BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF028J20

Length=666
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AHJ60264.1|  phenylalanine ammonia-lyase 1                           367   3e-119   Ipomoea purpurea
sp|Q42858.1|PAL2_IPOBA  RecName: Full=Phenylalanine ammonia-lyase       359   3e-116   Ipomoea batatas [batate]
dbj|BAF98438.1|  phenylalanine ammonia-lyase                            315   7e-105   Glehnia littoralis
dbj|BAF98437.1|  phenylalanine ammonia-lyase                            315   2e-104   Glehnia littoralis
ref|XP_009629066.1|  PREDICTED: phenylalanine ammonia-lyase             328   2e-104   Nicotiana tomentosiformis
gb|AAG49585.1|AF325496_1  phenylalanine ammonia-lyase                   327   7e-104   Ipomoea nil [qian niu]
gb|AIB08913.1|  phenylalanine ammonia-lyase                             311   1e-103   Angelica sinensis [Chinese angelica]
gb|ABG75911.1|  phenylalanine ammonia-lyase 2                           325   3e-103   Nicotiana attenuata
sp|P14166.1|PAL1_IPOBA  RecName: Full=Phenylalanine ammonia-lyase       325   3e-103   Ipomoea batatas [batate]
dbj|BAF98439.1|  phenylalanine ammonia-lyase                            310   1e-102   Glehnia littoralis
gb|AAC33966.1|  phenylalanine ammonia-lyase                             318   3e-102   Capsicum chinense [bonnet pepper]
gb|ABG75910.1|  phenylalanine ammonia-lyase 1                           322   5e-102   Nicotiana attenuata
sp|P35512.1|PALY_MALDO  RecName: Full=Phenylalanine ammonia-lyase       306   7e-102   Malus domestica [apple tree]
ref|XP_009766905.1|  PREDICTED: phenylalanine ammonia-lyase             322   1e-101   Nicotiana sylvestris
gb|AET41698.1|  phenylalanine ammonia-lyase                             309   1e-101   Prunus salicina [Japanese plum]
ref|XP_009625397.1|  PREDICTED: phenylalanine ammonia-lyase             321   1e-101   Nicotiana tomentosiformis
ref|XP_004246650.1|  PREDICTED: phenylalanine ammonia-lyase-like        321   1e-101   
emb|CDP06747.1|  unnamed protein product                                317   1e-101   Coffea canephora [robusta coffee]
sp|P35513.2|PAL2_TOBAC  RecName: Full=Phenylalanine ammonia-lyase       321   2e-101   Nicotiana tabacum [American tobacco]
ref|XP_004249558.1|  PREDICTED: phenylalanine ammonia-lyase             321   2e-101   Solanum lycopersicum
gb|AGT63063.1|  phenylalanine ammonia-lyase                             321   2e-101   Solanum tuberosum [potatoes]
ref|XP_004246649.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    320   3e-101   Solanum lycopersicum
gb|ACF94717.1|  phenylalanine ammonia lyase                             307   5e-101   Robinia pseudoacacia [black locust]
gb|ACR56688.1|  phenylalanine ammonia-lyase                             319   6e-101   Scutellaria viscidula [zhan mao huang qin]
gb|ACF17667.1|  putative phenylalanine ammonia-lyase                    319   7e-101   Capsicum annuum
ref|XP_009781653.1|  PREDICTED: phenylalanine ammonia-lyase             319   1e-100   Nicotiana sylvestris
gb|AFC37247.1|  phenylalanine ammonia-lyase                             306   1e-100   Camellia chekiangoleosa
gb|AEO92028.1|  phenylalanine ammonia-lyase 2                           318   1e-100   Coffea canephora [robusta coffee]
gb|AEY94464.1|  phenylalanine ammonia-lyase                             307   2e-100   Prunella vulgaris
dbj|BAF36975.1|  phenylalanine ammonia-lyase                            306   2e-100   Lotus japonicus
gb|AEL21617.1|  phenylalanine ammonia lyase 2                           318   3e-100   Coffea arabica [arabica coffee]
emb|CDP20698.1|  unnamed protein product                                317   3e-100   Coffea canephora [robusta coffee]
ref|XP_011094662.1|  PREDICTED: phenylalanine ammonia-lyase             317   6e-100   Sesamum indicum [beniseed]
sp|P45733.1|PAL3_TOBAC  RecName: Full=Phenylalanine ammonia-lyase       317   9e-100   Nicotiana tabacum [American tobacco]
gb|AIA66448.1|  PAL1                                                    317   9e-100   Capsicum annuum
dbj|BAG31930.1|  phenylalanine ammonia-lyase                            317   1e-99    Daucus carota [carrots]
dbj|BAC56977.1|  phenylalanine ammonia-lyase                            316   1e-99    Daucus carota [carrots]
ref|XP_006367534.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      308   2e-99    
dbj|BAA95629.1|  phenylalanine ammonia lyase                            315   2e-99    Catharanthus roseus [chatas]
ref|XP_003635685.1|  PREDICTED: phenylalanine ammonia-lyase             303   2e-99    Vitis vinifera
emb|CAA34715.1|  unnamed protein product                                311   3e-99    Petroselinum crispum
sp|P45729.1|PAL3_PETCR  RecName: Full=Phenylalanine ammonia-lyase 3     315   3e-99    Petroselinum crispum
ref|XP_006364021.1|  PREDICTED: phenylalanine ammonia-lyase-like        315   5e-99    Solanum tuberosum [potatoes]
sp|P45726.1|PALY_CAMSI  RecName: Full=Phenylalanine ammonia-lyase       314   7e-99    Camellia sinensis [black tea]
emb|CBJ23826.1|  phenylalanine ammonia-lyase                            314   8e-99    Melissa officinalis [sweet balm]
ref|XP_003625662.1|  Phenylalanine ammonia-lyase                        306   1e-98    
dbj|BAF36972.1|  phenylalanine ammonia-lyase                            313   1e-98    Lotus japonicus
gb|AGF50184.1|  phenylalanine ammonia lyase                             300   1e-98    Salvia virgata
ref|XP_006354336.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    314   1e-98    
ref|XP_006354338.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    314   1e-98    Solanum tuberosum [potatoes]
gb|AAU08174.1|  phenylalanine ammonia-lyase                             313   1e-98    Camellia sinensis [black tea]
ref|XP_008387584.1|  PREDICTED: phenylalanine ammonia-lyase 1           313   2e-98    
gb|AGF50183.1|  phenylalanine ammonia lyase                             300   2e-98    Salvia hypoleuca
gb|AFG30054.1|  phenylalanine ammonialyase                              313   2e-98    Malus hybrid cultivar
gb|ACF94716.1|  phenylalanine ammonia lyase                             313   3e-98    Robinia pseudoacacia [black locust]
gb|ADN32767.1|  phenylalanine ammonia-lyase 1                           312   3e-98    Scutellaria baicalensis [Baikal skullcap]
sp|P45735.1|PALY_VITVI  RecName: Full=Phenylalanine ammonia-lyase       304   3e-98    Vitis vinifera
gb|AFP24940.1|  phenylalanine ammonia lyase                             312   4e-98    Prunus salicina [Japanese plum]
sp|P24481.1|PAL1_PETCR  RecName: Full=Phenylalanine ammonia-lyase 1     312   4e-98    Petroselinum crispum
pdb|1W27|A  Chain A, Phenylalanine Ammonia-Lyase (Pal) From Petro...    312   4e-98    Petroselinum crispum
ref|XP_004493977.1|  PREDICTED: phenylalanine ammonia-lyase-like        312   5e-98    Cicer arietinum [garbanzo]
gb|ADI40166.1|  phenylalanine ammonia-lyase                             312   6e-98    Morus alba
sp|O64963.1|PAL1_PRUAV  RecName: Full=Phenylalanine ammonia-lyase 1     312   6e-98    Prunus avium [gean]
gb|AEA72280.1|  phenylalanine ammonia-lyase                             311   7e-98    Angelica gigas
gb|ABV71917.1|  PAL                                                     296   7e-98    Plectranthus scutellarioides
gb|ADF59061.1|  phenylalanine ammonia-lyase 1 precursor                 311   8e-98    Pyrus x bretschneideri [bai li]
gb|AEZ01784.1|  phenylalanine ammonia-lyase                             311   1e-97    Pyrus x bretschneideri [bai li]
gb|AAK84225.1|AF401636_1  phenylalanine ammonia-lyase                   311   1e-97    Rehmannia glutinosa [Chinese foxglove]
gb|AAK60273.1|AF383150_1  phenylalanine ammonia-lyase 3                 299   1e-97    Manihot esculenta [manioc]
gb|ABV44808.1|  phenylalanine ammonia lyase 1                           299   1e-97    Eriobotrya japonica [loquat]
ref|XP_009373523.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    311   1e-97    Pyrus x bretschneideri [bai li]
ref|XP_008243955.1|  PREDICTED: phenylalanine ammonia-lyase 1           311   1e-97    Prunus mume [ume]
ref|XP_011031723.1|  PREDICTED: phenylalanine ammonia-lyase G4          311   1e-97    Populus euphratica
pir||JQ1070  phenylalanine ammonia-lyase (EC 4.3.1.5) - soybean  ...    302   1e-97 
gb|AHY94892.1|  phenylalanine ammonia lyase                             310   2e-97    Prunella vulgaris
dbj|BAF36973.1|  phenylalanine ammonia-lyase                            306   2e-97    Lotus japonicus
dbj|BAF36971.1|  phenylalanine ammonia-lyase                            310   2e-97    Lotus japonicus
gb|AEZ67457.1|  phenylalanine ammonia-lyase                             310   2e-97    Perilla frutescens [beefsteak-mint]
ref|XP_009342990.1|  PREDICTED: phenylalanine ammonia-lyase 1           310   2e-97    
gb|AGL81344.1|  phenylalanine ammonia lyase                             310   2e-97    Pyrus communis
gb|AGL50914.1|  phenylalanine ammonia lyase                             310   2e-97    Pyrus communis
gb|ABB70117.2|  phenylalanine ammonia lyase                             310   3e-97    Pyrus communis
ref|XP_006354339.1|  PREDICTED: phenylalanine ammonia-lyase-like        310   3e-97    Solanum tuberosum [potatoes]
ref|XP_008369679.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      310   3e-97    
ref|XP_008355619.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    310   4e-97    
ref|XP_011077338.1|  PREDICTED: phenylalanine ammonia-lyase             309   5e-97    Sesamum indicum [beniseed]
ref|XP_006358655.1|  PREDICTED: phenylalanine ammonia-lyase-like        309   5e-97    Solanum tuberosum [potatoes]
ref|XP_004246651.1|  PREDICTED: phenylalanine ammonia-lyase             310   5e-97    
gb|ACF94715.1|  phenylalanine ammonia lyase                             298   6e-97    Robinia pseudoacacia [black locust]
gb|AHZ31605.1|  phenylalanine ammonia-lyase                             309   8e-97    Olea europaea
sp|O23865.1|PAL1_DAUCA  RecName: Full=Phenylalanine ammonia-lyase 1     308   1e-96    Daucus carota [carrots]
dbj|BAF36969.1|  phenylalanine ammonia-lyase                            301   1e-96    Lotus japonicus
sp|P45728.1|PAL2_PETCR  RecName: Full=Phenylalanine ammonia-lyase 2     308   1e-96    Petroselinum crispum
ref|XP_002531677.1|  Phenylalanine ammonia-lyase, putative              308   1e-96    Ricinus communis
sp|O23924.1|PALY_DIGLA  RecName: Full=Phenylalanine ammonia-lyase       308   1e-96    Digitalis lanata [Grecian foxglove]
gb|AAA34179.2|  phenylalanine ammonia lyase                             308   1e-96    Solanum lycopersicum
sp|P35511.1|PAL1_SOLLC  RecName: Full=Phenylalanine ammonia-lyase...    308   1e-96    Solanum lycopersicum
sp|P26600.1|PAL5_SOLLC  RecName: Full=Phenylalanine ammonia-lyase...    308   2e-96    Solanum lycopersicum
ref|XP_006364022.1|  PREDICTED: phenylalanine ammonia-lyase-like        308   2e-96    Solanum tuberosum [potatoes]
gb|AAN52280.1|AF480620_1  phenylalanine ammonia-lyase                   308   2e-96    Populus tremuloides
gb|AFK47120.1|  unknown                                                 291   2e-96    Lotus japonicus
ref|XP_007162755.1|  hypothetical protein PHAVU_001G1777000g            293   3e-96    Phaseolus vulgaris [French bean]
dbj|BAF36970.1|  phenylalanine ammonia-lyase                            307   3e-96    Lotus japonicus
ref|XP_007208432.1|  hypothetical protein PRUPE_ppa002099mg             307   3e-96    Prunus persica
ref|XP_007009873.1|  Phenylalanine ammonia-lyase 2                      307   3e-96    
gb|AEX32784.1|  phenylalanine ammonia-lyase                             307   4e-96    Vitis vinifera
ref|XP_003635657.2|  PREDICTED: phenylalanine ammonia-lyase-like        306   4e-96    Vitis vinifera
ref|XP_002281799.1|  PREDICTED: phenylalanine ammonia-lyase             306   5e-96    Vitis vinifera
gb|AFZ78651.1|  phenylalanine ammonia-lyase                             306   5e-96    Populus tomentosa [Chinese white poplar]
ref|XP_002312013.1|  phenylalanine ammonia-lyase family protein         306   6e-96    Populus trichocarpa [western balsam poplar]
sp|P45732.1|PALY_STYHU  RecName: Full=Phenylalanine ammonia-lyase       306   6e-96    Stylosanthes humilis [alfafinha do nordeste]
gb|AFZ94859.1|  phenylalanine ammonia-lyase                             306   6e-96    Plectranthus scutellarioides
ref|XP_010107519.1|  Phenylalanine ammonia-lyase                        301   6e-96    
sp|Q04593.1|PAL2_PEA  RecName: Full=Phenylalanine ammonia-lyase 2       306   6e-96    Pisum sativum [garden pea]
dbj|BAD94354.1|  phenylalanine ammonia lyase                            296   7e-96    Arabidopsis thaliana [mouse-ear cress]
dbj|BAF36974.1|  phenylalanine ammonia-lyase                            305   8e-96    Lotus japonicus
gb|AJO53273.1|  phenylalanine ammonia-lyase                             306   1e-95    Pogostemon cablin
dbj|BAF36968.1|  phenylalanine ammonia-lyase                            305   1e-95    Lotus japonicus
gb|AAK62030.1|  phenylalanine ammonia-lyase 1                           306   1e-95    Manihot esculenta [manioc]
gb|AEX32790.1|  phenylalanine ammonia-lyase                             306   1e-95    Vitis vinifera
gb|KEH24018.1|  phenylalanine ammonia-lyase-like protein                306   1e-95    Medicago truncatula
sp|P31425.1|PAL1_SOLTU  RecName: Full=Phenylalanine ammonia-lyase 1     306   1e-95    Solanum tuberosum [potatoes]
ref|XP_004253518.1|  PREDICTED: phenylalanine ammonia-lyase-like        302   1e-95    
dbj|BAF36967.1|  phenylalanine ammonia-lyase                            306   1e-95    Lotus japonicus
gb|AGF50182.1|  phenylalanine ammonia lyase                             292   2e-95    Salvia officinalis
gb|EYU38541.1|  hypothetical protein MIMGU_mgv1a001582mg                307   2e-95    Erythranthe guttata [common monkey flower]
gb|AID16077.1|  phenylalanine ammonium lyase                            305   2e-95    Morus alba
ref|XP_002268256.1|  PREDICTED: phenylalanine ammonia-lyase             305   2e-95    Vitis vinifera
gb|KHN17149.1|  Phenylalanine ammonia-lyase 2                           303   2e-95    Glycine soja [wild soybean]
ref|XP_003633987.1|  PREDICTED: phenylalanine ammonia-lyase-like        305   2e-95    Vitis vinifera
ref|XP_002268181.1|  PREDICTED: phenylalanine ammonia-lyase             305   2e-95    Vitis vinifera
gb|ABM67591.1|  phenylalanin ammonia-lyase                              305   2e-95    Vitis vinifera
ref|XP_003633986.1|  PREDICTED: phenylalanine ammonia-lyase-like        305   3e-95    Vitis vinifera
emb|CDX74991.1|  BnaA05g07370D                                          295   3e-95    
gb|KHG26972.1|  Phenylalanine ammonia-lyase                             305   3e-95    Gossypium arboreum [tree cotton]
ref|XP_006354337.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    305   3e-95    Solanum tuberosum [potatoes]
gb|KHN39030.1|  Phenylalanine ammonia-lyase class 2                     302   3e-95    Glycine soja [wild soybean]
ref|XP_010662075.1|  PREDICTED: phenylalanine ammonia-lyase             305   3e-95    Vitis vinifera
ref|NP_001236956.1|  phenylalanine ammonia-lyase 2                      305   3e-95    
ref|XP_003633985.1|  PREDICTED: phenylalanine ammonia-lyase-like        305   3e-95    Vitis vinifera
emb|CAL91038.1|  phenylalanine ammonia-lyase 4                          293   4e-95    Cynara cardunculus var. scolymus [artichoke]
gb|ACC63889.1|  phenylalanine ammonia-lyase                             304   5e-95    Populus trichocarpa [western balsam poplar]
prf||2001451A  Phe ammonia lyase                                        304   5e-95 
sp|Q01861.1|PAL1_PEA  RecName: Full=Phenylalanine ammonia-lyase 1       304   5e-95    Pisum sativum [garden pea]
gb|AJR20994.1|  phenylalanine ammonia-lyase                             304   5e-95    Populus szechuanica
gb|ABD73282.1|  phenylalanine ammonia-lyase                             304   5e-95    Salvia miltiorrhiza [Chinese salvia]
ref|XP_002267953.1|  PREDICTED: phenylalanine ammonia-lyase             304   5e-95    Vitis vinifera
emb|CAN61378.1|  hypothetical protein VITISV_032212                     303   6e-95    Vitis vinifera
ref|XP_004234632.2|  PREDICTED: phenylalanine ammonia-lyase             304   6e-95    
sp|Q42667.1|PALY_CITLI  RecName: Full=Phenylalanine ammonia-lyase       304   6e-95    Citrus limon [lemon]
gb|AFQ92048.1|  phenylalanine ammonia-lyase                             289   7e-95    Pyrus pyrifolia [sha li]
gb|KHN00850.1|  Phenylalanine ammonia-lyase 2                           301   7e-95    Glycine soja [wild soybean]
gb|KDO46246.1|  hypothetical protein CISIN_1g004955mg                   304   9e-95    Citrus sinensis [apfelsine]
ref|XP_002268732.1|  PREDICTED: phenylalanine ammonia-lyase             303   9e-95    Vitis vinifera
ref|XP_006436446.1|  hypothetical protein CICLE_v10030821mg             303   9e-95    Citrus clementina [clementine]
ref|XP_006439143.1|  hypothetical protein CICLE_v10010874mg             291   1e-94    
ref|XP_003542541.1|  PREDICTED: phenylalanine ammonia-lyase class...    303   1e-94    
gb|AAQ74878.1|  phenylalanine ammonia lyase                             303   1e-94    Populus trichocarpa x Populus deltoides
gb|AGA84059.1|  phenylalanine ammonia lyase                             303   1e-94    Picrorhiza kurrooa
ref|NP_001266106.1|  phenylalanine ammonia-lyase 2                      303   2e-94    Cicer arietinum [garbanzo]
ref|XP_006589419.1|  PREDICTED: phenylalanine ammonia-lyase 2-lik...    303   2e-94    Glycine max [soybeans]
ref|XP_003590471.1|  Phenylalanine ammonia-lyase                        303   2e-94    Medicago truncatula
gb|ADO64252.1|  PAL                                                     302   2e-94    Epimedium sagittatum
sp|P27990.1|PALY_MEDSA  RecName: Full=Phenylalanine ammonia-lyase       303   2e-94    Medicago sativa [alfalfa]
gb|AEE81750.1|  phenylalanine ammonia lyase                             303   2e-94    Morus alba var. multicaulis
emb|CAN77065.1|  hypothetical protein VITISV_009233                     302   2e-94    Vitis vinifera
ref|XP_002315308.1|  phenylalanine ammonia-lyase family protein         302   3e-94    Populus trichocarpa [western balsam poplar]
gb|KJB36583.1|  hypothetical protein B456_006G166000                    302   3e-94    Gossypium raimondii
gb|AAF40224.1|AF237955_1  phenylalanine ammonia-lyase 2                 302   3e-94    Rubus idaeus [European raspberry]
gb|AFZ78653.1|  phenylalanine ammonia-lyase                             302   3e-94    Populus tomentosa [Chinese white poplar]
gb|KDO36715.1|  hypothetical protein CISIN_1g016039mg                   293   3e-94    Citrus sinensis [apfelsine]
gb|KJB46526.1|  hypothetical protein B456_007G373700                    300   5e-94    Gossypium raimondii
emb|CDX91331.1|  BnaC04g08190D                                          292   5e-94    
gb|AAN52279.1|AF480619_1  phenylalanine ammonia-lyase                   301   6e-94    Populus tremuloides
gb|KJB46525.1|  hypothetical protein B456_007G373600                    301   6e-94    Gossypium raimondii
gb|KJB62426.1|  hypothetical protein B456_009G416300                    301   6e-94    Gossypium raimondii
gb|AJO53274.1|  phenylalanine ammonia-lyase                             301   6e-94    Pogostemon cablin
gb|KHG18863.1|  Phenylalanine ammonia-lyase                             301   7e-94    Gossypium arboreum [tree cotton]
ref|XP_006290660.1|  hypothetical protein CARUB_v10016752mg             301   7e-94    Capsella rubella
gb|AFN85669.1|  phenylalanine ammonia-lyase                             301   7e-94    Hibiscus cannabinus [bimli-jute]
gb|AGE10589.1|  phenylalanine amononia-lyase                            301   8e-94    Lonicera japonica [Japanese honeysuckle]
gb|ABD42947.1|  phenylalanine ammonia lyase                             301   9e-94    Acacia auriculiformis x Acacia mangium
dbj|BAA21643.1|  phenylalanine ammonia-lyase                            301   1e-93    Populus sieboldii x Populus grandidentata
ref|XP_010262867.1|  PREDICTED: phenylalanine ammonia-lyase             301   1e-93    Nelumbo nucifera [Indian lotus]
gb|AIY26016.1|  PAL                                                     300   1e-93    Jasminum sambac [Arabian jasmine]
gb|KEH24019.1|  phenylalanine ammonia-lyase-like protein                301   1e-93    Medicago truncatula
ref|XP_010426963.1|  PREDICTED: phenylalanine ammonia-lyase 2-like      301   1e-93    Camelina sativa [gold-of-pleasure]
gb|KHG29664.1|  Phenylalanine ammonia-lyase                             301   1e-93    Gossypium arboreum [tree cotton]
ref|XP_002519521.1|  Phenylalanine ammonia-lyase, putative              300   1e-93    Ricinus communis
sp|P45730.1|PALY_POPTR  RecName: Full=Phenylalanine ammonia-lyase       300   1e-93    Populus trichocarpa [western balsam poplar]
gb|AIL23235.1|  phenylalanine ammonia-lyase                             300   1e-93    Astragalus chrysochlorus
gb|AFU90757.1|  phenylalanine ammonia-lyase                             300   1e-93    Epimedium sagittatum
gb|AHZ30594.1|  phenylalanine ammonia lyase-2                           300   2e-93    Prunus domestica
ref|XP_002322884.2|  phenylalanine ammonia-lyase family protein         300   2e-93    Populus trichocarpa [western balsam poplar]
ref|XP_007144370.1|  hypothetical protein PHAVU_007G150500g             300   2e-93    Phaseolus vulgaris [French bean]
gb|KJB73539.1|  hypothetical protein B456_011G238400                    300   2e-93    Gossypium raimondii
ref|XP_003556238.1|  PREDICTED: phenylalanine ammonia-lyase 2-like      300   2e-93    Glycine max [soybeans]
gb|ACS71953.1|  phenylalanine ammonia-lyase                             300   2e-93    Euphorbia pulcherrima
gb|ACM44926.1|  phenylalanine ammonia-lyase                             300   2e-93    Euphorbia pulcherrima
gb|AAK60275.1|AF383152_1  phenylalanine ammonia-lyase 2                 300   2e-93    Manihot esculenta [manioc]
gb|KDO50672.1|  hypothetical protein CISIN_1g037382mg                   295   2e-93    Citrus sinensis [apfelsine]
gb|AGW27206.1|  phenylalanine ammonia-lyase 3                           301   2e-93    Salvia miltiorrhiza [Chinese salvia]
emb|CDY18464.1|  BnaA04g21230D                                          291   3e-93    Brassica napus [oilseed rape]
ref|XP_010253912.1|  PREDICTED: phenylalanine ammonia-lyase             300   3e-93    Nelumbo nucifera [Indian lotus]
gb|AAK15640.1|AF326116_1  phenylalanine ammonia-lyase                   300   3e-93    Agastache rugosa
ref|XP_011048535.1|  PREDICTED: phenylalanine ammonia-lyase-like        300   3e-93    Populus euphratica
gb|ADR78835.1|  phenylalanine ammonia lyase                             295   3e-93    Ziziphus jujuba [Chinese jujube]
gb|AFZ78650.1|  phenylalanine ammonia-lyase                             300   3e-93    Populus tomentosa [Chinese white poplar]
ref|XP_007027354.1|  PHE ammonia lyase 1                                300   3e-93    Theobroma cacao [chocolate]
ref|XP_010515816.1|  PREDICTED: phenylalanine ammonia-lyase 2           300   3e-93    Camelina sativa [gold-of-pleasure]
ref|XP_004497516.1|  PREDICTED: phenylalanine ammonia-lyase-like        299   4e-93    Cicer arietinum [garbanzo]
ref|XP_006381441.1|  phenylalanine ammonia-lyase family protein         299   4e-93    Populus trichocarpa [western balsam poplar]
sp|O49835.1|PAL1_LITER  RecName: Full=Phenylalanine ammonia-lyase...    299   4e-93    Lithospermum erythrorhizon
sp|Q40910.1|PAL4_POPKI  RecName: Full=Phenylalanine ammonia-lyase G4    295   4e-93    Populus sieboldii x Populus grandidentata
pir||S60043  phenylalanine ammonia-lyase (EC 4.3.1.5) 4 - Japanes...    296   4e-93 
ref|XP_004304440.1|  PREDICTED: phenylalanine ammonia-lyase 1           299   4e-93    Fragaria vesca subsp. vesca
gb|ADN32768.1|  phenylalanine ammonia-lyase 2                           299   4e-93    Scutellaria baicalensis [Baikal skullcap]
gb|ACE95170.1|  phenylalanine ammonia-lyase                             299   4e-93    Populus tomentosa [Chinese white poplar]
ref|XP_006403711.1|  hypothetical protein EUTSA_v10010153mg             299   5e-93    Eutrema salsugineum [saltwater cress]
ref|XP_006481493.1|  PREDICTED: phenylalanine ammonia-lyase-like        299   5e-93    Citrus sinensis [apfelsine]
emb|CAB42793.1|  phenylalanine-ammonia lyase                            299   5e-93    Citrus clementina x Citrus reticulata
ref|XP_010107516.1|  Phenylalanine ammonia-lyase 1                      294   6e-93    
ref|XP_002315309.2|  hypothetical protein POPTR_0010s23110g             298   6e-93    
ref|XP_006293761.1|  hypothetical protein CARUB_v10022721mg             299   7e-93    Capsella rubella
gb|AEW43005.1|  phenylalanine ammonia lyase                             288   7e-93    Leucaena leucocephala [cassie]
gb|ABR14606.1|  phenylalanine ammonia-lyase                             298   8e-93    Salvia miltiorrhiza [Chinese salvia]
sp|P45731.1|PAL1_POPKI  RecName: Full=Phenylalanine ammonia-lyase G1    298   8e-93    Populus sieboldii x Populus grandidentata
gb|AAC18870.1|  phenylalanine ammonia lyase                             298   1e-92    Arabidopsis thaliana [mouse-ear cress]
ref|NP_181241.1|  phenylalanine ammonia-lyase 1                         298   1e-92    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002881488.1|  hypothetical protein ARALYDRAFT_482690             298   1e-92    
ref|XP_010504083.1|  PREDICTED: phenylalanine ammonia-lyase 2-like      298   2e-92    Camelina sativa [gold-of-pleasure]
ref|XP_008366650.1|  PREDICTED: phenylalanine ammonia-lyase 1           298   2e-92    Malus domestica [apple tree]
ref|XP_010658395.1|  PREDICTED: phenylalanine ammonia-lyase G1          298   2e-92    Vitis vinifera
gb|KHG30005.1|  Phenylalanine ammonia-lyase                             297   2e-92    Gossypium arboreum [tree cotton]
sp|P19142.1|PAL2_PHAVU  RecName: Full=Phenylalanine ammonia-lyase...    297   2e-92    Phaseolus vulgaris [French bean]
gb|AGY49231.1|  phenylalanine ammonia lyase                             297   2e-92    Ricinus communis
dbj|BAE71252.1|  putative phenylalanine ammonia lyase                   297   2e-92    Trifolium pratense [peavine clover]
gb|ADL09136.1|  phenylanlanine ammonia-lyase                            297   2e-92    Brassica oleracea var. botrytis [cauliflower]
ref|XP_006428758.1|  hypothetical protein CICLE_v10011134mg             298   3e-92    
gb|ACM62741.1|  phenylalanine ammonia-lyase                             297   3e-92    Garcinia mangostana [mangosteen]
gb|ADF59062.1|  phenylalanine ammonia-lyase 2 precursor                 297   3e-92    Pyrus x bretschneideri [bai li]
ref|XP_010516949.1|  PREDICTED: phenylalanine ammonia-lyase 1           297   3e-92    Camelina sativa [gold-of-pleasure]
ref|XP_009606373.1|  PREDICTED: phenylalanine ammonia-lyase G4-like     296   4e-92    Nicotiana tomentosiformis
ref|XP_003591877.1|  Phenylalanine ammonia-lyase                        297   4e-92    Medicago truncatula
gb|ABC69916.1|  phenylalanine ammonia-lyase                             296   4e-92    Brassica napus [oilseed rape]
gb|AAZ29733.1|  phenylalanine ammonia lyase                             296   4e-92    Trifolium pratense [peavine clover]
ref|XP_011010447.1|  PREDICTED: phenylalanine ammonia-lyase             296   4e-92    Populus euphratica
ref|XP_009141625.1|  PREDICTED: phenylalanine ammonia-lyase 1           296   4e-92    Brassica rapa
gb|ABE03772.1|  phenylalanine ammonia-lyase                             296   4e-92    Arnebia euchroma
gb|ABY89691.1|  phenylalanine ammonialyase 2 protein                    296   4e-92    Brassica rapa subsp. oleifera [biennial turnip rape]
gb|KHN02334.1|  Phenylalanine ammonia-lyase 1                           294   4e-92    Glycine soja [wild soybean]
gb|AIB06732.1|  phenylalanine ammonia lyase                             296   4e-92    Mangifera indica
dbj|BAH20339.1|  AT3G53260                                              293   4e-92    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010107520.1|  Phenylalanine ammonia-lyase                        296   5e-92    Morus notabilis
sp|P07218.2|PAL1_PHAVU  RecName: Full=Phenylalanine ammonia-lyase...    291   5e-92    Phaseolus vulgaris [French bean]
gb|ABF50788.1|  phenylalanine ammonia-lyase                             296   5e-92    Isatis tinctoria [woad]
ref|XP_009794410.1|  PREDICTED: phenylalanine ammonia-lyase-like        296   5e-92    Nicotiana sylvestris
ref|XP_006424540.1|  hypothetical protein CICLE_v10027912mg             296   6e-92    Citrus clementina [clementine]
gb|ACA30407.1|  phenylalanine ammonia-lyase                             296   6e-92    Stylosanthes guianensis [stylo]
ref|XP_010325983.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    296   6e-92    
dbj|BAO01110.1|  phenylalanine ammonia-lyase                            296   6e-92    Vigna radiata [mung bean]
pir||A24727  phenylalanine ammonia-lyase (EC 4.3.1.5) - kidney be...    290   7e-92 
sp|Q43052.1|PAL2_POPKI  RecName: Full=Phenylalanine ammonia-lyase...    296   7e-92    Populus sieboldii x Populus grandidentata
emb|CAL91169.1|  phenylalanine ammonia-lyase 3                          296   7e-92    Cynara cardunculus var. scolymus [artichoke]
ref|XP_004246652.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    296   7e-92    
gb|ACV30588.1|  phenylalanine ammonia-lyase                             282   8e-92    Carica papaya [mamon]
sp|P45734.1|PALY_TRISU  RecName: Full=Phenylalanine ammonia-lyase       296   8e-92    Trifolium subterraneum
ref|XP_010107518.1|  Phenylalanine ammonia-lyase                        297   9e-92    
gb|ABV44807.1|  phenylalanine ammonia lyase 2                           284   9e-92    Eriobotrya japonica [loquat]
ref|XP_008449240.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      295   9e-92    Cucumis melo [Oriental melon]
prf||2006271A  Phe ammonia lyase                                        296   1e-91 
gb|ACZ36441.1|  phenylalanine ammonialyase                              295   1e-91    Brassica oleracea var. alboglabra [Chinese broccoli]
gb|AIA24411.1|  phenylalanine ammonia-lyase                             295   1e-91    Sinopodophyllum hexandrum [Himalayan mayapple]
ref|XP_007162756.1|  hypothetical protein PHAVU_001G177800g             295   1e-91    Phaseolus vulgaris [French bean]
ref|XP_009143533.1|  PREDICTED: phenylalanine ammonia-lyase 1           295   1e-91    Brassica rapa
ref|XP_006488063.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      295   1e-91    Citrus sinensis [apfelsine]
gb|KHN09507.1|  Phenylalanine ammonia-lyase 1                           295   1e-91    Glycine soja [wild soybean]
gb|AAX84839.1|  phenylalanine ammonia-lyase                             295   1e-91    Astragalus mongholicus
ref|XP_009103852.1|  PREDICTED: phenylalanine ammonia-lyase 2-like      295   1e-91    Brassica rapa
dbj|BAM28965.1|  phenylalanine ammonia lyase                            283   2e-91    
ref|XP_003521397.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      295   2e-91    
dbj|BAF36976.1|  phenylalanine ammonia-lyase                            295   2e-91    
gb|AEV53411.1|  phenylalanine ammonia-lyase 3                           295   2e-91    
dbj|BAJ17655.1|  phenylalanine ammonia lyase                            295   2e-91    
gb|ADA81868.1|  phenylalanine ammonia-lyase                             295   2e-91    
gb|AAZ29732.1|  phenylalanine ammonia lyase                             295   2e-91    
ref|XP_003554382.1|  PREDICTED: phenylalanine ammonia-lyase 1-lik...    294   3e-91    
ref|XP_011041027.1|  PREDICTED: phenylalanine ammonia-lyase G2B-l...    294   3e-91    
ref|XP_009116020.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    295   3e-91    
gb|ABN79671.2|  phenylalanine ammonia-lyase                             295   3e-91    
ref|XP_006424538.1|  hypothetical protein CICLE_v10027913mg             294   3e-91    
gb|AAM12956.1|  phenylalanine ammonia-lyase                             294   3e-91    
gb|AAX22053.1|  phenylalanine ammonia-lyase                             294   3e-91    
ref|XP_011041025.1|  PREDICTED: phenylalanine ammonia-lyase G2B         294   3e-91    
gb|AAC18871.1|  phenylalanine ammonia lyase                             294   4e-91    
ref|NP_190894.1|  phenylalanine ammonia-lyase 2                         294   4e-91    
gb|AGH13333.1|  phenylalanine ammonia-lyase                             294   4e-91    
gb|AAX22055.1|  phenylalanine ammonia-lyase                             294   4e-91    
gb|ABY89690.1|  phenylalanine ammonialyase 1 protein                    294   4e-91    
ref|XP_010505261.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      294   5e-91    
gb|ABI33979.1|  phenylalanine ammonia lyase                             293   5e-91    
gb|KFK36594.1|  hypothetical protein AALP_AA4G144000                    294   6e-91    
ref|XP_010509401.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      294   6e-91    
gb|ABQ63094.1|  phenylalanine ammonia-lyase                             293   6e-91    
gb|EYU34451.1|  hypothetical protein MIMGU_mgv1a002104mg                293   6e-91    
gb|AAR31107.1|  phenylalanine ammonia-lyase                             293   7e-91    
gb|AAZ29735.1|  phenylalanine ammonia lyase                             293   7e-91    
ref|XP_007143727.1|  hypothetical protein PHAVU_007G096300g             293   7e-91    
gb|AAZ29734.1|  phenylalanine ammonia lyase                             293   8e-91    
ref|XP_011041026.1|  PREDICTED: phenylalanine ammonia-lyase G2B-l...    294   8e-91    
gb|ADY02660.1|  phenylalanine ammonia lyase                             293   8e-91    
ref|XP_002877909.1|  phenylalanine ammonia-lyase 2                      293   8e-91    
sp|P27991.1|PAL1_SOYBN  RecName: Full=Phenylalanine ammonia-lyase 1     293   8e-91    
gb|KFK34576.1|  hypothetical protein AALP_AA5G163700                    293   9e-91    
gb|AGV54597.1|  phenylalanine ammonia-lyase                             293   9e-91    
ref|XP_006410883.1|  hypothetical protein EUTSA_v10016314mg             293   9e-91    
gb|AIZ76768.1|  PAL2                                                    283   1e-90    
gb|AIZ76770.1|  PAL2                                                    283   1e-90    
gb|AAN32867.1|AF460204_1  phenylalanine ammonia-lyase 2                 290   1e-90    
gb|AID51445.1|  phenylalanine ammonia-lyase 2                           293   1e-90    
gb|ACR15762.1|  phenylalanine ammonia-lyase                             293   1e-90    
gb|KGN48161.1|  hypothetical protein Csa_6G445740                       288   1e-90    
ref|XP_010553331.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      293   2e-90    
ref|XP_003521396.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      292   2e-90    
gb|ACT53399.1|  phenylalanine ammonia-lyase 2                           292   2e-90    
gb|KGN52971.1|  hypothetical protein Csa_4G008250                       278   2e-90    
gb|ADD82537.1|  phenylalanine ammonia-lyase                             289   2e-90    
gb|AFG26322.1|  phenylalanine ammonia-lyase                             292   2e-90    
gb|AAY82485.1|  phenylalanine ammonia-lyase                             286   2e-90    
gb|ABC69917.1|  phenylalanine ammonia-lyase                             292   3e-90    
gb|ADY02661.1|  phenylalanine ammonia lyase                             291   3e-90    
gb|ACT32033.1|  phenylalanine ammonia-lyase                             291   3e-90    
ref|XP_007220629.1|  hypothetical protein PRUPE_ppa002328mg             289   4e-90    
gb|KHG04887.1|  Phenylalanine ammonia-lyase                             291   5e-90    
gb|KDO50673.1|  hypothetical protein CISIN_1g005031mg                   291   6e-90    
gb|AAL55242.1|AF299330_1  phenylalanine ammonia-lyase                   291   6e-90    
ref|XP_010684079.1|  PREDICTED: phenylalanine ammonia-lyase             291   6e-90    
ref|XP_010935894.1|  PREDICTED: phenylalanine ammonia-lyase             290   7e-90    
ref|XP_004143255.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      291   7e-90    
gb|KJB16792.1|  hypothetical protein B456_002G248000                    291   8e-90    
ref|XP_006428759.1|  hypothetical protein CICLE_v10011175mg             291   8e-90    
gb|AAD45384.1|  phenylalanine ammonia-lyase                             289   9e-90    
ref|XP_007220630.1|  hypothetical protein PRUPE_ppa002328mg             290   1e-89    
ref|XP_004156289.1|  PREDICTED: phenylalanine ammonia-lyase-like        290   1e-89    
gb|AER12109.1|  PAL                                                     290   1e-89    
ref|XP_008449239.1|  PREDICTED: phenylalanine ammonia-lyase-like        290   1e-89    
gb|AFP49806.1|  phenylalanine ammonialyase 1                            290   2e-89    
gb|AEL21616.1|  phenylalanine ammonia lyase 1                           290   2e-89    
gb|AID51446.1|  phenylalanine ammonia-lyase 3                           290   2e-89    
gb|AAN32866.1|AF460203_1  phenylalanine ammonia-lyase 1                 290   2e-89    
gb|AAY82486.1|  phenylalanine ammonia-lyase                             287   2e-89    
gb|AFP86474.1|  phenylalanine ammonia-lyase                             290   2e-89    
sp|P45727.1|PALY_PERAE  RecName: Full=Phenylalanine ammonia-lyase       287   2e-89    
gb|KDP29132.1|  hypothetical protein JCGZ_16521                         289   2e-89    
gb|AIZ76769.1|  PAL2                                                    284   2e-89    
ref|XP_008233304.1|  PREDICTED: phenylalanine ammonia-lyase 1           289   2e-89    
gb|ADY02662.1|  phenylalanine ammonia lyase                             288   3e-89    
gb|AEH02821.1|  phenylalanine ammonia lyase                             289   3e-89    
gb|AEJ88223.1|  phenylalanine ammonia lyase                             289   3e-89    
gb|AFJ80777.1|  phenylalanine ammonia-lyase                             288   4e-89    
gb|ADD12041.1|  phenylalanine ammonia lyase                             288   5e-89    
gb|AGU91428.1|  phenylalanine ammonia-lyase                             288   6e-89    
ref|XP_004143256.1|  PREDICTED: phenylalanine ammonia-lyase-like        288   7e-89    
ref|XP_004156293.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    288   7e-89    
emb|CAB42794.1|  phenylalanine-ammonia lyase                            288   8e-89    
gb|AAM28276.1|  phenylalanine ammonia-lyase                             275   1e-88    
gb|AIZ76767.1|  PAL2                                                    284   1e-88    
ref|XP_010528074.1|  PREDICTED: phenylalanine ammonia-lyase 1           287   1e-88    
gb|KDP44384.1|  hypothetical protein JCGZ_20064                         287   2e-88    
gb|EPS61109.1|  phenylalanine ammonia-lyase                             286   2e-88    
ref|XP_008805217.1|  PREDICTED: phenylalanine ammonia-lyase             286   2e-88    
emb|CAL91037.1|  phenylalanine ammonia-lyase 1                          286   2e-88    
gb|ADC34597.1|  phenylalanine ammonia-lyase                             286   3e-88    
gb|AAP34199.1|  phenylalanine ammonia-lyase                             286   3e-88    
gb|ACT21093.1|  phenylalanine ammonia-lyase                             286   4e-88    
gb|AFI71896.1|  phenylalanine ammonia-lyase                             286   4e-88    
gb|ADQ28104.1|  phenylalanine ammonia-lyase                             286   5e-88    
ref|XP_002285277.1|  PREDICTED: phenylalanine ammonia-lyase             286   6e-88    
dbj|BAM28963.1|  phenylalanine ammonia lyase                            286   6e-88    
gb|AGE10591.1|  phenylalanine amononia-lyase                            285   7e-88    
sp|O49836.1|PAL2_LITER  RecName: Full=Phenylalanine ammonia-lyase...    285   9e-88    
ref|XP_007016787.1|  PHE ammonia lyase 1                                285   1e-87    
gb|KGN52973.1|  hypothetical protein Csa_4G008760                       278   1e-87    
ref|XP_011077265.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    285   1e-87    
gb|ACM61988.1|  phenylalanine ammonia-lyase                             284   2e-87    
dbj|BAG70992.1|  phenylalanine ammonia-lyase                            284   2e-87    
dbj|BAM28964.1|  phenylalanine ammonia lyase                            285   2e-87    
ref|XP_008449238.1|  PREDICTED: phenylalanine ammonia-lyase             283   3e-87    
ref|XP_009392118.1|  PREDICTED: phenylalanine ammonia-lyase-like        283   4e-87    
ref|XP_009399473.1|  PREDICTED: phenylalanine ammonia-lyase             283   4e-87    
gb|ACG56648.1|  phenylalanine ammonia lyase                             283   4e-87    
gb|ACT68010.1|  phenylalanine ammonia-lyase                             283   4e-87    
ref|XP_002529414.1|  Phenylalanine ammonia-lyase, putative              283   6e-87    
gb|AID69536.1|  phenylalanine ammonia-lyase                             278   6e-87    
sp|Q42609.1|PALY_BROFI  RecName: Full=Phenylalanine ammonia-lyase       282   1e-86    
gb|AHG06397.1|  phenylalanine ammonia lyase 62                          282   1e-86    
gb|ACG56647.1|  phenylalanine ammonia lyase                             282   1e-86    
ref|XP_010529727.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      282   1e-86    
gb|AGE10605.1|  phenylalanine amononia-lyase                            270   1e-86    
gb|AAW78932.1|  phenylalanine-ammonia lyase                             281   3e-86    
ref|XP_008449237.1|  PREDICTED: phenylalanine ammonia-lyase-like        281   3e-86    
gb|AGC23439.1|  phenylalanine ammonia-lyase                             281   3e-86    
gb|KGN48165.1|  hypothetical protein Csa_6G445780                       272   5e-86    
ref|XP_004167356.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    279   6e-86    
ref|XP_008454138.1|  PREDICTED: phenylalanine ammonia-lyase-like        280   7e-86    
gb|ACG80829.1|  phenylalanine ammonia lyase                             276   1e-85    
ref|XP_010031967.1|  PREDICTED: phenylalanine ammonia-lyase-like        280   1e-85    
ref|XP_009759945.1|  PREDICTED: phenylalanine ammonia-lyase G4-like     280   1e-85    
ref|XP_008785254.1|  PREDICTED: phenylalanine ammonia-lyase-like        279   2e-85    
gb|AIC66437.1|  phenylalanine ammonia lyase                             279   2e-85    
ref|XP_004152158.1|  PREDICTED: phenylalanine ammonia-lyase-like        279   2e-85    
gb|AFP49807.1|  phenylalanine ammonialyase 4                            279   2e-85    
gb|AEO92029.1|  phenylalanine ammonia-lyase 3                           279   2e-85    
ref|XP_010906526.1|  PREDICTED: phenylalanine ammonia-lyase-like        278   3e-85    
ref|XP_004173358.1|  PREDICTED: phenylalanine ammonia-lyase-like        275   3e-85    
gb|KGN48162.1|  hypothetical protein Csa_6G445750                       278   4e-85    
gb|AFU82540.1|  phenylalanine ammonia-lyase                             261   4e-85    
ref|XP_004143257.1|  PREDICTED: phenylalanine ammonia-lyase-like        278   6e-85    
gb|AAO13347.1|  phenylalanine ammonia-lyase2                            277   8e-85    
gb|ACG80828.1|  phenylalanine ammonia lyase                             274   8e-85    
gb|KGN48164.1|  hypothetical protein Csa_6G445770                       277   1e-84    
ref|XP_004143356.1|  PREDICTED: phenylalanine ammonia-lyase-like        277   1e-84    
ref|XP_010067318.1|  PREDICTED: phenylalanine ammonia-lyase             276   2e-84    
ref|XP_008463969.1|  PREDICTED: phenylalanine ammonia-lyase-like        276   2e-84    
ref|XP_009596642.1|  PREDICTED: phenylalanine ammonia-lyase G4-like     276   2e-84    
ref|XP_008454139.1|  PREDICTED: phenylalanine ammonia-lyase-like        276   2e-84    
gb|AHA42443.1|  phenylalanine ammonia lyase                             275   3e-84    
gb|AAV98199.1|  phenylalanine ammonialyase 1                            276   4e-84    
ref|XP_008449236.1|  PREDICTED: phenylalanine ammonia-lyase-like        275   4e-84    
gb|AAR19393.1|  phenylalanine ammonia-lyase                             275   4e-84    
gb|AEC11891.1|  PAL1                                                    276   4e-84    
dbj|BAM28966.1|  phenylalanine ammonia lyase                            275   4e-84    
ref|XP_004145752.1|  PREDICTED: phenylalanine ammonia-lyase-like        275   4e-84    
ref|XP_010934327.1|  PREDICTED: phenylalanine ammonia-lyase-like        275   4e-84    
gb|AFS28702.1|  putative phenylalanine ammonia-lyase                    271   5e-84    
sp|Q9M568.1|PAL1_RUBID  RecName: Full=Phenylalanine ammonia-lyase...    275   8e-84    
ref|XP_008454137.1|  PREDICTED: phenylalanine ammonia-lyase-like        275   1e-83    
dbj|BAM28967.1|  phenylalanine ammonia lyase                            274   1e-83    
ref|XP_002862326.1|  predicted protein                                  260   1e-83    
dbj|BAM05604.1|  phenylalanine ammonia lyase                            266   1e-83    
ref|XP_009401948.1|  PREDICTED: phenylalanine ammonia-lyase-like        273   3e-83    
ref|XP_004152155.1|  PREDICTED: phenylalanine ammonia-lyase-like        273   3e-83    
ref|XP_010067316.1|  PREDICTED: phenylalanine ammonia-lyase             273   3e-83    
gb|ADN32766.1|  phenylalanine ammonia-lyase                             273   3e-83    
gb|AEM63671.1|  phenylalanine ammonia lyase 2                           273   4e-83    
ref|XP_002882662.1|  hypothetical protein ARALYDRAFT_897210             273   4e-83    
gb|AJO53272.1|  phenylalanine ammonia-lyase                             273   4e-83    
gb|ADQ39192.1|  phenylalanine ammonia lyase 6                           273   5e-83    
ref|XP_009146849.1|  PREDICTED: phenylalanine ammonia-lyase 4           272   5e-83    
gb|ACZ51372.1|  phenylalanine ammonia-lyase                             272   5e-83    
ref|XP_004143259.1|  PREDICTED: phenylalanine ammonia-lyase-like        272   6e-83    
emb|CDY08611.1|  BnaA05g28470D                                          272   6e-83    
ref|XP_004143258.1|  PREDICTED: phenylalanine ammonia-lyase-like        272   6e-83    
ref|XP_009413725.1|  PREDICTED: phenylalanine ammonia-lyase-like        271   1e-82    
gb|AAD47085.1|AF167487_1  phenylalanine ammonia lyase                   263   2e-82    
gb|AEM63670.1|  phenylalanine ammonia lyase 1                           271   2e-82    
ref|XP_010032174.1|  PREDICTED: phenylalanine ammonia-lyase-like        271   2e-82    
emb|CAA53733.1|  phenylanaline ammonia-lyase                            269   2e-82    
ref|XP_004307376.1|  PREDICTED: phenylalanine ammonia-lyase 1           271   3e-82    
ref|XP_006407581.1|  hypothetical protein EUTSA_v10020168mg             270   3e-82    
gb|AAW51923.2|  phenylalanine ammonia-lyase 2                           271   3e-82    
emb|CDY00922.1|  BnaC05g42780D                                          270   4e-82    
gb|AHF20178.1|  phenylalanine ammonia lyase                             268   4e-82    
ref|XP_006407580.1|  hypothetical protein EUTSA_v10020168mg             270   4e-82    
emb|CAA68064.1|  phenylalanine ammonia-lyase                            260   5e-82    
gb|AGE10617.1|  phenylalanine amononia-lyase                            267   5e-82    
gb|AIE16710.1|  phenylalanine ammonia-lyase                             255   7e-82    
dbj|BAB19128.1|  phenylalanine ammonia-lyase                            267   7e-82    
dbj|BAL49995.1|  phenylalanine ammonia-lyase                            269   1e-81    
dbj|BAF93189.1|  putative phenylalanine ammonia-lyase                   264   2e-81    
ref|XP_010067317.1|  PREDICTED: phenylalanine ammonia-lyase-like        268   3e-81    
gb|ADA72013.1|  phenylalanine ammonia-lyase                             268   3e-81    
ref|XP_010482945.1|  PREDICTED: phenylalanine ammonia-lyase 4-like      268   3e-81    
gb|ACX31148.1|  phenylalanine ammonialyase                              266   4e-81    
gb|AHG06396.1|  phenylalanine ammonia lyase 2                           268   4e-81    
gb|AIE16718.1|  phenylalanine ammonia-lyase                             253   5e-81    
gb|AGE10590.1|  phenylalanine amononia-lyase                            267   8e-81    
gb|EMS57329.1|  Phenylalanine ammonia-lyase                             259   8e-81    
dbj|BAJ85028.1|  predicted protein                                      265   9e-81    
gb|AGZ95690.1|  phenylalanine ammonia-lyase                             266   1e-80    
gb|AAS48415.1|  phenylalanine lyase                                     266   1e-80    
gb|ACZ44834.1|  phenylalanine ammonia-lyase                             266   1e-80    
gb|ADT63058.1|  phenylalanine ammonia-lyase                             266   2e-80    
gb|ACT22906.1|  phenylalanine ammonia-lyase                             263   2e-80    
ref|NP_187645.1|  phenylalanine ammonia-lyase 4                         265   3e-80    
dbj|BAC10907.1|  phenylalanine ammonia-lyase 1                          256   3e-80    
gb|AAK60274.1|AF383151_1  phenylalanine ammonia-lyase 1                 265   3e-80    
gb|KFK38414.1|  hypothetical protein AALP_AA3G110100                    265   3e-80    
ref|XP_010543544.1|  PREDICTED: phenylalanine ammonia-lyase 4           265   5e-80    
ref|XP_006297083.1|  hypothetical protein CARUB_v10013086mg             265   5e-80    
gb|KFK38413.1|  hypothetical protein AALP_AA3G110100                    265   5e-80    
ref|XP_010464706.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    264   6e-80    
ref|XP_004239660.1|  PREDICTED: phenylalanine ammonia-lyase-like        265   6e-80    
ref|XP_003580144.1|  PREDICTED: phenylalanine ammonia-lyase             264   7e-80    
gb|AII00960.1|  phenylalanine ammonia lyase                             256   8e-80    
gb|AER58180.1|  phenylalanine ammonia lyase                             264   9e-80    
gb|EMT29669.1|  Phenylalanine ammonia-lyase                             261   1e-79    
gb|EMT29668.1|  Phenylalanine ammonia-lyase                             263   1e-79    
gb|ACT53398.1|  phenylalanine ammonia-lyase 1                           263   1e-79    
emb|CAA89005.1|  phenylalanine ammonia-lyase                            258   1e-79    



