPGKPELAPPGYYLLYVIAKGVPSKAAWVKV  616



>ref|XP_010454240.1| PREDICTED: galactose oxidase-like [Camelina sativa]
Length=590

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/105 (42%), Positives = 60/105 (57%), Gaps = 5/105 (5%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDD-AXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLT  243
            P+IV   +  ++ YG+ FN+    +       ++KVTM  P FTTH      RM ILG+ 
Sbjct  485  PKIVAAGTPKQVRYGQFFNVKVDLNQKGATKENLKVTMLAPAFTTHSISMNMRMLILGVA  544

Query  242  SV----AKDTISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
            +V    A   I AVAP +G  APPGYYL+F  H+GVPS G W+ +
Sbjct  545  NVKPAGAGYDIQAVAPPNGNIAPPGYYLLFAVHKGVPSTGEWIQV  589



>ref|XP_008801460.1| PREDICTED: galactose oxidase-like [Phoenix dactylifera]
Length=595

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 45/104 (43%), Positives = 59/104 (57%), Gaps = 8/104 (8%)
 Frame = -3

Query  407  EKLSQTELVYGKNFNIHFK--XDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGL----  246
            E L    + YG++F I F     +  +   + VTMY  P TTHGY   QR+ IL +    
Sbjct  491  EVLPAEGMQYGRSFTIAFAIIMTELVERDDLMVTMYAQPLTTHGYSMNQRLLILEMEEFA  550

Query  245  --TSVAKDTISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
               SV   +I+  AP SG+ APPGYY + V HRGVPSKG+WV +
Sbjct  551  MINSVGSYSITVRAPPSGEYAPPGYYQVHVVHRGVPSKGIWVKL  594



>gb|KDP25206.1| hypothetical protein JCGZ_20362 [Jatropha curcas]
Length=545

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 59/110 (54%), Gaps = 9/110 (8%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHF--KXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGL  246
            P I E   +  L Y + F + F  K +   ++  I VTM  P FTTH +   QR+ +L L
Sbjct  436  PAITEINPEANLRYKQKFTMGFESKTEKMVNLQKIYVTMVAPSFTTHSFAMNQRLLVLAL  495

Query  245  TS-------VAKDTISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
             +         K ++    P +G  APPGYY +FV H GVPS+G+WVHIK
Sbjct  496  DNNGVQKVGTGKYSVQVNTPVTGALAPPGYYQLFVVHEGVPSRGMWVHIK  545



>ref|XP_009797022.1| PREDICTED: galactose oxidase-like [Nicotiana sylvestris]
Length=551

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 40/107 (37%), Positives = 58/107 (54%), Gaps = 6/107 (6%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTS  240
            P+I+   S  +  YG+  +I F      +   +KVTM  P F TH +   QRM +L  + 
Sbjct  445  PRIISPASHLKYTYGQRVDIRFTASGLLNTDLVKVTMVAPGFNTHSFTMNQRMLVLPRSG  504

Query  239  VAKDT------ISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
            + +        IS V P SG  APPGYYL+FV H+ +PS+ +WV I+
Sbjct  505  MVRQVGRFVYQISCVFPKSGIFAPPGYYLLFVVHQDIPSEAIWVRIQ  551



>emb|CDY51183.1| BnaC02g45610D [Brassica napus]
Length=592

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 61/106 (58%), Gaps = 6/106 (6%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAX-DMSSIKVTMYPPPFTTHGYXEGQRMXILGLT  243
            P+IV   +  ++ +G+ FN+  +   A     ++ VTM  PPFTTH      R+ +LG++
Sbjct  486  PKIVHTDTPKQIKFGQTFNVKIELKQANVAKENVMVTMLAPPFTTHAVSMNMRLLLLGIS  545

Query  242  SVAKD-----TISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
             V K+      I AVAP SG  APPGYYL++  + GVPS G W+ I
Sbjct  546  DVKKEHGDVHQIQAVAPPSGNVAPPGYYLLYAVYNGVPSVGEWIQI  591



>ref|XP_009127543.1| PREDICTED: galactose oxidase-like [Brassica rapa]
Length=593

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 61/106 (58%), Gaps = 6/106 (6%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAX-DMSSIKVTMYPPPFTTHGYXEGQRMXILGLT  243
            P+IV   +  ++ +G+ FN+  +   A     ++ VTM  PPFTTH      R+ +LG++
Sbjct  487  PKIVHTDTPKQIKFGQTFNVKIELKQANVAKENVMVTMLAPPFTTHAVSMNMRLLLLGIS  546

Query  242  SVAKD-----TISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
             V K+      I AVAP SG  APPGYYL++  + GVPS G W+ I
Sbjct  547  DVKKEHGDVHQIQAVAPPSGNVAPPGYYLLYAVYNGVPSVGEWIQI  592



>ref|XP_010271448.1| PREDICTED: galactose oxidase-like [Nelumbo nucifera]
Length=549

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 58/105 (55%), Gaps = 5/105 (5%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTS  240
            P+I+  LSQ +L YG+   +      A D S + +TM  P FTTH +   QR+ +L    
Sbjct  444  PRIIYPLSQVKLKYGQRLRVRISVPGAFDSSRVSITMVAPSFTTHSFSMNQRLLVLDAAR  503

Query  239  VAKDT-----ISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
            V   +     +  + P SG  +P GYYL+FV H+ VPSKG+W+ I
Sbjct  504  VTPVSGPVYDVETLMPKSGLLSPSGYYLLFVVHQEVPSKGIWIQI  548



>ref|XP_002324431.2| hypothetical protein POPTR_0018s09110g [Populus trichocarpa]
 gb|EEF02996.2| hypothetical protein POPTR_0018s09110g [Populus trichocarpa]
Length=608

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 61/109 (56%), Gaps = 8/109 (7%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDD-AXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLT  243
            P I+   +  ++ Y   F ++ K      +   I+VTMY P FTTHG    QR+  LGL 
Sbjct  500  PVIIADKAPNQIGYNNLFKLYIKSKALKVEKKDIQVTMYAPAFTTHGVSMNQRLLDLGLE  559

Query  242  SVAKDT-------ISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
             V  +        I+AV+P SG+ APPGYY++FV H+GVPS   WV IK
Sbjct  560  DVITENAFLGIHAITAVSPPSGRVAPPGYYMLFVVHQGVPSVSSWVQIK  608



>ref|XP_011083592.1| PREDICTED: galactose oxidase-like [Sesamum indicum]
Length=550

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 42/107 (39%), Positives = 63/107 (59%), Gaps = 6/107 (6%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAX-DMSSIKVTMYPPPFTTHGYXEGQRMXILG--  249
            P+I+  +SQ+E+ YG+   I F       + +S+ VTM  P F TH +   QR+ +L   
Sbjct  444  PKIISPVSQSEIRYGQQLPIRFTIPPGRLNSTSVMVTMVAPSFNTHSFSMNQRLLVLSHG  503

Query  248  -LTSVAKDT--ISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
             +T+V K T  +    P SG  AP GYYL+FV H+ +PS+G+WV I+
Sbjct  504  DVTAVGKSTYQVRVGTPGSGNLAPAGYYLVFVVHQDIPSEGIWVQIR  550



>ref|XP_002456130.1| hypothetical protein SORBIDRAFT_03g031030 [Sorghum bicolor]
 gb|EES01250.1| hypothetical protein SORBIDRAFT_03g031030 [Sorghum bicolor]
Length=621

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 39/94 (41%), Positives = 55/94 (59%), Gaps = 5/94 (5%)
 Frame = -3

Query  386  LVYGKNFNIHFKX-DDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTSVAKD----TI  222
            + YG  F + F     A     +KVT+Y PPFTTHGY   QR+ +L +T+   D    T+
Sbjct  526  MAYGAKFTLQFSTPGQAVVQDDVKVTLYAPPFTTHGYSMNQRLLVLSVTTFTADGQRHTV  585

Query  221  SAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
            +  AP   + APPGYY+++V  +GVPSK  WV +
Sbjct  586  TVDAPGKPELAPPGYYMLYVIAKGVPSKAAWVKV  619



>ref|XP_008347351.1| PREDICTED: galactose oxidase-like [Malus domestica]
Length=533

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 40/105 (38%), Positives = 57/105 (54%), Gaps = 5/105 (5%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTS  240
            PQIV  +SQ ++ YGK  +I F         S+ V+M  P F TH +   QR+ +L   +
Sbjct  428  PQIVAPISQAKINYGKKLSIQFSVKGNLATQSVSVSMVAPSFNTHSFSMNQRLLVLEAEN  487

Query  239  VAKDTISA-----VAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
            V K   +A       P+SG  AP GYYL++V H+ +PS  +WV I
Sbjct  488  VKKVGTTAYQVQVTTPASGNLAPSGYYLLYVVHQKIPSAAIWVQI  532



>ref|XP_009794042.1| PREDICTED: galactose oxidase-like [Nicotiana sylvestris]
Length=553

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 40/106 (38%), Positives = 60/106 (57%), Gaps = 5/106 (5%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTS  240
            PQI+   SQ  + YG+   + FK     + + + VTM  P F TH + + QR+ +L   +
Sbjct  448  PQIISPASQYTIGYGQRVPVRFKVSGRVNRNLVTVTMVAPGFNTHSFTQNQRLLVLASEN  507

Query  239  VA-----KDTISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
            V         I+ V P+S   APPGYYL+FV H+ +PS+G+WV I+
Sbjct  508  VKLLGEKAYQINVVTPNSATLAPPGYYLLFVVHQDIPSEGIWVKIQ  553



>gb|KJB38605.1| hypothetical protein B456_006G262900 [Gossypium raimondii]
Length=548

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 42/106 (40%), Positives = 61/106 (58%), Gaps = 6/106 (6%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXD-DAXDMSSIKVTMYPPPFTTHGYXEGQRMXILG--  249
            P I+   S + + Y K + I    + D  D SS+ VTM+ P F TH +   QR+ +LG  
Sbjct  442  PTIIAPKSMSGIRYRKKYTIQVVINSDKVDESSVSVTMFAPAFNTHSFSMNQRLLVLGNE  501

Query  248  -LTSVAKD--TISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
             +T+V      I A  P SG  AP G+YL+FV H+G+PS+G+WV +
Sbjct  502  KVTAVGNSIYNIEATTPKSGNLAPSGFYLLFVVHQGIPSQGIWVRL  547



>ref|XP_004292851.1| PREDICTED: uncharacterized protein LOC101303486 [Fragaria vesca 
subsp. vesca]
Length=585

 Score = 82.4 bits (202),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 42/93 (45%), Positives = 58/93 (62%), Gaps = 6/93 (6%)
 Frame = -3

Query  380  YGKNFNIHFKXDD-AXDMSSIKVTMYPPPFTTHGYXEGQRMX---ILGLTSVAKD--TIS  219
            YG NF I F+    + D+S +KVTMY PPFTTHG+  GQR+    ++ L  V  +   + 
Sbjct  492  YGHNFLIEFQVKKVSVDLSDLKVTMYAPPFTTHGFSMGQRLVELVVVELKIVEFELFRVE  551

Query  218  AVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
              AP + + AP G+YL+FV H GVPS G+W+ I
Sbjct  552  VAAPPTAEIAPLGFYLVFVVHVGVPSSGIWLQI  584



>gb|KGN60010.1| hypothetical protein Csa_3G865940 [Cucumis sativus]
Length=556

 Score = 82.0 bits (201),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 39/107 (36%), Positives = 58/107 (54%), Gaps = 7/107 (7%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTS  240
            P I+E  SQ  + +G+   + F   D  D + + VTM  PPF TH +   QR+ +LG ++
Sbjct  449  PTIIEPRSQVMVFHGQRLKVEFTVIDELDPTKVSVTMLAPPFNTHSFSMNQRLLVLGRSN  508

Query  239  VAKDT-------ISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
            V           +    P SG  AP G+Y++FV H+ VPS+G+WV I
Sbjct  509  VTTTIWPELMYEVEVNVPVSGNIAPSGFYILFVVHQCVPSEGIWVQI  555



>ref|XP_009337669.1| PREDICTED: galactose oxidase-like [Pyrus x bretschneideri]
Length=533

 Score = 82.0 bits (201),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 40/105 (38%), Positives = 57/105 (54%), Gaps = 5/105 (5%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTS  240
            PQIV  +SQ ++ YGK  +I F         S+ V+M  P F TH +   QR+ +L   +
Sbjct  428  PQIVAPISQAKINYGKKLSIQFSVKGNLATKSVSVSMVAPSFNTHSFSMNQRLLVLEAEN  487

Query  239  VAKDTISA-----VAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
            V K   +A       P+SG  AP GYYL++V H+ +PS  +WV I
Sbjct  488  VKKVGTTAYQVQVTTPASGNLAPSGYYLLYVVHQKIPSAAIWVQI  532



>ref|XP_011026783.1| PREDICTED: galactose oxidase-like [Populus euphratica]
Length=547

 Score = 82.0 bits (201),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 56/99 (57%), Gaps = 7/99 (7%)
 Frame = -3

Query  392  TELVYGKNFNIHFKXDD-AXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTSVAKDT---  225
            T L Y + F++HF       ++  I VTM  P FT+H Y   QR+ +L L S A+     
Sbjct  449  TNLEYKQKFSMHFHIHQWHEELGKIYVTMVAPSFTSHSYSMNQRLLVLALDSEAQKVDFS  508

Query  224  ---ISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
               +   AP++   APPGYY +FV H GVPSKG WVHIK
Sbjct  509  NYVVDVHAPATATLAPPGYYQLFVVHEGVPSKGTWVHIK  547



>ref|XP_004147870.1| PREDICTED: galactose oxidase-like [Cucumis sativus]
 ref|XP_004166816.1| PREDICTED: galactose oxidase-like [Cucumis sativus]
Length=537

 Score = 82.0 bits (201),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 39/107 (36%), Positives = 58/107 (54%), Gaps = 7/107 (7%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTS  240
            P I+E  SQ  + +G+   + F   D  D + + VTM  PPF TH +   QR+ +LG ++
Sbjct  430  PTIIEPRSQVMVFHGQRLKVEFTVIDELDPTKVSVTMLAPPFNTHSFSMNQRLLVLGRSN  489

Query  239  VAKDT-------ISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
            V           +    P SG  AP G+Y++FV H+ VPS+G+WV I
Sbjct  490  VTTTIWPELMYEVEVNVPVSGNIAPSGFYILFVVHQCVPSEGIWVQI  536



>ref|XP_010493033.1| PREDICTED: galactose oxidase-like [Camelina sativa]
Length=592

 Score = 82.0 bits (201),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 44/105 (42%), Positives = 59/105 (56%), Gaps = 5/105 (5%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDD-AXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLT  243
            P+IV   +  ++ YG+ FN+    +       ++KVTM  P FTTH      RM ILG+ 
Sbjct  487  PKIVAAGTPKQVRYGQFFNVKADLNQKGVTKENLKVTMLAPAFTTHSISMNMRMLILGVA  546

Query  242  SV----AKDTISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
             V    A   I AVAP +G  APPGYYL+F  H+GVPS G W+ +
Sbjct  547  DVKPAGAGYDIQAVAPPNGNIAPPGYYLLFAVHKGVPSTGEWIQV  591



>ref|XP_009614398.1| PREDICTED: galactose oxidase-like [Nicotiana tomentosiformis]
Length=553

 Score = 81.6 bits (200),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 40/106 (38%), Positives = 59/106 (56%), Gaps = 5/106 (5%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILG---  249
            PQI+   SQ  + YG+   I FK     + + + VTM  P F TH + + QR+ +L    
Sbjct  448  PQIISPASQYIIGYGQRVPIRFKVSGRVNRNLVTVTMVAPGFNTHSFTQNQRLLVLANEN  507

Query  248  --LTSVAKDTISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
              L       ++ V P+S   APPGYYL+FV H+ +PS+G+WV I+
Sbjct  508  VKLVGEKAYQVNVVTPNSATLAPPGYYLLFVVHQDIPSEGIWVKIQ  553



>ref|XP_003527766.1| PREDICTED: galactose oxidase-like [Glycine max]
Length=558

 Score = 81.6 bits (200),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 43/106 (41%), Positives = 62/106 (58%), Gaps = 6/106 (6%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDM-SSIKVTMYPPPFTTHGYXEGQRMXIL---  252
            P IV   SQT+L YG+   + F+   A  +  S+ VTM  PPF TH +   QRM +L   
Sbjct  452  PTIVFPASQTKLKYGQTLRLRFEVMSATLVGDSVSVTMLSPPFNTHSFSMNQRMLVLEPH  511