>gb|AHJ60264.1| phenylalanine ammonia-lyase 1 [Ipomoea purpurea]
Length=707

 Score =   367 bits (941),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 172/174 (99%), Positives = 173/174 (99%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCS NYPLMQKLRQVLVDHAL
Sbjct  534  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSENYPLMQKLRQVLVDHAL  593

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
            QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK
Sbjct  594  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  653

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            FIREELGTE+LTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC
Sbjct  654  FIREELGTEMLTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  707



>sp|Q42858.1|PAL2_IPOBA RecName: Full=Phenylalanine ammonia-lyase [Ipomoea batatas]
 dbj|BAA11459.1| phenylalanine ammonia-lyase [Ipomoea batatas]
Length=708

 Score =   359 bits (921),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 167/174 (96%), Positives = 173/174 (99%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPL QKLRQVLVDHAL
Sbjct  535  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLFQKLRQVLVDHAL  594

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
            QNGEHEKNVSTSIFQKIAAFEDELKA+LPKEVEGARSA+ENGNPAIPNRITECRSYPLYK
Sbjct  595  QNGEHEKNVSTSIFQKIAAFEDELKAVLPKEVEGARSAIENGNPAIPNRITECRSYPLYK  654

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGTE+LTGEKV+SPGEVCDKVFTAVCDGGIIDPLLECLKSW+GAPLPIC
Sbjct  655  FVREELGTEMLTGEKVKSPGEVCDKVFTAVCDGGIIDPLLECLKSWDGAPLPIC  708



>dbj|BAF98438.1| phenylalanine ammonia-lyase [Glehnia littoralis]
Length=267

 Score =   315 bits (808),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 148/174 (85%), Positives = 160/174 (92%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKR LTMGVNGELHPSRFCEKDLLRVVDREY+FAY DDPCSA YPLMQKLR+ LV+HAL
Sbjct  94   VAKRVLTMGVNGELHPSRFCEKDLLRVVDREYIFAYIDDPCSATYPLMQKLRETLVEHAL  153

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NG+ E+N+STSIFQKIAAFEDELKALLPKEVE AR+ALE+GNPAIPNRI ECRSYPLYK
Sbjct  154  NNGDKERNLSTSIFQKIAAFEDELKALLPKEVESARAALESGNPAIPNRIKECRSYPLYK  213

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGTE LTGEKV+SPGE  DKVFTA+  G IIDPLLECL+SWNGAPLPIC
Sbjct  214  FVREELGTEYLTGEKVRSPGEEFDKVFTAMSRGEIIDPLLECLESWNGAPLPIC  267



>dbj|BAF98437.1| phenylalanine ammonia-lyase [Glehnia littoralis]
Length=267

 Score =   315 bits (806),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 147/173 (85%), Positives = 158/173 (91%), Gaps = 0/173 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAK+ LTMGVNGELHPSRFCEKDLLRVVDREY+FAY DDPCSA YPLMQKLRQVLV+HAL
Sbjct  94   VAKKVLTMGVNGELHPSRFCEKDLLRVVDREYIFAYIDDPCSATYPLMQKLRQVLVEHAL  153

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
            +NGE EKN+STSIFQKIAAFEDELK LLPKEVE AR+ LE+GNPA+PNRI ECRSYPLYK
Sbjct  154  KNGETEKNLSTSIFQKIAAFEDELKTLLPKEVESARAVLESGNPAVPNRIKECRSYPLYK  213

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPI  146
            FIREELGT  LTGEKV SPGE  DKVFTA+C G IIDPL+ECL+SWNGAPLPI
Sbjct  214  FIREELGTVYLTGEKVTSPGEEFDKVFTAMCKGQIIDPLMECLQSWNGAPLPI  266



>ref|XP_009629066.1| PREDICTED: phenylalanine ammonia-lyase [Nicotiana tomentosiformis]
 sp|P25872.1|PAL1_TOBAC RecName: Full=Phenylalanine ammonia-lyase [Nicotiana tabacum]
 gb|AAA34122.1| phenylalanine ammonia lyase [Nicotiana tabacum]
 dbj|BAA22948.1| phenylalanine ammonia-lyase [Nicotiana tabacum]
Length=715

 Score =   328 bits (842),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 148/174 (85%), Positives = 166/174 (95%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLTMG NGELHP+RFCEK+LLR+VDREY+FAYADDPCS NYPLMQKLRQVLVDHA+
Sbjct  542  VAKRTLTMGANGELHPARFCEKELLRIVDREYLFAYADDPCSCNYPLMQKLRQVLVDHAM  601

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE EKNV++SIFQKI AFEDELKA+LPKEVE AR+ALE+GNPAIPNRITECRSYPLY+
Sbjct  602  NNGESEKNVNSSIFQKIGAFEDELKAVLPKEVESARAALESGNPAIPNRITECRSYPLYR  661

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+R+ELGTE+LTGEKV+SPGE CDKVFTA+C+G IIDP+LECLKSWNGAPLPIC
Sbjct  662  FVRKELGTELLTGEKVRSPGEECDKVFTAMCNGQIIDPMLECLKSWNGAPLPIC  715