Query  251  GLTSVAKDT--ISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
             L+ V + T  +   AP S   APPG+YL+F+ H+ +PS+G+WV +
Sbjct  512  DLSKVGESTYEVEVTAPVSAVLAPPGFYLLFLVHQEIPSQGIWVQM  557



>ref|XP_009774595.1| PREDICTED: galactose oxidase-like [Nicotiana sylvestris]
Length=554

 Score = 81.6 bits (200),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 41/106 (39%), Positives = 62/106 (58%), Gaps = 5/106 (5%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXIL---G  249
            P+I+   S+ ++ YG+  NI F    + +   + VTM  P F TH +   QRM +L    
Sbjct  449  PRIIAPASRHKIKYGQRVNIRFTVPGSVNRDVVNVTMVAPGFNTHSFTMNQRMLVLFSGN  508

Query  248  LTSVAKDT--ISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
            +T V K    I++V P+S   AP GYYL+FV H+ +PS+G+WV I+
Sbjct  509  VTRVGKSAYKINSVFPNSSNLAPAGYYLLFVVHQDIPSEGIWVRIQ  554



>ref|XP_011069751.1| PREDICTED: galactose oxidase-like [Sesamum indicum]
Length=560

 Score = 81.6 bits (200),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 41/111 (37%), Positives = 61/111 (55%), Gaps = 10/111 (9%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXIL----  252
            P+IV   S +++ YG+   I+F      +   I VTM  PPFTTH +   QR+ +L    
Sbjct  450  PRIVSPASHSQIEYGQQLVINFTAQGRINRGFITVTMVAPPFTTHSFSMNQRLLVLTNRT  509

Query  251  ----GLTSVAKDT--ISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
                 +T + +    +  + P S   APPGYYL+FV +R VPS+G+W+ IK
Sbjct  510  GISASVTPLGRSNYQVRVMTPGSNILAPPGYYLLFVVYREVPSQGIWIQIK  560



>gb|KJB38607.1| hypothetical protein B456_006G263100 [Gossypium raimondii]
Length=549

 Score = 81.3 bits (199),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 42/106 (40%), Positives = 61/106 (58%), Gaps = 6/106 (6%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXD-DAXDMSSIKVTMYPPPFTTHGYXEGQRMXILG--  249
            P I+   S + + Y K + I    + D  D SS+ VTM+ P F TH +   QR+ +LG  
Sbjct  443  PTIIAPKSMSVIRYRKKYTIQVVINSDKVDESSVLVTMFAPAFNTHSFSMNQRLLVLGNE  502

Query  248  -LTSVAKDT--ISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
             +T V   T  + A  P SG  AP G+YL+FV H+G+PS+G+WV +
Sbjct  503  KVTVVGNSTYNVEATTPRSGNVAPSGFYLLFVVHQGIPSQGIWVRL  548



>ref|XP_009337676.1| PREDICTED: galactose oxidase-like [Pyrus x bretschneideri]
Length=533

 Score = 81.3 bits (199),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 40/105 (38%), Positives = 57/105 (54%), Gaps = 5/105 (5%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTS  240
            PQIV  +SQ ++ YGK  +I F         S+ V+M  P F TH +   QR+ +L   +
Sbjct  428  PQIVAPISQAKINYGKKLSIQFLVKGNLATKSVSVSMVAPSFNTHSFSMNQRLLVLEAEN  487

Query  239  VAKDTISA-----VAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
            V K   +A       P+SG  AP GYYL++V H+ +PS  +WV I
Sbjct  488  VKKVGTTAYQVQVTTPASGNLAPSGYYLLYVVHQKIPSAAIWVQI  532



>ref|XP_009408991.1| PREDICTED: galactose oxidase-like [Musa acuminata subsp. malaccensis]
Length=540

 Score = 81.3 bits (199),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 41/101 (41%), Positives = 59/101 (58%), Gaps = 2/101 (2%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTS  240
            PQI+   S  +L YG  F++ F      +   I+VTM  P F TH +   QR+ +L  T 
Sbjct  442  PQILTPPSPIQLTYGGRFSLQFSVGVVSE-GGIRVTMVAPSFATHSFSMNQRLLVLE-TE  499

Query  239  VAKDTISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
                 + AVAP+S   APPGYY+++V + GVPS+G+W HI+
Sbjct  500  GGMSEVVAVAPASAILAPPGYYMVYVVNGGVPSEGIWAHIQ  540



>gb|AAL84955.1| AT5g19580/T20D1_100 [Arabidopsis thaliana]
 gb|AAN64541.1| At5g19580/T20D1_100 [Arabidopsis thaliana]
 dbj|BAE99231.1| hypothetical protein [Arabidopsis thaliana]
Length=594

 Score = 81.3 bits (199),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 44/105 (42%), Positives = 60/105 (57%), Gaps = 5/105 (5%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFK-XDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLT  243
            P+IV   +  ++ YG+ FN+     +      ++KVTM  P FTTH      RM ILG+ 
Sbjct  489  PKIVTTGTPKQVKYGQFFNVKVDLKEKGATKGNLKVTMLAPAFTTHSISMNMRMLILGVN  548

Query  242  SV----AKDTISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
            +V    A   I AVAP +G  APPGYYLIF  ++GVPS G W+ +
Sbjct  549  NVKPAGAGYDIQAVAPPNGNIAPPGYYLIFAIYKGVPSTGEWIQV  593



>ref|XP_004291825.1| PREDICTED: galactose oxidase-like [Fragaria vesca subsp. vesca]
Length=554

 Score = 81.3 bits (199),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 58/106 (55%), Gaps = 5/106 (5%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTS  240
            P I   LSQ  + YG+   + F       ++S+ VTM  P FTTH +   QR+ +L   +
Sbjct  449  PSIFSPLSQVTVGYGQKLAVRFSITGKIALNSVSVTMVSPSFTTHSFSMNQRLLVLASEN  508

Query  239  V-----AKDTISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
            V      K  +    P++G  AP GYYL++V H+ +PS+G+WV IK
Sbjct  509  VIAVGNLKFEVQVTTPATGNLAPSGYYLLYVVHQQIPSEGIWVKIK  554



>ref|XP_010670846.1| PREDICTED: galactose oxidase-like [Beta vulgaris subsp. vulgaris]
Length=538

 Score = 80.9 bits (198),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 58/106 (55%), Gaps = 6/106 (6%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTS  240
            P I++ +S  ++ YG+   I F      +++S+KVTM   PF TH +   QR+ +L    
Sbjct  432  PVIIKPISSAKIKYGRFLTIKFSVSGLINLASVKVTMLRAPFNTHSFSMSQRLLVLTNRK  491

Query  239  VAKDT------ISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
            +   T      +    P S   APPG+Y++FV HR +PSKG+WV +
Sbjct  492  LVSPTGQGRFQVRVRLPGSANIAPPGFYMLFVVHRNIPSKGIWVQL  537



>ref|NP_197459.1| glyoxal oxidase-related protein [Arabidopsis thaliana]
 gb|AED92727.1| glyoxal oxidase-related protein [Arabidopsis thaliana]
Length=594

 Score = 81.3 bits (199),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 44/105 (42%), Positives = 60/105 (57%), Gaps = 5/105 (5%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFK-XDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLT  243
            P+IV   +  ++ YG+ FN+     +      ++KVTM  P FTTH      RM ILG+ 
Sbjct  489  PKIVTTGTPKQVKYGQFFNVKVDLKEKGATKGNLKVTMLAPAFTTHSISMNMRMLILGVN  548

Query  242  SV----AKDTISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
            +V    A   I AVAP +G  APPGYYLIF  ++GVPS G W+ +
Sbjct  549  NVKPAGAGYDIQAVAPPNGNIAPPGYYLIFAIYKGVPSTGEWIQV  593



>ref|XP_008357159.1| PREDICTED: galactose oxidase-like [Malus domestica]
Length=401

 Score = 80.1 bits (196),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 56/105 (53%), Gaps = 5/105 (5%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTS  240
            PQIV  +SQ ++ YGK  +I F         S+ V+M  P F  H +   QR+ +L   +
Sbjct  296  PQIVAPISQAKINYGKKLSIQFSVKGNLATXSVSVSMVAPSFNXHSFSMNQRLLVLXAEN  355

Query  239  VAKDTISA-----VAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
            V K   +A       P+SG  AP GYYL++V H+ +PS  +WV I
Sbjct  356  VKKVGTTAYQVQVTTPASGNLAPSGYYLLYVVHQKIPSAAIWVQI  400



>ref|XP_009603236.1| PREDICTED: galactose oxidase-like [Nicotiana tomentosiformis]
Length=564

 Score = 80.9 bits (198),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 39/107 (36%), Positives = 57/107 (53%), Gaps = 6/107 (6%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTS  240
            P+I+   S  +  YG+  +I F      +   +KVTM  P F TH +   QRM +L  + 
Sbjct  458  PRIISPASHLKFTYGQRVDIRFTASRLLNRDLVKVTMVAPGFNTHSFTMNQRMLVLPRSG  517

Query  239  VAKDT------ISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
            + +        IS V P S   APPGYYL+FV H+ +PS+ +WV I+
Sbjct  518  IVRQVGRFVYQISCVFPKSAIFAPPGYYLLFVVHQDIPSEAIWVRIQ  564



>gb|KJB38606.1| hypothetical protein B456_006G263000 [Gossypium raimondii]
Length=549

 Score = 80.9 bits (198),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 61/106 (58%), Gaps = 6/106 (6%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXD-DAXDMSSIKVTMYPPPFTTHGYXEGQRMXILG--  249
            P I+   S + + Y K + I    + +  D SS+ VTM+ P F TH +   QR+ +LG  
Sbjct  443  PTIIASKSMSGIRYRKKYTIQVVINSNKVDESSVSVTMFAPAFNTHSFSMNQRLLVLGNE  502

Query  248  -LTSVAKD--TISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
             +T+V      + A  P SG  AP G+YL+FV H+G+PS+G+WV +
Sbjct  503  KVTAVGNSMYNVEATTPKSGNLAPSGFYLLFVVHQGIPSQGIWVRL  548



>ref|XP_008466667.1| PREDICTED: galactose oxidase-like [Cucumis melo]
Length=655

 Score = 80.9 bits (198),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 39/107 (36%), Positives = 57/107 (53%), Gaps = 7/107 (7%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTS  240
            P I+E  SQ  + +G+   + F   D  D + I VTM  PPF TH +   QR+ ++G  +
Sbjct  548  PTIIEPRSQIMVFHGQRLKVEFTVIDEMDPTKISVTMLAPPFNTHSFSMNQRLLVVGRGN  607

Query  239  VAKDT-------ISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
            V           +    P SG  AP G+Y++FV H+ VPS+G+WV I
Sbjct  608  VTTTIWPELMYEVEVNIPVSGNIAPSGFYILFVVHQCVPSEGIWVQI  654



>ref|XP_008377179.1| PREDICTED: galactose oxidase-like [Malus domestica]
Length=537

 Score = 80.5 bits (197),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 40/105 (38%), Positives = 61/105 (58%), Gaps = 5/105 (5%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTS  240
            P I+  L+Q ++ YG+   + F       M+S+ VTM  PPF+TH +   QR+ +LG  +
Sbjct  432  PTIINPLNQAKIHYGRKLTVQFSLTGTLAMNSVLVTMVAPPFSTHSFSMNQRLLVLGAEN  491

Query  239  VAK---DTISA--VAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
            V K    T  A    P S   AP GYY+++V H+ +PS+G++VHI
Sbjct  492  VQKVGPTTYQAQVTTPPSVNLAPSGYYILYVVHQQIPSEGIFVHI  536



>ref|XP_008221409.1| PREDICTED: galactose oxidase-like [Prunus mume]
Length=540

 Score = 80.5 bits (197),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 57/105 (54%), Gaps = 5/105 (5%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILG---  249
            P+IV  +SQ ++ YGK   I F        +S+ VTM  P FTTH +    R  +L    
Sbjct  435  PKIVSSISQAKINYGKKLTIRFSVMGTLATNSVSVTMVAPSFTTHSFSMNHRSLVLASEN  494

Query  248  LTSVAKDT--ISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
            + SV K    +    P+SG  AP GYYL++V H+ +PS G+WV I
Sbjct  495  VKSVGKSAYEVEVTTPASGNLAPSGYYLLYVVHQQIPSDGIWVQI  539



>gb|KFK26190.1| hypothetical protein AALP_AA8G214300 [Arabis alpina]
Length=592

 Score = 80.9 bits (198),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 60/106 (57%), Gaps = 6/106 (6%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDD-AXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLT  243
            P+IV   +  ++ YG+NF +    +       ++KVTM  PPFTTH      R+ +LG++
Sbjct  486  PKIVANGTPKQIRYGQNFKVKVNLNQQGVTKQNLKVTMLAPPFTTHSISMNMRLLLLGVS  545

Query  242  SVAKD-----TISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
            +V         I  +AP +G  APPGYYLIF  ++GVPS G W+ +
Sbjct  546  AVTPAGAGTFEIQTLAPPNGNIAPPGYYLIFAVYQGVPSTGEWIQV  591



>ref|XP_006342232.1| PREDICTED: galactose oxidase-like [Solanum tuberosum]
Length=553

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 42/105 (40%), Positives = 58/105 (55%), Gaps = 5/105 (5%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTS  240
            PQI+   S  +  YG+  +I F      +  SIKVT+  P F TH     QRM +L    
Sbjct  448  PQIISPDSHLKFTYGQRVDIRFTALGLLNRDSIKVTIVAPGFNTHSNTMNQRMLVLPRGI  507

Query  239  VAK-----DTISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
            V +       +S V P+SGK APPGYYL+FV H+ +PS+ +WV +
Sbjct  508  VRQVGRFVYEVSCVFPNSGKLAPPGYYLLFVVHQDIPSEAIWVRV  552



>ref|XP_007222145.1| hypothetical protein PRUPE_ppa004709mg [Prunus persica]
 gb|EMJ23344.1| hypothetical protein PRUPE_ppa004709mg [Prunus persica]
Length=495

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 41/105 (39%), Positives = 56/105 (53%), Gaps = 5/105 (5%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILG---  249
            P+IV   SQ ++ YGK   I F        +S+ VTM  P FTTH +    R  +L    
Sbjct  390  PKIVTPKSQAKINYGKKLTIRFSVTGTLATNSVSVTMVAPSFTTHSFSMNHRSLVLASEN  449

Query  248  LTSVAKDT--ISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
            + SV K    +    P+SG  AP GYYL++V H+ +PS G+WV I
Sbjct  450  VKSVGKSAYEVEVTTPASGNLAPSGYYLLYVVHQQIPSDGIWVQI  494



>ref|XP_006473606.1| PREDICTED: galactose oxidase-like [Citrus sinensis]
Length=535

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 41/106 (39%), Positives = 57/106 (54%), Gaps = 5/106 (5%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTS  240
            P IV   SQ  L Y + F + F       ++ + VTM  P F TH +   QR+ +L   +
Sbjct  430  PTIVLPESQFTLKYKQKFRVRFSASGPVALNKVTVTMVAPSFNTHSFSMNQRLLVLASDT  489

Query  239  VAK-----DTISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
            V K       I   +P SG  AP GYYL+FV H+ VPS+G+WVH++
Sbjct  490  VTKLGNSGYEIVVNSPGSGNLAPSGYYLLFVVHQDVPSEGIWVHVQ  535



>ref|XP_007225625.1| hypothetical protein PRUPE_ppa003824mg [Prunus persica]
 gb|EMJ26824.1| hypothetical protein PRUPE_ppa003824mg [Prunus persica]
Length=546

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 41/105 (39%), Positives = 59/105 (56%), Gaps = 5/105 (5%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGL--  246
            P+IV   SQ ++ YG+   + F        + + VTM  P FTTH +   QR+ +L    
Sbjct  441  PKIVAPQSQAKINYGQKLAVRFSVAGTVAPNLVLVTMVAPSFTTHSFSMNQRLLVLAAES  500

Query  245  -TSVAKDT--ISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
             T+VAK T  +    P SG  AP GYYL++V H+ +PS+G+WV I
Sbjct  501  ATNVAKSTYQVQVTTPGSGNLAPSGYYLLYVVHQQIPSEGIWVQI  545



>gb|KDO84767.1| hypothetical protein CISIN_1g009420mg [Citrus sinensis]
Length=535