>gb|AAG49585.1|AF325496_1 phenylalanine ammonia-lyase [Ipomoea nil]
Length=711

 Score =   327 bits (838),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 151/174 (87%), Positives = 162/174 (93%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLTMG NGELHP+RFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQ LVDHAL
Sbjct  538  VAKRTLTMGANGELHPARFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQALVDHAL  597

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
            QNGE EKN  TSIF K+AAFEDELKA+LPKEVE AR A+E+GNPAIPNRI ECRSYPLYK
Sbjct  598  QNGESEKNTGTSIFLKVAAFEDELKAVLPKEVEAARIAVESGNPAIPNRIKECRSYPLYK  657

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+RE LGTE+LTGEKV+SPGE CDKVFTA+C+G IIDPLLECLKSW+GAPLPIC
Sbjct  658  FVREGLGTELLTGEKVRSPGEECDKVFTAMCEGSIIDPLLECLKSWDGAPLPIC  711



>gb|AIB08913.1| phenylalanine ammonia-lyase, partial [Angelica sinensis]
Length=233

 Score =   311 bits (797),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 146/173 (84%), Positives = 158/173 (91%), Gaps = 0/173 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKR LTMGVNGELHPSRFCEKDLLRVVDREY+FAY DDPCSA YPLMQKLR+ LV+HAL
Sbjct  61   VAKRVLTMGVNGELHPSRFCEKDLLRVVDREYIFAYIDDPCSATYPLMQKLRETLVEHAL  120

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NG+ E+N+STSIFQKIAAFEDELK LLPKEVE AR+ALE+GNPAIPNRI ECRSYPLYK
Sbjct  121  NNGDKERNLSTSIFQKIAAFEDELKTLLPKEVESARAALESGNPAIPNRIKECRSYPLYK  180

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPI  146
            F+REELGTE LTGEKV+SPGE  DKVFTA+  G IIDPLLECL+SWNGAPLPI
Sbjct  181  FVREELGTEYLTGEKVRSPGEEFDKVFTAMSKGEIIDPLLECLESWNGAPLPI  233



>gb|ABG75911.1| phenylalanine ammonia-lyase 2 [Nicotiana attenuata]
Length=717

 Score =   325 bits (834),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 147/174 (84%), Positives = 166/174 (95%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLTMG NGELHP+RFCEK+LLRVVDREY+FAYADDPCS NYPLMQKLRQVLVDHA+
Sbjct  544  VAKRTLTMGANGELHPARFCEKELLRVVDREYLFAYADDPCSCNYPLMQKLRQVLVDHAM  603

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
            +NGE EKNV++SIFQKI AFEDELKA+LPKEVE AR+ALE+GNPAI NRITECRSYPLY+
Sbjct  604  KNGESEKNVNSSIFQKIGAFEDELKAVLPKEVENARAALESGNPAIANRITECRSYPLYR  663

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+R+ELGTE+LTGE+V+SPGE CDKVFTA+C+G IIDP+LECLKSWNGAPLPIC
Sbjct  664  FVRKELGTELLTGERVRSPGEECDKVFTAMCNGQIIDPMLECLKSWNGAPLPIC  717



>sp|P14166.1|PAL1_IPOBA RecName: Full=Phenylalanine ammonia-lyase [Ipomoea batatas]
 gb|AAA33389.1| phenylalanine ammonia-lyase [Ipomoea batatas]
Length=707

 Score =   325 bits (834),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 150/174 (86%), Positives = 163/174 (94%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLT+G NGELHP+RFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQ LVDHAL
Sbjct  534  VAKRTLTVGANGELHPARFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQALVDHAL  593

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
            QNGE+EKN  TSIF K+AAFEDELKA+LPKEVE AR A+E+GNPAIPNRI ECRSYPLYK
Sbjct  594  QNGENEKNTGTSIFLKVAAFEDELKAVLPKEVEAARIAVESGNPAIPNRIKECRSYPLYK  653

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+RE LGTE+LTGEKV+SPGE CDKVFTA+C+G IIDPLLECLKSW+GAPLPIC
Sbjct  654  FVREGLGTELLTGEKVRSPGEECDKVFTAMCEGSIIDPLLECLKSWDGAPLPIC  707



>dbj|BAF98439.1| phenylalanine ammonia-lyase [Glehnia littoralis]
Length=267

 Score =   310 bits (794),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 145/174 (83%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKR LTMGVNGELHPSRFCEKDLLRVVDREY+FAY DDPCSA YPLMQKLRQ LV+HAL
Sbjct  94   VAKRVLTMGVNGELHPSRFCEKDLLRVVDREYIFAYIDDPCSATYPLMQKLRQTLVEHAL  153

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NG++E+N+STSIFQKIA FEDELKALLPKEVE AR+ALE+GNPAIPNRI ECRSYPLYK
Sbjct  154  TNGDNERNLSTSIFQKIATFEDELKALLPKEVESARAALESGNPAIPNRIEECRSYPLYK  213

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REEL T+ LTGEKV+SPGE  DKVFTA+  G IIDPLL CL+SWNGAPLPIC
Sbjct  214  FVREELATDYLTGEKVRSPGEEFDKVFTAMSKGEIIDPLLACLESWNGAPLPIC  267



>gb|AAC33966.1| phenylalanine ammonia-lyase [Capsicum chinense]
Length=532

 Score =   318 bits (814),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 145/174 (83%), Positives = 163/174 (94%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLTMG NGELHP+RFCEK+LLRVVDREY+FAYADDPCS+ YPLMQKLRQVLVDHAL
Sbjct  359  VAKRTLTMGANGELHPARFCEKELLRVVDREYLFAYADDPCSSTYPLMQKLRQVLVDHAL  418

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE EKNV++SIFQKIAAFEDELKA+LPKEVE AR  LE+GNP+IPNRITECRSYPLY+
Sbjct  419  NNGESEKNVNSSIFQKIAAFEDELKAVLPKEVESARITLESGNPSIPNRITECRSYPLYR  478

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
             +R+ELGTE+LTGE+V+SPGE  DKVFTA+C+G +IDPLLECLKSWNGAPLPIC
Sbjct  479  LVRKELGTELLTGERVRSPGEEIDKVFTAMCNGQVIDPLLECLKSWNGAPLPIC  532



>gb|ABG75910.1| phenylalanine ammonia-lyase 1 [Nicotiana attenuata]
Length=712

 Score =   322 bits (826),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 150/174 (86%), Positives = 161/174 (93%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLTMG NGELHPSRFCEKDLLRVVDREYVFAYADD CSANYPLMQKLRQVLVDHAL
Sbjct  539  VAKRTLTMGANGELHPSRFCEKDLLRVVDREYVFAYADDACSANYPLMQKLRQVLVDHAL  598

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
            QNGE+EKN ++SIFQKI AFEDELKA+LPKEVE AR ALE+GNPAI NRI ECRSYPLY+
Sbjct  599  QNGENEKNANSSIFQKILAFEDELKAVLPKEVESARIALESGNPAIANRIKECRSYPLYR  658

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELG E+LTGEKV+SPGE CDKVFTA+C+G IID LLECLK WNGAPLPIC
Sbjct  659  FVREELGAELLTGEKVRSPGEECDKVFTAMCNGQIIDSLLECLKEWNGAPLPIC  712



>sp|P35512.1|PALY_MALDO RecName: Full=Phenylalanine ammonia-lyase, partial [Malus domestica]
 emb|CAA48231.1| phenylalanine ammonia-lyase [Malus sp.]
Length=235

 Score =   306 bits (785),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 143/174 (82%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLT GVNGELHPSRFCEKDLL+VVDREYVFAY DDPCSA YPLMQKLR+VL++HAL
Sbjct  62   VAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLREVLIEHAL  121

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE EKN STSIFQKI AFE+ELKALLPKEVE ARSA+E GN A+PNRI ECRSYPLYK
Sbjct  122  TNGESEKNASTSIFQKIGAFEEELKALLPKEVESARSAIEGGNAAVPNRIAECRSYPLYK  181

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELG E LTGEKV+SPGE CDKVF A+C G IIDP+L CL+ WNGAPLPIC
Sbjct  182  FVREELGGEYLTGEKVRSPGEECDKVFQAICQGKIIDPILGCLEGWNGAPLPIC  235



>ref|XP_009766905.1| PREDICTED: phenylalanine ammonia-lyase [Nicotiana sylvestris]
 gb|ACJ66297.1| phenylalanine ammonia-lyase 4 [Nicotiana tabacum]
 gb|ACJ66298.1| phenylalanine ammonia-lyase 4 [Nicotiana tabacum]
Length=717

 Score =   322 bits (824),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 146/174 (84%), Positives = 164/174 (94%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLTMG NGELHP+RFCEK+LLRVVDREY+FAYADDPCS NYPLMQKLRQVLVDHA+
Sbjct  544  VAKRTLTMGANGELHPARFCEKELLRVVDREYLFAYADDPCSCNYPLMQKLRQVLVDHAM  603

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE EKNV++SIFQKI AFEDELKA+LPKEVE AR+ALE GNPAI NRITECRSYPLY+
Sbjct  604  NNGESEKNVNSSIFQKIGAFEDELKAVLPKEVESARAALECGNPAIANRITECRSYPLYR  663

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+R+ELGTE+LTGE+V+SPGE C+KVFTA+C+G IIDP+LECLKSWNGAPLPIC
Sbjct  664  FVRKELGTELLTGERVRSPGEECEKVFTAMCNGQIIDPMLECLKSWNGAPLPIC  717



>gb|AET41698.1| phenylalanine ammonia-lyase [Prunus salicina]
Length=317

 Score =   309 bits (792),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 142/174 (82%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLT GVNGELHPSRFCEKDLL+VVDREYVFAY DDPCSA YPLMQKLRQVLV+HAL
Sbjct  144  VAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLRQVLVEHAL  203

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE+EKN STSIFQKI AFE+ELK LLPKEV+ AR+AL++G+  +PNRITECRSYPLYK
Sbjct  204  TNGENEKNASTSIFQKIVAFEEELKVLLPKEVDSARAALDSGSAGVPNRITECRSYPLYK  263

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELG E LTGEKV+SPGE CDKVF+A+C+G IIDP+LECL+ WNGAPLPIC
Sbjct  264  FVREELGAEYLTGEKVRSPGEECDKVFSAICEGKIIDPILECLEGWNGAPLPIC  317



>ref|XP_009625397.1| PREDICTED: phenylalanine ammonia-lyase [Nicotiana tomentosiformis]
Length=712

 Score =   321 bits (823),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 149/174 (86%), Positives = 161/174 (93%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLTMG NGELHPSRFCEKDLLRVVDREYVFAYADD CSANYPLMQKLRQVLVDHAL
Sbjct  539  VAKRTLTMGTNGELHPSRFCEKDLLRVVDREYVFAYADDACSANYPLMQKLRQVLVDHAL  598

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
            QNGE+EKN ++SIFQKI AFEDELKA+LPKEVE AR+ALE+GNPAI NRI ECRSYPLY+
Sbjct  599  QNGENEKNANSSIFQKILAFEDELKAVLPKEVESARAALESGNPAIANRIKECRSYPLYR  658

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+R ELG E+LTGEKV+SPGE CDKVFTA+C+G IID LLECLK WNGAPLPIC
Sbjct  659  FVRGELGAELLTGEKVRSPGEECDKVFTAMCNGQIIDSLLECLKEWNGAPLPIC  712



>ref|XP_004246650.1| PREDICTED: phenylalanine ammonia-lyase-like [Solanum lycopersicum]
Length=721

 Score =   321 bits (823),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 145/174 (83%), Positives = 164/174 (94%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLTMG NGELHP+RFCEK+LLRVVDREYVFAYADDPCS+ YPLMQKLRQVLVDHA+
Sbjct  548  VAKRTLTMGANGELHPARFCEKELLRVVDREYVFAYADDPCSSTYPLMQKLRQVLVDHAM  607

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
            +NGE EKNV++SIFQKI AFEDELKA+LPKEVE AR+ +E+GNPAIPNRITECRSYPLY+
Sbjct  608  KNGESEKNVNSSIFQKIVAFEDELKAVLPKEVESARAVVESGNPAIPNRITECRSYPLYR  667

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
             +R+ELG+E+LTGEKV+SPGE  DKVFTA+C+G IIDPLLECLKSWNGAPLPIC
Sbjct  668  LVRQELGSELLTGEKVRSPGEEIDKVFTAMCNGQIIDPLLECLKSWNGAPLPIC  721



>emb|CDP06747.1| unnamed protein product [Coffea canephora]
Length=557

 Score =   317 bits (812),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 146/174 (84%), Positives = 160/174 (92%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLTMG NGELHPSRFC+KDLLRVVDREY FAY DDPCSA YPLMQKLRQVLVDHAL
Sbjct  384  VAKRTLTMGANGELHPSRFCDKDLLRVVDREYAFAYVDDPCSATYPLMQKLRQVLVDHAL  443

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
            +NG+ EKNV+TSIFQKIAAFEDELKA+LPKEVE ARSA+E+GNPAIPNRI ECRSYPLYK
Sbjct  444  KNGDQEKNVNTSIFQKIAAFEDELKAVLPKEVESARSAVESGNPAIPNRIRECRSYPLYK  503

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+RE LGTE+L+GEK QSPGEV D+VFTA+  G I+DPLLECL+ WNGAPLPIC
Sbjct  504  FVREVLGTELLSGEKAQSPGEVFDQVFTAMSKGQIVDPLLECLQEWNGAPLPIC  557



>sp|P35513.2|PAL2_TOBAC RecName: Full=Phenylalanine ammonia-lyase [Nicotiana tabacum]
 dbj|BAA22947.1| phenylalanine ammonia-lyase [Nicotiana tabacum]
 dbj|BAA22963.1| phenylalanine ammonia-lyase [Nicotiana tabacum]
Length=712

 Score =   321 bits (823),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 149/174 (86%), Positives = 161/174 (93%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLTMG NGELHPSRFCEKDLLRVVDREYVFAYADD CSANYPLMQKLRQVLVDHAL
Sbjct  539  VAKRTLTMGTNGELHPSRFCEKDLLRVVDREYVFAYADDACSANYPLMQKLRQVLVDHAL  598

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
            QNGE+EKN ++SIFQKI AFEDELKA+LPKEVE AR+ALE+GNPAI NRI ECRSYPLY+
Sbjct  599  QNGENEKNANSSIFQKILAFEDELKAVLPKEVESARAALESGNPAIANRIKECRSYPLYR  658

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+R ELG E+LTGEKV+SPGE CDKVFTA+C+G IID LLECLK WNGAPLPIC
Sbjct  659  FVRGELGAELLTGEKVRSPGEECDKVFTAMCNGQIIDSLLECLKEWNGAPLPIC  712



>ref|XP_004249558.1| PREDICTED: phenylalanine ammonia-lyase [Solanum lycopersicum]
Length=711

 Score =   321 bits (822),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 146/174 (84%), Positives = 163/174 (94%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLTMG NGELHPSRFCEKDLLR+VDREY+FAYADDPCSANYPLMQKLRQVLV+HAL
Sbjct  538  VAKRTLTMGANGELHPSRFCEKDLLRIVDREYLFAYADDPCSANYPLMQKLRQVLVEHAL  597

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
            QNGE+EKN S+SIFQKI AFE+ELK++LP+EVE AR ALE+GNPAI NRI ECRSYPLYK
Sbjct  598  QNGENEKNASSSIFQKIVAFEEELKSVLPREVESARVALESGNPAIANRINECRSYPLYK  657

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGTE+LTGE+V+SPGE CDKVFTA+C+G IID LLECLK WNGAPLP+C
Sbjct  658  FVREELGTELLTGERVRSPGEECDKVFTAMCNGQIIDSLLECLKEWNGAPLPVC  711



>gb|AGT63063.1| phenylalanine ammonia-lyase [Solanum tuberosum]
Length=722

 Score =   321 bits (823),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 145/174 (83%), Positives = 163/174 (94%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLTMG NGELHP+RFCEK+LLRVVDREYVFAYADDPCS+ YPLMQKLRQVLVDHA+
Sbjct  549  VAKRTLTMGANGELHPARFCEKELLRVVDREYVFAYADDPCSSTYPLMQKLRQVLVDHAM  608

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE EKNV++SIFQKI AFEDELKA+LPKEVE AR+ LE+GNP+IPNRITECRSYPLYK
Sbjct  609  NNGESEKNVNSSIFQKIVAFEDELKAMLPKEVESARAVLESGNPSIPNRITECRSYPLYK  668

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
             +R+ELG+E+LTGEKV+SPGE  DKVFTA+C+G IIDPLLECL+SWNGAPLPIC
Sbjct  669  LVRQELGSELLTGEKVRSPGEEIDKVFTAMCNGQIIDPLLECLQSWNGAPLPIC  722



>ref|XP_004246649.1| PREDICTED: phenylalanine ammonia-lyase-like isoform X1 [Solanum 
lycopersicum]
Length=721

 Score =   320 bits (821),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 145/174 (83%), Positives = 163/174 (94%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLTMG NGELHP+RFCEK+LLRVVDREYVFAYADDPCS+ YPLMQKLRQVLVDHA+
Sbjct  548  VAKRTLTMGANGELHPARFCEKELLRVVDREYVFAYADDPCSSTYPLMQKLRQVLVDHAM  607

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
            +NGE EKNV++SIFQKI AFEDELKA LPKEVE AR+ +E+GNPAIPNRITECRSYPLY+
Sbjct  608  KNGESEKNVNSSIFQKIVAFEDELKAALPKEVESARAVVESGNPAIPNRITECRSYPLYR  667

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
             +R+ELG+E+LTGEKV+SPGE  DKVFTA+C+G IIDPLLECLKSWNGAPLPIC
Sbjct  668  LVRQELGSELLTGEKVRSPGEEIDKVFTAMCNGQIIDPLLECLKSWNGAPLPIC  721



>gb|ACF94717.1| phenylalanine ammonia lyase [Robinia pseudoacacia]
Length=311

 Score =   307 bits (787),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 144/174 (83%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLT GVNGELHPSRFCEKDLL+VVDRE+VFAY DDPCSA YPLMQKLRQVLVDHAL
Sbjct  138  VAKRTLTTGVNGELHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLMQKLRQVLVDHAL  197

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE+EKN++TSIFQKIA FE+ELKALLPKEVE AR+A E+GN AIPN+I ECRSYPLYK
Sbjct  198  VNGENEKNLNTSIFQKIATFEEELKALLPKEVESARAAYESGNAAIPNKINECRSYPLYK  257

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGT +LTGEKV+SPGE  DK+FTA+C G IIDPLLECL  WNGAPLPIC
Sbjct  258  FVREELGTGLLTGEKVRSPGEEFDKLFTAMCQGKIIDPLLECLGEWNGAPLPIC  311



>gb|ACR56688.1| phenylalanine ammonia-lyase [Scutellaria viscidula]
Length=711

 Score =   319 bits (818),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 150/174 (86%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            +AKRTLTMG NGELHPSRFCEKDLLRVVDREYVFAY DDPCSANYPLMQKLRQVLVDHAL
Sbjct  538  LAKRTLTMGANGELHPSRFCEKDLLRVVDREYVFAYIDDPCSANYPLMQKLRQVLVDHAL  597

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
            +NGE+EKN STSIFQKI AFE+ELKALLPKEVE AR ALE GNPA+PNRITECRSYPLYK
Sbjct  598  KNGENEKNASTSIFQKIEAFEEELKALLPKEVESARMALEAGNPAVPNRITECRSYPLYK  657

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            FIREE GTE LTGEKV SPGE CDKVFTA+ +G IID LL CL++WNGAPLPIC
Sbjct  658  FIREEAGTEFLTGEKVTSPGEECDKVFTALTNGFIIDSLLTCLEAWNGAPLPIC  711



>gb|ACF17667.1| putative phenylalanine ammonia-lyase [Capsicum annuum]
Length=717

 Score =   319 bits (818),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 146/174 (84%), Positives = 163/174 (94%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLTMG NGELHP+RFCEK+LLRVVDREY+FAYADDPCS+ YPLMQKLRQVLVDHAL
Sbjct  544  VAKRTLTMGANGELHPARFCEKELLRVVDREYLFAYADDPCSSTYPLMQKLRQVLVDHAL  603

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE EKNV++SIFQKIAAFEDELKA+LPKEVE AR  LE+GNP+IPNRITECRSYPLY+
Sbjct  604  NNGESEKNVNSSIFQKIAAFEDELKAVLPKEVESARITLESGNPSIPNRITECRSYPLYR  663

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
             +R+ELGTE+LTGE+V+SPGE  DKVFTA+C+G IIDPLLECLKSWNGAPLPIC
Sbjct  664  LVRKELGTELLTGERVRSPGEEIDKVFTAMCNGQIIDPLLECLKSWNGAPLPIC  717



>ref|XP_009781653.1| PREDICTED: phenylalanine ammonia-lyase [Nicotiana sylvestris]
Length=712

 Score =   319 bits (817),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 148/174 (85%), Positives = 160/174 (92%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLTMG NGELHPSRFCEKDLLRVVDREYVFAYADD CSANYPLMQKLRQVLVDHAL
Sbjct  539  VAKRTLTMGANGELHPSRFCEKDLLRVVDREYVFAYADDACSANYPLMQKLRQVLVDHAL  598

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
            +NGE+EKN ++SIFQKI AFE ELKA+LPKEVE AR +LENGNPAI NRI ECRSYPLY+
Sbjct  599  ENGENEKNANSSIFQKILAFEGELKAVLPKEVESARISLENGNPAIANRIKECRSYPLYR  658

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELG E+LTGEKV+SPGE CDKVFTA+C+G IID LLECLK WNGAPLPIC
Sbjct  659  FVREELGAELLTGEKVRSPGEECDKVFTAMCNGQIIDSLLECLKEWNGAPLPIC  712



>gb|AFC37247.1| phenylalanine ammonia-lyase [Camellia chekiangoleosa]
Length=308

 Score =   306 bits (784),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 144/174 (83%), Positives = 157/174 (90%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLTMGVNGELHPSRFCEK+LLRVVDRE+VF Y DDPCSA YPLMQKLRQVLV+HAL
Sbjct  135  VAKRTLTMGVNGELHPSRFCEKELLRVVDREHVFEYIDDPCSATYPLMQKLRQVLVEHAL  194

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
            +NG+ EKNVSTSIFQKI AFE+EL ALLPKEVE AR A+E+GNP IPNRI ECRSYPLYK
Sbjct  195  KNGDAEKNVSTSIFQKIRAFEEELMALLPKEVESARRAVESGNPGIPNRIKECRSYPLYK  254

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGT  LTGEK  SPGE  DKVFTA+C+G +IDPLL+CLKSWNGAPLPIC
Sbjct  255  FVREELGTGFLTGEKALSPGEEFDKVFTAMCEGQVIDPLLDCLKSWNGAPLPIC  308



>gb|AEO92028.1| phenylalanine ammonia-lyase 2 [Coffea canephora]
 gb|AEO94540.1| phenylalanine ammonia-lyase 2 [Coffea canephora]
Length=711

 Score =   318 bits (816),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 147/174 (84%), Positives = 160/174 (92%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLTMG NGELHPSRFCEKDLLRVVDREY FAY DDPCSA YPLMQKLRQVLVDHAL
Sbjct  538  VAKRTLTMGANGELHPSRFCEKDLLRVVDREYAFAYVDDPCSATYPLMQKLRQVLVDHAL  597

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
            +NG+ EKNV+TSIFQKIAAFEDELKA+LPKEVE ARSA+E+GNPAIPNRI ECRSYPLYK
Sbjct  598  KNGDQEKNVNTSIFQKIAAFEDELKAVLPKEVESARSAVESGNPAIPNRIRECRSYPLYK  657

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+RE LGTE+L+GEK QSPGEV D+VFTA+  G I+DPLLECL+ WNGAPLPIC
Sbjct  658  FVREVLGTELLSGEKAQSPGEVFDQVFTAMSKGQIVDPLLECLQEWNGAPLPIC  711



>gb|AEY94464.1| phenylalanine ammonia-lyase, partial [Prunella vulgaris]
Length=349

 Score =   307 bits (787),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 145/174 (83%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLTMG NGELHPSRFCEK+L+RVVDREYVFAYADDPCSA YPLMQKLRQVLVDHAL
Sbjct  176  VAKRTLTMGANGELHPSRFCEKELIRVVDREYVFAYADDPCSATYPLMQKLRQVLVDHAL  235

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
            +NG+ EKNVSTSIF KI AFE+ELKALLPKEVE AR ALE+G PA+ NRI ECRSYPLYK
Sbjct  236  KNGDGEKNVSTSIFHKIEAFEEELKALLPKEVESARIALESGAPAVANRIAECRSYPLYK  295

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            FIRE LGT  LTGEK  SPGE CDKVFTA+CDG I+DPLLECL+ WNG PLPIC
Sbjct  296  FIREGLGTGFLTGEKAVSPGEECDKVFTALCDGLIVDPLLECLQGWNGEPLPIC  349



>dbj|BAF36975.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=311

 Score =   306 bits (784),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 141/174 (81%), Positives = 156/174 (90%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLT GVNGELHPSRFCEKDLL+VVDRE +FAY DDPC A YPLMQKLRQVLVDHAL
Sbjct  138  VAKRTLTTGVNGELHPSRFCEKDLLKVVDRETLFAYIDDPCLATYPLMQKLRQVLVDHAL  197

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE+EK+  TSIFQKIA FEDELK+LLPKEVE AR+A E+GNPA+PN+I ECRSYPLYK
Sbjct  198  VNGEYEKDSKTSIFQKIATFEDELKSLLPKEVESARAAYESGNPAMPNKINECRSYPLYK  257

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+R+ELGTE+LTGEK +SPGE CDK+FTA+C G IIDPLLECL  WNGAPLPIC
Sbjct  258  FVRKELGTELLTGEKTRSPGEECDKLFTAICQGKIIDPLLECLGEWNGAPLPIC  311



>gb|AEL21617.1| phenylalanine ammonia lyase 2 [Coffea arabica]
Length=711

 Score =   318 bits (814),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 147/174 (84%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLTMG NGELHPSRFCEKDLLRVVDREY FAY DDPCSA YPLMQKLRQVLVDHAL
Sbjct  538  VAKRTLTMGANGELHPSRFCEKDLLRVVDREYAFAYVDDPCSATYPLMQKLRQVLVDHAL  597

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
            +NG+ EKNV+TSIFQKIAAFEDELKA+LPKEVE ARSA+E+GNPAIPNRI ECRSYPLYK
Sbjct  598  KNGDQEKNVNTSIFQKIAAFEDELKAVLPKEVESARSAVESGNPAIPNRIRECRSYPLYK  657

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+RE LGT +LTGEK QSPGEV D+VFTA+  G I+DPLLECL+ WNGAPLPIC
Sbjct  658  FVREVLGTGLLTGEKAQSPGEVFDQVFTAMSKGQIVDPLLECLQEWNGAPLPIC  711



>emb|CDP20698.1| unnamed protein product [Coffea canephora]
Length=674

 Score =   317 bits (811),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 147/174 (84%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLTMG NGELHPSRFCEKDLLRVVDREY FAY DDPCSA YPLMQKLRQVLVDHAL
Sbjct  501  VAKRTLTMGANGELHPSRFCEKDLLRVVDREYAFAYVDDPCSATYPLMQKLRQVLVDHAL  560

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
            +NG+ EKNV+TSIFQKIAAFEDELKA+LPKEVE ARSA+ENGNPAIPNRI +CRSYPLYK
Sbjct  561  KNGDQEKNVNTSIFQKIAAFEDELKAVLPKEVESARSAVENGNPAIPNRIRKCRSYPLYK  620

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+RE LGT +LTGEK QSPGEV D+VFTA+  G I+DPLLECL+ WNGAPLPIC
Sbjct  621  FVREVLGTGLLTGEKAQSPGEVFDQVFTAMNKGQIVDPLLECLQEWNGAPLPIC  674



>ref|XP_011094662.1| PREDICTED: phenylalanine ammonia-lyase [Sesamum indicum]
Length=711

 Score =   317 bits (812),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 150/174 (86%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAY DDPCSA YPLMQKLRQVLVDHAL
Sbjct  538  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYIDDPCSATYPLMQKLRQVLVDHAL  597

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
            +NG+ EK++STSIFQKI AFEDELKALLPKEVE AR ALE+GNPAI NRITECRSYPLYK
Sbjct  598  KNGDGEKSLSTSIFQKIEAFEDELKALLPKEVESARIALESGNPAIANRITECRSYPLYK  657

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            FIREELGT  LTGEKV SPGE CDKVFTA+  G I+DPLL+CL  WNGAPLPIC
Sbjct  658  FIREELGTNFLTGEKVTSPGEECDKVFTALSKGLIVDPLLKCLDGWNGAPLPIC  711



>sp|P45733.1|PAL3_TOBAC RecName: Full=Phenylalanine ammonia-lyase [Nicotiana tabacum]
 emb|CAA55075.1| phenylalanine ammonia-lyase [Nicotiana tabacum]
Length=712

 Score =   317 bits (811),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 147/174 (84%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLTMG NGELHPSRFCEKDLLRVVDREYVF YADD CSANYPLMQKLRQVLVDHAL
Sbjct  539  VAKRTLTMGANGELHPSRFCEKDLLRVVDREYVFRYADDACSANYPLMQKLRQVLVDHAL  598

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
            +NGE+EKN ++SIFQKI AFE ELKA+LPKEVE AR +LENGNPAI NRI ECRSYPLY+
Sbjct  599  ENGENEKNANSSIFQKILAFEGELKAVLPKEVESARISLENGNPAIANRIKECRSYPLYR  658

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELG E+LTGEKV+SPGE CDKVFTA+C+G IID LLECLK WNGAPLPIC
Sbjct  659  FVREELGAELLTGEKVRSPGEECDKVFTAMCNGQIIDSLLECLKEWNGAPLPIC  712



>gb|AIA66448.1| PAL1 [Capsicum annuum]
Length=717

 Score =   317 bits (811),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 145/174 (83%), Positives = 162/174 (93%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLTMG NGELHP+RFCEK+LLRVVDREY+FAYADD CS+ YPLMQKLRQVLVDHAL
Sbjct  544  VAKRTLTMGANGELHPARFCEKELLRVVDREYLFAYADDTCSSTYPLMQKLRQVLVDHAL  603

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE EKNV++SIFQKIAAFEDELKA+LPKEVE AR  LE+GNP+IPNRITECRSYPLY+
Sbjct  604  NNGESEKNVNSSIFQKIAAFEDELKAVLPKEVESARITLESGNPSIPNRITECRSYPLYR  663

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
             +R+ELGTE+LTGE+V+SPGE  DKVFTA+C+G IIDPLLECLKSWNGAPLPIC
Sbjct  664  LVRKELGTELLTGERVRSPGEEIDKVFTAMCNGQIIDPLLECLKSWNGAPLPIC  717



>dbj|BAG31930.1| phenylalanine ammonia-lyase [Daucus carota]
Length=715

 Score =   317 bits (811),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 147/174 (84%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKR LTMGVNGELHPSRFCEKDLLRVVDREY+FAY DDPCSA YPLMQKLR+ LV+HAL
Sbjct  542  VAKRVLTMGVNGELHPSRFCEKDLLRVVDREYIFAYIDDPCSATYPLMQKLRETLVEHAL  601

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NG+ E+N+STSIFQKIAAFEDELKALLPKEVE AR+A+E+GNPAIPNRI ECRSYPLYK
Sbjct  602  NNGDKERNLSTSIFQKIAAFEDELKALLPKEVESARAAVESGNPAIPNRIKECRSYPLYK  661

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGTE LTGEKV SPGE  DKVFTA+  G IIDPLLECL+SWNGAPLPIC
Sbjct  662  FVREELGTEYLTGEKVTSPGEEFDKVFTAMTKGEIIDPLLECLQSWNGAPLPIC  715



>dbj|BAC56977.1| phenylalanine ammonia-lyase [Daucus carota]
Length=715

 Score =   316 bits (810),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 147/174 (84%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKR LTMGVNGELHPSRFCEKDLLRVVDREY+FAY DDPCSA YPLMQKLR+ LV+HAL
Sbjct  542  VAKRVLTMGVNGELHPSRFCEKDLLRVVDREYIFAYIDDPCSATYPLMQKLRETLVEHAL  601

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NG+ E+N+STSIFQKIAAFEDELKALLPKEVE AR+A+E+GNPAIPNRI ECRSYPLYK
Sbjct  602  NNGDKERNLSTSIFQKIAAFEDELKALLPKEVESARAAVESGNPAIPNRIKECRSYPLYK  661

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGTE LTGEKV SPGE  DKVFTA+  G IIDPLLECL+SWNGAPLPIC
Sbjct  662  FVREELGTEYLTGEKVTSPGEEFDKVFTAMTKGEIIDPLLECLQSWNGAPLPIC  715



>ref|XP_006367534.1| PREDICTED: phenylalanine ammonia-lyase 1-like, partial [Solanum 
tuberosum]
Length=441

 Score =   308 bits (789),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 139/174 (80%), Positives = 161/174 (93%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLT+G  GELHP+RFCEK+LLRVVDREY+F YADDPCS+ YPLMQKLRQVLVDHA+
Sbjct  268  VAKRTLTIGAIGELHPARFCEKELLRVVDREYLFTYADDPCSSTYPLMQKLRQVLVDHAM  327

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
            +NGE EKN+++SIFQKI AFEDEL A+LPKEVE AR+ LE+GNP+IPNRITECRSYPLY+
Sbjct  328  KNGESEKNINSSIFQKIGAFEDELNAVLPKEVESARALLESGNPSIPNRITECRSYPLYR  387

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
             +R+ELGTE+LTGEKV+SPGE  +KVFTA+C+G IIDPLLECLKSWNGAPLPIC
Sbjct  388  LVRQELGTELLTGEKVRSPGEEIEKVFTAMCNGQIIDPLLECLKSWNGAPLPIC  441



>dbj|BAA95629.1| phenylalanine ammonia lyase [Catharanthus roseus]
Length=716

 Score =   315 bits (808),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 146/174 (84%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLT+GVNGELHPSRFCEKDL+RVVDREYVFAY DDPCS  YPLM+KLRQV+VDHAL
Sbjct  543  VAKRTLTVGVNGELHPSRFCEKDLIRVVDREYVFAYVDDPCSGTYPLMEKLRQVIVDHAL  602

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
            QNGE EKNV+TSIFQKIAAFEDELK +LPKEVE AR+ALENGNPAIPNRI ECRSYPLYK
Sbjct  603  QNGESEKNVNTSIFQKIAAFEDELKTVLPKEVESARTALENGNPAIPNRIKECRSYPLYK  662

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+RE++G E LTGEK +SPGE  DKVFTA+C+  IIDPLLECLK WNGAPLPIC
Sbjct  663  FVREDVGAEFLTGEKDRSPGEEFDKVFTAMCNEKIIDPLLECLKEWNGAPLPIC  716



>ref|XP_003635685.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=308

 Score =   303 bits (776),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 140/174 (80%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAK+TLT G NGELHPSRFCEKDLL+VVDRE+VFAY DDPCSA YPLMQK+RQVLV+HAL
Sbjct  135  VAKKTLTTGANGELHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLMQKVRQVLVEHAL  194

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE+EKN STSIFQKI AFE+ELKA+LPKEVE AR  +E+GNP+IPNRI ECRSYPLYK
Sbjct  195  NNGENEKNGSTSIFQKIVAFEEELKAVLPKEVESARGGVESGNPSIPNRIKECRSYPLYK  254

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGT +LTGEKV+SPGE  DKVFTA+C+G IIDPLL+CL +WNGAPLPIC
Sbjct  255  FVREELGTGLLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNGAPLPIC  308



>emb|CAA34715.1| unnamed protein product [Petroselinum crispum]
Length=580

 Score =   311 bits (798),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 145/174 (83%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKR LTMGVNGELHPSRFCEKDLLRVVDREY+FAY DDPCSA YPLMQKLRQ LV+HAL
Sbjct  407  VAKRVLTMGVNGELHPSRFCEKDLLRVVDREYIFAYIDDPCSATYPLMQKLRQTLVEHAL  466

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
            +NG++E+N+STSIFQKIA FEDELKALLPKEVE AR+ALE+GNPAIPNRI ECRSYPLYK
Sbjct  467  KNGDNERNLSTSIFQKIATFEDELKALLPKEVESARAALESGNPAIPNRIEECRSYPLYK  526

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+R+ELGTE LTGEKV SPGE  +KVF A+  G IIDPLLECL+SWNGAPLPIC
Sbjct  527  FVRKELGTEYLTGEKVTSPGEEFEKVFIAMSKGEIIDPLLECLESWNGAPLPIC  580



>sp|P45729.1|PAL3_PETCR RecName: Full=Phenylalanine ammonia-lyase 3 [Petroselinum crispum]
 emb|CAA57057.1| phenylalanine ammonia-lyase 3 [Petroselinum crispum]
Length=718

 Score =   315 bits (808),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 147/174 (84%), Positives = 160/174 (92%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKR LTMGVNGELHPSRFCEKDLLRVVDREY+FAY DDPCSA YPLMQKLR+ LV+HAL
Sbjct  545  VAKRVLTMGVNGELHPSRFCEKDLLRVVDREYIFAYIDDPCSATYPLMQKLRETLVEHAL  604

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NG+ E+N+STSIFQKIAAFEDELKALLPKEVE AR+ALE+GNPAIPNRI ECRSYPLYK
Sbjct  605  NNGDKERNLSTSIFQKIAAFEDELKALLPKEVETARAALESGNPAIPNRIKECRSYPLYK  664

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGTE LTGEKV+SPGE  +KVFTA+  G IIDPLLECL+SWNGAPLPIC
Sbjct  665  FVREELGTEYLTGEKVRSPGEEFEKVFTAMSKGEIIDPLLECLESWNGAPLPIC  718



>ref|XP_006364021.1| PREDICTED: phenylalanine ammonia-lyase-like [Solanum tuberosum]
Length=723

 Score =   315 bits (806),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 142/174 (82%), Positives = 162/174 (93%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLTMG NGELHP+RFCEK+LLRVVDREY+FAYADDPCS+NYPLMQKLRQVLVD A+
Sbjct  550  VAKRTLTMGANGELHPARFCEKELLRVVDREYLFAYADDPCSSNYPLMQKLRQVLVDQAM  609

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
            +NGE EKNV++SIFQKI AFEDEL A+LPKEVE  R+ +E+GNP+IPNRITECRSYPLY+
Sbjct  610  KNGESEKNVNSSIFQKIGAFEDELIAVLPKEVESVRAVVESGNPSIPNRITECRSYPLYR  669

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
             +R+ELGTE+LTGEKV+SPGE  DKVFTA+C+G IIDPLLECLKSWNGAPLPIC
Sbjct  670  LVRQELGTELLTGEKVRSPGEEIDKVFTAMCNGQIIDPLLECLKSWNGAPLPIC  723



>sp|P45726.1|PALY_CAMSI RecName: Full=Phenylalanine ammonia-lyase [Camellia sinensis]
 dbj|BAA05643.1| phenylalanine ammonia-lyase [Camellia sinensis]
Length=714

 Score =   314 bits (805),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 144/174 (83%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKR LTMGVNGELHPSRFCEKDLLRVVDREY+FAY DDPCSA YPLMQKLRQVLV+HAL
Sbjct  541  VAKRVLTMGVNGELHPSRFCEKDLLRVVDREYIFAYIDDPCSATYPLMQKLRQVLVEHAL  600

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
            +NGE EKN+STSIFQKI AFE+E+K LLPKEVE  R+A+ENGN AIPNRI ECRSYPLYK
Sbjct  601  KNGESEKNLSTSIFQKIRAFEEEIKTLLPKEVESTRAAIENGNSAIPNRIKECRSYPLYK  660

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGTE+LTGEKV+SPGE  DKVFTA+C G +IDPL++CLK WNGAPLPIC
Sbjct  661  FVREELGTELLTGEKVRSPGEEFDKVFTALCKGEMIDPLMDCLKEWNGAPLPIC  714



>emb|CBJ23826.1| phenylalanine ammonia-lyase [Melissa officinalis]
Length=709

 Score =   314 bits (804),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 147/174 (84%), Positives = 157/174 (90%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLTMG NGELHPSRFCEKDL+RVVDREYVFAY DDPCSA YPLMQKLRQVLV+HAL
Sbjct  536  VAKRTLTMGANGELHPSRFCEKDLIRVVDREYVFAYIDDPCSATYPLMQKLRQVLVEHAL  595

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
            +NGE EKN STSIFQKI AFE+ELK LLPKEVE AR+ALE+GNPAI NRI ECRSYPLYK
Sbjct  596  KNGEGEKNASTSIFQKIEAFEEELKTLLPKEVESARTALESGNPAIANRIAECRSYPLYK  655

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            FIREELG + LTGEKV SPGE CDKVFTA+ +G IIDPLLECL+ WNGAPLPIC
Sbjct  656  FIREELGADFLTGEKVVSPGEECDKVFTALSNGLIIDPLLECLQGWNGAPLPIC  709



>ref|XP_003625662.1| Phenylalanine ammonia-lyase [Medicago truncatula]
Length=456

 Score =   306 bits (785),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 142/174 (82%), Positives = 156/174 (90%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAK+TLTMGVNGELHPSRFCEKDLL+VVDRE+VFAY DDPCSA YPL QKLRQVLVDHAL
Sbjct  283  VAKKTLTMGVNGELHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLSQKLRQVLVDHAL  342

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE EKN++TSIFQKIA FE+ELK+LLPKEVE AR+A E+GNP IPN+I  CRSYPLYK
Sbjct  343  VNGESEKNLNTSIFQKIATFEEELKSLLPKEVESARTAYESGNPTIPNKINGCRSYPLYK  402

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGT +LTGE V SPGEVCDK+FTA+C G IIDPLLECL  WNGAPLPIC
Sbjct  403  FVREELGTGLLTGENVISPGEVCDKLFTAMCQGKIIDPLLECLGEWNGAPLPIC  456



>dbj|BAF36972.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=688

 Score =   313 bits (802),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 145/174 (83%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLT GVNGELHPSRFCEKDLL+VVDRE VFAY DDPCSA YPLMQKLRQVLVDHAL
Sbjct  515  VAKRTLTTGVNGELHPSRFCEKDLLKVVDRETVFAYIDDPCSATYPLMQKLRQVLVDHAL  574

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             N E+EKN++TSIFQKIA FEDELK+LLPKEVE AR+A E+GNPAIPN+I ECRSYPLYK
Sbjct  575  VNEENEKNMNTSIFQKIATFEDELKSLLPKEVESARAAYESGNPAIPNKINECRSYPLYK  634

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+RE LGTE+LTGEKV+SPGE CDK+FTA+C+G IIDPLLECL  WNGAPLPIC
Sbjct  635  FVREGLGTELLTGEKVRSPGEECDKLFTAICEGKIIDPLLECLGEWNGAPLPIC  688



>gb|AGF50184.1| phenylalanine ammonia lyase, partial [Salvia virgata]
Length=282

 Score =   300 bits (769),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 140/174 (80%), Positives = 153/174 (88%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKR LTMG NGELHPSRFCEKDL+RVVDREYVF+Y DDPC A YPLMQKLRQVLV+HAL
Sbjct  109  VAKRALTMGANGELHPSRFCEKDLIRVVDREYVFSYVDDPCLATYPLMQKLRQVLVEHAL  168

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
            +NGE EKN STSIFQKI  FE+ELKALLPKEVE AR ALE+G+PA+PNRI ECRSYPLYK
Sbjct  169  KNGEGEKNASTSIFQKIEQFEEELKALLPKEVEAARLALESGSPAVPNRIAECRSYPLYK  228

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELG   LTGEK  SPGE CDKVFTA+C+G I+DPLL+CLK WNG PLPIC
Sbjct  229  FVREELGAGFLTGEKAVSPGEECDKVFTALCNGLIVDPLLDCLKGWNGQPLPIC  282



>ref|XP_006354336.1| PREDICTED: phenylalanine ammonia-lyase-like isoform X1 [Solanum 
tuberosum]
Length=719

 Score =   314 bits (804),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 141/174 (81%), Positives = 161/174 (93%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLTMG NGELHP+RFC+K+LL+VVD+EY+FAY DDPC++NYPLMQKLRQVLVDHA+
Sbjct  546  VAKRTLTMGANGELHPARFCKKELLQVVDKEYLFAYVDDPCNSNYPLMQKLRQVLVDHAM  605

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE EKNV++SIFQKI AFEDELK +LPKEVE AR  +E+GNPAIPNRITECRSYPLY+
Sbjct  606  NNGESEKNVNSSIFQKIVAFEDELKVVLPKEVESARVVVESGNPAIPNRITECRSYPLYR  665

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
             +REELGTE+LTGEKV+SPGE  DKVFTA+C+G IIDPLLECLKSWNGAPLPIC
Sbjct  666  LVREELGTEVLTGEKVRSPGEEIDKVFTAMCNGQIIDPLLECLKSWNGAPLPIC  719



>ref|XP_006354338.1| PREDICTED: phenylalanine ammonia-lyase-like isoform X3 [Solanum 
tuberosum]
Length=723

 Score =   314 bits (804),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 141/174 (81%), Positives = 161/174 (93%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLTMG NGELHP+RFC+K+LL+VVD+EY+FAY DDPC++NYPLMQKLRQVLVDHA+
Sbjct  550  VAKRTLTMGANGELHPARFCKKELLQVVDKEYLFAYVDDPCNSNYPLMQKLRQVLVDHAM  609

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE EKNV++SIFQKI AFEDELK +LPKEVE AR  +E+GNPAIPNRITECRSYPLY+
Sbjct  610  NNGESEKNVNSSIFQKIVAFEDELKVVLPKEVESARVVVESGNPAIPNRITECRSYPLYR  669

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
             +REELGTE+LTGEKV+SPGE  DKVFTA+C+G IIDPLLECLKSWNGAPLPIC
Sbjct  670  LVREELGTEVLTGEKVRSPGEEIDKVFTAMCNGQIIDPLLECLKSWNGAPLPIC  723



>gb|AAU08174.1| phenylalanine ammonia-lyase [Camellia sinensis]
Length=714

 Score =   313 bits (803),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 144/174 (83%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKR LTMGVNGELHPSRFCEKDLLRVVDREY+FAY DDPCSA YPLMQKLRQVLV+HAL
Sbjct  541  VAKRVLTMGVNGELHPSRFCEKDLLRVVDREYIFAYIDDPCSATYPLMQKLRQVLVEHAL  600

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
            +NGE EKN+STSIFQKI AFE+E+K LLPKEVE  R+A+ENGN AIPNRI ECRSYPLYK
Sbjct  601  KNGESEKNLSTSIFQKIRAFEEEIKTLLPKEVESTRAAIENGNSAIPNRIKECRSYPLYK  660

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGTE+LTGEKV+SPGE  DKVFTA+C G +IDPL++CLK WNGAPLPIC
Sbjct  661  FVREELGTELLTGEKVRSPGEEFDKVFTALCKGEMIDPLMDCLKEWNGAPLPIC  714



>ref|XP_008387584.1| PREDICTED: phenylalanine ammonia-lyase 1 [Malus domestica]
Length=720

 Score =   313 bits (803),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 145/174 (83%), Positives = 156/174 (90%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLT GVNGELHPSRFCEKDLL+VVDREYVFAY DDPCSA YPLMQKLRQVLV+HAL
Sbjct  547  VAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLRQVLVEHAL  606

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE EKN STSIFQKI AFE+ELKALLPKEVE ARSA+E+GN A+PNRI ECRSYPLYK
Sbjct  607  TNGESEKNASTSIFQKIGAFEEELKALLPKEVESARSAIESGNAAVPNRIAECRSYPLYK  666

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELG E LTGEKV+SPGE CDKVF A+C G IIDP+L CL+ WNGAPLPIC
Sbjct  667  FVREELGGEYLTGEKVRSPGEECDKVFQAICQGKIIDPILGCLEGWNGAPLPIC  720



>gb|AGF50183.1| phenylalanine ammonia lyase, partial [Salvia hypoleuca]
Length=282

 Score =   300 bits (768),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 139/174 (80%), Positives = 153/174 (88%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLTMG NGELHPSRFCEKDL+RVVDREYVF+Y DDPC A YPLMQKLRQVLV+HAL
Sbjct  109  VAKRTLTMGANGELHPSRFCEKDLIRVVDREYVFSYVDDPCLATYPLMQKLRQVLVEHAL  168

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
            +NGE EKN STSIF KI  FE+ELKALLPKEVE AR ALE+G+PA+PNRI ECRSYPLYK
Sbjct  169  KNGEGEKNASTSIFHKIEQFEEELKALLPKEVEAARMALESGSPAVPNRIAECRSYPLYK  228

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+RE+LG   LTGEK  SPGE CDKVFTA+C+G I+DPLL+CLK WNG PLPIC
Sbjct  229  FVREQLGAGFLTGEKAVSPGEECDKVFTALCNGLIVDPLLDCLKGWNGQPLPIC  282



>gb|AFG30054.1| phenylalanine ammonialyase [Malus hybrid cultivar]
Length=720

 Score =   313 bits (801),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 145/174 (83%), Positives = 156/174 (90%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLT GVNGELHPSRFCEKDLL+VVDREYVFAY DDPCSA YPLMQKLRQVLV+HAL
Sbjct  547  VAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLRQVLVEHAL  606

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE EKN STSIFQKI AFE+ELKALLPKEVE ARSA+E+GN A+PNRI ECRSYPLYK
Sbjct  607  TNGESEKNASTSIFQKIGAFEEELKALLPKEVESARSAIESGNAAVPNRIAECRSYPLYK  666

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELG E LTGEKV+SPGE CDKVF A+C G IIDP+L CL+ WNGAPLPIC
Sbjct  667  FVREELGGEYLTGEKVRSPGEECDKVFQAICQGKIIDPILGCLEGWNGAPLPIC  720



>gb|ACF94716.1| phenylalanine ammonia lyase [Robinia pseudoacacia]
Length=719

 Score =   313 bits (801),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 146/174 (84%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLT GVNGELHPSRFCEKDLL+VVDREYVFAY DDPCSA YPLMQKLRQVLVDHAL
Sbjct  546  VAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLRQVLVDHAL  605

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE+EKN++TSIFQKIA FEDELKALLPKEVE AR+A E+GNPAIPN+I ECRSYPLYK
Sbjct  606  VNGEYEKNLNTSIFQKIATFEDELKALLPKEVESARAAYESGNPAIPNKIKECRSYPLYK  665

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGT +LTGEKV+SPG   DK+FTA+C G IIDPLLECL  WNGAPLPIC
Sbjct  666  FVREELGTGLLTGEKVRSPGGEFDKLFTAMCRGKIIDPLLECLGEWNGAPLPIC  719



>gb|ADN32767.1| phenylalanine ammonia-lyase 1 [Scutellaria baicalensis]
Length=711

 Score =   312 bits (800),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 147/174 (84%), Positives = 157/174 (90%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            +AKRTLTMG NGELHPSRFCEKDLLRVVDREYVFAY DDPCSANYPLMQKLRQVLVDHAL
Sbjct  538  LAKRTLTMGANGELHPSRFCEKDLLRVVDREYVFAYIDDPCSANYPLMQKLRQVLVDHAL  597

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
            +NGE+EKN STSI Q+I AFE+ELKALLPKEVE AR ALE GNPA+PNRITECRSYPLYK
Sbjct  598  KNGENEKNASTSILQEIEAFEEELKALLPKEVESARMALEAGNPAVPNRITECRSYPLYK  657

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            FIR E GTE LTGEKV SPGE CDKVFTA+ +G IID LL CL++WNGAPLPIC
Sbjct  658  FIRGEAGTEFLTGEKVTSPGEECDKVFTALTNGFIIDQLLTCLEAWNGAPLPIC  711



>sp|P45735.1|PALY_VITVI RecName: Full=Phenylalanine ammonia-lyase, partial [Vitis vinifera]
 emb|CAA53581.1| phenylalanine ammonium lyase [Vitis vinifera]
Length=416

 Score =   304 bits (778),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 140/174 (80%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAK+TLT+G NGELHPSRFCEKDLL+VVDRE+VFAY DDPCSA YPLMQK+RQVLV+HAL
Sbjct  243  VAKKTLTIGANGELHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLMQKVRQVLVEHAL  302

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE EKN STSIFQKI AFE+ELKA+LPKEVE AR  +E+GNP+IPNRI ECRSYPLYK
Sbjct  303  NNGESEKNGSTSIFQKIGAFEEELKAVLPKEVESARDGVESGNPSIPNRIKECRSYPLYK  362

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGT +LTGEKV+SPGE  DKVFTA+C+G IIDPLL+CL +WNGAPLPIC
Sbjct  363  FVREELGTGLLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNGAPLPIC  416



>gb|AFP24940.1| phenylalanine ammonia lyase [Prunus salicina]
Length=717

 Score =   312 bits (800),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 142/174 (82%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLT GVNGELHPSRFCEKDLL+VVDREYVFAY DDPCSA YPLMQKLRQVLV+HAL
Sbjct  544  VAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLRQVLVEHAL  603

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE+EKN STSIFQKI AFE+ELK LLPKEV+ AR+AL++G+  +PNRITECRSYPLYK
Sbjct  604  TNGENEKNASTSIFQKIVAFEEELKVLLPKEVDSARAALDSGSAGVPNRITECRSYPLYK  663

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELG E LTGEKV+SPGE CDKVF+A+C+G IIDP+LECL+ WNGAPLPIC
Sbjct  664  FVREELGAEYLTGEKVRSPGEECDKVFSAICEGKIIDPILECLEGWNGAPLPIC  717



>sp|P24481.1|PAL1_PETCR RecName: Full=Phenylalanine ammonia-lyase 1 [Petroselinum crispum]
 emb|CAA68938.1| PAL1 protein [Petroselinum crispum]
Length=716

 Score =   312 bits (800),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 145/174 (83%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKR LTMGVNGELHPSRFCEKDLLRVVDREY+FAY DDPCSA YPLMQKLRQ LV+HAL
Sbjct  543  VAKRVLTMGVNGELHPSRFCEKDLLRVVDREYIFAYIDDPCSATYPLMQKLRQTLVEHAL  602

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
            +NG++E+N+STSIFQKIA FEDELKALLPKEVE AR+ALE+GNPAIPNRI ECRSYPLYK
Sbjct  603  KNGDNERNLSTSIFQKIATFEDELKALLPKEVESARAALESGNPAIPNRIEECRSYPLYK  662

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+R+ELGTE LTGEKV SPGE  +KVF A+  G IIDPLLECL+SWNGAPLPIC
Sbjct  663  FVRKELGTEYLTGEKVTSPGEEFEKVFIAMSKGEIIDPLLECLESWNGAPLPIC  716



>pdb|1W27|A Chain A, Phenylalanine Ammonia-Lyase (Pal) From Petroselinum 
Crispum
 pdb|1W27|B Chain B, Phenylalanine Ammonia-Lyase (Pal) From Petroselinum 
Crispum
Length=714

 Score =   312 bits (799),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 145/174 (83%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKR LTMGVNGELHPSRFCEKDLLRVVDREY+FAY DDPCSA YPLMQKLRQ LV+HAL
Sbjct  541  VAKRVLTMGVNGELHPSRFCEKDLLRVVDREYIFAYIDDPCSATYPLMQKLRQTLVEHAL  600

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
            +NG++E+N+STSIFQKIA FEDELKALLPKEVE AR+ALE+GNPAIPNRI ECRSYPLYK
Sbjct  601  KNGDNERNLSTSIFQKIATFEDELKALLPKEVESARAALESGNPAIPNRIEECRSYPLYK  660

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+R+ELGTE LTGEKV SPGE  +KVF A+  G IIDPLLECL+SWNGAPLPIC
Sbjct  661  FVRKELGTEYLTGEKVTSPGEEFEKVFIAMSKGEIIDPLLECLESWNGAPLPIC  714



>ref|XP_004493977.1| PREDICTED: phenylalanine ammonia-lyase-like [Cicer arietinum]
Length=723

 Score =   312 bits (800),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 144/174 (83%), Positives = 157/174 (90%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLT GVNGELHPSRFCEKDLL+VVDRE+VFAY DDPCSA YPLMQKLRQVLVDHAL
Sbjct  550  VAKRTLTTGVNGELHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLMQKLRQVLVDHAL  609

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE+EKN++TSIFQKIA FEDELK LLPKEVE AR+A E+GNPAIPN+I  CRSYPLYK
Sbjct  610  VNGENEKNLNTSIFQKIATFEDELKTLLPKEVESARAAYESGNPAIPNKINGCRSYPLYK  669

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGT +LTGEKV SPGE CDK+FTA+C G IIDPLLECL  WNGAPLP+C
Sbjct  670  FVREELGTSLLTGEKVISPGEECDKLFTAMCQGKIIDPLLECLGEWNGAPLPVC  723



>gb|ADI40166.1| phenylalanine ammonia-lyase [Morus alba]
Length=726

 Score =   312 bits (799),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 142/174 (82%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLT GVNGELHPSRFCEKDLL+VVDREYVFAY DDPCSA YPLMQKLRQVLV+HAL
Sbjct  553  VAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLRQVLVEHAL  612

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE+EKN STSIFQKI AFE+ELK LLPKEV+ AR+AL++G+  +PNRITECRSYPLYK
Sbjct  613  TNGENEKNASTSIFQKIVAFEEELKVLLPKEVDSARAALDSGSAGVPNRITECRSYPLYK  672

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELG E LTGEKV+SPGE CDKVFTA+C+G IIDP+L+CL+ WNGAPLPIC
Sbjct  673  FVREELGAEYLTGEKVRSPGEECDKVFTAICEGKIIDPILDCLEGWNGAPLPIC  726



>sp|O64963.1|PAL1_PRUAV RecName: Full=Phenylalanine ammonia-lyase 1 [Prunus avium]
 gb|AAC78457.1| phenylalanine ammonia-lyase [Prunus avium]
Length=717

 Score =   312 bits (799),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 142/174 (82%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLT GVNGELHPSRFCEKDLL+VVDREYVFAY DDPCSA YPLMQKLRQVLV+HAL
Sbjct  544  VAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLRQVLVEHAL  603

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE+EKN STSIFQKI AFE+ELK LLPKEV+ AR+AL++G+  +PNRITECRSYPLYK
Sbjct  604  TNGENEKNASTSIFQKIVAFEEELKVLLPKEVDSARAALDSGSAGVPNRITECRSYPLYK  663

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELG E LTGEKV+SPGE CDKVFTA+C+G IIDP+L+CL+ WNGAPLPIC
Sbjct  664  FVREELGAEYLTGEKVRSPGEECDKVFTAICEGKIIDPILDCLEGWNGAPLPIC  717



>gb|AEA72280.1| phenylalanine ammonia-lyase, partial [Angelica gigas]
Length=699

 Score =   311 bits (797),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 145/174 (83%), Positives = 157/174 (90%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKR LT GVNGELHPSRFCEKDLLRVVDREY+FAY DDPCSA YPLMQKLRQ LV+HAL
Sbjct  526  VAKRVLTTGVNGELHPSRFCEKDLLRVVDREYIFAYIDDPCSATYPLMQKLRQTLVEHAL  585