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 41/106 (39%), Positives = 57/106 (54%), Gaps = 5/106 (5%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTS  240
            P IV   SQ  L Y + F + F       ++ + VTM  P F TH +   QR+ +L   +
Sbjct  430  PTIVLPESQFTLKYKQKFRVRFSASGPVALNKVTVTMVAPSFNTHSFSMNQRLLVLASDT  489

Query  239  VAK-----DTISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
            V K       I   +P SG  AP GYYL+FV H+ VPS+G+WVH++
Sbjct  490  VTKLGNSGYEIVVNSPGSGNLAPSGYYLLFVVHQDVPSEGIWVHVQ  535



>ref|XP_008377171.1| PREDICTED: galactose oxidase-like [Malus domestica]
Length=533

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 39/105 (37%), Positives = 56/105 (53%), Gaps = 5/105 (5%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTS  240
            PQIV  +SQ ++ YGK  +I F         S+ V+M  P F  H +   QR+ +L   +
Sbjct  428  PQIVAPISQAKINYGKKLSIQFSVKGNLATXSVSVSMVAPSFNXHSFSMNQRLLVLXAEN  487

Query  239  VAKDTISA-----VAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
            V K   +A       P+SG  AP GYYL++V H+ +PS  +WV I
Sbjct  488  VKKVGTTAYQVQVTTPASGNLAPSGYYLLYVVHQKIPSAAIWVQI  532



>ref|XP_010916153.1| PREDICTED: galactose oxidase-like [Elaeis guineensis]
Length=541

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 63/106 (59%), Gaps = 6/106 (6%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGL-T  243
            P+I    S   L YGK F++ F    A     + VTM  P F+TH +   QR+ IL   T
Sbjct  437  PKIDISASPISLNYGKQFSMRFAVG-AISGGGVTVTMAAPAFSTHSFSMNQRLLILETGT  495

Query  242  SVAKDT----ISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
            +++ D     ++AVAP+SG  AP GYYL+FV + G+PS+G+W HIK
Sbjct  496  ALSGDNSSYEVTAVAPASGVLAPSGYYLVFVVNGGIPSEGVWAHIK  541



>ref|XP_010061250.1| PREDICTED: galactose oxidase-like [Eucalyptus grandis]
 gb|KCW68173.1| hypothetical protein EUGRSUZ_F01844 [Eucalyptus grandis]
Length=551

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 40/107 (37%), Positives = 60/107 (56%), Gaps = 6/107 (6%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILG---  249
            P+I+   SQ  + YG    + F    A   S + VTM  P FTTH +   QR+ ++G   
Sbjct  445  PRIISPASQAGIGYGMKLLVRFSVVGAVSASRVTVTMVAPSFTTHSFSMNQRLLVIGDGR  504

Query  248  -LTSVAKDT--ISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
             +T+V K    + AV P +   AP GYYL+FV H+ VPS+G+W+ ++
Sbjct  505  GVTAVGKSVYEVEAVTPGTRTLAPAGYYLLFVVHQDVPSEGIWIRVQ  551



>ref|XP_010424026.1| PREDICTED: galactose oxidase-like, partial [Camelina sativa]
Length=529

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 58/105 (55%), Gaps = 5/105 (5%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDD-AXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLT  243
            P+I    +  ++ YG+ FN+    +       ++K+TM  P FTTH      RM ILG+ 
Sbjct  424  PKIFAAGTPKQVRYGQFFNVKVDLNQKGATKENLKITMLAPAFTTHSISMNMRMLILGVA  483

Query  242  SV----AKDTISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
             V    A   I AVAP +G  APPGYYL+F  H+GVPS G W+ +
Sbjct  484  DVKPAGAGYDIQAVAPPNGNIAPPGYYLLFAVHKGVPSTGEWIQV  528



>ref|XP_010420764.1| PREDICTED: galactose oxidase-like isoform X1 [Camelina sativa]
 ref|XP_010420765.1| PREDICTED: galactose oxidase-like isoform X2 [Camelina sativa]
Length=588

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 58/105 (55%), Gaps = 5/105 (5%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDD-AXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLT  243
            P+I    +  ++ YG+ FN+    +       ++K+TM  P FTTH      RM ILG+ 
Sbjct  483  PKIFAAGTPKQVRYGQFFNVKVDLNQKGATKENLKITMLAPAFTTHSISMNMRMLILGVA  542

Query  242  SV----AKDTISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
             V    A   I AVAP +G  APPGYYL+F  H+GVPS G W+ +
Sbjct  543  DVKPAGAGYDIQAVAPPNGNIAPPGYYLLFAVHKGVPSTGEWIQV  587



>ref|XP_010271447.1| PREDICTED: galactose oxidase-like [Nelumbo nucifera]
Length=553

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/106 (41%), Positives = 58/106 (55%), Gaps = 5/106 (5%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILG---  249
            P+I+   SQT+L YG++  + F          + VTM  P FTTH +   QR+  L    
Sbjct  448  PEIISPPSQTKLKYGQSITVRFSLSGELSSKGVSVTMVAPSFTTHSFAMNQRLLELDGRQ  507

Query  248  LTSVAKDT--ISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
            +  V+K    +    P SG  AP GYYL+FV H  VPS+G+WVHIK
Sbjct  508  VKPVSKSVYDVQVTIPESGFLAPSGYYLLFVVHTEVPSEGIWVHIK  553



>ref|XP_004291826.1| PREDICTED: galactose oxidase-like [Fragaria vesca subsp. vesca]
Length=554

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/106 (36%), Positives = 58/106 (55%), Gaps = 5/106 (5%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTS  240
            P I   LSQ  + YG+   + F       ++S+ VTM  P FTTH +   QR+ +L   +
Sbjct  449  PSIFSPLSQVTVGYGQKLAVRFSITGKIALNSVSVTMVSPSFTTHSFSMNQRLLVLASEN  508

Query  239  V-----AKDTISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
            V      K  +    P++G  AP GYYL++V H+ +PS+G+WV I+
Sbjct  509  VIAVGNLKFEVQVTTPATGNLAPSGYYLLYVVHQQIPSEGIWVKIQ  554



>ref|XP_006435123.1| hypothetical protein CICLE_v10003275mg [Citrus clementina]
 gb|ESR48363.1| hypothetical protein CICLE_v10003275mg [Citrus clementina]
Length=521

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 57/106 (54%), Gaps = 5/106 (5%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTS  240
            P IV   SQ  L Y + F + F       ++ + VTM  P F TH +   QR+ +L   +
Sbjct  416  PTIVLPESQFTLKYKQKFRVRFSASGPVALNKVTVTMVAPSFNTHSFSMNQRLLVLASDT  475

Query  239  VAKD-----TISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
            V K       I   +P SG  AP GYYL+FV H+ VPS+G+WVH++
Sbjct  476  VTKLGNSGYEIVVNSPGSGNLAPSGYYLLFVVHQDVPSEGIWVHVQ  521



>ref|XP_006342233.1| PREDICTED: galactose oxidase-like [Solanum tuberosum]
Length=553

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 40/105 (38%), Positives = 62/105 (59%), Gaps = 5/105 (5%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILG---  249
            P++V   S+ ++ YG   NI F      + + +KVTM  P F TH +   QR+  L    
Sbjct  449  PRVVSPSSRRKVKYGGQVNIRFIIPGPINRNLVKVTMVAPGFNTHSFTMNQRILELSSGN  508

Query  248  LTSVAKDT--ISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
            +T V   T  I+++ P+S K APPGYY++FV H+ +PS+G+W+ I
Sbjct  509  VTQVGTSTFKINSIFPNSSKLAPPGYYMLFVVHQDIPSEGIWIRI  553



>ref|XP_009336713.1| PREDICTED: galactose oxidase-like [Pyrus x bretschneideri]
Length=537

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 60/105 (57%), Gaps = 5/105 (5%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTS  240
            P I+  L+Q ++ YG    I F       M+S+ VTM  PPF+TH +   QR+ +LG  +
Sbjct  432  PTILTPLNQAKIRYGIKLTIQFSLTGTLAMNSVSVTMVAPPFSTHSFSMNQRLLVLGAEN  491

Query  239  VAK---DTISA--VAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
            V K    T  A    P SG  AP GYY+++V H+ +PS+G++V I
Sbjct  492  VQKVGPTTYQAQVTTPPSGNLAPSGYYILYVVHQQIPSEGIFVQI  536



>ref|XP_002510488.1| Galactose oxidase precursor, putative [Ricinus communis]
 gb|EEF52675.1| Galactose oxidase precursor, putative [Ricinus communis]
Length=547

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 38/106 (36%), Positives = 58/106 (55%), Gaps = 5/106 (5%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILG---  249
            P I+   S++ L Y +   + FK       +++ VTM  P FTTH +   QR+ +L    
Sbjct  442  PTIISPASKSRLGYAQKLAVRFKVTGRLTENTVSVTMVAPSFTTHSFSMNQRLLVLDNEK  501

Query  248  LTSVAKDT--ISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
            +T V   T  +   AP S   APPG+YL+FV H  +PS+G+WV ++
Sbjct  502  VTDVGTGTYDVQVTAPRSTNLAPPGFYLLFVVHEDIPSEGIWVQVR  547



>ref|XP_002876427.1| hypothetical protein ARALYDRAFT_907231 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52686.1| hypothetical protein ARALYDRAFT_907231 [Arabidopsis lyrata subsp. 
lyrata]
Length=547

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 54/96 (56%), Gaps = 6/96 (6%)
 Frame = -3

Query  386  LVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTSVAKDT------  225
            L Y + FN+ F       +  + V +  P FTTH +   QRM IL L SV +D       
Sbjct  452  LSYKRLFNVDFSIAQFLTVDLLSVRIVAPSFTTHSFAMNQRMVILKLLSVTRDQLTNSYR  511

Query  224  ISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
            ISA+ PS+ + APPGYY++F+ H G+PS   WV I+
Sbjct  512  ISALGPSTAEIAPPGYYMMFLVHAGIPSSAAWVQIE  547



>emb|CDM83959.1| unnamed protein product [Triticum aestivum]
Length=577

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 42/92 (46%), Positives = 55/92 (60%), Gaps = 5/92 (5%)
 Frame = -3

Query  380  YGKNFNIHFKX-DDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTSVA----KDTISA  216
            YG    + F     A   + +KVTMY PPFTTHG+ + QR+ +L +T+      K  ++A
Sbjct  484  YGDKLTLRFTSRGPAVVEADMKVTMYAPPFTTHGFSQNQRLLVLQVTAFKPEGNKYKVTA  543

Query  215  VAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
             APS    APPGYYL+FV  +GVPSK  WV I
Sbjct  544  QAPSKPTLAPPGYYLVFVLVKGVPSKAAWVKI  575



>gb|EEC71262.1| hypothetical protein OsI_03252 [Oryza sativa Indica Group]
Length=624

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 40/92 (43%), Positives = 53/92 (58%), Gaps = 5/92 (5%)
 Frame = -3

Query  380  YGKNFNIHFKXD-DAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTSVA----KDTISA  216
            YG  F   F           +KVTMY PPFTTHGY   QR+ IL +T+ A    + T++ 
Sbjct  531  YGARFTFRFTTPAQGVGQGDVKVTMYAPPFTTHGYSMNQRLLILPVTAFAAQGQRHTVTV  590

Query  215  VAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
             AP   + APPGYY+++V  +GVPSK  WV +
Sbjct  591  DAPPKPELAPPGYYMVYVVAKGVPSKAAWVKM  622



>ref|NP_191321.1| glyoxal oxidase-related protein [Arabidopsis thaliana]
 emb|CAB41193.1| putative protein [Arabidopsis thaliana]
 gb|AEE79679.1| glyoxal oxidase-related protein [Arabidopsis thaliana]
Length=547

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 40/100 (40%), Positives = 55/100 (55%), Gaps = 6/100 (6%)
 Frame = -3

Query  398  SQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTSVAKDT--  225
            S   L Y + FN+ F       +  + V +  P FTTH +   QRM IL L SV +D   
Sbjct  448  SDKVLSYKRLFNVDFSIAQFLTVDLLSVRIVAPSFTTHSFAMNQRMVILKLLSVTRDQLT  507

Query  224  ----ISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
                +SA+ PS+ + APPGYY+IF+ H G+PS   WV I+
Sbjct  508  NSYRVSALGPSTAEIAPPGYYMIFLVHAGIPSSAAWVQIE  547



>ref|XP_006391296.1| hypothetical protein EUTSA_v10018300mg [Eutrema salsugineum]
 gb|ESQ28582.1| hypothetical protein EUTSA_v10018300mg [Eutrema salsugineum]
Length=610

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 59/107 (55%), Gaps = 8/107 (7%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFN--IHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGL  246
            P+IV   +  ++ YG+ FN  I  K +D     ++ VTM  PPFTTH      R+ +LG+
Sbjct  504  PKIVTSATPKQIKYGQMFNVRIELKQEDVTK-ENVMVTMLAPPFTTHAVSMNMRLLLLGI  562

Query  245  TSVAK-----DTISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
              + K       I +VAP SG  APPGYYL+   + GVPS G W+ I
Sbjct  563  NDIKKVKPDFHQIQSVAPPSGNVAPPGYYLLSAVYNGVPSVGEWIQI  609



>ref|XP_003569556.2| PREDICTED: uncharacterized protein LOC100835848 [Brachypodium 
distachyon]
Length=586

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 42/94 (45%), Positives = 53/94 (56%), Gaps = 7/94 (7%)
 Frame = -3

Query  380  YGKNFNIHFKXDDAXD---MSSIKVTMYPPPFTTHGYXEGQRMXILGLTSV----AKDTI  222
            YG  F+  F             +KVTMY PPFTTHGY   QR+ +L +T+     AK  +
Sbjct  491  YGAKFSFRFSTPGGQPPVLEGDVKVTMYAPPFTTHGYSMNQRLLVLQVTAFKAEGAKHKV  550

Query  221  SAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
            +  APS    APPGYY++FV  +GVPSK  WV I
Sbjct  551  TIHAPSKPALAPPGYYMVFVLAKGVPSKAAWVKI  584



>emb|CDY44816.1| BnaCnng11720D [Brassica napus]
Length=552

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 38/94 (40%), Positives = 54/94 (57%), Gaps = 6/94 (6%)
 Frame = -3

Query  380  YGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTSVAKDTIS------  219
            Y + FN+HF       +  + V +  P FTTH +   QRM IL L SV  + ++      
Sbjct  459  YKRLFNVHFSIPLFLTIDLLSVRIVAPSFTTHSFAMNQRMVILKLLSVTHEDLTNSYKLD  518

Query  218  AVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
            A+ PS+ + APPGYY+IF+ H G+PS G WV I+
Sbjct  519  ALGPSTAEIAPPGYYMIFLVHAGIPSSGFWVQIE  552



>ref|XP_008221311.1| PREDICTED: galactose oxidase-like [Prunus mume]
Length=535

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 56/105 (53%), Gaps = 5/105 (5%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILG---  249
            P+IV   SQ ++ YGK   I F        +S+ VTM  P FTTH +    R  +L    
Sbjct  430  PKIVSPKSQAKINYGKKLTIRFSMTGTLATNSVSVTMVAPSFTTHSFSMNHRSLVLASEN  489

Query  248  LTSVAKDT--ISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
            + SV K    +    P+SG  AP GYYL++V H+ +PS G+WV I
Sbjct  490  VKSVGKSAYEVEVTTPASGNLAPSGYYLLYVVHQQIPSDGIWVQI  534



>ref|XP_004969528.1| PREDICTED: uncharacterized protein LOC101774211 [Setaria italica]
Length=624

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 39/95 (41%), Positives = 56/95 (59%), Gaps = 6/95 (6%)
 Frame = -3

Query  386  LVYGKNFNIHFKXDD-AXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTSVA-----KDT  225
            + YG  F + F         + +KVTMY PPFTTHG+   QR+ +L +T+       + T
Sbjct  528  MAYGSQFTLQFTTPALPVAETDMKVTMYAPPFTTHGFSMNQRLLVLSVTAFVPKGPNRYT  587

Query  224  ISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
            I+  AP   + APPGYYL++V  +GVPSK +WV +
Sbjct  588  ITVGAPGKPELAPPGYYLLYVMAQGVPSKAVWVKV  622



>ref|XP_010516382.1| PREDICTED: galactose oxidase-like [Camelina sativa]
Length=546

 Score = 79.0 bits (193),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 55/100 (55%), Gaps = 6/100 (6%)
 Frame = -3