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NG++E+N+STSIFQKIA FEDELKALLPKEVE AR+ALE+GNPAIPNRI ECRSYPLYK
Sbjct  586  TNGDNERNLSTSIFQKIATFEDELKALLPKEVESARAALESGNPAIPNRIEECRSYPLYK  645

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGTE LTGEK +SPGE  DKVFTA+  G IIDPLL CL+SWNGAPLPIC
Sbjct  646  FVREELGTEYLTGEKARSPGEEFDKVFTAMSRGEIIDPLLACLESWNGAPLPIC  699



>gb|ABV71917.1| PAL [Solenostemon scutellarioides]
Length=233

 Score =   296 bits (759),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 140/172 (81%), Positives = 150/172 (87%), Gaps = 0/172 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLTMG NGELHPSRFCEKDL+RVVDREYVFAY DDPCSA YPLMQKLRQVLVDHAL
Sbjct  62   VAKRTLTMGANGELHPSRFCEKDLIRVVDREYVFAYIDDPCSATYPLMQKLRQVLVDHAL  121

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
            QNGE+EKNV TSIF KI +FE+ELKALLPKE E AR +LE+GNPAI NRI ECRSYPLYK
Sbjct  122  QNGENEKNVGTSIFHKIESFEEELKALLPKEDESARISLESGNPAIANRIAECRSYPLYK  181

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLP  149
            FIR ELG   LTGEK  SPGE C+KVFTA+  G I+DPLLECL+ WNGAPLP
Sbjct  182  FIRGELGASFLTGEKATSPGEECEKVFTALSKGLIVDPLLECLQGWNGAPLP  233



>gb|ADF59061.1| phenylalanine ammonia-lyase 1 precursor [Pyrus x bretschneideri]
Length=719

 Score =   311 bits (798),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 144/174 (83%), Positives = 156/174 (90%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLT GVNGELHPSRFCEKDLL+VVDREYVFAY DDPCSA YPLMQKLR+VLV+HAL
Sbjct  546  VAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLREVLVEHAL  605

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE EKN STSIFQKI AFE+ELKALLPKEVE ARSA+E+GN A+PNRI ECRSYPLYK
Sbjct  606  TNGESEKNASTSIFQKIGAFEEELKALLPKEVESARSAIESGNAAVPNRIAECRSYPLYK  665

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELG E LTGEKV+SPGE CDKVF A+C G IIDP+L CL+ WNGAPLPIC
Sbjct  666  FVREELGGEYLTGEKVRSPGEECDKVFQAICQGKIIDPILGCLEGWNGAPLPIC  719



>gb|AEZ01784.1| phenylalanine ammonia-lyase [Pyrus x bretschneideri]
Length=719

 Score =   311 bits (797),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 144/174 (83%), Positives = 156/174 (90%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLT GVNGELHPSRFCEKDLL+VVDREYVFAY DDPCSA YPLMQKLR+VLV+HAL
Sbjct  546  VAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLREVLVEHAL  605

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE EKN STSIFQKI AFE+ELKALLPKEVE ARSA+E+GN A+PNRI ECRSYPLYK
Sbjct  606  TNGESEKNASTSIFQKIGAFEEELKALLPKEVESARSAIESGNAAVPNRIAECRSYPLYK  665

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELG E LTGEKV+SPGE CDKVF A+C G IIDP+L CL+ WNGAPLPIC
Sbjct  666  FVREELGGEYLTGEKVRSPGEECDKVFQAICQGKIIDPILGCLEGWNGAPLPIC  719



>gb|AAK84225.1|AF401636_1 phenylalanine ammonia-lyase [Rehmannia glutinosa]
Length=708

 Score =   311 bits (796),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 148/174 (85%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLTMG+NGELHPSRFCEKDLLRVVDREYVFAY DDPCS  YPLMQKLRQVLVDHAL
Sbjct  535  VAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYIDDPCSGTYPLMQKLRQVLVDHAL  594

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE EKNVSTSIFQKI AFE ELKA+LPKEVE AR ALE+GNPAI NRITECRSYPLYK
Sbjct  595  NNGESEKNVSTSIFQKIEAFEVELKAILPKEVESARIALESGNPAIGNRITECRSYPLYK  654

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            FIREELGT  LTGEKV SPGE CDKVFTA+  G I+DPLL+CL+ WNGAP PIC
Sbjct  655  FIREELGTNYLTGEKVVSPGEECDKVFTALSKGLIVDPLLKCLEGWNGAPPPIC  708



>gb|AAK60273.1|AF383150_1 phenylalanine ammonia-lyase 3 [Manihot esculenta]
Length=315

 Score =   299 bits (765),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 140/174 (80%), Positives = 152/174 (87%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKR LT G +GELHPSRFCEKDLL+VVDRE VF+Y DD CSA YPLMQKLRQVLVDHAL
Sbjct  142  VAKRILTTGASGELHPSRFCEKDLLKVVDREQVFSYVDDACSATYPLMQKLRQVLVDHAL  201

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE EKN STSIFQKI AFE+ELKALLPKEVE AR A ENGNPAI N+I ECRSYPLYK
Sbjct  202  ANGESEKNASTSIFQKIRAFEEELKALLPKEVESAREAYENGNPAIANKIKECRSYPLYK  261

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REE+GT +LTGEKV+SPGE  DKVFTA+C G IIDP+L+CLK WNGAPLPIC
Sbjct  262  FVREEIGTGLLTGEKVRSPGEEFDKVFTAMCQGKIIDPMLDCLKEWNGAPLPIC  315



>gb|ABV44808.1| phenylalanine ammonia lyase 1 [Eriobotrya japonica]
Length=330

 Score =   299 bits (766),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 138/173 (80%), Positives = 153/173 (88%), Gaps = 0/173 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKR LTMG NGELHPSRFCEKDLL+VVDREYVF Y DDPCSA YPLMQKLR VLV+HAL
Sbjct  157  VAKRVLTMGFNGELHPSRFCEKDLLKVVDREYVFTYIDDPCSATYPLMQKLRHVLVEHAL  216

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NG+ E++ STSIFQKIAAFE+ELKALLPKEVE  R+  ENG  AIPNRI ECRSYPLYK
Sbjct  217  SNGDKERSTSTSIFQKIAAFEEELKALLPKEVETTRAEYENGKTAIPNRIKECRSYPLYK  276

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPI  146
            F+REELGT++LTGEKV+SPGE CDKVF+A+C G +IDPLL+CLK WNGAPLPI
Sbjct  277  FVREELGTDLLTGEKVRSPGEECDKVFSAMCAGKLIDPLLDCLKEWNGAPLPI  329



>ref|XP_009373523.1| PREDICTED: LOW QUALITY PROTEIN: phenylalanine ammonia-lyase 1-like 
[Pyrus x bretschneideri]
Length=719

 Score =   311 bits (796),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 144/174 (83%), Positives = 156/174 (90%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLT GVNGELHPSRFCEKDLL+VVDREYVFAY DDPCSA YPLMQKLR+VLV+HAL
Sbjct  546  VAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLREVLVEHAL  605

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE EKN STSIFQKI AFE+ELKALLPKEVE ARSA+E+GN A+PNRI ECRSYPLYK
Sbjct  606  TNGESEKNASTSIFQKIGAFEEELKALLPKEVESARSAIESGNAAVPNRIAECRSYPLYK  665

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELG E LTGEKV+SPGE CDKVF A+C G IIDP+L CL+ WNGAPLPIC
Sbjct  666  FVREELGGEYLTGEKVRSPGEECDKVFQAICQGKIIDPILGCLEGWNGAPLPIC  719



>ref|XP_008243955.1| PREDICTED: phenylalanine ammonia-lyase 1 [Prunus mume]
Length=717

 Score =   311 bits (796),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 141/174 (81%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLT GVNGELHPSRFCEKDLL+VVDREYVFAY DDPCSA YPLMQKLRQVLV+HAL
Sbjct  544  VAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLRQVLVEHAL  603

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE+EKN STSIFQKI AFE+ELK LLPKEV+ AR+AL++G+  +PNRITECRSYPLYK
Sbjct  604  TNGENEKNASTSIFQKIVAFEEELKVLLPKEVDSARAALDSGSAGVPNRITECRSYPLYK  663

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELG E LTGEKV+SPGE CDKVF+A+C+G IIDP+L+CL+ WNGAPLPIC
Sbjct  664  FVREELGAEYLTGEKVRSPGEECDKVFSAICEGKIIDPILDCLEGWNGAPLPIC  717



>ref|XP_011031723.1| PREDICTED: phenylalanine ammonia-lyase G4 [Populus euphratica]
Length=711

 Score =   311 bits (796),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 145/174 (83%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKR LTMG NGELHPSRFCEKDLL+VVDRE+VF Y DDPCSA YPLMQKLRQVLVDHAL
Sbjct  538  VAKRVLTMGFNGELHPSRFCEKDLLKVVDREHVFTYIDDPCSATYPLMQKLRQVLVDHAL  597

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE E N STSIFQKI AFE+ELKALLPKEVE AR  LENGNPAIPNRITECRSYPLYK
Sbjct  598  MNGEKEHNSSTSIFQKIGAFEEELKALLPKEVESARHELENGNPAIPNRITECRSYPLYK  657

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGT +LTGEKV SPGE  DKVFTA+C G +IDP+LECLK WNGAPLP+C
Sbjct  658  FVREELGTILLTGEKVGSPGEEFDKVFTAICAGKLIDPMLECLKEWNGAPLPLC  711



>pir||JQ1070 phenylalanine ammonia-lyase (EC 4.3.1.5) - soybean  (fragment)
Length=416

 Score =   302 bits (773),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 142/174 (82%), Positives = 153/174 (88%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLT GVNGELHPSRFCEKDLL+VVDREY FAY DDPCS  YPLMQKLRQVLVD+AL
Sbjct  243  VAKRTLTTGVNGELHPSRFCEKDLLKVVDREYTFAYIDDPCSGTYPLMQKLRQVLVDYAL  302

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE+EKN +TSIFQKIA+FE+ELK LLPKEVEGAR A EN   AIPN+I ECRSYPLYK
Sbjct  303  ANGENEKNTNTSIFQKIASFEEELKTLLPKEVEGARVAYENDQCAIPNKIKECRSYPLYK  362

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGT +LTGE+V SPGE CDKVFTA+C G IIDPLLECL  WNGAPLPIC
Sbjct  363  FVREELGTALLTGERVISPGEECDKVFTALCQGNIIDPLLECLGEWNGAPLPIC  416



>gb|AHY94892.1| phenylalanine ammonia lyase [Prunella vulgaris]
Length=710

 Score =   310 bits (795),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 145/174 (83%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLTMG NGELHPSRFCEK+L+RVVDREYVFAYADDPCSA YPLMQKLRQVLVDHAL
Sbjct  537  VAKRTLTMGANGELHPSRFCEKELIRVVDREYVFAYADDPCSATYPLMQKLRQVLVDHAL  596

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
            +NG+ EKNVSTSIF KI AFE+ELKALLPKEVE AR ALE+G PA+ NRI ECRSYPLYK
Sbjct  597  KNGDGEKNVSTSIFHKIEAFEEELKALLPKEVESARIALESGAPAVANRIAECRSYPLYK  656

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            FIRE LGT  LTGEK  SPGE CDKVFTA+CDG I+DPLLECL+ WNG PLPIC
Sbjct  657  FIREGLGTGFLTGEKAVSPGEECDKVFTALCDGLIVDPLLECLQGWNGEPLPIC  710



>dbj|BAF36973.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=569

 Score =   306 bits (785),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 142/174 (82%), Positives = 156/174 (90%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLT  V+GELHPSRFCEKDLL+VVDRE VFAY DDPCSA YPLMQKLRQVLVDHAL
Sbjct  396  VAKRTLTTSVSGELHPSRFCEKDLLKVVDREVVFAYIDDPCSATYPLMQKLRQVLVDHAL  455

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             N E+EKN +TSIFQKI+ FEDELK+LLPKEVE AR+A E+GNP IPN+I ECRSYPLYK
Sbjct  456  VNAENEKNQNTSIFQKISTFEDELKSLLPKEVESARNAYESGNPVIPNKINECRSYPLYK  515

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGTE+LTGEKV+SPGE CDK+FTA+C G IIDPLLECL  WNGAPLPIC
Sbjct  516  FVREELGTELLTGEKVRSPGEECDKLFTAICQGKIIDPLLECLGEWNGAPLPIC  569



>dbj|BAF36971.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=717

 Score =   310 bits (795),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 143/174 (82%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLT  VNGELHPSRFCEKDLL+VVDRE +FAY DDPCSA YPLMQKLRQVLVDHAL
Sbjct  544  VAKRTLTTSVNGELHPSRFCEKDLLKVVDRETLFAYIDDPCSATYPLMQKLRQVLVDHAL  603

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE+EKN  TSIFQKIA FEDELK+LLPKEVE AR+A E+GNP IPN+I ECRSYPLYK
Sbjct  604  VNGENEKNSKTSIFQKIATFEDELKSLLPKEVESARAAYESGNPTIPNKINECRSYPLYK  663

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGTE+LTGEK +SPGE CDK+FTA+C G IIDPLLECL  WNGAPLPIC
Sbjct  664  FVREELGTELLTGEKTRSPGEECDKLFTAICQGKIIDPLLECLGEWNGAPLPIC  717



>gb|AEZ67457.1| phenylalanine ammonia-lyase [Perilla frutescens]
Length=711

 Score =   310 bits (795),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 145/174 (83%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLTMGVNGELHPSRFCEKDL+ VVDREYVFAY DDPCSA YPLMQKLRQVLVDHAL
Sbjct  538  VAKRTLTMGVNGELHPSRFCEKDLISVVDREYVFAYIDDPCSATYPLMQKLRQVLVDHAL  597

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
            +NGE EKNVSTSIF KI AFE+ELKALLPKEVE AR ALE GNPAI NRI+ECRSYPLYK
Sbjct  598  KNGETEKNVSTSIFHKIEAFEEELKALLPKEVESARIALEGGNPAIANRISECRSYPLYK  657

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            FIREELG   LTGEK  SPGE CD+VFTA+ +G I+DPLL CL+ WNGAPLPIC
Sbjct  658  FIREELGASFLTGEKTTSPGEECDRVFTALSNGLIVDPLLNCLQGWNGAPLPIC  711



>ref|XP_009342990.1| PREDICTED: phenylalanine ammonia-lyase 1 [Pyrus x bretschneideri]
Length=720

 Score =   310 bits (795),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 143/174 (82%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLT GVNGELHPSRFCEKDLL+VVDREYVFAY DDPCSA YPLMQKLRQVLV+HAL
Sbjct  547  VAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLRQVLVEHAL  606

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE EKN STSIFQKI AFE+ELK LLPKEVE ARSA+E+GN A+PNRI ECRSYPLYK
Sbjct  607  TNGESEKNASTSIFQKIGAFEEELKTLLPKEVESARSAIESGNAAVPNRIAECRSYPLYK  666

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELG E LTGEKV+SPGE CD+VF A+C G IIDP+L CL+ WNGAPLPIC
Sbjct  667  FVREELGGEYLTGEKVRSPGEECDRVFQAICQGKIIDPILGCLEGWNGAPLPIC  720



>gb|AGL81344.1| phenylalanine ammonia lyase [Pyrus communis]
Length=720

 Score =   310 bits (795),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 143/174 (82%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLT GVNGELHPSRFCEKDLL+VVDREYVFAY DDPCSA YPLMQKLRQVLV+HAL
Sbjct  547  VAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLRQVLVEHAL  606

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE EKN STSIFQKI AFE+ELK LLPKEVE ARSA+E+GN A+PNRI ECRSYPLYK
Sbjct  607  TNGESEKNASTSIFQKIGAFEEELKTLLPKEVESARSAIESGNAAVPNRIAECRSYPLYK  666

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELG E LTGEKV+SPGE CD+VF A+C G IIDP+L CL+ WNGAPLPIC
Sbjct  667  FVREELGGEYLTGEKVRSPGEECDRVFQAICQGKIIDPILGCLEGWNGAPLPIC  720



>gb|AGL50914.1| phenylalanine ammonia lyase [Pyrus communis]
Length=720

 Score =   310 bits (795),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 143/174 (82%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLT GVNGELHPSRFCEKDLL+VVDREYVFAY DDPCSA YPLMQKLRQVLV+HAL
Sbjct  547  VAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLRQVLVEHAL  606

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE EKN STSIFQKI AFE+ELK LLPKEVE ARSA+E+GN A+PNRI ECRSYPLYK
Sbjct  607  TNGESEKNASTSIFQKIGAFEEELKTLLPKEVESARSAIESGNAAVPNRIAECRSYPLYK  666

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELG E LTGEKV+SPGE CD+VF A+C G IIDP+L CL+ WNGAPLPIC
Sbjct  667  FVREELGGEYLTGEKVRSPGEECDRVFQAICQGKIIDPILGCLEGWNGAPLPIC  720



>gb|ABB70117.2| phenylalanine ammonia lyase [Pyrus communis]
Length=720

 Score =   310 bits (795),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 143/174 (82%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLT GVNGELHPSRFCEKDLL+VVDREYVFAY DDPCSA YPLMQKLRQVLV+HAL
Sbjct  547  VAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLRQVLVEHAL  606

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE EKN STSIFQKI AFE+ELK LLPKEVE ARSA+E+GN A+PNRI ECRSYPLYK
Sbjct  607  TNGESEKNASTSIFQKIGAFEEELKTLLPKEVESARSAIESGNAAVPNRIAECRSYPLYK  666

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELG E LTGEKV+SPGE CD+VF A+C G IIDP+L CL+ WNGAPLPIC
Sbjct  667  FVREELGGEYLTGEKVRSPGEECDRVFQAICQGKIIDPILGCLEGWNGAPLPIC  720



>ref|XP_006354339.1| PREDICTED: phenylalanine ammonia-lyase-like [Solanum tuberosum]
Length=722

 Score =   310 bits (795),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 140/174 (80%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAK+TLTMG NGELHP+RFCEK+LL+VV+REY+F YADDPCS  YPLMQKLRQVLVDHA+
Sbjct  549  VAKKTLTMGANGELHPARFCEKELLQVVEREYLFTYADDPCSCTYPLMQKLRQVLVDHAM  608

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
            +NGE E NV++SIFQKI AFEDELKA+LPKEVE AR  LE+GNP IPNRITECRSYPLY+
Sbjct  609  KNGESESNVNSSIFQKIVAFEDELKAVLPKEVESARVVLESGNPVIPNRITECRSYPLYR  668

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+R+ELGTE+LTGEK++SPGE  DKVFTA C+G IIDPLLECLKSWNGAPLPIC
Sbjct  669  FVRKELGTEVLTGEKIRSPGEEIDKVFTAFCNGQIIDPLLECLKSWNGAPLPIC  722



>ref|XP_008369679.1| PREDICTED: phenylalanine ammonia-lyase 1-like [Malus domestica]
Length=720

 Score =   310 bits (794),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 143/174 (82%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLT GVNGELHPSRFCEKDLL+VVDREYVFAY DDPCSA YPLMQKLR+VL +HAL
Sbjct  547  VAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLREVLXEHAL  606

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE EKN STSIFQKI AFE+ELKALLPKEVE ARSA+E+GN A+PNRI ECRSYPLYK
Sbjct  607  TNGESEKNASTSIFQKIGAFEEELKALLPKEVESARSAIESGNAAVPNRIAECRSYPLYK  666

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELG E LTGEKV+SPGE CDKVF A+C G IIDP+L CL+ WNGAPLPIC
Sbjct  667  FVREELGGEYLTGEKVRSPGEECDKVFQAICQGKIIDPILGCLEGWNGAPLPIC  720



>ref|XP_008355619.1| PREDICTED: LOW QUALITY PROTEIN: phenylalanine ammonia-lyase 1-like 
[Malus domestica]
Length=720

 Score =   310 bits (793),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 143/174 (82%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLT GVNGELHPSRFCEKDLL+VVDREYVFAY DDPCSA YPLMQKLR+VL +HAL
Sbjct  547  VAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLREVLXEHAL  606

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE EKN STSIFQKI AFE+ELKALLPKEVE ARSA+E+GN A+PNRI ECRSYPLYK
Sbjct  607  TNGESEKNASTSIFQKIGAFEEELKALLPKEVESARSAIESGNAAVPNRIAECRSYPLYK  666

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELG E LTGEKV+SPGE CDKVF A+C G IIDP+L CL+ WNGAPLPIC
Sbjct  667  FVREELGGEYLTGEKVRSPGEECDKVFQAICQGKIIDPILGCLEGWNGAPLPIC  720



>ref|XP_011077338.1| PREDICTED: phenylalanine ammonia-lyase [Sesamum indicum]
Length=712

 Score =   309 bits (792),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 145/174 (83%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAY DDPCS NYPLMQKLRQVLV+HAL
Sbjct  539  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYVDDPCSENYPLMQKLRQVLVEHAL  598

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
            +NG++EKN+STSIFQKI AFEDELKALLPKEVE AR ALE+GNPAI NRI ECRSYPLY+
Sbjct  599  KNGDNEKNLSTSIFQKIGAFEDELKALLPKEVESARIALESGNPAIANRIKECRSYPLYR  658

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            FIREELGT  LTGEKV SPGE  DKVFTA+  G I+DPLL+CL+ W+G+PLPIC
Sbjct  659  FIREELGTGFLTGEKVTSPGEEGDKVFTALSKGLIVDPLLKCLEGWSGSPLPIC  712



>ref|XP_006358655.1| PREDICTED: phenylalanine ammonia-lyase-like [Solanum tuberosum]
Length=709

 Score =   309 bits (792),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 141/174 (81%), Positives = 161/174 (93%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLTM  NGELHP+RFCEK+LL VVDREY+FAYADDPCS+NYPLMQKLRQVLVD+A+
Sbjct  536  VAKRTLTMDANGELHPARFCEKELLLVVDREYLFAYADDPCSSNYPLMQKLRQVLVDYAM  595

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
            +NGE EKNV++SIFQKI AFEDELK +LP EVE AR  LE+GNP+IPNRITECRSYPLY+
Sbjct  596  KNGESEKNVNSSIFQKIGAFEDELKVVLPNEVENARVILESGNPSIPNRITECRSYPLYR  655

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+R+ELGTE+LTGE+V+SPGE  DKVFTA+C+G IIDPLLECLKSWNGAPLPIC
Sbjct  656  FVRKELGTELLTGERVRSPGEDIDKVFTALCNGQIIDPLLECLKSWNGAPLPIC  709



>ref|XP_004246651.1| PREDICTED: phenylalanine ammonia-lyase [Solanum lycopersicum]
Length=721

 Score =   310 bits (793),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 138/174 (79%), Positives = 161/174 (93%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAK+TL MG NGELHP+RFCEK+LL+VV+REY+F YADDPCS+ YPLMQKLRQVLVDHA+
Sbjct  548  VAKKTLAMGANGELHPARFCEKELLQVVEREYLFTYADDPCSSTYPLMQKLRQVLVDHAM  607

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
            +NGE EKNV++SIFQKI AFEDELKA+LPKEVE AR+ +E+GNPAIPNRITECRSYPLY+
Sbjct  608  KNGESEKNVNSSIFQKIVAFEDELKAVLPKEVESARAVVESGNPAIPNRITECRSYPLYR  667

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
             +R+E+GTE+LTGEKV+SPGE  DKVFTA C+G IIDPLLECLKSWNGAP+PIC
Sbjct  668  LVRQEVGTELLTGEKVRSPGEEIDKVFTAFCNGQIIDPLLECLKSWNGAPIPIC  721



>gb|ACF94715.1| phenylalanine ammonia lyase [Robinia pseudoacacia]
Length=332

 Score =   298 bits (762),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 140/174 (80%), Positives = 151/174 (87%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            +AKRTLT GVNGELHPSRFCEKDLL+VVDREYVFAY DD CSA YPLMQKLRQVLVDHAL
Sbjct  159  IAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYVDDACSATYPLMQKLRQVLVDHAL  218

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             N + EKN++TSIFQKI  FE+ELK LLPKEVE AR A ENG  AIPN+I ECRSYPLYK
Sbjct  219  ANADGEKNLNTSIFQKITTFEEELKTLLPKEVESARVAYENGQCAIPNKIEECRSYPLYK  278

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGT +LTGEKV SPGE CDK+FTA+C G IIDPLLECL  WNGAPLPIC
Sbjct  279  FVREELGTGLLTGEKVISPGEECDKLFTAMCQGKIIDPLLECLGEWNGAPLPIC  332



>gb|AHZ31605.1| phenylalanine ammonia-lyase [Olea europaea]
 gb|AHZ31606.1| phenylalanine ammonia-lyase [Olea europaea]
Length=713

 Score =   309 bits (791),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 145/174 (83%), Positives = 156/174 (90%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAK+TLT+GVNGELHPSRFCEKDLLRVVDREYVFAY DDPCSA YPLMQKLRQVLV+HAL
Sbjct  540  VAKKTLTVGVNGELHPSRFCEKDLLRVVDREYVFAYIDDPCSATYPLMQKLRQVLVEHAL  599

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
            +NGE EK  +TSIFQKI AFEDEL A LPKEVE AR ALE+GNPAIPN+I ECRSYPLYK
Sbjct  600  KNGETEKEANTSIFQKIGAFEDELIANLPKEVESARIALESGNPAIPNKINECRSYPLYK  659

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGTE+LTGEKV+SPGE CDKVFTA+  G IIDPLLECL  WNG PLPIC
Sbjct  660  FVREELGTELLTGEKVRSPGEECDKVFTAMSKGLIIDPLLECLNGWNGEPLPIC  713



>sp|O23865.1|PAL1_DAUCA RecName: Full=Phenylalanine ammonia-lyase 1 [Daucus carota]
 dbj|BAA23367.1| phenylalanine ammonia-lyase [Daucus carota]
Length=708

 Score =   308 bits (790),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 146/174 (84%), Positives = 156/174 (90%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAK+ LTMGVNGELHPSRFCE DLLRVVDREY+FAY DDPCSA YPLMQKLRQVLV+HAL
Sbjct  535  VAKKVLTMGVNGELHPSRFCELDLLRVVDREYIFAYIDDPCSATYPLMQKLRQVLVEHAL  594

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
            +NGE EKN+STSIFQKIAAFEDELKALLPKEVE AR+ +E+GNPAIPNRI ECRSYPLYK
Sbjct  595  KNGETEKNLSTSIFQKIAAFEDELKALLPKEVESARAVVESGNPAIPNRIKECRSYPLYK  654

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            FIREELGT  LTGEKV SPGE  DKVFTA+  G IIDPLL CL+SWNGAPLPI 
Sbjct  655  FIREELGTVYLTGEKVTSPGEEFDKVFTAMSKGEIIDPLLACLESWNGAPLPIA  708



>dbj|BAF36969.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=437

 Score =   301 bits (770),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 140/174 (80%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLT GV+GELHPSRFCEKDLL+VVDRE +FAY DDPC A YPLMQKLRQVLVDHAL
Sbjct  264  VAKRTLTTGVSGELHPSRFCEKDLLKVVDRETLFAYIDDPCLATYPLMQKLRQVLVDHAL  323

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE+EK+  TSIFQKI +FEDELK+LLPKEVE AR+A E+GNPAIPN+I ECRSYPLYK
Sbjct  324  VNGENEKDSKTSIFQKIGSFEDELKSLLPKEVESARAAYESGNPAIPNKINECRSYPLYK  383

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGTE+LTGEK +SPGE  DK+FTA+C G IIDPLLECL  WNGAPLPIC
Sbjct  384  FVREELGTELLTGEKSRSPGEEFDKLFTAICQGKIIDPLLECLGEWNGAPLPIC  437



>sp|P45728.1|PAL2_PETCR RecName: Full=Phenylalanine ammonia-lyase 2 [Petroselinum crispum]
 emb|CAA57056.1| phenylalanine ammonia-lyase 2 [Petroselinum crispum]
Length=716

 Score =   308 bits (790),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 143/174 (82%), Positives = 157/174 (90%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKR LTMGVNGELHPSRFCEKDLLR VDREY+FAY DDPCSA YPLMQKLRQ LV+HAL
Sbjct  543  VAKRVLTMGVNGELHPSRFCEKDLLRFVDREYIFAYIDDPCSATYPLMQKLRQTLVEHAL  602

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
            +NG++E+N++TSIFQKIA FEDELKALLPKEVE AR+ALE+GNPAIPNRI ECRSYPLYK
Sbjct  603  KNGDNERNMNTSIFQKIATFEDELKALLPKEVESARAALESGNPAIPNRIEECRSYPLYK  662

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+R+ELG E LTGEKV SPGE  DKVF A+  G IIDPLLECL+SWNGAPLPIC
Sbjct  663  FVRKELGIEYLTGEKVTSPGEEFDKVFIAMSKGEIIDPLLECLESWNGAPLPIC  716



>ref|XP_002531677.1| Phenylalanine ammonia-lyase, putative [Ricinus communis]
 gb|EEF30696.1| Phenylalanine ammonia-lyase, putative [Ricinus communis]
Length=719

 Score =   308 bits (790),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 142/174 (82%), Positives = 156/174 (90%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKR LTMG NGELHPSRFCEKDLL+VVDREY+FAY DDPCSA YPLMQKLRQVLVDHAL
Sbjct  546  VAKRVLTMGFNGELHPSRFCEKDLLKVVDREYIFAYIDDPCSATYPLMQKLRQVLVDHAL  605

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE EKN STSIFQKI AFE+ELKALLPKEVE AR+  +NGNPAIPN+I ECRSYPLYK
Sbjct  606  LNGEKEKNSSTSIFQKIGAFEEELKALLPKEVENARTEYDNGNPAIPNKIKECRSYPLYK  665

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGT +LTGEK++SPGE  DKVF+A+C G +IDP+LECLK WNGAPLPIC
Sbjct  666  FVREELGTGLLTGEKIRSPGEEFDKVFSAMCAGKLIDPMLECLKEWNGAPLPIC  719



>sp|O23924.1|PALY_DIGLA RecName: Full=Phenylalanine ammonia-lyase [Digitalis lanata]
 emb|CAA05251.1| phenylalanine ammonia lyase [Digitalis lanata]
Length=713

 Score =   308 bits (790),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 145/174 (83%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLT GVNGELHPSRFCE DLLRVVDREYVFAY DDPCSA YPLMQKLRQVLV+HAL
Sbjct  540  VAKRTLTTGVNGELHPSRFCELDLLRVVDREYVFAYVDDPCSATYPLMQKLRQVLVEHAL  599

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
            +NGE+EKN STSIFQKI AFE ELKA+LPKEVE AR ALE+G PAI NRITECRSYPLYK
Sbjct  600  KNGENEKNASTSIFQKIEAFEAELKAVLPKEVESARVALEDGKPAIANRITECRSYPLYK  659

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            FIREELGT  LTGEKV SPGE CD+VFTA+  G I+DPLL+CL+ WNGAPLPIC
Sbjct  660  FIREELGTNFLTGEKVMSPGEECDRVFTAMSKGLIVDPLLKCLEGWNGAPLPIC  713



>gb|AAA34179.2| phenylalanine ammonia lyase [Solanum lycopersicum]
Length=704

 Score =   308 bits (789),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 141/174 (81%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLTMG NGELHP+RF EK+LLRVVDREY+FAYADDPCS+NYPLMQKLRQVLVD A+
Sbjct  531  VAKRTLTMGANGELHPARFSEKELLRVVDREYLFAYADDPCSSNYPLMQKLRQVLVDQAM  590

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
            +NGE EKNV++SIFQKI AFEDEL A+LPKEVE  R+  E+GNP I NRITECRSYPLY+
Sbjct  591  KNGESEKNVNSSIFQKIGAFEDELIAVLPKEVESVRAVFESGNPLIRNRITECRSYPLYR  650

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
             +REELGTE+LTGEKV+SPGE  DKVFTA+C+G IIDPLLECLKSWNGAPLPIC
Sbjct  651  LVREELGTELLTGEKVRSPGEEIDKVFTAICNGQIIDPLLECLKSWNGAPLPIC  704



>sp|P35511.1|PAL1_SOLLC RecName: Full=Phenylalanine ammonia-lyase; Short=PAL [Solanum 
lycopersicum]
Length=704

 Score =   308 bits (789),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 141/174 (81%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLTMG NGELHP+RF EK+LLRVVDREY+FAYADDPCS+NYPLMQKLRQVLVD A+
Sbjct  531  VAKRTLTMGANGELHPARFSEKELLRVVDREYLFAYADDPCSSNYPLMQKLRQVLVDQAM  590

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
            +NGE EKNV++SIFQKI AFEDEL A+LPKEVE  R+  E+GNP I NRITECRSYPLY+
Sbjct  591  KNGESEKNVNSSIFQKIGAFEDELIAVLPKEVESVRAVFESGNPLIRNRITECRSYPLYR  650

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
             +REELGTE+LTGEKV+SPGE  DKVFTA+C+G IIDPLLECLKSWNGAPLPIC
Sbjct  651  LVREELGTELLTGEKVRSPGEEIDKVFTAICNGQIIDPLLECLKSWNGAPLPIC  704



>sp|P26600.1|PAL5_SOLLC RecName: Full=Phenylalanine ammonia-lyase; Short=PAL [Solanum 
lycopersicum]
 gb|AAA34176.1| phenylalanine ammonia-lyase [Solanum lycopersicum]
Length=721

 Score =   308 bits (789),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 137/174 (79%), Positives = 161/174 (93%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAK+TL MG NGELHP+RFCEK+LL+VV+REY+F YADDPCS+ YPLMQKLRQVLVDHA+
Sbjct  548  VAKKTLAMGANGELHPARFCEKELLQVVEREYLFTYADDPCSSTYPLMQKLRQVLVDHAM  607

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
            +NGE EKN+++SIFQKI AFEDELKA+LPKEVE AR+ +E+GNPAIPNRITECRSYPLY+
Sbjct  608  KNGESEKNLNSSIFQKIVAFEDELKAVLPKEVESARAVVESGNPAIPNRITECRSYPLYR  667

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
             +R+E+GTE+LTGEKV+SPGE  DKVFTA C+G IIDPLLECLKSWNGAP+PIC
Sbjct  668  LVRQEVGTELLTGEKVRSPGEEIDKVFTAFCNGQIIDPLLECLKSWNGAPIPIC  721



>ref|XP_006364022.1| PREDICTED: phenylalanine ammonia-lyase-like [Solanum tuberosum]
Length=723

 Score =   308 bits (789),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 138/174 (79%), Positives = 160/174 (92%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLT+G NGELHP+RFCEK+LLRVVDREY+FAYADDPCS+NYPLMQKLRQVLVD A+
Sbjct  550  VAKRTLTVGANGELHPARFCEKELLRVVDREYLFAYADDPCSSNYPLMQKLRQVLVDQAM  609

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
            +NGE EK+ ++SIFQKI AFEDEL A+LPKEVE  R+ +E+GNP+IPNRITECRSYPLY+
Sbjct  610  KNGESEKHFNSSIFQKIGAFEDELIAVLPKEVESVRAVVESGNPSIPNRITECRSYPLYR  669

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
             +R+ELGTE+LTGEK++SPGE  DKVFTA C+G IIDPLLECLKSWNGAPLPIC
Sbjct  670  LVRQELGTEVLTGEKIRSPGEEIDKVFTAFCNGQIIDPLLECLKSWNGAPLPIC  723



>gb|AAN52280.1|AF480620_1 phenylalanine ammonia-lyase [Populus tremuloides]
Length=711

 Score =   308 bits (788),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 144/174 (83%), Positives = 152/174 (87%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKR LTMG NGELHPSR CEKDLL+VVDRE+VF Y DDPCSA YPLMQKLRQVLVDHAL
Sbjct  538  VAKRVLTMGFNGELHPSRICEKDLLKVVDREHVFTYIDDPCSATYPLMQKLRQVLVDHAL  597

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE E N STSIFQKI  FEDELKALLPKEVE AR  LENGNPAIPNRITECRSYPLYK
Sbjct  598  MNGEKEHNSSTSIFQKIGVFEDELKALLPKEVESARLELENGNPAIPNRITECRSYPLYK  657

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGT +LTGEKV SPGE  DKVFTA+C G +IDP+LECLK WNGAPLP+C
Sbjct  658  FVREELGTILLTGEKVGSPGEEFDKVFTAICAGKLIDPMLECLKEWNGAPLPLC  711



>gb|AFK47120.1| unknown [Lotus japonicus]
Length=206

 Score =   291 bits (746),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 139/174 (80%), Positives = 151/174 (87%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLT GVNGELHPSRFCEKDLL VVDRE VFAY DDPCS  YPLMQKLRQ LVDHAL
Sbjct  33   VAKRTLTTGVNGELHPSRFCEKDLLTVVDREDVFAYIDDPCSGTYPLMQKLRQSLVDHAL  92

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
            +N + EKNV+TSIFQKIA FEDELKA+LPKEVE AR A +NG  AIPN+I ECRSYPLYK
Sbjct  93   ENADAEKNVNTSIFQKIAIFEDELKAILPKEVESARVAYDNGESAIPNKIKECRSYPLYK  152

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGT +LTGEKV+SPGE  DK+FTA+C G IIDP+LECL  WNGAPLPIC
Sbjct  153  FVREELGTGLLTGEKVKSPGEDFDKLFTAMCQGKIIDPILECLGEWNGAPLPIC  206



>ref|XP_007162755.1| hypothetical protein PHAVU_001G1777000g, partial [Phaseolus vulgaris]
 gb|ESW34749.1| hypothetical protein PHAVU_001G1777000g, partial [Phaseolus vulgaris]
Length=240

 Score =   293 bits (749),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 136/174 (78%), Positives = 152/174 (87%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            V+KRTLT G NGELHPSRFCEKDLL+VVDREYVF+Y DDPCS  YPLMQKLRQVLVDHAL
Sbjct  67   VSKRTLTTGGNGELHPSRFCEKDLLKVVDREYVFSYIDDPCSGTYPLMQKLRQVLVDHAL  126

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             N E+EK+V+TSIFQKIA FE+ELK +LPKEVE  R+A E+G  AIPN+I ECRSYPLYK
Sbjct  127  INAENEKDVNTSIFQKIATFEEELKTILPKEVESTRAAYESGKAAIPNKIKECRSYPLYK  186

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGT +LTGEKV+SPGE  DK+FTA+C G IIDPLLECL  WNGAPLPIC
Sbjct  187  FVREELGTGLLTGEKVKSPGEEFDKLFTAICQGKIIDPLLECLGEWNGAPLPIC  240



>dbj|BAF36970.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=704

 Score =   307 bits (787),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 141/174 (81%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            V KRTLT GVNGELHPSRFCEKDLL+VVDRE +F+Y DDPCSA YPLMQKLRQVLVDHAL
Sbjct  531  VVKRTLTTGVNGELHPSRFCEKDLLKVVDRETLFSYIDDPCSATYPLMQKLRQVLVDHAL  590

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE+EK+  TSIFQKIA FEDELK+LLPKEVE AR+A E+GNP IPN+I ECRSYPLYK
Sbjct  591  VNGENEKDSKTSIFQKIATFEDELKSLLPKEVESARAAYESGNPTIPNKINECRSYPLYK  650

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGTE+LTGEK +SPGE CDK+FTA+C G IIDPLLECL  WNGAPLPIC
Sbjct  651  FVREELGTELLTGEKTRSPGEECDKLFTAICQGKIIDPLLECLGEWNGAPLPIC  704



>ref|XP_007208432.1| hypothetical protein PRUPE_ppa002099mg [Prunus persica]
 gb|EMJ09631.1| hypothetical protein PRUPE_ppa002099mg [Prunus persica]
Length=717

 Score =   307 bits (787),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 139/174 (80%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLT GVNGELHPSRFCEKDLL+VVDREYVFAY DDPC+A YPLMQKLRQVLV+HAL
Sbjct  544  VAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCNATYPLMQKLRQVLVEHAL  603

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE+EKN STSIFQKI AFE+ELK LLPKEV+ AR+AL++G   +PNRITECRSYPLYK
Sbjct  604  TNGENEKNASTSIFQKIVAFEEELKVLLPKEVDSARAALDSGTAGVPNRITECRSYPLYK  663

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELG E LTGE+V+SPGE CDKVF+A+C+G IIDP+L+CL+ WNGAPLPIC
Sbjct  664  FVREELGAEYLTGEEVRSPGEECDKVFSAICEGKIIDPILDCLEGWNGAPLPIC  717



>ref|XP_007009873.1| Phenylalanine ammonia-lyase 2 [Theobroma cacao]
 gb|EOY18683.1| Phenylalanine ammonia-lyase 2 [Theobroma cacao]
Length=713

 Score =   307 bits (787),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 143/174 (82%), Positives = 153/174 (88%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKR LTMG NGELHPSRFCEKDLLRVVDREY++AY DDPCSA YPLMQKLRQVLVDHAL
Sbjct  540  VAKRVLTMGSNGELHPSRFCEKDLLRVVDREYLYAYVDDPCSATYPLMQKLRQVLVDHAL  599

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NG+ EKN +TSIFQKI AFE+ELK LLPKEVEGAR   ENGN AIPNRI ECRSYPLYK
Sbjct  600  MNGDREKNSTTSIFQKIGAFEEELKTLLPKEVEGARIEFENGNAAIPNRIEECRSYPLYK  659

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+RE LGT +LTGEKV SPGE CDKVF+A+C G +IDPLLECLK WNGAPLPIC
Sbjct  660  FVREVLGTSLLTGEKVISPGEECDKVFSAMCAGKLIDPLLECLKEWNGAPLPIC  713



>gb|AEX32784.1| phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   307 bits (786),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 141/174 (81%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAK+TLT G NGELHPSRFCEKDLL+VVDRE+VFAY DDPCSA YPLMQK+RQVLV+HAL
Sbjct  537  VAKKTLTTGANGELHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLMQKVRQVLVEHAL  596

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE+EKN STSIFQKIAAFE+ELKA+LPKEVE AR  +E+GNP+IPNRI ECRSYPLYK
Sbjct  597  NNGENEKNGSTSIFQKIAAFEEELKAVLPKEVESARGGVESGNPSIPNRIKECRSYPLYK  656

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGT +LTGEKV+SPGE  DKVFTA+C+G IIDPLL+CL +WNGAPLPIC
Sbjct  657  FVREELGTGLLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNGAPLPIC  710



>ref|XP_003635657.2| PREDICTED: phenylalanine ammonia-lyase-like [Vitis vinifera]
Length=710

 Score =   306 bits (785),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 141/174 (81%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAK+TLT G NGELHPSRFCEKDLL+VVDRE+VFAY DDPCSA YPLMQK+RQVLV+HAL
Sbjct  537  VAKKTLTTGANGELHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLMQKVRQVLVEHAL  596

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE+EKN STSIFQKIAAFE+ELKA+LPKEVE AR  +E+GNP+IPNRI ECRSYPLYK
Sbjct  597  NNGENEKNGSTSIFQKIAAFEEELKAVLPKEVESARGGVESGNPSIPNRIKECRSYPLYK  656

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGT +LTGEKV+SPGE  DKVFTA+C+G IIDPLL+CL +WNGAPLPIC
Sbjct  657  FVREELGTGLLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNGAPLPIC  710



>ref|XP_002281799.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   306 bits (785),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 140/174 (80%), Positives = 157/174 (90%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            +AK+TLT GVNGELHPSRFCEKDLL+VVDREY+FAY DDPCS  YPLMQK+RQVLV+HAL
Sbjct  537  IAKKTLTTGVNGELHPSRFCEKDLLKVVDREYIFAYIDDPCSETYPLMQKVRQVLVEHAL  596

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE+EKNVSTSIFQKI AFE+ELKALLPKEVE  R+ LE+GNP IPNRI +CRSYPLYK
Sbjct  597  NNGENEKNVSTSIFQKIVAFEEELKALLPKEVESTRAGLESGNPFIPNRIKDCRSYPLYK  656

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGT +LTGEKV+SPGE  DKVFTA+C+G IIDPLL+CL  WNGAPLPIC
Sbjct  657  FVREELGTGLLTGEKVRSPGEEFDKVFTAMCEGKIIDPLLDCLSGWNGAPLPIC  710



>gb|AFZ78651.1| phenylalanine ammonia-lyase [Populus tomentosa]
Length=711

 Score =   306 bits (785),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 143/174 (82%), Positives = 152/174 (87%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKR LTMG NGELHPSRFCEKDLL+VVDRE+ F Y DDPCSA YPLMQKLRQVLVDHAL
Sbjct  538  VAKRVLTMGFNGELHPSRFCEKDLLKVVDREHAFTYIDDPCSATYPLMQKLRQVLVDHAL  597

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE E N STSIFQKI AFE+ELK LLPKEVE AR  LENGNPAIPNRITECRSYPLYK
Sbjct  598  MNGEKEHNSSTSIFQKIGAFEEELKTLLPKEVENARLELENGNPAIPNRITECRSYPLYK  657

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGT +LTGEKV SPGE  DKVFTA+C G +IDP+LECLK WNGAPLP+C
Sbjct  658  FVREELGTILLTGEKVGSPGEEFDKVFTAICAGKLIDPMLECLKEWNGAPLPLC  711



>ref|XP_002312013.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
 gb|ACC63890.1| phenylalanine ammonia-lyase [Populus trichocarpa]
 gb|EEE89380.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
Length=711

 Score =   306 bits (785),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 143/174 (82%), Positives = 152/174 (87%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKR LTMG NGELHPSRFCEKDLL+VVDRE+ F Y DDPCSA YPLMQKLRQVLVDHAL
Sbjct  538  VAKRVLTMGFNGELHPSRFCEKDLLKVVDREHAFTYIDDPCSATYPLMQKLRQVLVDHAL  597

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE E N STSIFQKI AFE+ELK LLPKEVE AR  LENGNPAIPNRITECRSYPLYK
Sbjct  598  MNGEKEHNSSTSIFQKIGAFEEELKTLLPKEVENARLELENGNPAIPNRITECRSYPLYK  657

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGT +LTGEKV SPGE  DKVFTA+C G +IDP+LECLK WNGAPLP+C
Sbjct  658  FVREELGTILLTGEKVGSPGEEFDKVFTAICAGKLIDPMLECLKEWNGAPLPLC  711



>sp|P45732.1|PALY_STYHU RecName: Full=Phenylalanine ammonia-lyase [Stylosanthes humilis]
 gb|AAA99500.1| phenylalanine ammonia lyase [Stylosanthes humilis]
Length=715

 Score =   306 bits (785),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 141/174 (81%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLT GVNGELHPSRFCEKDLL++VDREY FAY DDPCSA YPLMQKLRQVLV+HAL
Sbjct  542  VAKRTLTTGVNGELHPSRFCEKDLLKIVDREYCFAYIDDPCSATYPLMQKLRQVLVEHAL  601

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             N E+EKNV+TSIFQKI  FE+ELK LLPKEVEGAR A ENG  AIPN+I ECRSYPLYK
Sbjct  602  ANAENEKNVNTSIFQKITTFEEELKTLLPKEVEGARIAYENGQSAIPNKIKECRSYPLYK  661

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGTE+LTGEKV+SPGE CDK+FTA+C G IIDPLLEC+  WNGAPLP+C
Sbjct  662  FVREELGTEMLTGEKVRSPGEECDKLFTAMCQGKIIDPLLECIGEWNGAPLPLC  715



>gb|AFZ94859.1| phenylalanine ammonia-lyase [Solenostemon scutellarioides]
Length=711

 Score =   306 bits (785),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 143/174 (82%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLTMG+NGELHPSRFCEKDLLRVVDREYVFAY DDPCSANYPLMQKLRQVLVDHAL
Sbjct  538  VAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYIDDPCSANYPLMQKLRQVLVDHAL  597

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
            +NG+ EKNV TSIFQKI  FE+EL A+LPKEVE AR ALE GNPAIPNRI ECRSYPLY 
Sbjct  598  KNGDSEKNVGTSIFQKIQVFEEELTAVLPKEVEAARIALEAGNPAIPNRIKECRSYPLYS  657

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            FIREELGTE LTGEK  SPGE  +KVFTA+ +G I+DPLL+CL++WNG PLPIC
Sbjct  658  FIREELGTEFLTGEKTVSPGEEGEKVFTALSNGLIVDPLLKCLEAWNGEPLPIC  711



>ref|XP_010107519.1| Phenylalanine ammonia-lyase [Morus notabilis]
 gb|EXC16201.1| Phenylalanine ammonia-lyase [Morus notabilis]
Length=535

 Score =   301 bits (772),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 140/174 (80%), Positives = 153/174 (88%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKR LT GVNGELHPSRFCEKDLL+VVDREYV+AY DDPCSA YPLMQ LRQVLV+HAL
Sbjct  362  VAKRVLTTGVNGELHPSRFCEKDLLKVVDREYVYAYIDDPCSATYPLMQTLRQVLVEHAL  421

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE EKN STSIFQKIAAFE+ELK+LLPKEVE AR A ENGN AI N+ITECRSYPLYK
Sbjct  422  TNGESEKNTSTSIFQKIAAFEEELKSLLPKEVESARIAYENGNAAISNKITECRSYPLYK  481

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGT +LTGEKV+SPGE  DKV+TA+C G +IDP+LECL  WNG PLPIC
Sbjct  482  FVREELGTSLLTGEKVRSPGEEFDKVYTAMCQGKLIDPMLECLSGWNGEPLPIC  535



>sp|Q04593.1|PAL2_PEA RecName: Full=Phenylalanine ammonia-lyase 2 [Pisum sativum]
 dbj|BAA00887.1| phenylalanine ammonia-lyase [Pisum sativum]
Length=724

 Score =   306 bits (785),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 142/174 (82%), Positives = 152/174 (87%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLT G+NGELHPSRFCEKDLLRVVDRE+VF+Y DDPCSA YPLMQKLRQVLVDHAL
Sbjct  551  VAKRTLTTGINGELHPSRFCEKDLLRVVDREHVFSYIDDPCSATYPLMQKLRQVLVDHAL  610

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE EKN++TSIFQKIA FEDELK LLPKEVE AR A ENGN  I N+I ECRSYPLYK
Sbjct  611  VNGESEKNLNTSIFQKIATFEDELKTLLPKEVESARGAYENGNTTISNKIKECRSYPLYK  670

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGT +LTGEKV SPGE CDK+FTA+C G IIDPLLECL  WNGAPLPI 
Sbjct  671  FVREELGTSLLTGEKVISPGEECDKLFTAICQGKIIDPLLECLGDWNGAPLPIS  724



>dbj|BAD94354.1| phenylalanine ammonia lyase [Arabidopsis thaliana]
Length=357

 Score =   296 bits (757),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 135/174 (78%), Positives = 152/174 (87%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAK+ LT GVNGELHPSRFCEKDLL+VVDRE V+ YADDPCSA YPL+QKLRQV+VDHAL
Sbjct  184  VAKKVLTTGVNGELHPSRFCEKDLLKVVDREQVYTYADDPCSATYPLIQKLRQVIVDHAL  243

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE EKN  TSIF KI AFE+ELKA+LPKEVE AR+A +NG  AIPNRI ECRSYPLY+
Sbjct  244  INGESEKNAVTSIFHKIGAFEEELKAVLPKEVEAARAAYDNGTSAIPNRIKECRSYPLYR  303

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGTE+LTGEKV SPGE  DKVFTA+C+G IIDP++ECL  WNGAP+PIC
Sbjct  304  FVREELGTELLTGEKVTSPGEEFDKVFTAICEGKIIDPMMECLNEWNGAPIPIC  357



>dbj|BAF36974.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=684

 Score =   305 bits (782),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 141/174 (81%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLT GVNGELHPSRFCEKDLL+VVDRE +FAY DDPC A YPLMQKLRQVLVDHAL
Sbjct  511  VAKRTLTTGVNGELHPSRFCEKDLLKVVDRETLFAYIDDPCLATYPLMQKLRQVLVDHAL  570

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE+EK+  TSIFQKIA FEDELK+LLPKEVE AR+A E+GNPAIPN+I ECRSYPLYK
Sbjct  571  VNGENEKDSKTSIFQKIATFEDELKSLLPKEVESARAAYESGNPAIPNKINECRSYPLYK  630

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGTE+LTGEK +SPGE  DK+FTA+C G IIDPL+ECL  WNGAPLPIC
Sbjct  631  FVREELGTELLTGEKTRSPGEEFDKLFTAICQGKIIDPLMECLGEWNGAPLPIC  684



>gb|AJO53273.1| phenylalanine ammonia-lyase [Pogostemon cablin]
Length=711

 Score =   306 bits (783),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 143/174 (82%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCS NYPLMQKLRQVLVDHAL
Sbjct  538  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSENYPLMQKLRQVLVDHAL  597

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NG+ EKN STSIFQKI AFE+ELKA+LPKEVEGAR A+E G   I NRI ECRSYPLYK
Sbjct  598  NNGDKEKNASTSIFQKIQAFEEELKAVLPKEVEGARLAVEGGKEVIGNRIKECRSYPLYK  657

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            FIREE+GTE LTGEKV SPGE CDKVF A+ +G ++DPL +CL++WNGAPLPIC
Sbjct  658  FIREEVGTEFLTGEKVTSPGEECDKVFKALTNGLMVDPLFKCLEAWNGAPLPIC  711



>dbj|BAF36968.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=690

 Score =   305 bits (782),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 141/174 (81%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLT GVNGELHPSRFCEKDLL+VVDRE +FAY DDPC A YPLMQKLRQVLVDHAL
Sbjct  517  VAKRTLTTGVNGELHPSRFCEKDLLKVVDRETLFAYIDDPCLATYPLMQKLRQVLVDHAL  576

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE+EK+  TSIFQKIA FEDELK+LLPKEVE AR+A E+GNPAIPN+I ECRSYPLYK
Sbjct  577  VNGENEKDSKTSIFQKIATFEDELKSLLPKEVESARAAYESGNPAIPNKINECRSYPLYK  636

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGTE+LTGEK +SPGE  DK+FTA+C G IIDPL+ECL  WNGAPLPIC
Sbjct  637  FVREELGTELLTGEKTRSPGEEFDKLFTAICQGKIIDPLMECLGEWNGAPLPIC  690



>gb|AAK62030.1| phenylalanine ammonia-lyase 1 [Manihot esculenta]
Length=710

 Score =   306 bits (783),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 139/174 (80%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKR LTMG+NGELHPSRFCEKDLL+VVDREYV+AY DDPCSA YPLMQKLRQVLVDHA+
Sbjct  537  VAKRVLTMGINGELHPSRFCEKDLLKVVDREYVYAYVDDPCSATYPLMQKLRQVLVDHAM  596

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE EKN STSIFQKI AFE+ELK LLPKEVE AR+  ENGNPAI N+I ECRSYPLYK
Sbjct  597  MNGEKEKNSSTSIFQKIGAFEEELKTLLPKEVESARTEYENGNPAISNKIKECRSYPLYK  656

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELG  +LTGEK++SPGE  DKVF+A+C G +IDP+LECLK WNGAPLPIC
Sbjct  657  FVREELGCSLLTGEKIRSPGEEFDKVFSAICAGKLIDPMLECLKEWNGAPLPIC  710



>gb|AEX32790.1| phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   306 bits (783),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 140/174 (80%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAK+TLT G NGELHPSRFCEKDLL+VVDRE+VFAY DDPCSA YPLMQK+RQVLV+HAL
Sbjct  537  VAKKTLTTGANGELHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLMQKVRQVLVEHAL  596

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE+EKN STSIFQKI AFE+ELKA+LPKEVE AR  +E+GNP+IPNRI ECRSYPLYK
Sbjct  597  NNGENEKNGSTSIFQKIVAFEEELKAVLPKEVESARGGVESGNPSIPNRIKECRSYPLYK  656

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGT +LTGEKV+SPGE  DKVFTA+C+G IIDPLL+CL +WNGAPLPIC
Sbjct  657  FVREELGTGLLTGEKVRSPGEDFDKVFTAICEGKIIDPLLDCLSAWNGAPLPIC  710



>gb|KEH24018.1| phenylalanine ammonia-lyase-like protein [Medicago truncatula]
Length=724

 Score =   306 bits (784),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 141/174 (81%), Positives = 156/174 (90%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAK+TLT+GVNGELHPSRFCEKDLL+VVDRE+VFAY DDPCSA YPL QKLRQVLVDHAL
Sbjct  551  VAKKTLTIGVNGELHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLSQKLRQVLVDHAL  610

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE EKN++TSIFQKIA FE+ELK+LLPKEVE AR+A E+GNP IPN+I  CRSYPLYK
Sbjct  611  VNGESEKNLNTSIFQKIATFEEELKSLLPKEVESARTAYESGNPTIPNKINGCRSYPLYK  670

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGT +LTGE V SPGEVCDK+FTA+C G IIDPLLECL  WNGAPLPIC
Sbjct  671  FVREELGTGLLTGENVISPGEVCDKLFTAMCQGKIIDPLLECLGEWNGAPLPIC  724



>sp|P31425.1|PAL1_SOLTU RecName: Full=Phenylalanine ammonia-lyase 1 [Solanum tuberosum]
Length=720

 Score =   306 bits (783),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 138/174 (79%), Positives = 160/174 (92%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLT+G  GELHP+RFCEK+LLRVVDREY+F YADDPCS+ YPLMQKLRQVLVDHA+
Sbjct  547  VAKRTLTIGAIGELHPARFCEKELLRVVDREYLFTYADDPCSSTYPLMQKLRQVLVDHAM  606

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
            +NGE EKN+++SIFQKI AFEDEL A+LPKEVE AR+ LE+GNP+IPNRITECRSYPLY+
Sbjct  607  KNGESEKNINSSIFQKIGAFEDELNAVLPKEVESARALLESGNPSIPNRITECRSYPLYR  666

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
             +R+ELGTE+LTGEKV+SPGE  +KVFTA+C+G I DPLLECLKSWNGAPLPIC
Sbjct  667  LVRQELGTELLTGEKVRSPGEEIEKVFTAMCNGQINDPLLECLKSWNGAPLPIC  720



>ref|XP_004253518.1| PREDICTED: phenylalanine ammonia-lyase-like, partial [Solanum 
lycopersicum]
Length=582

 Score =   302 bits (774),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 139/173 (80%), Positives = 158/173 (91%), Gaps = 0/173 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLTM  NGELHP+RFCEK+LL VVDREY+FAYADDPCS+NYPLMQKLRQVLVD+A+
Sbjct  409  VAKRTLTMDANGELHPARFCEKELLLVVDREYLFAYADDPCSSNYPLMQKLRQVLVDYAM  468

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
            +NGE EKNV++SIFQKI AFEDELK +LP EVE AR  LE G+P IPNRITECRSYPLY+
Sbjct  469  KNGESEKNVNSSIFQKIGAFEDELKVVLPDEVENARVVLEGGSPLIPNRITECRSYPLYR  528

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPI  146
            F+R+ELGTE+LTGE+V+SPGE  DKVFTA+C+G IIDPLLECLKSWNGAPLPI
Sbjct  529  FVRKELGTELLTGERVRSPGEDVDKVFTALCNGQIIDPLLECLKSWNGAPLPI  581