Query  398  SQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTSVAKDT--  225
            S   L Y + FN+ F       +  + V +  P FTTH +   QRM IL L SV +D   
Sbjct  447  SDKVLSYKRLFNVDFSIPQFLTVDLLSVRIVAPSFTTHSFAMNQRMVILKLLSVTRDQLT  506

Query  224  ----ISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
                +SA+ PS+ + APPGYY++F+ H G+PS   WV I+
Sbjct  507  NSYRVSALGPSTAEIAPPGYYMMFLVHAGIPSSAAWVQIE  546



>ref|XP_004500954.1| PREDICTED: galactose oxidase-like [Cicer arietinum]
Length=555

 Score = 79.0 bits (193),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 39/99 (39%), Positives = 56/99 (57%), Gaps = 6/99 (6%)
 Frame = -3

Query  398  SQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGL----TSVAK  231
            SQT+L YG+   + F+       +S+ VTM  PPF TH +   QR+ +L +     +V +
Sbjct  456  SQTKLKYGQKLKVRFQVKATLVRNSVSVTMIAPPFNTHSFSMNQRLLVLEMKLQNNTVGE  515

Query  230  DT--ISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
             T  I    P S   APP YYL+FV H+ VPS+G+WV +
Sbjct  516  STYEIEVTTPGSAILAPPAYYLLFVVHQEVPSQGVWVQL  554



>ref|XP_009119411.1| PREDICTED: galactose oxidase [Brassica rapa]
Length=552

 Score = 79.0 bits (193),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 37/94 (39%), Positives = 53/94 (56%), Gaps = 6/94 (6%)
 Frame = -3

Query  380  YGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTSVAKDTIS------  219
            Y + FN+HF       +  + V +  P FTTH +   QRM IL L SV  + ++      
Sbjct  459  YKRLFNVHFSIPQFLTIDLLSVRIVAPSFTTHSFAMNQRMVILKLLSVTHEDLTNSYKLD  518

Query  218  AVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
             + PS+ + APPGYY+IF+ H G+PS G WV I+
Sbjct  519  VLGPSTAEIAPPGYYMIFLVHAGIPSSGFWVQIE  552



>gb|KFK35620.1| hypothetical protein AALP_AA4G014800 [Arabis alpina]
Length=549

 Score = 79.0 bits (193),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 39/94 (41%), Positives = 53/94 (56%), Gaps = 6/94 (6%)
 Frame = -3

Query  380  YGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTSVAKD------TIS  219
            Y   FN+ F       +  + V +  P FTTH +   QRM IL L SVA+D       I+
Sbjct  456  YKTLFNLSFSIAQFLTIDLLSVRIVAPSFTTHSFAMNQRMVILKLISVARDGLTNSYRIN  515

Query  218  AVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
             + PS+ + APPGYY++F+ H GVPS G WV I+
Sbjct  516  VLGPSTAEIAPPGYYMMFLVHSGVPSSGTWVQIE  549



>ref|XP_010541740.1| PREDICTED: galactose oxidase-like [Tarenaya hassleriana]
Length=609

 Score = 79.0 bits (193),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 62/107 (58%), Gaps = 7/107 (7%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAX-DMSSIKVTMYPPPFTTHGYXEGQRMXILGLT  243
            P+IV   S  ++ +G+ F++  + +      + +++TM  P FTTH      RM +LG++
Sbjct  502  PRIVANGSPKQVRFGQKFSVRIQLNQTKFHKNEVRLTMLAPSFTTHSISMNMRMVLLGVS  561

Query  242  SVAKDT------ISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
            SVA +       I  +AP SG  APPGYYL+F  ++GVPS G W+ +
Sbjct  562  SVAHNVSPNVHEIQTLAPPSGNIAPPGYYLLFAVYKGVPSVGEWIQV  608



>emb|CDY58964.1| BnaC09g38100D [Brassica napus]
Length=571

 Score = 79.0 bits (193),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 55/99 (56%), Gaps = 6/99 (6%)
 Frame = -3

Query  398  SQTELVYGKNFNIHFKXDDA-XDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTSV-----  237
            S  ++ YG+NFN+    +       S+K+TM  P FTTH      RM +LG+  V     
Sbjct  472  SPKQIRYGQNFNVKVNLNQKDVTKQSLKLTMLAPSFTTHSISMNMRMLLLGVGGVNPAGG  531

Query  236  AKDTISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
            A   I  VAP SG  APPGYYL+F  ++GVPS G W+ I
Sbjct  532  ASFEIQTVAPPSGNVAPPGYYLLFAVYKGVPSTGEWIQI  570



>ref|XP_008221312.1| PREDICTED: galactose oxidase-like [Prunus mume]
Length=546

 Score = 79.0 bits (193),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 61/105 (58%), Gaps = 5/105 (5%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILG---  249
            P+IV   SQ ++ +G+   + F  +     + + VTM  P FTTH +   QR+ +L    
Sbjct  441  PKIVAPQSQAKINHGQKLAVRFYVEGTVAPNLVSVTMVAPSFTTHSFSMNQRLLVLAAES  500

Query  248  LTSVAKDT--ISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
            +T+VAK T  +    P SG  AP GYY+++V H+ +PS+G+WV I
Sbjct  501  VTNVAKSTYQVQVTTPGSGNLAPSGYYILYVVHQQIPSEGIWVQI  545



>ref|XP_007136065.1| hypothetical protein PHAVU_009G014900g [Phaseolus vulgaris]
 gb|ESW08059.1| hypothetical protein PHAVU_009G014900g [Phaseolus vulgaris]
Length=565

 Score = 79.0 bits (193),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 37/106 (35%), Positives = 57/106 (54%), Gaps = 5/106 (5%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTS  240
            P I+E  S T L+YG+ F +  K + A     + VTM  PPF TH +   QR+ +L +  
Sbjct  460  PIILEPSSHTNLMYGEKFKMGIKVNGALVPDLLSVTMLAPPFNTHSFSMNQRLLVLSVGD  519

Query  239  V-----AKDTISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
            V     +       AP S   APP +Y++F  H+ +PS+G+W+ I+
Sbjct  520  VKVSGNSSSEFEVTAPGSAVLAPPTFYMLFAVHQDIPSEGIWIKIQ  565



>emb|CDX92518.1| BnaA10g15570D [Brassica napus]
Length=564

 Score = 78.6 bits (192),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 55/99 (56%), Gaps = 6/99 (6%)
 Frame = -3

Query  398  SQTELVYGKNFNIHFKXDDA-XDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTSV-----  237
            S  ++ YG+NFN+    +       S+K+TM  P FTTH      RM +LG+  V     
Sbjct  465  SPKQIRYGQNFNVKVNLNQKDVTKQSLKLTMLAPSFTTHSISMNMRMLLLGVGGVNPAGG  524

Query  236  AKDTISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
            A   I  VAP SG  APPGYYL+F  ++GVPS G W+ I
Sbjct  525  ASFEIQTVAPPSGNVAPPGYYLLFAVYKGVPSTGEWIQI  563



>ref|XP_006400519.1| hypothetical protein EUTSA_v10012975mg [Eutrema salsugineum]
 gb|ESQ41972.1| hypothetical protein EUTSA_v10012975mg [Eutrema salsugineum]
Length=622

 Score = 79.0 bits (193),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 56/106 (53%), Gaps = 6/106 (6%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDA-XDMSSIKVTMYPPPFTTHGYXEGQRMXILGLT  243
            P+IV   +  ++ YG+NFN+    +       ++KV M  P FTTH      RM  LG+ 
Sbjct  516  PKIVNNATPKQIRYGQNFNVKVDLNQKDVTKENLKVHMLAPSFTTHSISMNMRMLFLGIV  575

Query  242  SV-----AKDTISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
             V         I  VAP +G  APPGYYLIF  ++GVPS G W+ I
Sbjct  576  GVNPAGAGSFEIQTVAPPNGNIAPPGYYLIFAVYKGVPSIGEWIQI  621



>ref|XP_006400518.1| hypothetical protein EUTSA_v10012975mg [Eutrema salsugineum]
 gb|ESQ41971.1| hypothetical protein EUTSA_v10012975mg [Eutrema salsugineum]
Length=595

 Score = 79.0 bits (193),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 42/106 (40%), Positives = 56/106 (53%), Gaps = 6/106 (6%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDA-XDMSSIKVTMYPPPFTTHGYXEGQRMXILGLT  243
            P+IV   +  ++ YG+NFN+    +       ++KV M  P FTTH      RM  LG+ 
Sbjct  489  PKIVNNATPKQIRYGQNFNVKVDLNQKDVTKENLKVHMLAPSFTTHSISMNMRMLFLGIV  548

Query  242  SV-----AKDTISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
             V         I  VAP +G  APPGYYLIF  ++GVPS G W+ I
Sbjct  549  GVNPAGAGSFEIQTVAPPNGNIAPPGYYLIFAVYKGVPSIGEWIQI  594



>emb|CDY62245.1| BnaC01g42480D [Brassica napus]
Length=552

 Score = 78.6 bits (192),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 38/94 (40%), Positives = 53/94 (56%), Gaps = 6/94 (6%)
 Frame = -3

Query  380  YGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTSVAKD------TIS  219
            Y + FN++F       +  + V +  P FTTH +   QRM IL L SV  +       I 
Sbjct  459  YKRLFNVNFSIPQFLTIDLLSVRIVAPSFTTHSFAMNQRMVILKLLSVTHEDLTNSYKID  518

Query  218  AVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
            A+ PS+ + APPGYY+IF+ H G+PS G WV I+
Sbjct  519  ALGPSTAEIAPPGYYMIFLVHAGIPSSGFWVQIE  552



>ref|XP_008352131.1| PREDICTED: LOW QUALITY PROTEIN: galactose oxidase-like [Malus 
domestica]
Length=402

 Score = 77.8 bits (190),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 57/105 (54%), Gaps = 5/105 (5%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTS  240
            P+I++  SQ ++ YG+   I F        + + VTM  P F TH +   QR+ +L   +
Sbjct  297  PRIIDPKSQAKISYGRKLFIRFSLTGNIATNLVSVTMVAPSFNTHSFSMNQRLLVLXAET  356

Query  239  VAKD-----TISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
            V K       +    P+SG  AP GYYL++V H+ +PS+G+WV I
Sbjct  357  VRKVWEMTYQVQVTTPASGNLAPSGYYLLYVVHQQIPSEGIWVQI  401



>ref|XP_010688268.1| PREDICTED: uncharacterized protein LOC104902254 [Beta vulgaris 
subsp. vulgaris]
Length=551

 Score = 78.2 bits (191),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 48/79 (61%), Gaps = 5/79 (6%)
 Frame = -3

Query  341  AXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTSV-----AKDTISAVAPSSGKXAPPGY  177
            A     I VT+Y PPFTTHGY   QR+ +L +TSV     A   +   AP SG+ APPGY
Sbjct  472  AVQQKDIMVTLYKPPFTTHGYSMNQRLLVLKVTSVVPQQRAAYQLQVEAPPSGEVAPPGY  531

Query  176  YLIFVXHRGVPSKGLWVHI  120
            YL+FV +RGVP    W+ +
Sbjct  532  YLLFVNYRGVPGAASWIQL  550



>gb|KJB27141.1| hypothetical protein B456_004G281100 [Gossypium raimondii]
Length=646

 Score = 78.6 bits (192),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 58/104 (56%), Gaps = 8/104 (8%)
 Frame = -3

Query  413  IVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTSVA  234
            IVEK S  ++ YG+ F +  + +   D   ++VT+Y PPF THG    QR+  LG+    
Sbjct  541  IVEK-SNNQVKYGQKFTVQIRGNGEIDQQKLQVTVYSPPFVTHGISMNQRLIQLGIMEFN  599

Query  233  K------DTISAVAPSSGKXAPPGYYLIFVXHRGVPSK-GLWVH  123
            K      + I   AP +G  APPGYY++FV + GVP +  +WV 
Sbjct  600  KNVAPNTNNIVLQAPMNGNIAPPGYYMLFVNYNGVPCRQSMWVQ  643



>ref|NP_001043851.1| Os01g0677000 [Oryza sativa Japonica Group]
 dbj|BAB90014.1| glyoxal oxidase precursor-like [Oryza sativa Japonica Group]
 dbj|BAF05765.1| Os01g0677000 [Oryza sativa Japonica Group]
 dbj|BAG97907.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE55169.1| hypothetical protein OsJ_02994 [Oryza sativa Japonica Group]
Length=624

 Score = 78.6 bits (192),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 40/92 (43%), Positives = 52/92 (57%), Gaps = 5/92 (5%)
 Frame = -3

Query  380  YGKNFNIHFKXD-DAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTSVA----KDTISA  216
            YG  F   F            KVTMY PPFTTHGY   QR+ IL +T+ A    + T++ 
Sbjct  531  YGARFTFRFTTPAQGVGQGDFKVTMYAPPFTTHGYSMNQRLLILPVTAFAAQGQRHTVTV  590

Query  215  VAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
             AP   + APPGYY+++V  +GVPSK  WV +
Sbjct  591  DAPPKPELAPPGYYMVYVVAKGVPSKAAWVKM  622



>gb|KDP38596.1| hypothetical protein JCGZ_04521 [Jatropha curcas]
Length=550

 Score = 78.2 bits (191),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 39/103 (38%), Positives = 59/103 (57%), Gaps = 5/103 (5%)
 Frame = -3

Query  413  IVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXIL---GLT  243
            IV   S+ ++ Y +   + FK     D +++ VTM  P FTTH +   QR+ +L    +T
Sbjct  447  IVSPASKAKIGYAQKLLVRFKVAGRLDTNTVSVTMIAPSFTTHSFSMNQRLLVLENEKVT  506

Query  242  SVAKDT--ISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
            +V   T  +   AP S   APPGYYL++V H+ +PS+G+WV I
Sbjct  507  NVGTATYNVEVTAPRSPNIAPPGYYLLYVVHQDIPSEGIWVQI  549



>gb|KJB27158.1| hypothetical protein B456_004G281200 [Gossypium raimondii]
Length=632

 Score = 78.6 bits (192),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 39/106 (37%), Positives = 58/106 (55%), Gaps = 7/106 (7%)
 Frame = -3

Query  416  QIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTSV  237
            +I+ + S  +L YG+ F +  + +   D   ++VT+Y PPF THG    QR+  LG+   
Sbjct  525  EIITEKSDNQLKYGQKFTVQIRGNGVIDQQKLQVTIYSPPFVTHGICMNQRLIQLGILEF  584

Query  236  AKD------TISAVAPSSGKXAPPGYYLIFVXHRGVPS-KGLWVHI  120
             KD       I   AP +G  A PGYY++FV + GVP  + +WV I
Sbjct  585  NKDVAPNTNNIVLQAPMNGNIAQPGYYMLFVNYNGVPCLRSMWVQI  630



>gb|KHG10828.1| galactose oxidase [Gossypium arboreum]
Length=614

 Score = 78.2 bits (191),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 37/104 (36%), Positives = 56/104 (54%), Gaps = 7/104 (7%)
 Frame = -3

Query  413  IVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTSVA  234
            I+   S  ++ YGK F +  + +   D   ++VT+Y PPF THG    QR+  LG+    
Sbjct  508  IIADKSNNQVKYGKKFTVQIRGNGEIDQQKLQVTIYSPPFVTHGISMNQRLIQLGIVEFN  567

Query  233  K------DTISAVAPSSGKXAPPGYYLIFVXHRGVPSK-GLWVH  123
            K      + I   AP +G  APPGYY++F+ + GVP +  +WV 
Sbjct  568  KNVTPNTNNIILQAPMNGNIAPPGYYMLFINYNGVPCRQSMWVQ  611



>ref|XP_007013099.1| Glyoxal oxidase-related protein, putative [Theobroma cacao]
 gb|EOY30718.1| Glyoxal oxidase-related protein, putative [Theobroma cacao]
Length=630

 Score = 78.2 bits (191),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 41/108 (38%), Positives = 60/108 (56%), Gaps = 8/108 (7%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFK-XDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLT  243
            P+IV   S  ++ YGK F +  +  D   D   ++V +Y P FTTHG    QR+  LG+ 
Sbjct  521  PEIVPDQSANKIHYGKRFTVQIRGADRTLDDEDLQVNIYYPAFTTHGISMNQRLVRLGIV  580