>dbj|BAF36967.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=730

 Score =   306 bits (783),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 142/174 (82%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLT GVNGELHPSRFCEKDLL+VVDRE VFAY DDPC A YPLMQKLRQVLVDHAL
Sbjct  557  VAKRTLTTGVNGELHPSRFCEKDLLKVVDREAVFAYIDDPCLATYPLMQKLRQVLVDHAL  616

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE+EK+  TSIFQKIA FEDELK+LLPKEVE AR+A E+GNP I N+I ECRSYPLYK
Sbjct  617  VNGENEKDSKTSIFQKIATFEDELKSLLPKEVESARAAYESGNPTISNKINECRSYPLYK  676

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGTE+LTGEK +SPGE CDK+FTA+C G IIDPLLECL  WNGAPLPIC
Sbjct  677  FVREELGTELLTGEKSRSPGEECDKLFTAICQGKIIDPLLECLGEWNGAPLPIC  730



>gb|AGF50182.1| phenylalanine ammonia lyase, partial [Salvia officinalis]
Length=282

 Score =   292 bits (748),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 137/174 (79%), Positives = 152/174 (87%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLTMG NGELHPSRFCEKDL+RVVDREYVF+Y DDPC A YPLMQKLRQVLV+HAL
Sbjct  109  VAKRTLTMGANGELHPSRFCEKDLIRVVDREYVFSYIDDPCLATYPLMQKLRQVLVEHAL  168

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
            +NGE EK+VSTSIF KI  FE+EL ALLPKEVE AR ALE+G+PA+PNRI ECRSYPLYK
Sbjct  169  KNGEGEKSVSTSIFHKIEQFEEELMALLPKEVESARIALESGSPAVPNRIAECRSYPLYK  228

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            FIRE+LG   LTGEK  SPGE CD VFTA+ +G I+DPLL+CLK+WNG PLPIC
Sbjct  229  FIREDLGAGFLTGEKAVSPGEECDMVFTALSNGLIVDPLLDCLKAWNGQPLPIC  282



>gb|EYU38541.1| hypothetical protein MIMGU_mgv1a001582mg [Erythranthe guttata]
Length=790

 Score =   307 bits (786),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 141/173 (82%), Positives = 157/173 (91%), Gaps = 0/173 (0%)
 Frame = -3

Query  661  AKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQ  482
            AK+TLTMGVNGELHPSRFCEKDLLRVVDREYVFAY DDPCS  YPLMQKLR+VLVDHAL+
Sbjct  618  AKKTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYIDDPCSGTYPLMQKLREVLVDHALK  677

Query  481  NGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKF  302
            NG+++KN +TSIFQKI AFE+ELKA+LPKEVE ARSA+ENGN A+ NRI ECRSYPLYKF
Sbjct  678  NGDNQKNAATSIFQKIEAFEEELKAVLPKEVESARSAVENGNAAVGNRIKECRSYPLYKF  737

Query  301  IREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            +REELGTE LTGEK+ SPGE CDKVFTA+  G I+DPLLECL+ WNGAPLPIC
Sbjct  738  MREELGTEFLTGEKLTSPGEECDKVFTALSKGLIVDPLLECLEGWNGAPLPIC  790



>gb|AID16077.1| phenylalanine ammonium lyase [Morus alba]
Length=726

 Score =   305 bits (782),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 140/174 (80%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKR LT GVNGELHPSRFCEKDLL+VVDREYV+AY DDPCSA YPLMQ LRQVLV+HAL
Sbjct  553  VAKRVLTTGVNGELHPSRFCEKDLLKVVDREYVYAYIDDPCSATYPLMQTLRQVLVEHAL  612

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE EKN STSIFQKIAAFE+ELKALLPKEVE AR+A ENGN AI N+ITECRSYPLYK
Sbjct  613  TNGESEKNTSTSIFQKIAAFEEELKALLPKEVESARTAYENGNAAISNKITECRSYPLYK  672

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+RE+LGT +LTGEKV+SPGE  DKV+TA+C G +IDP+LECL+ WNG PLPIC
Sbjct  673  FVREQLGTSLLTGEKVRSPGEEFDKVYTAMCQGKLIDPMLECLRGWNGEPLPIC  726



>ref|XP_002268256.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   305 bits (781),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 140/174 (80%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAK+TLT+G NGELHPSRFCEKDLL+VVDRE+VFAY DDPCSA YPLMQK+RQVLV+HAL
Sbjct  537  VAKKTLTIGANGELHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLMQKVRQVLVEHAL  596

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE EKN STSIFQKI AFE+ELKA+LPKEVE AR  +E+GNP+IPNRI ECRSYPLYK
Sbjct  597  NNGESEKNGSTSIFQKIGAFEEELKAVLPKEVESARDGVESGNPSIPNRIKECRSYPLYK  656

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGT +LTGEKV+SPGE  DKVFTA+C+G IIDPLL+CL +WNGAPLPIC
Sbjct  657  FVREELGTGLLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNGAPLPIC  710



>gb|KHN17149.1| Phenylalanine ammonia-lyase 2 [Glycine soja]
Length=619

 Score =   303 bits (775),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 139/174 (80%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKR LT+G+NGELHPSRFCEKDLL++VDREYV+AY DDPCSA YPLMQKLR VLVDHAL
Sbjct  446  VAKRVLTVGINGELHPSRFCEKDLLKIVDREYVYAYIDDPCSATYPLMQKLRLVLVDHAL  505

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
            QNG+ E + STSIFQKI AFE+EL ALLPKEVE AR  +ENGNPAIPNRI ECRSYPLYK
Sbjct  506  QNGDKEASSSTSIFQKIGAFEEELNALLPKEVESARIEVENGNPAIPNRIKECRSYPLYK  565

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+RE LGT +LTGEKV+SPGE  DKVFTA+C+G  IDPLL+CLK WNGAPLPIC
Sbjct  566  FVRENLGTTLLTGEKVKSPGEESDKVFTALCEGKFIDPLLDCLKEWNGAPLPIC  619



>ref|XP_003633987.1| PREDICTED: phenylalanine ammonia-lyase-like [Vitis vinifera]
Length=710

 Score =   305 bits (781),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 140/174 (80%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAK+TLT G NGELHPSRFCEKDLL+VVDRE+VFAY DDPCSA YPLMQK+RQVLV+HAL
Sbjct  537  VAKKTLTTGANGELHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLMQKVRQVLVEHAL  596

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE+EKN STSIFQKI AFE+ELKA+LPKEVE AR  +E+GNP+IPNRI ECRSYPLYK
Sbjct  597  NNGENEKNGSTSIFQKIVAFEEELKAVLPKEVESARGGVESGNPSIPNRIKECRSYPLYK  656

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGT +LTGEKV+SPGE  DKVFTA+C+G IIDPLL+CL +WNGAPLPIC
Sbjct  657  FVREELGTGLLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNGAPLPIC  710



>ref|XP_002268181.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
 ref|XP_010662070.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   305 bits (781),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 140/174 (80%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAK+TLT G NGELHPSRFCEKDLL+VVDRE+VFAY DDPCSA YPLMQK+RQVLV+HAL
Sbjct  537  VAKKTLTTGANGELHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLMQKVRQVLVEHAL  596

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE+EKN STSIFQKI AFE+ELKA+LPKEVE AR  +E+GNP+IPNRI ECRSYPLYK
Sbjct  597  NNGENEKNGSTSIFQKIVAFEEELKAVLPKEVESARGGVESGNPSIPNRIRECRSYPLYK  656

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGT +LTGEKV+SPGE  DKVFTA+C+G IIDPLL+CL +WNGAPLPIC
Sbjct  657  FVREELGTGLLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNGAPLPIC  710



>gb|ABM67591.1| phenylalanin ammonia-lyase [Vitis vinifera]
Length=710

 Score =   305 bits (781),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 140/174 (80%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAK+TLT G NGELHPSRFCEKDLL+VVDRE+VFAY DDPCSA YPLMQK+RQVLV+HAL
Sbjct  537  VAKKTLTTGANGELHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLMQKVRQVLVEHAL  596

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE+EKN STSIFQKI AFE+ELKA+LPKEVE AR  +E+GNP+IPNRI ECRSYPLYK
Sbjct  597  NNGENEKNGSTSIFQKIGAFEEELKAVLPKEVESARDGVESGNPSIPNRIKECRSYPLYK  656

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGT +LTGEKV+SPGE  DKVFTA+C+G IIDPLL+CL +WNGAPLPIC
Sbjct  657  FVREELGTGLLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNGAPLPIC  710



>ref|XP_003633986.1| PREDICTED: phenylalanine ammonia-lyase-like [Vitis vinifera]
Length=710

 Score =   305 bits (780),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 140/174 (80%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAK+TLT G NGELHPSRFCEKDLL+VVDRE+VFAY DDPCSA YPLMQK+RQVLV+HAL
Sbjct  537  VAKKTLTTGANGELHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLMQKVRQVLVEHAL  596

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE+EKN STSIFQKI AFE+ELKA+LPKEVE AR  +E+GNP+IPNRI ECRSYPLYK
Sbjct  597  NNGENEKNGSTSIFQKIGAFEEELKAVLPKEVESARDGVESGNPSIPNRIKECRSYPLYK  656

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGT +LTGEKV+SPGE  DKVFTA+C+G IIDPLL+CL +WNGAPLPIC
Sbjct  657  FVREELGTGLLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNGAPLPIC  710



>emb|CDX74991.1| BnaA05g07370D [Brassica napus]
Length=380

 Score =   295 bits (755),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 135/174 (78%), Positives = 150/174 (86%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAK+ LT GVNGELHPSRFCEKDLL+VVDRE V+ YADDPCSA YPL+QKLRQV+VDHAL
Sbjct  207  VAKKVLTTGVNGELHPSRFCEKDLLKVVDREQVYTYADDPCSATYPLIQKLRQVIVDHAL  266

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE EKN  TSIF KI AFE+ELKA+LP EVE AR A +NG  AIPNRI ECRSYPLY+
Sbjct  267  VNGESEKNAMTSIFHKIGAFEEELKAVLPDEVEAARVAYDNGTSAIPNRIKECRSYPLYR  326

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGTE+LTGEKV SPGE  DKVFTA+C+G IIDPL+ECL  WNGAP+PIC
Sbjct  327  FVREELGTELLTGEKVTSPGEEFDKVFTAICEGKIIDPLMECLSEWNGAPIPIC  380



>gb|KHG26972.1| Phenylalanine ammonia-lyase [Gossypium arboreum]
Length=710

 Score =   305 bits (780),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 140/174 (80%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKR LTMG NGELHPSRFCEKDLLRVVDREY++AYADDPCSANYPL+QKLRQVLVDHAL
Sbjct  537  VAKRVLTMGSNGELHPSRFCEKDLLRVVDREYLYAYADDPCSANYPLIQKLRQVLVDHAL  596

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NG+ EK+ +TSIFQKI  FE+ELK  LPKEVE AR+  ENGNPAIPN+I ECRSYPLYK
Sbjct  597  MNGDREKDSTTSIFQKIGVFEEELKTHLPKEVESARTEFENGNPAIPNKIEECRSYPLYK  656

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+RE LGT +LTGEKV SPGE CDKVFTA+C G +IDPLL+CLK WNGAPLPIC
Sbjct  657  FVREVLGTNLLTGEKVISPGEECDKVFTAMCAGKLIDPLLDCLKDWNGAPLPIC  710



>ref|XP_006354337.1| PREDICTED: phenylalanine ammonia-lyase-like isoform X2 [Solanum 
tuberosum]
Length=719

 Score =   305 bits (781),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 136/174 (78%), Positives = 160/174 (92%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAK+TLT+G NGELHP+RFCEK+LL+VV+REY+F YADDPCS+ YPLMQKLRQVLVDHA+
Sbjct  546  VAKKTLTIGANGELHPARFCEKELLQVVEREYLFTYADDPCSSTYPLMQKLRQVLVDHAM  605

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
            +NG  E NV++SIFQKI AFE+ELKA+LPKEVE AR+ LE+GNP+IPNRITECRSYPLY+
Sbjct  606  KNGVSETNVNSSIFQKIVAFEEELKAVLPKEVESARAMLESGNPSIPNRITECRSYPLYR  665

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
             +R+ELGTE+LTGEK++SPGE  DKVFTA C+G IIDPLLECLKSWNGAPLPIC
Sbjct  666  LVRQELGTEVLTGEKIRSPGEEIDKVFTAFCNGQIIDPLLECLKSWNGAPLPIC  719



>gb|KHN39030.1| Phenylalanine ammonia-lyase class 2 [Glycine soja]
Length=619

 Score =   302 bits (774),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 142/174 (82%), Positives = 152/174 (87%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLT GVNGELHPSRFCEKDLL+VVDREY FAY DDPCS  YPLMQKLRQVLVD+AL
Sbjct  446  VAKRTLTTGVNGELHPSRFCEKDLLKVVDREYTFAYIDDPCSGTYPLMQKLRQVLVDYAL  505

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE+EKN +TSIFQKIA FE+ELK LLPKEVEGAR A EN   AIPN+I ECRSYPLYK
Sbjct  506  ANGENEKNTNTSIFQKIATFEEELKTLLPKEVEGARVAYENDQCAIPNKIKECRSYPLYK  565

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGT +LTGE+V SPGE CDKVFTA+C G IIDPLLECL  WNGAPLPIC
Sbjct  566  FVREELGTALLTGERVISPGEECDKVFTALCQGKIIDPLLECLGEWNGAPLPIC  619



>ref|XP_010662075.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   305 bits (780),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 140/174 (80%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAK+TLT G NGELHPSRFCEKDLL+VVDRE+VFAY DDPCSA YPLMQK+RQVLV+HAL
Sbjct  537  VAKKTLTTGANGELHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLMQKVRQVLVEHAL  596

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE+EKN STSIFQKI AFE+ELKA+LPKEVE AR  +E+GNP+IPNRI ECRSYPLYK
Sbjct  597  NNGENEKNGSTSIFQKILAFEEELKAVLPKEVESARGGVESGNPSIPNRIKECRSYPLYK  656

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGT +LTGEKV+SPGE  DKVFTA+C+G IIDPLL+CL +WNGAPLPIC
Sbjct  657  FVREELGTGLLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNGAPLPIC  710



>ref|NP_001236956.1| phenylalanine ammonia-lyase 2 [Glycine max]
 gb|ACS88364.1| phenylalanine ammonia-lyase 2 [Glycine max]
 gb|ACU30058.1| phenylalanine ammonia-lyase 2 [Glycine max]
Length=717

 Score =   305 bits (780),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 143/174 (82%), Positives = 152/174 (87%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLT GVNGELHPSRFCEKDLL+VVDREY FAY DDPCS  YPLMQKLRQVLVD+AL
Sbjct  544  VAKRTLTTGVNGELHPSRFCEKDLLKVVDREYTFAYIDDPCSGTYPLMQKLRQVLVDYAL  603

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE+EKN STSIFQKIA FE+ELK LLPKEVEGAR A EN   AIPN+I ECRSYPLYK
Sbjct  604  ANGENEKNTSTSIFQKIATFEEELKTLLPKEVEGARVAYENDQCAIPNKIKECRSYPLYK  663

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGT +LTGE+V SPGE CDKVFTA+C G IIDPLLECL  WNGAPLPIC
Sbjct  664  FVREELGTALLTGERVISPGEECDKVFTALCQGKIIDPLLECLGEWNGAPLPIC  717



>ref|XP_003633985.1| PREDICTED: phenylalanine ammonia-lyase-like [Vitis vinifera]
Length=710

 Score =   305 bits (780),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 140/174 (80%), Positives = 157/174 (90%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAK+TLT G NG LHPSRFCEKDLL+VVDRE+VFAY DDPCSA YPLMQKLRQVLV+HAL
Sbjct  537  VAKKTLTTGANGGLHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLMQKLRQVLVEHAL  596

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE+EKN STSIFQKI AFE+ELKA+LPKEVE AR  +E+GNP+IPNRI ECRSYPLYK
Sbjct  597  SNGENEKNGSTSIFQKIVAFEEELKAVLPKEVESARGGVESGNPSIPNRIKECRSYPLYK  656

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGT +LTGEKV+SPGE  DKVFTA+C+G IIDPLL+CL +WNGAPLPIC
Sbjct  657  FVREELGTGLLTGEKVRSPGEEFDKVFTAMCEGKIIDPLLDCLSAWNGAPLPIC  710



>emb|CAL91038.1| phenylalanine ammonia-lyase 4 [Cynara cardunculus var. scolymus]
Length=339

 Score =   293 bits (751),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 137/174 (79%), Positives = 150/174 (86%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAK+ LTMGVNGELHPSRFCEKDLLRVVDREYVFAY DDPCSA YPLMQ+LRQVLVDHAL
Sbjct  166  VAKKVLTMGVNGELHPSRFCEKDLLRVVDREYVFAYIDDPCSATYPLMQRLRQVLVDHAL  225

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE EKN +TSIFQKIA FEDELKA+LPKEVE  R+A E  + +IPNRI  CRSYPLY+
Sbjct  226  NNGETEKNTNTSIFQKIATFEDELKAILPKEVESVRTAYETDSLSIPNRIKACRSYPLYR  285

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELG   LTGEKV SPGE  DKVFTA+C G +IDPLLEC++ WNGAPLPIC
Sbjct  286  FVREELGGGFLTGEKVTSPGEEFDKVFTAMCKGELIDPLLECVEGWNGAPLPIC  339



>gb|ACC63889.1| phenylalanine ammonia-lyase [Populus trichocarpa]
Length=711

 Score =   304 bits (778),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 140/174 (80%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKR LTMG NGELHPSRFCEKDLL+VVDRE+VF+Y DDPCSA YPLMQKLRQVLV+HAL
Sbjct  538  VAKRVLTMGFNGELHPSRFCEKDLLKVVDREHVFSYIDDPCSATYPLMQKLRQVLVEHAL  597

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE E+N +TSIFQKI +FE+ELK LLPKEVE AR  +ENGNPAIPNRI ECRSYPLYK
Sbjct  598  VNGERERNSTTSIFQKIGSFEEELKTLLPKEVESARLEVENGNPAIPNRIKECRSYPLYK  657

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGT +LTGEKV+SPGE  DKVFTA+C G +IDPLLECLK W+GAPLPIC
Sbjct  658  FVREELGTSLLTGEKVKSPGEEFDKVFTAICAGKLIDPLLECLKEWDGAPLPIC  711



>prf||2001451A Phe ammonia lyase
Length=723

 Score =   304 bits (779),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 139/174 (80%), Positives = 153/174 (88%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLT GVNGELHPSRFCEKDLLRVVDRE+VFAY DDPCSA YPLMQKLRQVLVDHAL
Sbjct  550  VAKRTLTTGVNGELHPSRFCEKDLLRVVDREHVFAYIDDPCSATYPLMQKLRQVLVDHAL  609

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE EKN++TSIFQKIA FEDELK LLPKEVE  R+A E+GNP +PN+I  CRSYPLY+
Sbjct  610  VNGESEKNLNTSIFQKIATFEDELKTLLPKEVESTRAAYESGNPTVPNKINGCRSYPLYR  669

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+R+ELGT +LTGEKV SPGE CDK+FTA+C G IIDPLL+CL  WNGAPLPI 
Sbjct  670  FVRQELGTGLLTGEKVISPGEECDKLFTAICQGKIIDPLLQCLGDWNGAPLPIS  723



>sp|Q01861.1|PAL1_PEA RecName: Full=Phenylalanine ammonia-lyase 1 [Pisum sativum]
 dbj|BAA00885.1| phenylalanine ammonia-lyase [Pisum sativum]
 dbj|BAA00886.1| phenylalanine ammonia-lyase [Pisum sativum]
Length=723

 Score =   304 bits (779),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 139/174 (80%), Positives = 153/174 (88%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLT GVNGELHPSRFCEKDLLRVVDRE+VFAY DDPCSA YPLMQKLRQVLVDHAL
Sbjct  550  VAKRTLTTGVNGELHPSRFCEKDLLRVVDREHVFAYIDDPCSATYPLMQKLRQVLVDHAL  609

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE EKN++TSIFQKIA FEDELK LLPKEVE  R+A E+GNP +PN+I  CRSYPLY+
Sbjct  610  VNGESEKNLNTSIFQKIATFEDELKTLLPKEVESTRAAYESGNPTVPNKINGCRSYPLYR  669

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+R+ELGT +LTGEKV SPGE CDK+FTA+C G IIDPLL+CL  WNGAPLPI 
Sbjct  670  FVRQELGTGLLTGEKVISPGEECDKLFTAICQGKIIDPLLQCLGDWNGAPLPIS  723



>gb|AJR20994.1| phenylalanine ammonia-lyase [Populus szechuanica]
Length=711

 Score =   304 bits (778),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 140/174 (80%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKR LTMG NGELHPSRFCEKDLL+VVDRE+VF+Y DDPCSA YPLMQKLRQVLV+HAL
Sbjct  538  VAKRVLTMGFNGELHPSRFCEKDLLKVVDREHVFSYIDDPCSATYPLMQKLRQVLVEHAL  597

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE E+N +TSIFQKI +FE+ELK LLPKEVE AR  +ENGNPAIPNRI ECRSYPLYK
Sbjct  598  VNGERERNSTTSIFQKIGSFEEELKTLLPKEVESARLEVENGNPAIPNRIKECRSYPLYK  657

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGT +LTGEKV+SPGE  DKVFTA+C G +IDPLLECLK W+GAPLPIC
Sbjct  658  FVREELGTSLLTGEKVKSPGEEFDKVFTAICAGKLIDPLLECLKEWDGAPLPIC  711



>gb|ABD73282.1| phenylalanine ammonia-lyase [Salvia miltiorrhiza]
Length=711

 Score =   304 bits (778),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 142/174 (82%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLTMGVNGELHPSRFCEKDL+RVVDREYVFAY DDPCSA YPLMQKLRQVLVDHAL
Sbjct  538  VAKRTLTMGVNGELHPSRFCEKDLIRVVDREYVFAYIDDPCSATYPLMQKLRQVLVDHAL  597

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
            +NG+ EKN STSIFQKI AFE+ELKALLPKEVE AR ALE+G+P + NRI ECRSYPLYK
Sbjct  598  KNGDLEKNASTSIFQKIEAFEEELKALLPKEVESARMALESGSPTVANRIAECRSYPLYK  657

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            FIRE+LG   LTGEK  SPGE C+KVFTA+ +G IIDPLLECL+ WNG PLPIC
Sbjct  658  FIREQLGAGFLTGEKAVSPGEECEKVFTALSNGLIIDPLLECLQGWNGQPLPIC  711



>ref|XP_002267953.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   304 bits (778),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 140/174 (80%), Positives = 157/174 (90%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAK+TLT G NG LHPSRFCEKDLL+VVDRE+VFAY DDPCSA YPLMQKLRQVLV+HAL
Sbjct  537  VAKKTLTTGANGGLHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLMQKLRQVLVEHAL  596

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE+EKN STSIFQKI AFE+ELKA+LPKEVE AR A+E+GNP+ PNRI ECRSYPLYK
Sbjct  597  SNGENEKNGSTSIFQKIVAFEEELKAVLPKEVESARGAVESGNPSTPNRIKECRSYPLYK  656

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGT +LTGEKV+SPGE  DKVFTA+C+G IIDPLL+CL +WNGAPLPIC
Sbjct  657  FVREELGTGLLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNGAPLPIC  710



>emb|CAN61378.1| hypothetical protein VITISV_032212 [Vitis vinifera]
Length=686

 Score =   303 bits (776),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 139/174 (80%), Positives = 157/174 (90%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAK+TLT G NGELHPSRFCEKDLL+VVDRE+VFAY DDPCSA YPLMQ +RQVLV+HAL
Sbjct  513  VAKKTLTTGANGELHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLMQNVRQVLVEHAL  572

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE+EKN STSIFQKI AFE+ELKA+LPKEVE AR  +E+GNP+IPNRI ECRSYPLYK
Sbjct  573  NNGENEKNGSTSIFQKILAFEEELKAVLPKEVESARGGVESGNPSIPNRIKECRSYPLYK  632

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGT +LTGEKV+SPGE  DKVFTA+C+G IIDPLL+CL +WNGAPLPIC
Sbjct  633  FVREELGTGLLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNGAPLPIC  686



>ref|XP_004234632.2| PREDICTED: phenylalanine ammonia-lyase [Solanum lycopersicum]
Length=720

 Score =   304 bits (778),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 139/174 (80%), Positives = 157/174 (90%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLTMG NGELHP+RF EK+LLRVVDREY+FAY DDPCS+NYPLMQKLRQVLVD A+
Sbjct  547  VAKRTLTMGANGELHPARFSEKELLRVVDREYLFAYVDDPCSSNYPLMQKLRQVLVDQAM  606

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
            +NGE EKNV++SIFQKI AFEDEL A+LPKEVE  R+ +E+GNP I NRITECRSYPLY+
Sbjct  607  KNGESEKNVNSSIFQKIGAFEDELIAVLPKEVESVRAVVESGNPLIRNRITECRSYPLYR  666

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
             +REELGTE+LTGEKV+SPGE  DKVFTA+C+G IIDPLLECLK WNGAPLPIC
Sbjct  667  LVREELGTELLTGEKVRSPGEEIDKVFTAMCNGQIIDPLLECLKRWNGAPLPIC  720



>sp|Q42667.1|PALY_CITLI RecName: Full=Phenylalanine ammonia-lyase [Citrus limon]
 gb|AAB67733.1| phenylalanine ammonia-lyase [Citrus limon]
Length=722

 Score =   304 bits (778),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 140/174 (80%), Positives = 156/174 (90%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKR LTMGVNGELHPSRFCEKDL++VVDREYVFAY DDPCSA+ PLMQKLRQVLVDHAL
Sbjct  547  VAKRVLTMGVNGELHPSRFCEKDLIKVVDREYVFAYIDDPCSASSPLMQKLRQVLVDHAL  606

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NG+ EKN +TSIFQKI AFEDELK LLPKEVE AR+ LE+GN AIPNRI ECRSYPLYK
Sbjct  607  DNGDREKNSTTSIFQKIGAFEDELKTLLPKEVEIARTELESGNAAIPNRIKECRSYPLYK  666

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
             +RE++GT +LTGEKV+SPGE  DKVFTA+C+G +IDP+LECLK WNGAPLPIC
Sbjct  667  IVREDIGTSLLTGEKVRSPGEEFDKVFTAMCEGKLIDPMLECLKEWNGAPLPIC  720



>gb|AFQ92048.1| phenylalanine ammonia-lyase, partial [Pyrus pyrifolia]
Length=234

 Score =   289 bits (739),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 134/173 (77%), Positives = 150/173 (87%), Gaps = 0/173 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKR LT+G+NGELHPSRFCEKDLL+VVDREYVFAY DDPCSA YPLMQKLR VLV+HAL
Sbjct  61   VAKRVLTVGLNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLRHVLVEHAL  120

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE E +  TSIFQKI AFE+ELK LLPKEV+ A +  ENG  AIPNRI ECRSYPLYK
Sbjct  121  SNGEKEISTGTSIFQKITAFEEELKTLLPKEVDNAWAEYENGKTAIPNRIKECRSYPLYK  180

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPI  146
            F+REELGT++LTG+KV+SPGE CDKVF A+C G +IDPLL+CLK WNGAPLPI
Sbjct  181  FVREELGTDLLTGDKVRSPGEECDKVFNAMCAGKLIDPLLDCLKEWNGAPLPI  233



>gb|KHN00850.1| Phenylalanine ammonia-lyase 2 [Glycine soja]
Length=619

 Score =   301 bits (771),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 139/174 (80%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKR LT+G+NGELHPSRFCEKDLL++VDREYV+AY DDPCSA YPLMQKLR VLVDHAL
Sbjct  446  VAKRVLTVGINGELHPSRFCEKDLLKIVDREYVYAYIDDPCSATYPLMQKLRLVLVDHAL  505

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
            QNG+ E N STSIFQKI AFE+EL ALLPKEVE AR  +ENGNPAIPNRI ECRSYPLYK
Sbjct  506  QNGDKEVNSSTSIFQKIGAFEEELNALLPKEVESARIEVENGNPAIPNRIKECRSYPLYK  565

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+RE LGT +LTGEKV+SPGE  DKVFTA+C+G +IDPLL+CLK W GAPLPIC
Sbjct  566  FVRENLGTTLLTGEKVKSPGEEFDKVFTALCEGKLIDPLLDCLKEWKGAPLPIC  619



>gb|KDO46246.1| hypothetical protein CISIN_1g004955mg [Citrus sinensis]
Length=722

 Score =   304 bits (778),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 140/174 (80%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKR LTMGVNGELHPSRFCEKDL++VVDREYVFAY DDPCSA+YPLMQKLRQVLVDHAL
Sbjct  547  VAKRVLTMGVNGELHPSRFCEKDLIKVVDREYVFAYIDDPCSASYPLMQKLRQVLVDHAL  606

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NG+ EKN +TSIFQKI AFEDELK LLPKEVE AR+ LE+GN AI NRI ECRSYPLYK
Sbjct  607  DNGDREKNSTTSIFQKIGAFEDELKTLLPKEVEIARTELESGNAAIANRIKECRSYPLYK  666

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
             +REE+GT +LTGEKV+SPGE  DKVF A+C+G +IDP+LECLK WNGAPLPIC
Sbjct  667  IVREEIGTSLLTGEKVRSPGEEFDKVFAAMCEGKLIDPMLECLKEWNGAPLPIC  720