Query  242  SVAKD------TISAVAPSSGKXAPPGYYLIFVXHRGVP-SKGLWVHI  120
             V K+      +I   AP +G  APPGYY++FV  +GVP  + +WV +
Sbjct  581  QVDKNVSSRTHSIKVQAPINGNIAPPGYYMLFVIQKGVPCRRAMWVQM  628



>ref|XP_007030653.1| Glyoxal oxidase-related protein [Theobroma cacao]
 gb|EOY11155.1| Glyoxal oxidase-related protein [Theobroma cacao]
Length=558

 Score = 78.2 bits (191),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 42/109 (39%), Positives = 58/109 (53%), Gaps = 10/109 (9%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTS  240
            PQI+      ++ YGK+F + F   D    S + V +  P FTTH +   QRM +L +  
Sbjct  452  PQILSL--DEKIRYGKSFWLSFSVKDYLTASVLSVRIVAPSFTTHSFAMNQRMVVLKIVG  509

Query  239  VAKDT--------ISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
            V            +S V PS+   APPGYYL+FV H G+PS G+WV I+
Sbjct  510  VTTLLPPAPYAYGLSMVGPSTAAIAPPGYYLLFVLHAGIPSSGMWVKIE  558



>ref|XP_008350494.1| PREDICTED: galactose oxidase-like [Malus domestica]
Length=537

 Score = 78.2 bits (191),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 60/105 (57%), Gaps = 5/105 (5%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTS  240
            P I+  L+Q ++ YG    I F       M+S+ VTM  PPF+TH +   QR+ +LG  +
Sbjct  432  PTILTPLNQAKIHYGIKLTIQFSLTGTLAMNSVSVTMVAPPFSTHSFSMNQRLLVLGAEN  491

Query  239  VAK---DTISA--VAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
            V +    T  A    P SG  AP GYY+++V H+ +PS+G++V I
Sbjct  492  VQQVGPTTYQAQVTTPPSGNLAPSGYYILYVVHQQIPSEGIFVQI  536



>gb|EMS66740.1| hypothetical protein TRIUR3_22174 [Triticum urartu]
Length=95

 Score = 73.2 bits (178),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 51/93 (55%), Gaps = 5/93 (5%)
 Frame = -3

Query  380  YGKNFNIHFKXD-DAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTSVAKD----TISA  216
            YG  +   F+   D    + + VT+Y PPFTTHGY   Q + IL LTS   D     I+ 
Sbjct  3    YGAKYTFRFRTPLDPVVEADVMVTLYAPPFTTHGYSMNQCLLILSLTSFIADPQGYAITV  62

Query  215  VAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
             AP   + APP YYL++V  + VPS  +WV I+
Sbjct  63   DAPGKPELAPPAYYLVYVLAKDVPSVAVWVKIQ  95



>ref|XP_004238325.1| PREDICTED: galactose oxidase-like [Solanum lycopersicum]
Length=547

 Score = 77.8 bits (190),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 41/105 (39%), Positives = 55/105 (52%), Gaps = 5/105 (5%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTS  240
            PQI+   S  +  YG+  +I F      +   IKVTM  P F TH     QRM +L    
Sbjct  442  PQIISPDSHLKFTYGQRVDIRFTALGLLNRDLIKVTMVAPGFNTHSNTMNQRMLVLPRGI  501

Query  239  VAK-----DTISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
            V +       +S V P SG  APPGYYL+FV H+ +PS+ +WV +
Sbjct  502  VRQVGRFVYEVSCVFPKSGSLAPPGYYLLFVVHQDIPSEAIWVRV  546



>ref|XP_010670864.1| PREDICTED: galactose oxidase-like [Beta vulgaris subsp. vulgaris]
Length=617

 Score = 78.2 bits (191),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 58/108 (54%), Gaps = 7/108 (6%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTS  240
            P I+   S +++ Y +   + F      D +SI VTM  PPF TH +   QR+ +L  T 
Sbjct  510  PIIITPDSGSKVQYAQVLEVKFLVFGLIDQASIMVTMLRPPFNTHSFSMSQRLLVLTNTM  569

Query  239  VAKDTI-------SAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
             +  +I       +   P S   +PPGYYL+FV H+G+PS G+WV IK
Sbjct  570  QSATSIGPNQFQVNVTTPESTNISPPGYYLLFVVHQGIPSTGIWVQIK  617



>ref|XP_008367966.1| PREDICTED: galactose oxidase-like [Malus domestica]
Length=540

 Score = 77.8 bits (190),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 57/105 (54%), Gaps = 5/105 (5%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTS  240
            P+IV+  SQ ++ YGK   I F    +   + + VT+  P F TH +   QR+ +L   +
Sbjct  435  PRIVDPKSQAKISYGKKLFIRFSLXGSIATNLVMVTIVAPSFNTHSFSMNQRLLVLAAET  494

Query  239  VAKD-----TISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
            V K       +    P SG  AP GYYL++V H+ +PS+G+WV I
Sbjct  495  VKKVGTMTYQVQVTTPGSGNLAPSGYYLLYVVHQQIPSEGIWVQI  539



>ref|XP_008338258.1| PREDICTED: galactose oxidase-like [Malus domestica]
Length=540

 Score = 77.8 bits (190),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 57/105 (54%), Gaps = 5/105 (5%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTS  240
            P+IV+  SQ ++ YGK   I F    +   + + VT+  P F TH +   QR+ +L   +
Sbjct  435  PRIVDPKSQAKISYGKKLFIRFSLXGSIATNLVMVTIVAPSFNTHSFSMNQRLLVLAAET  494

Query  239  VAKD-----TISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
            V K       +    P SG  AP GYYL++V H+ +PS+G+WV I
Sbjct  495  VKKVGTMTYQVQVTTPGSGNLAPSGYYLLYVVHQQIPSEGIWVQI  539



>ref|XP_010504696.1| PREDICTED: galactose oxidase-like [Camelina sativa]
Length=547

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 39/100 (39%), Positives = 55/100 (55%), Gaps = 6/100 (6%)
 Frame = -3

Query  398  SQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTSVAKDT--  225
            S   L Y + FN+ F       +  + V +  P FTTH +   QRM IL L SV +D   
Sbjct  448  SDKVLGYKRLFNVDFSIPQFLTVDLLSVRIVAPSFTTHSFAMNQRMVILKLLSVTRDQLT  507

Query  224  ----ISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
                +SA+ PS+ + APPGYY++F+ H G+PS   WV I+
Sbjct  508  NSYRVSALGPSTAEIAPPGYYMMFLVHAGIPSSAAWVQIE  547



>ref|NP_176897.1| glyoxal oxidase-related protein [Arabidopsis thaliana]
 gb|AAG00252.1|AC002130_17 F1N21.11 [Arabidopsis thaliana]
 gb|AAO22637.1| putative glyoxal oxidase (glx1) [Arabidopsis thaliana]
 gb|AAO42437.1| putative glyoxal oxidase (glx1) [Arabidopsis thaliana]
 gb|AEE34623.1| glyoxal oxidase-related protein [Arabidopsis thaliana]
Length=615

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 59/107 (55%), Gaps = 8/107 (7%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFN--IHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGL  246
            P+IV   +  ++ YG+ F+  I  K  +     ++ VTM  P FTTH      R+ +LG+
Sbjct  509  PRIVNTATPKQIKYGQMFDVKIELKQQNVAK-ENVMVTMLAPSFTTHSVSMNMRLLMLGI  567

Query  245  TSVAK-----DTISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
             +V         I AVAP SGK APPGYYL+F  + GVPS G W+ I
Sbjct  568  NNVKNVGGDNHQIQAVAPPSGKLAPPGYYLLFAVYNGVPSVGEWIQI  614



>ref|XP_002888587.1| hypothetical protein ARALYDRAFT_475824 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64846.1| hypothetical protein ARALYDRAFT_475824 [Arabidopsis lyrata subsp. 
lyrata]
Length=599

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 59/107 (55%), Gaps = 8/107 (7%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFN--IHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGL  246
            P+IV   +  ++ YG+ F+  I  K  +     ++ VTM  P FTTH      R+ +LG+
Sbjct  493  PRIVNTATPKQIKYGQMFDVKIELKQQNVAK-ENVMVTMLAPSFTTHSVSMNMRLLMLGI  551

Query  245  TSVAK-----DTISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
             +V         I AVAP SGK APPGYYL+F  + GVPS G W+ I
Sbjct  552  NNVKNVGGDNHQIQAVAPPSGKVAPPGYYLLFAVYNGVPSVGEWIQI  598



>gb|KJB27159.1| hypothetical protein B456_004G281300 [Gossypium raimondii]
Length=633

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 38/106 (36%), Positives = 57/106 (54%), Gaps = 7/106 (7%)
 Frame = -3

Query  416  QIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTSV  237
            +I+ + S  +L YG+ F +  +     D   ++VT+Y PPF THG    QR+  LG+   
Sbjct  526  EIIAEKSNNKLKYGQKFTVQIRGSGVIDQQKLQVTIYSPPFVTHGICMNQRLIQLGILEF  585

Query  236  AKDTISAV------APSSGKXAPPGYYLIFVXHRGVPS-KGLWVHI  120
             KD I         AP +G  A PGYY++FV + GVP  + +W+ I
Sbjct  586  NKDVIPNTNNIVLQAPMNGNIAQPGYYMLFVNYNGVPCLRSIWIQI  631



>ref|XP_004963606.1| PREDICTED: galactose oxidase-like [Setaria italica]
Length=622

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 40/92 (43%), Positives = 53/92 (58%), Gaps = 5/92 (5%)
 Frame = -3

Query  380  YGKNFNIHFKX-DDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTSVAKD----TISA  216
            YG  F   F    +    + +KVTMY PPFTTHGY   QR+ IL +T+  ++    T++ 
Sbjct  530  YGSPFTFRFSMPSEPVGEADVKVTMYAPPFTTHGYSMNQRLLILSVTAFREEGRSYTVTV  589

Query  215  VAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
             AP   + AP GYYL+FV  +GVPS   WV I
Sbjct  590  DAPGKPELAPRGYYLVFVVAKGVPSVAAWVKI  621



>ref|XP_009797023.1| PREDICTED: galactose oxidase-like [Nicotiana sylvestris]
Length=551

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 39/107 (36%), Positives = 57/107 (53%), Gaps = 6/107 (6%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTS  240
            P+I+   S  +  YG+  +I F      +   +KVTM  P F TH +   QRM +L  + 
Sbjct  445  PRIISPASHLKYTYGQRVDILFTASGLLNRDLVKVTMVAPGFNTHSFTMNQRMLVLPRSG  504

Query  239  VAKDT------ISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
            + +        IS V P SG  AP GYYL+FV H+ +PS+ +WV I+
Sbjct  505  MVRQVGRFVYQISCVFPKSGIFAPLGYYLLFVVHQDIPSEAIWVRIQ  551



>ref|XP_009388162.1| PREDICTED: galactose oxidase-like [Musa acuminata subsp. malaccensis]
Length=544

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 41/107 (38%), Positives = 58/107 (54%), Gaps = 7/107 (7%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTS  240
            P+IV   S   L YGK F++ F      D   ++VTM  P F TH +   QR+ +L   +
Sbjct  439  PRIVTSPSPLRLSYGKRFSLQFTAGAVGD-EGVRVTMVAPSFATHSFSMNQRLLVLETEA  497

Query  239  VAKDT------ISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
             AK        + A+AP+S   AP GYY++FV + GVPS+  W HI+
Sbjct  498  AAKAADSGTYQVMAMAPASAILAPSGYYMVFVVNGGVPSESNWAHIQ  544



>emb|CDP07430.1| unnamed protein product [Coffea canephora]
Length=561

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 37/107 (35%), Positives = 62/107 (58%), Gaps = 6/107 (6%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTS  240
            P+I+  +SQ+++ YG+   I F        + + VTM  P F TH +   QR+ +LG  +
Sbjct  455  PRIISPVSQSQIGYGRQLVIRFSVSGQLKGNLVTVTMAAPSFNTHSFSMNQRLLVLGGDN  514

Query  239  V-----AKDTISAVAPSSGKXAPPGYYLIF-VXHRGVPSKGLWVHIK  117
            V     +    + + PS+   APPG+YL+F V H+ +PS+G+WVH++
Sbjct  515  VKIAGNSTYQTAVLTPSTSSLAPPGFYLLFVVVHQDIPSQGIWVHLQ  561



>dbj|BAL41451.1| glyoxal oxidase 2 [Linum grandiflorum]
Length=693

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 60/109 (55%), Gaps = 8/109 (7%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDM---SSIKVTMYPPPFTTHGYXEGQRMXILG  249
            P I   ++   LVY +   + FK  D   +   +++KVTMY P FTTH      R+  LG
Sbjct  585  PVIDAAVTPATLVYNQKIVVQFKMTDQQQVVQQANLKVTMYVPAFTTHSISMNMRLLDLG  644

Query  248  LTSVAKD-----TISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
            L SV  +     +I    P   K AP GYYL+FV ++GVPS+G+WV IK
Sbjct  645  LDSVKPNGPGVYSIDVWTPPDTKVAPTGYYLLFVVNQGVPSEGIWVQIK  693



>gb|EYU38846.1| hypothetical protein MIMGU_mgv1a027114mg [Erythranthe guttata]
Length=479

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 60/106 (57%), Gaps = 6/106 (6%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAX-DMSSIKVTMYPPPFTTHGYXEGQRMXIL---  252
            P++V    QT++ YG+   I F       + +S+ VTM  P FTTH +   QR+ +L   
Sbjct  373  PRVVSPGPQTKIGYGQKLPIRFTIPPGRLNSTSVMVTMVAPSFTTHSFSMNQRLLVLTRA  432

Query  251  GLTSVAKDT--ISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
             L  V K T  I    P SG  APPGYY++FV H+ +PS+G+W+ I
Sbjct  433  DLKPVGKSTYQIRVDTPGSGNLAPPGYYMLFVVHQDIPSEGVWIQI  478



>ref|XP_009335425.1| PREDICTED: galactose oxidase-like [Pyrus x bretschneideri]
Length=547

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 58/105 (55%), Gaps = 5/105 (5%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILG---  249
            P+IV   SQ  + Y +   + F        + + VTM  P FTTH +   QR+ +L    
Sbjct  442  PKIVAPKSQGTITYAQKLAVRFSVTGTVATNLVSVTMVAPSFTTHSFSMNQRVLVLAAES  501

Query  248  LTSVAKDTISAV--APSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
            +T+VA  T  A+   P SG  AP GYYL++V H+ +PS+G+WV I
Sbjct  502  VTNVALSTYQALVTTPGSGHLAPSGYYLLYVVHQSIPSEGIWVQI  546



>gb|EPS72896.1| hypothetical protein M569_01859, partial [Genlisea aurea]
Length=516

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 36/95 (38%), Positives = 58/95 (61%), Gaps = 7/95 (7%)
 Frame = -3

Query  386  LVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTSVAKDT------  225
            L Y K F + F  + + + S++ V +  PPF+TH +   QRM +L + +++ D+      
Sbjct  423  LSYHKPFTVDFTAE-SLNPSAVTVRLLAPPFSTHSFSMNQRMVVLKIAAISCDSSRMRCH  481

Query  224  ISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
            ++A APS+ + APPGYYL+FV H  +PS G W+ I
Sbjct  482  VNAAAPSTAEIAPPGYYLLFVVHCEIPSHGSWIKI  516



>ref|XP_010532465.1| PREDICTED: galactose oxidase-like [Tarenaya hassleriana]
Length=607

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/107 (36%), Positives = 61/107 (57%), Gaps = 7/107 (7%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAX-DMSSIKVTMYPPPFTTHGYXEGQRMXILGLT  243
            P+IV   S   + +G+ F++  + +      + +++TM  P FTTH      RM +LG++
Sbjct  500  PRIVANGSPKHVRFGQKFSVRIQLNQTKFHKNEVRLTMLAPSFTTHSISMNMRMVLLGVS  559

Query  242  SVAKDT------ISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
            +VA +       I  +AP SG  APPGYYL+F  ++GVPS G W+ +
Sbjct  560  NVAHNVSPNVHEIQTLAPPSGNIAPPGYYLLFAVYKGVPSVGEWIQV  606



>ref|XP_008813838.1| PREDICTED: galactose oxidase-like [Phoenix dactylifera]
Length=548

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 59/108 (55%), Gaps = 8/108 (7%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTS  240
            P+I+E  +   L YGK F++ FK     +   + VTM  P F+TH +   QR+ IL  + 
Sbjct  442  PRIIEPRTPLMLNYGKQFSLRFKARLTSN-EGVSVTMVAPSFSTHSFSMNQRLLILKSSK  500

Query  239  VAK-------DTISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
             A          I AVAP S   APPGYY+ F+ +  +P +G+WVHI+
Sbjct  501  AATIPSGSSTHEIGAVAPKSRILAPPGYYMFFIVNGRIPGEGIWVHIQ  548



>ref|XP_010924630.1| PREDICTED: uncharacterized protein LOC105047413 [Elaeis guineensis]
Length=590

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 46/92 (50%), Positives = 54/92 (59%), Gaps = 5/92 (5%)
 Frame = -3

Query  380  YGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXIL-----GLTSVAKDTISA  216
            YG+NF I F   +  +   + VTMY PPFTTHG    QR+ IL        SV    I+ 
Sbjct  497  YGRNFTIAFTTTEPVERDDLMVTMYAPPFTTHGISMNQRLLILKTEEFATKSVGSYAITV  556

Query  215  VAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
            VAP S   APPGYYL+ V HRGVPSK +WV I
Sbjct  557  VAPPSAAYAPPGYYLVHVVHRGVPSKAVWVKI  588



>ref|XP_007017716.1| Glyoxal oxidase-related protein [Theobroma cacao]
 gb|EOY14941.1| Glyoxal oxidase-related protein [Theobroma cacao]
Length=546

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 39/106 (37%), Positives = 58/106 (55%), Gaps = 5/106 (5%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILG---  249
            P IV   S +E+ YGK   +          + + VTM  P FTTH +   QR+ +LG   
Sbjct  441  PTIVAPKSSSEIQYGKKLTVQVLITGKVAPNLVSVTMVAPSFTTHSFSMNQRVLVLGNDK  500

Query  248  LTSVAKDT--ISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
            +T++ K T  I    P S   AP G+YL+FV H+ +PS+G+WV ++
Sbjct  501  VTALEKSTYNIDVTTPRSANLAPAGFYLLFVVHQDIPSQGIWVKLR  546



>ref|XP_007039386.1| Glyoxal oxidase-related protein [Theobroma cacao]
 gb|EOY23887.1| Glyoxal oxidase-related protein [Theobroma cacao]
Length=569

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 54/107 (50%), Gaps = 6/107 (6%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTS  240
            P I+      +L Y +  ++ F  +   +   + VTM  P FTTH     QR+ +L L  
Sbjct  460  PSILAVRPGLKLGYKQKVSLEFTLEGNVNQGDVYVTMVAPSFTTHSIAMNQRLLVLALDE  519

Query  239  VAKDT------ISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
              K T      +   AP +   APPGYY +F+ H G+PSKG WVHIK
Sbjct  520  GVKKTPSGNYLVKGYAPETAALAPPGYYQLFLVHEGIPSKGTWVHIK  566



>ref|XP_011457694.1| PREDICTED: galactose oxidase-like [Fragaria vesca subsp. vesca]
Length=547

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 54/106 (51%), Gaps = 5/106 (5%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTS  240
            P I+   SQ  L YG+   I F       ++S+ +TM  P FTTH +    R+ +L    
Sbjct  442  PSIISPGSQVRLGYGRRLAIRFSITGTIALNSVSITMVSPSFTTHSFAMNHRLVVLASEK  501

Query  239  V-----AKDTISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
            V     +   +    P+SG  AP GYYL+ V H+ +PS G+WV I+
Sbjct  502  VKALKNSTFQVQVTTPASGNLAPAGYYLLHVVHQKIPSAGIWVKIR  547



>ref|XP_011074991.1| PREDICTED: galactose oxidase-like [Sesamum indicum]
Length=544

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 44/107 (41%), Positives = 60/107 (56%), Gaps = 7/107 (7%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDM-SSIKVTMYPPPFTTHGYXEGQRMXIL-GL  246
            P+IV   +QT++ Y +   + F   D  +  +SI VTM  P FTTH     QR+ +L G 
Sbjct  437  PRIVSPTAQTKIGYNQQLTVLFTFPDNLNRDASIMVTMVAPAFTTHSCSMNQRLIVLSGG  496

Query  245  TSVAKD-----TISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
               A D      I  + PSSG  A PG+YL+FV H+ VPS+G+WV I
Sbjct  497  NVTAADGRSTYQIRVMTPSSGNIAQPGFYLLFVVHQDVPSEGIWVQI  543



>ref|XP_008387970.1| PREDICTED: galactose oxidase-like [Malus domestica]
Length=547

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 54/105 (51%), Gaps = 5/105 (5%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTS  240
            P+IV   SQ  + Y +   + F        + + VTM  P FTTH +   QR+ +L   S
Sbjct  442  PKIVAPNSQGTITYAQKLAVRFSVTGTLATNLVSVTMVAPSFTTHSFSMNQRVLVLAAES  501

Query  239  VAKDTISA-----VAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
            V    +S        P SG  AP GYYL++V H+ +PS+G+WV +
Sbjct  502  VTNVALSTYQVLVTTPGSGNLAPSGYYLLYVVHQSIPSEGIWVQV  546



>ref|XP_008350495.1| PREDICTED: galactose oxidase-like [Malus domestica]
Length=536

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 59/105 (56%), Gaps = 5/105 (5%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTS  240
            P I+   +Q ++ YG+   + F       M+S+ VTM  PPF+TH +   QR+ +LG  +
Sbjct  431  PTIIAPRNQAKIRYGRKLTVQFSLAGRFAMNSVSVTMVAPPFSTHSFSMNQRLLVLGAEN  490

Query  239  ---VAKDTISA--VAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
               V   T  A    P SG  AP GYY+++V H+ +PS+G++V I
Sbjct  491  THQVGPTTYEAQVTTPPSGNLAPSGYYILYVVHQQIPSEGIFVKI  535



>ref|XP_004239377.1| PREDICTED: galactose oxidase-like [Solanum lycopersicum]
Length=567

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 53/93 (57%), Gaps = 5/93 (5%)
 Frame = -3

Query  380  YGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTSVAK-----DTISA  216
            YG+ F+I F    + D + + VTM  P FTTH +   QR+ IL +  + +       I+ 
Sbjct  475  YGQEFSITFTLGVSQDTNEVMVTMVAPSFTTHSFAMNQRLLILDIVKIQQVSSFDQKITV  534

Query  215  VAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
             AP S   APPGYY++FV H+GVP   +WV ++
Sbjct  535  YAPPSRNIAPPGYYMVFVVHQGVPGHSIWVKME  567



>gb|EYU23055.1| hypothetical protein MIMGU_mgv1a021812mg, partial [Erythranthe 
guttata]
Length=517

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 39/106 (37%), Positives = 57/106 (54%), Gaps = 7/106 (7%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTS  240
            P+IVE   +  L Y   F + F+  +   MS + V +  PPF TH +   QRM +L    
Sbjct  414  PRIVE--IEETLGYTAPFLVRFRVPEFRRMSEVSVRIVAPPFNTHSFSMNQRMVVLRWDE  471

Query  239  VAK-----DTISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
             A        ++A  PS+ + APPGYYL+F+ H G+PS G W+ I+
Sbjct  472  AAYIGGDVYEVAAFGPSTAEIAPPGYYLLFLVHSGIPSSGAWIKIQ  517



>gb|KHG29502.1| galactose oxidase [Gossypium arboreum]
Length=488

 Score = 75.9 bits (185),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 42/104 (40%), Positives = 61/104 (59%), Gaps = 8/104 (8%)
 Frame = -3

Query  413  IVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLT---  243
            IVEK S  ++ YG+   I  + +   D   ++VT+Y PPF THG    QR+  LG+    
Sbjct  383  IVEK-SNNQVKYGQKLTIQIRGNGEIDQQKLQVTVYSPPFVTHGISMNQRLIQLGIVEFN  441

Query  242  -SVAKDTISAV--APSSGKXAPPGYYLIFVXHRGVPSK-GLWVH  123
             +VA +T + V  AP +G  APPGYY++FV + GVP +  +WV 
Sbjct  442  KNVAPNTNNIVLQAPMNGNIAPPGYYMLFVNYNGVPCRQSMWVQ  485



>ref|XP_010670858.1| PREDICTED: galactose oxidase-like [Beta vulgaris subsp. vulgaris]
Length=545

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/106 (36%), Positives = 58/106 (55%), Gaps = 6/106 (6%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXIL----  252
            P I   +S + + YG+   + F    + ++  IKVTM  PPF TH +   QR+ +L    
Sbjct  439  PIINVPISGSRIRYGEVIKVKFLIVGSNNLDLIKVTMLRPPFNTHSFSMSQRLLVLTNTK  498

Query  251  --GLTSVAKDTISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
               LT   +  ++ + P S   APPG+Y+ FV H+ VPSKG+WV +
Sbjct  499  PVKLTGTGQFQVNIMIPGSANIAPPGFYIFFVVHQNVPSKGVWVQL  544



>ref|XP_002299426.2| hypothetical protein POPTR_0001s11390g, partial [Populus trichocarpa]
 gb|EEE84231.2| hypothetical protein POPTR_0001s11390g, partial [Populus trichocarpa]
Length=563

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 52/96 (54%), Gaps = 7/96 (7%)
 Frame = -3

Query  392  TELVYGKNFNIHFKXDD-AXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTSVAKDT---  225
            T L Y + F +HF       ++  I VTM  P FT+H Y   QR+ +L L S A+     
Sbjct  451  TNLEYKQKFTMHFHIHQWHEELGKIYVTMVAPSFTSHSYSMNQRLLVLALDSEAQKVDFS  510

Query  224  ---ISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWV  126
               +   AP++   APPGYY +FV H GVPSKG WV
Sbjct  511  NYVVDVHAPATATLAPPGYYQLFVVHEGVPSKGTWV  546



>gb|KJB27154.1| hypothetical protein B456_004G281000 [Gossypium raimondii]
Length=677

 Score = 76.3 bits (186),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 58/106 (55%), Gaps = 7/106 (7%)
 Frame = -3

Query  416  QIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTSV  237
            +I+ + S  ++ YG+ F +  + +   D   ++VT+Y PPF THG    QR+  LG+   
Sbjct  570  EIIVENSNNQVKYGQKFTVQIRGNVEIDQQKLQVTIYSPPFVTHGVAMNQRLIQLGIVEF  629

Query  236  AK------DTISAVAPSSGKXAPPGYYLIFVXHRGVPS-KGLWVHI  120
             K      + I   AP +   APPGYY++FV + GVP  + +WV I
Sbjct  630  NKNVAINTNNIVLQAPINSNIAPPGYYMLFVNYNGVPCRRSMWVRI  675



>gb|KHG16412.1| galactose oxidase [Gossypium arboreum]
Length=477

 Score = 75.5 bits (184),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 57/105 (54%), Gaps = 8/105 (8%)
 Frame = -3

Query  413  IVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTSVA  234
            IVEK S  ++ YG+ F    + +   D   ++VT+Y PPF THG    QR+  LG+    
Sbjct  372  IVEK-SNNQVKYGQKFTAQIRGNVEIDQQKLQVTIYSPPFVTHGVAMNQRLIQLGIVEFN  430

Query  233  K------DTISAVAPSSGKXAPPGYYLIFVXHRGVPS-KGLWVHI  120
            K      + I   AP +   APPGYY++FV + GVP  + +WV I
Sbjct  431  KYVALNTNNIVLQAPINSNIAPPGYYMLFVNYNGVPCRRSMWVRI  475



>ref|XP_010535983.1| PREDICTED: galactose oxidase-like [Tarenaya hassleriana]
Length=588

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 60/107 (56%), Gaps = 7/107 (7%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDM-SSIKVTMYPPPFTTHGYXEGQRMXILGLT  243
            P+IV   +  ++ YG+ F +  + +      + +K+TM  P FTTH      RM +LG++
Sbjct  481  PKIVAGGNPKKIKYGQKFTVKIQLNQPKFWRNDVKLTMLAPSFTTHSISMNMRMLLLGIS  540

Query  242  SVAKDT------ISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
             V  +       I A+AP +G  APPGYYL+F  ++GVPS G W+ I
Sbjct  541  GVTNNVGPNFHDIQAMAPPNGNVAPPGYYLLFAVYKGVPSVGEWIQI  587



>ref|XP_004289629.1| PREDICTED: galactose oxidase-like [Fragaria vesca subsp. vesca]
Length=547

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/106 (34%), Positives = 55/106 (52%), Gaps = 5/106 (5%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTS  240
            P  +   SQ E+ YG+   + F       + ++ VTM  P FTTH +   QR+ IL   +
Sbjct  442  PTTLSPSSQAEVGYGEKLTVSFSITGTIALDTVSVTMVSPSFTTHSFSMNQRLVILASET  501

Query  239  VAKD-----TISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
            V         +    P+SG  AP GY+L++V H+ +PS G+WV I+
Sbjct  502  VRALGNLTFQVEVTTPASGNLAPSGYFLLYVVHQQIPSAGIWVKIR  547



>ref|XP_006290310.1| hypothetical protein CARUB_v10019204mg [Capsella rubella]
 gb|EOA23208.1| hypothetical protein CARUB_v10019204mg [Capsella rubella]
Length=547

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 38/100 (38%), Positives = 54/100 (54%), Gaps = 6/100 (6%)
 Frame = -3

Query  398  SQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTSVAKDT--  225
            S   L Y + FNI F       +  + V +  P FTTH +   QRM IL L SV +D   
Sbjct  448  SDKVLGYKRLFNIDFSIPQFLTVDLLSVRIVAPSFTTHSFAMNQRMVILNLLSVTRDQLT  507

Query  224  ----ISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
                ++ + PS+ + APPGYY++F+ H G+PS   WV I+
Sbjct  508  NSYRVNVLGPSTAEIAPPGYYMMFLVHAGIPSSAAWVQIE  547



>ref|XP_010105253.1| hypothetical protein L484_019396 [Morus notabilis]
 gb|EXC04188.1| hypothetical protein L484_019396 [Morus notabilis]
Length=548

 Score = 75.5 bits (184),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 59/107 (55%), Gaps = 6/107 (6%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDM-SSIKVTMYPPPFTTHGYXEGQRMXILG--  249
            P+IV   SQ+++ Y     + F    A  +  S+ VTM  P FTTH +   QR+ +L   
Sbjct  442  PKIVSPPSQSKVSYLNKLAVRFTVSGATLLPGSVAVTMVAPSFTTHSFSMNQRLLVLSAE  501

Query  248  -LTSVAKDT--ISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
             +TS+ K T  +    P SG  AP GYYL FV H+ +PS G+WV I+
Sbjct  502  SMTSLGKSTYEVRVTTPGSGILAPSGYYLWFVVHQEIPSDGIWVQIQ  548



>ref|XP_006382737.1| glyoxal oxidase-related family protein [Populus trichocarpa]
 gb|ERP60534.1| glyoxal oxidase-related family protein [Populus trichocarpa]
Length=550

 Score = 75.1 bits (183),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 36/92 (39%), Positives = 52/92 (57%), Gaps = 5/92 (5%)
 Frame = -3

Query  377  GKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTSVAKD-----TISAV  213
            G+ F + F  ++    S + V +  P FTTH +   QRM +L +  +  D     T S  
Sbjct  459  GQRFLVSFSVEEYLTQSVLSVRIVAPSFTTHSFSMNQRMVVLKIDDIIYDDTSSYTSSVF  518

Query  212  APSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
             PSS + APPGYY++FV H G+PS G+WV I+
Sbjct  519  GPSSSEIAPPGYYMLFVVHSGIPSSGVWVRIQ  550



>ref|XP_008218222.1| PREDICTED: galactose oxidase [Prunus mume]
Length=553

 Score = 75.1 bits (183),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 39/95 (41%), Positives = 57/95 (60%), Gaps = 5/95 (5%)
 Frame = -3

Query  386  LVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXIL---GLTSVAKDT--I  222
            L Y + F++ F   +   +S + V +  P FTTH +   QRM ++   G+T VA +T  I
Sbjct  459  LGYRQFFSVAFAVPELLSVSVLSVRLVAPSFTTHSFAMNQRMIVMKLIGVTRVAPETYEI  518

Query  221  SAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
            S V PS+G+ APPGYYL+FV H  +PS   WV ++
Sbjct  519  SLVGPSTGEIAPPGYYLLFVVHADIPSSAAWVKLQ  553



>ref|XP_002514260.1| Galactose oxidase precursor, putative [Ricinus communis]
 gb|EEF48214.1| Galactose oxidase precursor, putative [Ricinus communis]
Length=613

 Score = 75.5 bits (184),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 54/97 (56%), Gaps = 7/97 (7%)
 Frame = -3

Query  386  LVYGKNFNIHFKXDD-AXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTSVAKD------  228
            L YG  F +  K      +   +KVTMY P FTTHG    QR+  LGL  V  +      
Sbjct  517  LFYGGEFMVQIKLKGLKVEQQDLKVTMYAPAFTTHGVSMNQRLIDLGLKKVESNPLLGLH  576

Query  227  TISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
            +I++VAP S   APPGYY++ V ++GVPS   WV IK
Sbjct  577  SIASVAPPSSTIAPPGYYMLSVVYQGVPSVSKWVQIK  613



>ref|XP_004499224.1| PREDICTED: galactose oxidase-like [Cicer arietinum]
Length=549

 Score = 75.1 bits (183),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 38/107 (36%), Positives = 62/107 (58%), Gaps = 7/107 (7%)
 Frame = -3

Query  419  PQIVEKLS--QTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXIL--  252
            P+I+  +S  QT+L YG+   + F+     D + + VT+  PPF TH +   QR+ +L  
Sbjct  442  PKIMSHISESQTKLRYGQKLVLRFQVKTTLDRNLLYVTLLAPPFNTHSFSMNQRLLVLEP  501

Query  251  -GLTSVAKDTISAVA--PSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
              + +VA  T   V   P S   APPG+Y++FV H+ +PS+G+W+ +
Sbjct  502  NKVNNVAGTTYEIVVTIPGSTILAPPGFYMLFVVHKEIPSEGIWIQM  548



>gb|KEH36231.1| glyoxal oxidase amino-terminal protein [Medicago truncatula]
Length=555

 Score = 75.1 bits (183),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 37/102 (36%), Positives = 55/102 (54%), Gaps = 9/102 (9%)
 Frame = -3

Query  398  SQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTSVAKDTI-  222
            SQT+L Y +   + F+       + + VTMY P F TH +   QR+ +L   S +K+ + 
Sbjct  453  SQTKLKYAQKLKVRFQVKATLMKNMVSVTMYAPSFNTHSFSMNQRLLVLDELSSSKNVVG  512

Query  221  --------SAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
                        P+S   APPGYYL+FV H+ VPS+G+WV +
Sbjct  513  ESTSTYQVEVAIPNSPILAPPGYYLLFVVHQEVPSQGVWVQL  554



>ref|XP_007208189.1| hypothetical protein PRUPE_ppa020922mg, partial [Prunus persica]
 gb|EMJ09388.1| hypothetical protein PRUPE_ppa020922mg, partial [Prunus persica]
Length=528

 Score = 75.1 bits (183),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 39/95 (41%), Positives = 57/95 (60%), Gaps = 5/95 (5%)
 Frame = -3

Query  386  LVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXIL---GLTSVAKDT--I  222
            L Y + F++ F   +   +S + V +  P FTTH +   QRM ++   G+T VA +T  I
Sbjct  434  LGYRQFFSVAFAVPELLSVSVLSVRLVAPSFTTHSFAMNQRMIVMKLIGVTRVAPETYEI  493

Query  221  SAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
            S V PS+G+ APPGYYL+FV H  +PS   WV ++
Sbjct  494  SLVGPSTGEIAPPGYYLLFVVHADIPSSAAWVKLQ  528



>ref|XP_006471853.1| PREDICTED: galactose oxidase-like [Citrus sinensis]
 gb|KDO53324.1| hypothetical protein CISIN_1g041651mg [Citrus sinensis]
Length=557

 Score = 75.1 bits (183),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 38/101 (38%), Positives = 57/101 (56%), Gaps = 6/101 (6%)
 Frame = -3

Query  401  LSQTELV-YGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTSVAKDT  225
            LS  E + Y   F + F  ++      + V +  P FTTH +   QRM +L +  V+  T
Sbjct  457  LSLNETIGYKATFQVRFSVEEYLSAGVVSVRLIAPSFTTHSFGMNQRMVVLKILEVSHVT  516

Query  224  -----ISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
                 ++AVAPS+ + APPGYYL+FV H  +PS G+WV ++
Sbjct  517  SYVYHLAAVAPSTAEIAPPGYYLLFVVHAEIPSSGMWVKME  557



>ref|XP_006433075.1| hypothetical protein CICLE_v10000768mg [Citrus clementina]
 gb|ESR46315.1| hypothetical protein CICLE_v10000768mg [Citrus clementina]
Length=546

 Score = 75.1 bits (183),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 38/101 (38%), Positives = 57/101 (56%), Gaps = 6/101 (6%)
 Frame = -3

Query  401  LSQTELV-YGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTSVAKDT  225
            LS  E + Y   F + F  ++      + V +  P FTTH +   QRM +L +  V+  T
Sbjct  446  LSLNETIGYKATFQVRFSVEEYLSAGVVSVRLIAPSFTTHSFGMNQRMVVLKILEVSHVT  505

Query  224  -----ISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
                 ++AVAPS+ + APPGYYL+FV H  +PS G+WV ++
Sbjct  506  SYVYHLAAVAPSTAEIAPPGYYLLFVVHAEIPSSGMWVKME  546



>ref|XP_010470629.1| PREDICTED: galactose oxidase-like isoform X1 [Camelina sativa]
 ref|XP_010470630.1| PREDICTED: galactose oxidase-like isoform X2 [Camelina sativa]
Length=597

 Score = 75.1 bits (183),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 58/107 (54%), Gaps = 8/107 (7%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNF--NIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGL  246
            P I+   +  ++ YG+ F  NI  K  +     ++ +TM  PPFTTH      R+ +LG+
Sbjct  491  PIIINTATPKQIKYGQMFDVNIELKQPNVPK-ENVMLTMLAPPFTTHSVSMNMRLLMLGI  549

Query  245  TSVA-----KDTISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
              V      K  I AVAP SG  APPGYY++F  + GVPS G W+ I
Sbjct  550  KDVKNVGGDKYKIEAVAPPSGNVAPPGYYVLFAVYNGVPSVGEWIQI  596



>ref|XP_009606830.1| PREDICTED: galactose oxidase [Nicotiana tomentosiformis]
Length=556

 Score = 75.1 bits (183),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 36/95 (38%), Positives = 54/95 (57%), Gaps = 5/95 (5%)
 Frame = -3

Query  386  LVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTSVAKDT-----I  222
            L+Y + F++ F       M  + V +  P FTTH +   QRM +L   +V+  T      
Sbjct  457  LIYKQPFSVTFTVPKFLKMGIVLVRIVAPSFTTHSFSMNQRMVVLKSIAVSTVTDNTYRF  516

Query  221  SAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
            +A  PS+ + APPGYY++FV H G+PS G+WV I+
Sbjct  517  TAFGPSTKEIAPPGYYMLFVVHAGIPSSGVWVQIQ  551



>emb|CDP08591.1| unnamed protein product [Coffea canephora]
Length=548

 Score = 74.7 bits (182),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 36/95 (38%), Positives = 57/95 (60%), Gaps = 5/95 (5%)
 Frame = -3

Query  389  ELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLT---SVAKDT--  225
             + Y + F++ F  ++   ++S+ V +  P FTTH +   QRM IL      +VA  T  
Sbjct  453  NITYQRKFSVTFSVNNFLKVASLSVRIIAPSFTTHSFSMNQRMLILKFVEAVNVASSTYR  512

Query  224  ISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
            I+A+ PSS + AP GYY++FV H  +PS G+WV++
Sbjct  513  ITAIGPSSPEIAPKGYYMLFVVHEDIPSTGMWVNV  547



>ref|XP_004489989.1| PREDICTED: uncharacterized protein LOC101500908 [Cicer arietinum]
Length=599

 Score = 75.1 bits (183),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 56/94 (60%), Gaps = 9/94 (10%)
 Frame = -3

Query  380  YGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTS-------VAKDTI  222
            YG  F++ F   +  +++ IKVTM  P FTTH +   QR+ +L +T+       V K TI
Sbjct  507  YGGLFSVTFALREVREINGIKVTMVAPSFTTHSFAMNQRVLVLEMTAMEEVGNLVYKATI  566

Query  221  SAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
                P+S   APPGYY+++V H G+PS  +WVH+
Sbjct  567  RG--PTSLTVAPPGYYMLYVVHAGIPSVAVWVHV  598



>emb|CDY44928.1| BnaA02g04330D [Brassica napus]
Length=583

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 56/106 (53%), Gaps = 6/106 (6%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDA-XDMSSIKVTMYPPPFTTHGYXEGQRMXILGLT  243
            P+IV   +  ++ YGK F +  + +       ++K  M  P FTTH      RM +LG+ 
Sbjct  477  PKIVNNGTPKQIKYGKVFKVKVELNQKDVTKENLKAHMLAPSFTTHSISMNMRMLLLGVA  536

Query  242  SVAKD-----TISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
            SV         I A AP +G  APPGYYLIF  ++GVPS G W+ I
Sbjct  537  SVNPSGGNSFEIQAAAPPNGNLAPPGYYLIFAVYKGVPSVGEWIQI  582



>ref|XP_004152661.1| PREDICTED: galactose oxidase-like [Cucumis sativus]
Length=561

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 37/106 (35%), Positives = 59/106 (56%), Gaps = 6/106 (6%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFK-XDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLT  243
            P+I+   SQT + + +   + F    +   +++++VTM  PPF TH +   QR+ ++G  
Sbjct  455  PKILSPSSQTTVRHTQQLAVRFNVTGNNVSLNTVEVTMVAPPFNTHSFSMSQRLLVIGGE  514

Query  242  SV-----AKDTISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
            +V     A   +    P SG  AP GYYL+FV HR +PS G+W+ I
Sbjct  515  NVTDLGNATCDVHVSIPGSGTIAPYGYYLLFVVHREIPSNGIWIRI  560



>ref|XP_009392205.1| PREDICTED: galactose oxidase-like [Musa acuminata subsp. malaccensis]
Length=546

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 37/105 (35%), Positives = 59/105 (56%), Gaps = 7/105 (7%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTS  240
            P+I      TE+ YG+  +I  + ++   +  + VTM  P FTTH +   QR+ +L +  
Sbjct  443  PRITGMEPGTEITYGEMLSIEAQLEEG--VGEVVVTMVAPAFTTHSFSMNQRLLVLEVGG  500

Query  239  VAKDT-----ISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
            V + +     +  VAP+S   AP GYY++FV   GVPS+G W+H+
Sbjct  501  VRRSSSGCYMVEVVAPASAVLAPRGYYMVFVVQEGVPSRGTWIHV  545



>gb|EMT23870.1| hypothetical protein F775_01170 [Aegilops tauschii]
Length=467

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 40/100 (40%), Positives = 55/100 (55%), Gaps = 5/100 (5%)
 Frame = -3

Query  401  LSQTELVYGKNFNIHFKXD-DAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTSVAKD-  228
            L +  + YG  +   F+   D    + + VTMY PPFTTHGY   QR+ IL +TS   D 
Sbjct  368  LPREGMRYGAKYTFRFRTPLDPVVEADVMVTMYAPPFTTHGYSMNQRLLILSVTSYIPDP  427

Query  227  ---TISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
                I+  AP   + APP YYL++V  + VPS  +WV I+
Sbjct  428  QGYAITVDAPGKPELAPPAYYLVYVLAKDVPSVAVWVKIQ  467



>emb|CDY42279.1| BnaC02g08850D [Brassica napus]
Length=583

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 56/106 (53%), Gaps = 6/106 (6%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDA-XDMSSIKVTMYPPPFTTHGYXEGQRMXILGLT  243
            P+IV   +  ++ YGK F +  + +       ++K  M  P FTTH      RM +LG+ 
Sbjct  477  PKIVNNATPKQIKYGKVFKVKVELNQKDVTKENLKAHMLAPSFTTHSISMNMRMLLLGVA  536

Query  242  SVAKD-----TISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
            SV         I A AP +G  APPGYYL+F  ++GVPS G W+ I
Sbjct  537  SVNPSGGNSFEIQAAAPPNGNLAPPGYYLLFAVYKGVPSIGEWIQI  582



>gb|KGN62661.1| hypothetical protein Csa_2G365680 [Cucumis sativus]
Length=561

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 37/106 (35%), Positives = 59/106 (56%), Gaps = 6/106 (6%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFK-XDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLT  243
            P+I+   SQT + + +   + F    +   +++++VTM  PPF TH +   QR+ ++G  
Sbjct  455  PKILSPSSQTTVRHTQQLAVRFNVTGNNVSLNTVEVTMVAPPFNTHSFSMSQRLLVIGGE  514

Query  242  SV-----AKDTISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
            +V     A   +    P SG  AP GYYL+FV HR +PS G+W+ I
Sbjct  515  NVTDLGNATCDVHVSIPGSGTIAPYGYYLLFVVHREIPSNGIWIRI  560



>ref|XP_009126377.1| PREDICTED: galactose oxidase-like [Brassica rapa]
Length=583

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 56/106 (53%), Gaps = 6/106 (6%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDA-XDMSSIKVTMYPPPFTTHGYXEGQRMXILGLT  243
            P+IV   +  ++ YGK F +  + +       ++K  M  P FTTH      RM +LG+ 
Sbjct  477  PKIVNNGTPKQIKYGKVFKVKVELNQKDVTKENLKAHMLAPSFTTHSISMNMRMLLLGVA  536

Query  242  SVAKD-----TISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
            SV         I A AP +G  APPGYYLIF  ++GVPS G W+ I
Sbjct  537  SVNPSGGNSFEIQAAAPPNGNLAPPGYYLIFAVYKGVPSVGEWIQI  582



>ref|XP_006392509.1| hypothetical protein EUTSA_v10023396mg [Eutrema salsugineum]
 gb|ESQ29795.1| hypothetical protein EUTSA_v10023396mg [Eutrema salsugineum]
Length=548

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 38/94 (40%), Positives = 52/94 (55%), Gaps = 6/94 (6%)
 Frame = -3

Query  380  YGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTSVAKD------TIS  219
            Y + FN+ F          + V +  P FTTH     QRM IL L SV ++       I+
Sbjct  455  YKRLFNVDFSIPQFLTTDLLSVRIVAPSFTTHSLAMNQRMVILKLLSVTREGLTNSYRIN  514

Query  218  AVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
            A+ PS+ + APPGYY++F+ H GVPS G WV I+
Sbjct  515  ALGPSTAEIAPPGYYMMFLVHAGVPSVGAWVQIE  548



>ref|XP_006389311.1| glyoxal oxidase-related family protein [Populus trichocarpa]
 gb|ERP48225.1| glyoxal oxidase-related family protein [Populus trichocarpa]
Length=551

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 36/93 (39%), Positives = 53/93 (57%), Gaps = 6/93 (6%)
 Frame = -3

Query  377  GKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTSVAKD------TISA  216
            G+ F + F   +    S + V +  P FTTH Y   QRM +L +  +  +      T+S 
Sbjct  459  GQRFLLSFSVGEYIAGSVLSVRIVAPSFTTHSYSMNQRMVVLRIDEIIDNETSSSYTLSV  518

Query  215  VAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
            V PSS + APPGYYL++V H G+PS G+WV ++
Sbjct  519  VGPSSAEIAPPGYYLLYVVHSGIPSSGVWVRLQ  551



>ref|XP_007160695.1| hypothetical protein PHAVU_001G009200g [Phaseolus vulgaris]
 gb|ESW32689.1| hypothetical protein PHAVU_001G009200g [Phaseolus vulgaris]
Length=552

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 40/106 (38%), Positives = 59/106 (56%), Gaps = 6/106 (6%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXIL---G  249
            P+IV   S T + YG+   +      A   S ++VT+  PPF TH +   QRM +L    
Sbjct  446  PRIVGPESGTRVAYGQKVKVRVDVAAALVRSLVRVTVLAPPFATHSFSMNQRMLVLEPSH  505

Query  248  LTSVAKDT---ISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
            +T+V   T   +   AP S   APPG+YL+FV H+ +PS+G+W+ I
Sbjct  506  VTNVDGPTTFELEVTAPGSPILAPPGFYLLFVVHQEIPSEGIWIQI  551



>ref|XP_004164439.1| PREDICTED: galactose oxidase-like [Cucumis sativus]
Length=561

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 37/106 (35%), Positives = 59/106 (56%), Gaps = 6/106 (6%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFK-XDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLT  243
            P+I+   SQT + + +   + F    +   +++++VTM  PPF TH +   QR+ ++G  
Sbjct  455  PKILSPSSQTTVRHTQQLAVRFNVTGNNVSLNTVEVTMVAPPFNTHSFSMSQRLLVIGGE  514

Query  242  SV-----AKDTISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
            +V     A   +    P SG  AP GYYL+FV HR +PS G+W+ I
Sbjct  515  NVTDLGNATCDVHVSIPGSGTIAPYGYYLLFVVHREIPSNGIWIRI  560



>ref|XP_009779182.1| PREDICTED: galactose oxidase-like [Nicotiana sylvestris]
Length=596

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 50/93 (54%), Gaps = 5/93 (5%)
 Frame = -3

Query  380  YGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTSVAK-----DTISA  216
            YG+ F+I F          + V+M PP FTTH +   QR+ IL +  V +       I+ 
Sbjct  504  YGQKFSITFTLGFYQPAKELMVSMIPPSFTTHSFAMNQRLLILDVVGVQRLSLFAQKITV  563

Query  215  VAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
             AP S   APPGYY++FV HRGVP    W+ ++
Sbjct  564  CAPPSRNIAPPGYYMVFVVHRGVPGHSSWIRMQ  596



>ref|XP_006838081.1| hypothetical protein AMTR_s00225p00021580 [Amborella trichopoda]
 gb|ERN00650.1| hypothetical protein AMTR_s00225p00021580 [Amborella trichopoda]
Length=546

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 39/92 (42%), Positives = 51/92 (55%), Gaps = 5/92 (5%)
 Frame = -3

Query  380  YGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILG---LTSVAKDTISA--  216
            +G+ F + F  +       I VTM  P FTTH +   QR+ +L    LT ++ +   A  
Sbjct  453  FGQQFQVRFSVESMVGAEGITVTMVAPSFTTHSFSMNQRLLVLQNTMLTVLSPNVYQANT  512

Query  215  VAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
            VAP S   APPGYYLIFV H+GVPS  +W  I
Sbjct  513  VAPQSPLLAPPGYYLIFVVHQGVPSSAIWSRI  544



>ref|XP_010660091.1| PREDICTED: galactose oxidase [Vitis vinifera]
Length=544

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 37/94 (39%), Positives = 55/94 (59%), Gaps = 5/94 (5%)
 Frame = -3

Query  386  LVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTSVAKDT-----I  222
            L+YG++F+I F   +  +   +   +  P FTTH     QRM +L + SV ++      +
Sbjct  450  LLYGQSFSIVFNVCEYTNDRVLSANIVAPSFTTHTVAMNQRMVVLRVESVMQEVGNTYRL  509

Query  221  SAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
            S V PS+ + APPGYY++FV H G+PS G WV I
Sbjct  510  SVVGPSTPEIAPPGYYMLFVVHSGIPSHGSWVKI  543



>ref|XP_011003791.1| PREDICTED: galactose oxidase-like [Populus euphratica]
Length=551

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 36/93 (39%), Positives = 53/93 (57%), Gaps = 6/93 (6%)
 Frame = -3

Query  377  GKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTSVAKD------TISA  216
            G+ F + F   +    S + V +  P FTTH Y   QRM +L +  +  +      T+S 
Sbjct  459  GQRFLLSFSVGEYIAGSVLSVRIVAPSFTTHSYSMNQRMVVLRIDGIIHNETSSSYTLSV  518

Query  215  VAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
            V PSS + APPGYYL++V H G+PS G+WV ++
Sbjct  519  VGPSSAEIAPPGYYLLYVVHSGIPSSGVWVRLQ  551



>emb|CBI34230.3| unnamed protein product [Vitis vinifera]
Length=432

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 37/94 (39%), Positives = 55/94 (59%), Gaps = 5/94 (5%)
 Frame = -3

Query  386  LVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTSVAKDT-----I  222
            L+YG++F+I F   +  +   +   +  P FTTH     QRM +L + SV ++      +
Sbjct  338  LLYGQSFSIVFNVCEYTNDRVLSANIVAPSFTTHTVAMNQRMVVLRVESVMQEVGNTYRL  397

Query  221  SAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
            S V PS+ + APPGYY++FV H G+PS G WV I
Sbjct  398  SVVGPSTPEIAPPGYYMLFVVHSGIPSHGSWVKI  431



>ref|XP_008444780.1| PREDICTED: galactose oxidase-like [Cucumis melo]
Length=563

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 36/106 (34%), Positives = 60/106 (57%), Gaps = 6/106 (6%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFK-XDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILG--  249
            P+I+   SQT + + +   + F    +   +++++VTM  PPF TH +   QR+ ++G  
Sbjct  457  PKILSPSSQTTVSHAQQLAVRFTVTGNNVTLNAVEVTMVAPPFNTHSFSMSQRLLVIGGE  516

Query  248  -LTSVAKDT--ISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHI  120
             +T +   T  +    P SG  AP GYYL+FV HR +PS G+W+ +
Sbjct  517  NVTDMGNATWDVHVSIPKSGTIAPSGYYLLFVVHREIPSNGIWIRL  562



>gb|KJB59770.1| hypothetical protein B456_009G270800 [Gossypium raimondii]
Length=547

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 37/106 (35%), Positives = 55/106 (52%), Gaps = 5/106 (5%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILG---  249
            P I    S + + YG    +          + + VTM  P F TH +   QR+ +LG   
Sbjct  442  PTITAPKSMSGIKYGTKLTVRVVITGKVAKNQVSVTMVAPAFNTHSFSMNQRLLVLGNDK  501

Query  248  LTSVAKDT--ISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
            + ++ K T  I    P SG  AP G+YL+FV H+G+PSKG+WV ++
Sbjct  502  VVALGKATYDIDVTTPRSGNLAPSGFYLLFVVHQGIPSKGIWVKLQ  547



>ref|XP_009393211.1| PREDICTED: galactose oxidase-like [Musa acuminata subsp. malaccensis]
Length=542

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 42/108 (39%), Positives = 59/108 (55%), Gaps = 8/108 (7%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXIL-GLT  243
            P +    +  EL Y K F++ F    A     + VTM  P F TH +   QR+ IL    
Sbjct  435  PTVTWAGTPVELNYAKPFSLRFSVA-AMSEKGVLVTMVAPSFATHSFSMNQRLLILESEL  493

Query  242  SVAKDT------ISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
            + A D       + A+APSS   APPGYY++FV + G+PS+G+WVHI+
Sbjct  494  AAAADAESSLYVVDAMAPSSTFMAPPGYYMVFVVNGGIPSEGVWVHIQ  541



>ref|XP_007209012.1| hypothetical protein PRUPE_ppa023406mg [Prunus persica]
 gb|EMJ10211.1| hypothetical protein PRUPE_ppa023406mg [Prunus persica]
Length=533

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/101 (39%), Positives = 55/101 (54%), Gaps = 12/101 (12%)
 Frame = -3

Query  389  ELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTSVAKD------  228
            +L Y + F + FK +   D   I VTM  P FTTH +   QR+ +L  + V K+      
Sbjct  433  DLTYLQKFYLGFKTNYVPD--KIYVTMVAPSFTTHSFAMNQRVLVLDFSQVGKNGNLSGS  490

Query  227  ----TISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
                 +   AP+  + APPGYYL+FV   G+PS+G+WV IK
Sbjct  491  KGYINLEGFAPARPELAPPGYYLLFVVCDGIPSRGMWVRIK  531



>ref|XP_006357288.1| PREDICTED: galactose oxidase-like [Solanum tuberosum]
Length=570

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 51/93 (55%), Gaps = 5/93 (5%)
 Frame = -3

Query  380  YGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTSVAK-----DTISA  216
            YG+ F++ F    + DM  + VTM  P FTTH +   QR+ IL +  + +       I  
Sbjct  478  YGQKFSVTFTLGVSQDMKEVMVTMIAPSFTTHSFAMNQRLLILDIVEIQQLSSFTQKIMV  537

Query  215  VAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
             AP S   AP GYY++FV H+GVP   +WV ++
Sbjct  538  YAPPSRNIAPLGYYMVFVVHKGVPGHSIWVKMQ  570



>ref|XP_003527665.1| PREDICTED: galactose oxidase-like [Glycine max]
Length=541

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 35/106 (33%), Positives = 53/106 (50%), Gaps = 5/106 (5%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTS  240
            P IVE  S   + YG+ F +  + +       + VTM  PPF TH +   QR+ +L +  
Sbjct  436  PMIVEPCSHANVTYGEKFKMGIEVNGTLVPELVSVTMLAPPFNTHSFSMNQRLLVLSIGQ  495

Query  239  VAKD-----TISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
            V              P S   APP +YL+FV H+ +PS+G+W+ I+
Sbjct  496  VNVTGNWTCEFEVTPPGSAVLAPPTFYLLFVVHQDIPSEGIWIKIQ  541



>gb|KDO66470.1| hypothetical protein CISIN_1g042680mg [Citrus sinensis]
Length=530

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/107 (34%), Positives = 55/107 (51%), Gaps = 6/107 (6%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTS  240
            P I+E  S     YGK   +  K  +   ++ ++V++  PPF THG    QRM  L +  
Sbjct  424  PAILEDQSDKAATYGKWVYLRVKSSEPLTINYVQVSIVAPPFVTHGISMNQRMLFLSVIE  483

Query  239  VAK------DTISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
            +        D +   AP +   APPGYYL+ V ++G+PS  +W H+K
Sbjct  484  LKNNVAPGVDEVVVAAPPTSALAPPGYYLLSVVNQGIPSHSIWFHLK  530



>ref|XP_008775019.1| PREDICTED: galactose oxidase-like [Phoenix dactylifera]
Length=544

 Score = 73.2 bits (178),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 42/107 (39%), Positives = 59/107 (55%), Gaps = 7/107 (7%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXIL--GL  246
            P+I    S   L YGK F + F    A     + VTM  P F+TH +   QR+ IL  G 
Sbjct  439  PKIDNSSSPISLNYGKQFTLRFAVA-AISGGGVSVTMAAPAFSTHAFSMNQRLLILETGK  497

Query  245  TSVAKDT----ISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
               A +     ++AVAP+SG  AP GYY++FV + G+PS+G+W  I+
Sbjct  498  ALAAGNNGSYEVTAVAPASGILAPSGYYMVFVVNGGIPSEGVWAQIQ  544



>ref|XP_002512263.1| Galactose oxidase precursor, putative [Ricinus communis]
 gb|EEF49715.1| Galactose oxidase precursor, putative [Ricinus communis]
Length=533

 Score = 73.2 bits (178),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 39/105 (37%), Positives = 57/105 (54%), Gaps = 7/105 (7%)
 Frame = -3

Query  410  VEKLSQTELVYGKN--FNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTSV  237
            V  L ++ L YG    F + F  ++    + + V +  P FTTH +   QRM +L + S+
Sbjct  429  VLSLDKSTLGYGNASAFRVRFHVEEYISDNVLSVRIVAPSFTTHSFAMNQRMVVLKMNSI  488

Query  236  AKDTISAVA-----PSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
              +T +  A     PS+ + APPGYYL+FV H G PS G WV I+
Sbjct  489  EAETSNTYALHVAGPSTVQIAPPGYYLLFVVHAGTPSNGSWVKIQ  533



>ref|XP_006451227.1| hypothetical protein CICLE_v10007862mg [Citrus clementina]
 ref|XP_006475692.1| PREDICTED: galactose oxidase-like [Citrus sinensis]
 gb|ESR64467.1| hypothetical protein CICLE_v10007862mg [Citrus clementina]
Length=570

 Score = 73.2 bits (178),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 36/107 (34%), Positives = 55/107 (51%), Gaps = 6/107 (6%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTS  240
            P I+E  S     YGK   +  K  +   ++ ++V++  PPF THG    QRM  L +  
Sbjct  464  PAILEDQSDKAATYGKWVYLRVKSSEPLTINYVQVSIVAPPFVTHGISMNQRMLFLSVIE  523

Query  239  VAK------DTISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
            +        D +   AP +   APPGYYL+ V ++G+PS  +W H+K
Sbjct  524  LKNNVAPGVDEVVVAAPPTSALAPPGYYLLSVVNQGIPSHSIWFHLK  570



>gb|EYU36763.1| hypothetical protein MIMGU_mgv1a004035mg [Erythranthe guttata]
Length=548

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 42/108 (39%), Positives = 61/108 (56%), Gaps = 7/108 (6%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSS-IKVTMYPPPFTTHGYXEGQRMXIL---  252
            P IV  +S + + YG+   I F       + S +KVTM  P FTTH +   QR+ +L   
Sbjct  441  PVIVTPVSPSVIGYGQELTIGFAVASGRIIGSLVKVTMVAPSFTTHSFSMNQRLLVLSGG  500

Query  251  GLTSVAKDT---ISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
             +T+   +T   I  + P SG  AP GYYL+FV ++ +PS+G+WV IK
Sbjct  501  NVTTSFDNTTYQIRVITPGSGILAPSGYYLLFVVYQEIPSEGIWVQIK  548



>ref|XP_008245383.1| PREDICTED: galactose oxidase-like [Prunus mume]
Length=553

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 39/101 (39%), Positives = 55/101 (54%), Gaps = 12/101 (12%)
 Frame = -3

Query  389  ELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTSVAKD------  228
            +L Y + F + FK +   D   I VT+  P FTTH +   QR+ +L  + V K+      
Sbjct  453  DLTYLQKFYLGFKTNYVPD--KIYVTLVAPSFTTHSFAMNQRVLVLDFSQVGKNGNISGS  510

Query  227  ----TISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
                 +   AP+  + APPGYYL+FV   GVPS+G+WV IK
Sbjct  511  KGYINLEGFAPARPELAPPGYYLLFVVCDGVPSRGMWVRIK  551



>ref|XP_004304717.1| PREDICTED: galactose oxidase [Fragaria vesca subsp. vesca]
Length=546

 Score = 72.4 bits (176),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 38/106 (36%), Positives = 60/106 (57%), Gaps = 7/106 (7%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTS  240
            P+IV  L    + Y + F++ F   +    S + VT+  P FTTH +   QRM ++ L  
Sbjct  443  PRIVSVLEN--IGYREQFSVAFAVPEYVHSSVVSVTLVAPSFTTHSFAMNQRMVVMKLGE  500

Query  239  VAK---DT--ISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
            V +   DT  ++ + PS+ + APPGYYL+FV H  +PS  +WV ++
Sbjct  501  VRELSLDTYEVAVMGPSAKEIAPPGYYLLFVVHADIPSSAMWVKLQ  546



>emb|CDY43429.1| BnaC07g14960D [Brassica napus]
Length=509

 Score = 72.4 bits (176),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 38/115 (33%), Positives = 56/115 (49%), Gaps = 15/115 (13%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTS  240
            P+I    SQ+ + YG N  + FK         +KVTM  P FTTH +   QR+ +L    
Sbjct  396  PKITSPKSQSTITYGTNLKVKFKVSGKIK-GPVKVTMVFPSFTTHSFSMNQRLLVLDNVK  454

Query  239  VAKDT--------------ISAVAPSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
            V + +              +    P S   APPGYY++FV +  VPS+G+WV ++
Sbjct  455  VKRTSSVFGALFGKTKHYEVQVRTPKSAIIAPPGYYMMFVVNENVPSEGIWVRLQ  509



>ref|NP_177692.1| glyoxal oxidase-related protein [Arabidopsis thaliana]
 gb|AAF87115.1|AC006434_11 F10A5.18 [Arabidopsis thaliana]
 gb|AEE35738.1| glyoxal oxidase-related protein [Arabidopsis thaliana]
Length=547

 Score = 72.4 bits (176),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 41/107 (38%), Positives = 58/107 (54%), Gaps = 7/107 (7%)
 Frame = -3

Query  419  PQIVEKLSQTELVYGKNFNIHFKXDDAXDMSSIKVTMYPPPFTTHGYXEGQRMXILGLTS  240
            P IV+   QT + YG+   + F        S +KVTM  P FTTH +   QR+ +L    
Sbjct  442  PSIVDPRPQTTVNYGRVLRLRFIVSGRVK-SPVKVTMLFPSFTTHSFSMHQRLLVLDHVI  500

Query  239  VAKDTISAV------APSSGKXAPPGYYLIFVXHRGVPSKGLWVHIK  117
              K  IS +       PSS   APPGYY++FV ++ +PS+GLWV ++
Sbjct  501  SFKLGISKIYEVRVRTPSSAILAPPGYYMVFVVNQDIPSEGLWVRLQ  547



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 557844602525