>ref|XP_002268732.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   303 bits (777),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 139/174 (80%), Positives = 157/174 (90%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAK+TLT G NGELHPSRFCEKDLL+VVDRE+VFAY DDPCSA YPLMQK+RQVLV+HAL
Sbjct  537  VAKKTLTTGANGELHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLMQKVRQVLVEHAL  596

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE+EKN STSIFQKI AFE+ELKA+LPKEVE AR  +E+GNP+IPNRI ECRSYPLYK
Sbjct  597  NNGENEKNGSTSIFQKIGAFEEELKAVLPKEVESARDGVESGNPSIPNRIKECRSYPLYK  656

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGT +LTGE V+SPGE  DKVFTA+C+G IIDPLL+CL +WNGAPLPIC
Sbjct  657  FVREELGTGLLTGETVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNGAPLPIC  710



>ref|XP_006436446.1| hypothetical protein CICLE_v10030821mg [Citrus clementina]
 ref|XP_006485648.1| PREDICTED: phenylalanine ammonia-lyase-like [Citrus sinensis]
 gb|ESR49686.1| hypothetical protein CICLE_v10030821mg [Citrus clementina]
Length=722

 Score =   303 bits (777),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 140/174 (80%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKR LTMGVNGELHPSRFCEKDL++VVDREYVFAY DDPCSA+YPLMQKLRQVLVDHAL
Sbjct  547  VAKRVLTMGVNGELHPSRFCEKDLIKVVDREYVFAYIDDPCSASYPLMQKLRQVLVDHAL  606

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NG+ EKN +TSIFQKI AFEDELK LLPKEVE AR+ LE+GN AI NRI ECRSYPLYK
Sbjct  607  DNGDREKNSTTSIFQKIGAFEDELKTLLPKEVEIARTELESGNAAIANRIKECRSYPLYK  666

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
             +REE+GT +LTGEKV+SPGE  DKVF A+C+G +IDP+LECLK WNGAPLPIC
Sbjct  667  IVREEIGTSLLTGEKVRSPGEEFDKVFAAMCEGKLIDPMLECLKEWNGAPLPIC  720



>ref|XP_006439143.1| hypothetical protein CICLE_v10010874mg [Citrus clementina]
 gb|ESR52383.1| hypothetical protein CICLE_v10010874mg [Citrus clementina]
Length=308

 Score =   291 bits (745),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 136/173 (79%), Positives = 148/173 (86%), Gaps = 0/173 (0%)
 Frame = -3

Query  661  AKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQ  482
            AK+ LTMGVNGELHPSRFCEKDLL+VVDREYVF+YADDPCSA YPLM+KLRQVLVDHAL 
Sbjct  136  AKKVLTMGVNGELHPSRFCEKDLLKVVDREYVFSYADDPCSATYPLMRKLRQVLVDHALT  195

Query  481  NGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKF  302
            N E  KN + SIF KI AFE+ELK LLPKEVE ARSA E+GN  IPNRI ECRSYPLY+F
Sbjct  196  NNEDLKNANASIFLKIGAFEEELKTLLPKEVESARSAFESGNLEIPNRIKECRSYPLYRF  255

Query  301  IREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            +REELG   LTGEK  SPGE CDKVFTA+C G IIDPLLECLK W+G+PLPIC
Sbjct  256  VREELGARYLTGEKAISPGEECDKVFTAICQGKIIDPLLECLKEWDGSPLPIC  308



>ref|XP_003542541.1| PREDICTED: phenylalanine ammonia-lyase class 2-like [Glycine 
max]
Length=716

 Score =   303 bits (776),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 142/174 (82%), Positives = 152/174 (87%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLT GVNGELHPSRFCEKDLL+VVDREY FAY DDPCS  YPLMQKLRQVLVD+AL
Sbjct  543  VAKRTLTTGVNGELHPSRFCEKDLLKVVDREYTFAYIDDPCSGTYPLMQKLRQVLVDYAL  602

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE+EKN +TSIFQKIA FE+ELK LLPKEVEGAR A EN   AIPN+I ECRSYPLYK
Sbjct  603  ANGENEKNTNTSIFQKIATFEEELKTLLPKEVEGARVAYENDQCAIPNKIKECRSYPLYK  662

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGT +LTGE+V SPGE CDKVFTA+C G IIDPLLECL  WNGAPLPIC
Sbjct  663  FVREELGTALLTGERVVSPGEECDKVFTAMCQGKIIDPLLECLGEWNGAPLPIC  716



>gb|AAQ74878.1| phenylalanine ammonia lyase [Populus trichocarpa x Populus deltoides]
Length=711

 Score =   303 bits (776),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 140/174 (80%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKR LTMG NGELHPSRFCEKDLL+VVDRE+VF+Y DDPCSA YPLMQKLRQVLV+HAL
Sbjct  538  VAKRVLTMGFNGELHPSRFCEKDLLKVVDREHVFSYIDDPCSATYPLMQKLRQVLVEHAL  597

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE E N +TSIFQKI +FE+ELK LLPKEVE AR  +ENGNPAIPNRI ECRSYPLYK
Sbjct  598  VNGERETNSTTSIFQKIGSFEEELKTLLPKEVESARLEVENGNPAIPNRIKECRSYPLYK  657

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGT +LTGEKV+SPGE  DKVFTA+C G +IDPLLECLK W+GAPLPIC
Sbjct  658  FVREELGTSLLTGEKVKSPGEEFDKVFTAICAGKLIDPLLECLKEWDGAPLPIC  711



>gb|AGA84059.1| phenylalanine ammonia lyase [Picrorhiza kurrooa]
Length=713

 Score =   303 bits (776),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 144/174 (83%), Positives = 153/174 (88%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLTMG NGELHPSRF E DLLRVVDREYVFAY DDPCSA YPLMQKLRQVLVD+AL
Sbjct  540  VAKRTLTMGANGELHPSRFSELDLLRVVDREYVFAYVDDPCSATYPLMQKLRQVLVDNAL  599

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
            +NGE EKN STSIF KI AFE+ELK+LLPKEVE AR ALE GNPAI NRI ECRSYPLYK
Sbjct  600  KNGESEKNASTSIFHKIEAFEEELKSLLPKEVESARIALEAGNPAIGNRIKECRSYPLYK  659

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            FIREELGTE LTGEKV SPGE CDK+FTA+  G I+DPLL+CL+ WNGAPLPIC
Sbjct  660  FIREELGTEYLTGEKVISPGEECDKIFTAISKGLIVDPLLKCLEGWNGAPLPIC  713



>ref|NP_001266106.1| phenylalanine ammonia-lyase 2 [Cicer arietinum]
 sp|Q9SMK9.1|PAL2_CICAR RecName: Full=Phenylalanine ammonia-lyase 2 [Cicer arietinum]
 emb|CAB60719.1| phenylalanine ammonia-lyase [Cicer arietinum]
Length=718

 Score =   303 bits (776),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 138/174 (79%), Positives = 151/174 (87%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKR LT+GVNGELHPSRFCEKDLL VV+REYVFAY DDPCSA YPLMQKLR VLVDHAL
Sbjct  545  VAKRVLTVGVNGELHPSRFCEKDLLNVVEREYVFAYIDDPCSATYPLMQKLRHVLVDHAL  604

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
            +NG+ E N STSIFQKI AFE ELK LLPKEVE  R  +ENGNPA+PNRI ECRSYPLYK
Sbjct  605  ENGDREGNSSTSIFQKIGAFEQELKTLLPKEVESVRVDVENGNPAVPNRIIECRSYPLYK  664

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+RE LGT +LTGEK++SPGE CDKVF A+CDG  IDP+L+CLK WNGAPLPIC
Sbjct  665  FVRENLGTSLLTGEKIRSPGEECDKVFAALCDGRFIDPMLDCLKEWNGAPLPIC  718



>ref|XP_006589419.1| PREDICTED: phenylalanine ammonia-lyase 2-like isoform X1 [Glycine 
max]
 ref|XP_006589420.1| PREDICTED: phenylalanine ammonia-lyase 2-like isoform X2 [Glycine 
max]
Length=717

 Score =   303 bits (775),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 139/174 (80%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKR LT+G+NGELHPSRFCEKDLL++VDREYV+AY DDPCSA YPLMQKLR VLVDHAL
Sbjct  544  VAKRVLTVGINGELHPSRFCEKDLLKIVDREYVYAYIDDPCSATYPLMQKLRLVLVDHAL  603

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
            QNG+ E + STSIFQKI AFE+EL ALLPKEVE AR  +ENGNPAIPNRI ECRSYPLYK
Sbjct  604  QNGDKEASSSTSIFQKIGAFEEELNALLPKEVESARIEVENGNPAIPNRIKECRSYPLYK  663

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+RE LGT +LTGEKV+SPGE  DKVFTA+C+G  IDPLL+CLK WNGAPLPIC
Sbjct  664  FVRENLGTTLLTGEKVKSPGEESDKVFTALCEGKFIDPLLDCLKEWNGAPLPIC  717



>ref|XP_003590471.1| Phenylalanine ammonia-lyase [Medicago truncatula]
 gb|AES60722.1| phenylalanine ammonia-lyase-like protein [Medicago truncatula]
Length=712

 Score =   303 bits (775),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 141/174 (81%), Positives = 152/174 (87%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLT GVNGELHPSRFCEKDLL+VVDREYVFAYADDPC A YPLMQKLRQVLVDHAL
Sbjct  539  VAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYADDPCLATYPLMQKLRQVLVDHAL  598

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             N E EKN +TSIFQKIA FEDELKA+LPKEVE AR+A ENG   I N+I ECRSYPLYK
Sbjct  599  VNTEGEKNSNTSIFQKIATFEDELKAILPKEVESARTAYENGQSGISNKIKECRSYPLYK  658

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGT +LTGEKV SPGE CDK+FTA+C G I+DPL+ECL  WNGAPLPIC
Sbjct  659  FVREELGTALLTGEKVISPGEECDKLFTAMCQGKIVDPLMECLGEWNGAPLPIC  712



>gb|ADO64252.1| PAL [Epimedium sagittatum]
Length=708

 Score =   302 bits (774),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 136/174 (78%), Positives = 157/174 (90%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAK+ LTMGVNGELHPSRFCEKDLL+V+DREY+FAY DDPCSA YPLMQKLRQVLVDHAL
Sbjct  535  VAKKVLTMGVNGELHPSRFCEKDLLKVIDREYIFAYIDDPCSATYPLMQKLRQVLVDHAL  594

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NG++EK+++TSIFQKI+ FE+ELKALLPKEVE  R+A+E+GNP IPNRI ECRSYPLYK
Sbjct  595  LNGQNEKDLNTSIFQKISTFEEELKALLPKEVESMRTAIESGNPLIPNRIKECRSYPLYK  654

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGTE+LTGEKV+SPGE  DKVFTA+C G +IDPLL C+  W G+PLPIC
Sbjct  655  FVREELGTELLTGEKVRSPGEEIDKVFTAICQGKLIDPLLACVSEWYGSPLPIC  708



>sp|P27990.1|PALY_MEDSA RecName: Full=Phenylalanine ammonia-lyase [Medicago sativa]
 emb|CAA41169.1| phenylalanine ammonia-lyase [Medicago sativa]
Length=725

 Score =   303 bits (775),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 140/174 (80%), Positives = 153/174 (88%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAK+TLTMGVNGELHPSRFCEKDLL+VVDRE+VFAY DDPCSA YPL QKLRQVLVDHAL
Sbjct  552  VAKKTLTMGVNGELHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLSQKLRQVLVDHAL  611

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE EKN +TSIFQKIA FE+ELK LLPKEVE AR+A E+GNP IPN+I  CRSYPLYK
Sbjct  612  VNGESEKNFNTSIFQKIATFEEELKTLLPKEVESARTAYESGNPTIPNKINGCRSYPLYK  671

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGT +LTGE V SPGE CDK+F+A+C G IIDPLLECL  WNGAPLPIC
Sbjct  672  FVREELGTGLLTGENVISPGEECDKLFSAMCQGKIIDPLLECLGEWNGAPLPIC  725



>gb|AEE81750.1| phenylalanine ammonia lyase [Morus alba var. multicaulis]
Length=726

 Score =   303 bits (775),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 139/174 (80%), Positives = 153/174 (88%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKR LT GVNGELHPSRFCEKDLL+VVDREYV+AY DDPCSA YPLMQ LRQVLV+HAL
Sbjct  553  VAKRVLTTGVNGELHPSRFCEKDLLKVVDREYVYAYIDDPCSATYPLMQTLRQVLVEHAL  612

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE EKN STSIFQKIAAFE+ELKALLPKEVE AR+A ENGN AI N+ITECRSYPLYK
Sbjct  613  TNGESEKNTSTSIFQKIAAFEEELKALLPKEVESARTAYENGNAAISNKITECRSYPLYK  672

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+RE+LGT +LTGEKV+SPGE  DKV+TA+C G +IDP+L CL  WNG PLPIC
Sbjct  673  FVREQLGTSLLTGEKVRSPGEEFDKVYTAMCQGKLIDPMLACLSGWNGEPLPIC  726



>emb|CAN77065.1| hypothetical protein VITISV_009233 [Vitis vinifera]
Length=707

 Score =   302 bits (774),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 139/174 (80%), Positives = 157/174 (90%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAK+TLT G NGELHPSRFCEK LL+VVDRE+VFAY DDPCSA YPLMQK+RQVLV+HAL
Sbjct  534  VAKKTLTTGANGELHPSRFCEKXLLKVVDREHVFAYIDDPCSATYPLMQKVRQVLVEHAL  593

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE+EKN STSIFQKI AFE+ELKA+LPKEVE AR  +E+GNP+IPNRI ECRSYPLYK
Sbjct  594  NNGENEKNGSTSIFQKIVAFEEELKAVLPKEVESARGGVESGNPSIPNRIRECRSYPLYK  653

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGT +LTGEKV+SPGE  DKVFTA+C+G IIDPLL+CL +WNGAPLPIC
Sbjct  654  FVREELGTGLLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNGAPLPIC  707



>ref|XP_002315308.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
 gb|ACC63891.1| phenylalanine ammonia-lyase [Populus trichocarpa]
 gb|EEF01479.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
Length=711

 Score =   302 bits (774),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 139/174 (80%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKR LTMG NGELHPSRFCEKDLL+VVDRE+VF+Y DDPCSA YPLMQ LRQVLV+HAL
Sbjct  538  VAKRVLTMGFNGELHPSRFCEKDLLKVVDREHVFSYIDDPCSATYPLMQNLRQVLVEHAL  597

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE E+N +TSIFQKI +FE+ELK LLPKEVE AR  +ENGNPAIPNRI ECRSYPLYK
Sbjct  598  VNGERERNSTTSIFQKIGSFEEELKTLLPKEVESARLEVENGNPAIPNRIKECRSYPLYK  657

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGT +LTGEKV+SPGE  DKVFTA+C G +IDPLLECLK W+GAPLPIC
Sbjct  658  FVREELGTSLLTGEKVKSPGEEFDKVFTAICAGKLIDPLLECLKEWDGAPLPIC  711



>gb|KJB36583.1| hypothetical protein B456_006G166000 [Gossypium raimondii]
Length=720

 Score =   302 bits (774),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 138/174 (79%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            +AK+ LT G NGELHPSRFCEKDLL+ VDREYVFAY DDPCSA YPLMQKLRQVLV+HAL
Sbjct  547  IAKKVLTTGANGELHPSRFCEKDLLKAVDREYVFAYIDDPCSATYPLMQKLRQVLVEHAL  606

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE+EKN STSIFQKIAAFE+ELKA+LPKEVE AR+++ENGN AIPN+I ECRS+PLYK
Sbjct  607  TNGENEKNASTSIFQKIAAFEEELKAVLPKEVESARASVENGNAAIPNKIKECRSFPLYK  666

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGT +LTGE V SPGE  DKVFTA+C G IIDP+LECL+ WNGAPLPIC
Sbjct  667  FVREELGTGLLTGENVMSPGEEFDKVFTAMCQGRIIDPMLECLEEWNGAPLPIC  720



>gb|AAF40224.1|AF237955_1 phenylalanine ammonia-lyase 2 [Rubus idaeus]
Length=730

 Score =   302 bits (774),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 138/174 (79%), Positives = 153/174 (88%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            +AKR LT GVNGELHPSRFCEKDLL VV+REY+FAY DDPCSA YPLMQ+LRQVLV+HAL
Sbjct  557  LAKRVLTTGVNGELHPSRFCEKDLLMVVEREYLFAYIDDPCSATYPLMQRLRQVLVEHAL  616

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE+EKN STSIFQKI AFE+ELK +LPKEVE AR+A E+GN AIPNRI ECRSYPLYK
Sbjct  617  TNGENEKNASTSIFQKITAFEEELKTILPKEVESARAAYESGNAAIPNRIVECRSYPLYK  676

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELG E LTGEKV+SPGE CDKVFTA+C G IIDP+L+CL  WNG PLPIC
Sbjct  677  FVREELGGEFLTGEKVRSPGEECDKVFTAMCQGNIIDPILDCLSGWNGEPLPIC  730



>gb|AFZ78653.1| phenylalanine ammonia-lyase [Populus tomentosa]
Length=711

 Score =   302 bits (773),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 139/174 (80%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKR LTMG NGELHPSRFCEKDLL+VVDRE+VF+Y DDPCSA YPLMQ LRQVLV+HAL
Sbjct  538  VAKRVLTMGFNGELHPSRFCEKDLLKVVDREHVFSYIDDPCSATYPLMQNLRQVLVEHAL  597

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE E+N +TSIFQKI +FE+ELK LLPKEVE AR  +ENGNPAIPNRI ECRSYPLYK
Sbjct  598  VNGERERNSTTSIFQKIGSFEEELKTLLPKEVESARLEVENGNPAIPNRIKECRSYPLYK  657

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGT +LTGEKV+SPGE  DKVFTA+C G +IDPLLECLK W+GAPLPIC
Sbjct  658  FVREELGTSLLTGEKVKSPGEEFDKVFTAICAGKLIDPLLECLKEWDGAPLPIC  711



>gb|KDO36715.1| hypothetical protein CISIN_1g016039mg [Citrus sinensis]
Length=396

 Score =   293 bits (749),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 137/174 (79%), Positives = 149/174 (86%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAK+ LTMGVNGELHPSRFCEKDLL+VVDREYVF+YADDPCSA YPLM+KLRQVLVDHAL
Sbjct  223  VAKKVLTMGVNGELHPSRFCEKDLLKVVDREYVFSYADDPCSATYPLMRKLRQVLVDHAL  282

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             N E  KN + SIF KI AFE+ELK LLPKEVE ARSA E+GN  IPNRI ECRSYPLY+
Sbjct  283  TNNEDLKNANASIFLKIGAFEEELKTLLPKEVESARSAFESGNLEIPNRIKECRSYPLYR  342

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELG   LTGEK  SPGE CDKVFTA+C G IIDPLLECLK W+G+PLPIC
Sbjct  343  FVREELGARYLTGEKAISPGEECDKVFTAICQGKIIDPLLECLKEWDGSPLPIC  396



>gb|KJB46526.1| hypothetical protein B456_007G373700 [Gossypium raimondii]
Length=670

 Score =   300 bits (769),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 137/174 (79%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAK+TLT G NGELHPSRFCEKDLL+ VD EYVF+Y DDPCSA YPLMQKLRQVLV+HAL
Sbjct  497  VAKKTLTTGPNGELHPSRFCEKDLLKAVDHEYVFSYIDDPCSATYPLMQKLRQVLVEHAL  556

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NG +E N STSIFQKIAAFE+ELK LLPKEVE +R ++ENGNPAIPN+IT+CRSYPLYK
Sbjct  557  SNGNNENNASTSIFQKIAAFEEELKTLLPKEVENSRVSIENGNPAIPNKITKCRSYPLYK  616

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGT +LTGEKV+SPGE  DKVF A+C G +IDP+LECLK WNGAPLPIC
Sbjct  617  FVREELGTGLLTGEKVKSPGEEFDKVFIAMCQGKVIDPMLECLKEWNGAPLPIC  670



>emb|CDX91331.1| BnaC04g08190D [Brassica napus]
Length=380

 Score =   292 bits (747),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 134/174 (77%), Positives = 149/174 (86%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAK+ LT G NGELHPSRFCEKDLL+VVDRE V+ YADDPCSA YPL+QKLRQV+VDHAL
Sbjct  207  VAKKVLTTGDNGELHPSRFCEKDLLKVVDREQVYTYADDPCSATYPLIQKLRQVIVDHAL  266

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE EKN  TSIF KI AFE+ELKA+LP EVE AR A +NG  AIPNRI ECRSYPLY+
Sbjct  267  VNGESEKNAMTSIFHKIGAFEEELKAVLPDEVEAARVAYDNGTSAIPNRIKECRSYPLYR  326

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGTE+LTGEKV SPGE  DKVFTA+C+G IIDPL+ECL  WNGAP+PIC
Sbjct  327  FVREELGTELLTGEKVTSPGEEFDKVFTAICEGKIIDPLMECLSEWNGAPIPIC  380



>gb|AAN52279.1|AF480619_1 phenylalanine ammonia-lyase [Populus tremuloides]
Length=714

 Score =   301 bits (771),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 140/174 (80%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            V+KR LT G NGELHPSRFCEK+LL+VVDRE VFAYADDPCSA YPLMQKLRQVLVDHAL
Sbjct  541  VSKRVLTTGANGELHPSRFCEKELLKVVDREDVFAYADDPCSATYPLMQKLRQVLVDHAL  600

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE+EKN STS+FQKIAAFEDELKALLPKEVE AR+A ++GN AI N+I ECRSYPLYK
Sbjct  601  ANGENEKNASTSVFQKIAAFEDELKALLPKEVESARAAYDSGNSAIENKIKECRSYPLYK  660

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGT +LTGE V+SPGE  DKVFTA+C+G IIDP+LECL  WNGAPLPIC
Sbjct  661  FVREELGTGLLTGENVRSPGEEFDKVFTAMCEGKIIDPMLECLGEWNGAPLPIC  714



>gb|KJB46525.1| hypothetical protein B456_007G373600 [Gossypium raimondii]
Length=718

 Score =   301 bits (772),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 137/174 (79%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAK+TLT G NGELHPSRFCEKDLL+ VD EYVF+Y DDPCSA YPLMQKLRQVLV+HAL
Sbjct  545  VAKKTLTTGPNGELHPSRFCEKDLLKAVDHEYVFSYIDDPCSATYPLMQKLRQVLVEHAL  604

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NG +E N STSIFQKIAAFE+ELK LLPKEVE +R +++NGNPAIPN+ITECRSYPLYK
Sbjct  605  SNGNNENNASTSIFQKIAAFEEELKTLLPKEVENSRVSIQNGNPAIPNKITECRSYPLYK  664

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGT +LTGEKV+SPGE  DKVF A+C G +IDP+LECLK WNGAPLPIC
Sbjct  665  FVREELGTGLLTGEKVKSPGEEFDKVFIAMCQGKVIDPMLECLKEWNGAPLPIC  718



>gb|KJB62426.1| hypothetical protein B456_009G416300 [Gossypium raimondii]
Length=721

 Score =   301 bits (772),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 139/174 (80%), Positives = 152/174 (87%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            +AK+TLT G NGELHPSRFCEKDLL+ VDREYVFAY DDPCSA YPLMQKLRQVLV+HAL
Sbjct  548  IAKKTLTTGANGELHPSRFCEKDLLKAVDREYVFAYIDDPCSATYPLMQKLRQVLVEHAL  607

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE EKN STSIFQKI  FE+EL+A+LPKEVE AR  LENGN AIPN I +CRSYPLYK
Sbjct  608  TNGESEKNTSTSIFQKITDFEEELQAVLPKEVESARVTLENGNAAIPNMIKDCRSYPLYK  667

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGT +LTGEKV+SPGE  DKVFTA+C G IIDP+LECLK WNGAPLPIC
Sbjct  668  FVREELGTGLLTGEKVKSPGEEFDKVFTAMCQGKIIDPMLECLKEWNGAPLPIC  721



>gb|AJO53274.1| phenylalanine ammonia-lyase [Pogostemon cablin]
Length=715

 Score =   301 bits (771),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 140/174 (80%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            +AKRTLTMGVNGELHPSRFCEKDL+RVVDREYVFAY DDPCSA YPLMQKLRQVLV+HAL
Sbjct  542  LAKRTLTMGVNGELHPSRFCEKDLIRVVDREYVFAYIDDPCSATYPLMQKLRQVLVEHAL  601

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
            +NG+ EK VSTSIFQKI +FE+ELKALLPKEVE AR A+E GN AI NRI ECRSYPLYK
Sbjct  602  KNGDGEKTVSTSIFQKIESFEEELKALLPKEVESARMAVEGGNLAISNRIAECRSYPLYK  661

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            FIREELG+E LTGEK  SPGE C+KVFTA+  G ++DPLL+C+K WNGAPLPIC
Sbjct  662  FIREELGSEFLTGEKTTSPGEECEKVFTALSKGLMVDPLLKCVKGWNGAPLPIC  715



>gb|KHG18863.1| Phenylalanine ammonia-lyase [Gossypium arboreum]
Length=720

 Score =   301 bits (771),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 137/174 (79%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            +AK+ LT G NGELHPSRFCEKDLL+ VDREYVFAY DDPCSA Y +MQKLRQVLV+HAL
Sbjct  547  IAKKVLTTGANGELHPSRFCEKDLLKAVDREYVFAYIDDPCSATYSMMQKLRQVLVEHAL  606

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE+EKN STSIFQKIAAFE+ELKA+LPKEVE AR+++ENGN AIPN+I ECRS+PLYK
Sbjct  607  TNGENEKNASTSIFQKIAAFEEELKAVLPKEVESARASVENGNAAIPNKIKECRSFPLYK  666

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGT +LTGE V SPGE  DKVFTA+C G IIDP+LECLK WNGAPLPIC
Sbjct  667  FVREELGTGLLTGENVMSPGEEFDKVFTAMCQGKIIDPMLECLKEWNGAPLPIC  720



>ref|XP_006290660.1| hypothetical protein CARUB_v10016752mg [Capsella rubella]
 gb|EOA23558.1| hypothetical protein CARUB_v10016752mg [Capsella rubella]
Length=718

 Score =   301 bits (771),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 138/174 (79%), Positives = 153/174 (88%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAK+ LT GVNGELHPSRFCEKDLL+VVDRE VF YADDPCSA YPLMQKLRQV+VDHAL
Sbjct  545  VAKKVLTTGVNGELHPSRFCEKDLLKVVDREQVFTYADDPCSATYPLMQKLRQVIVDHAL  604

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE EKN  TSIFQKI AFE+ELKA+LPKEVE  R+A  +GN AIPNRI ECRSYPLYK
Sbjct  605  SNGETEKNAGTSIFQKIGAFEEELKAVLPKEVEATRAAYGSGNAAIPNRIKECRSYPLYK  664

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGT++LTGEKV SPGE  DKVFTA+C+G IIDPL++CLK WNGAP+PIC
Sbjct  665  FVREELGTKLLTGEKVVSPGEEFDKVFTAMCEGKIIDPLMDCLKEWNGAPIPIC  718



>gb|AFN85669.1| phenylalanine ammonia-lyase [Hibiscus cannabinus]
Length=715

 Score =   301 bits (771),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 139/174 (80%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            + K+TLT G NGELHPSRF EKDLL+VVD EYVFAY DDPCSA YPLMQKLRQVLV+HAL
Sbjct  542  IVKKTLTTGANGELHPSRFSEKDLLKVVDCEYVFAYVDDPCSATYPLMQKLRQVLVEHAL  601

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE+EKN STSIFQKIAAFE+ELK +LPKEVE AR +LENGN AIPNRI +CRSYPLYK
Sbjct  602  TNGENEKNTSTSIFQKIAAFEEELKVVLPKEVESARVSLENGNAAIPNRIKDCRSYPLYK  661

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REE+GT +LTGEKV+SPGE  DKVFTA+C G IIDP+LECLK WNGAPLPIC
Sbjct  662  FVREEIGTGLLTGEKVKSPGEEFDKVFTAICQGKIIDPMLECLKEWNGAPLPIC  715



>gb|AGE10589.1| phenylalanine amononia-lyase [Lonicera japonica]
Length=714

 Score =   301 bits (770),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 140/174 (80%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKR LTMG NGELHPSRFCEKDLLRVVDREYVFAY DDPCSA YPLM+KLRQVLV+HAL
Sbjct  541  VAKRVLTMGANGELHPSRFCEKDLLRVVDREYVFAYIDDPCSATYPLMEKLRQVLVEHAL  600

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
            +N   EKNVSTSIFQKI AFE+ELKALLPKEVE  R+ +E+GN  I NRI +CRSYPLYK
Sbjct  601  KNEVSEKNVSTSIFQKIGAFEEELKALLPKEVESTRALIESGNGGIANRIKDCRSYPLYK  660

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGTE+LTGEKV+SPGE  DKVFTA+C+G IIDPLL+CL SWNG+PLPIC
Sbjct  661  FVREELGTELLTGEKVRSPGEEFDKVFTAMCEGKIIDPLLDCLTSWNGSPLPIC  714



>gb|ABD42947.1| phenylalanine ammonia lyase [Acacia auriculiformis x Acacia mangium]
Length=714

 Score =   301 bits (770),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 138/174 (79%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLT GVNGELH SRFCE+DLL+VVDRE+VF Y DDP SA YPLMQKLRQVLVDHAL
Sbjct  541  VAKRTLTTGVNGELHSSRFCERDLLKVVDREHVFTYIDDPTSATYPLMQKLRQVLVDHAL  600

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
            +NG++EKN STSIFQKIAAFE+ELK LLPKEVE AR+A ENGN ++PN+I ECRSYPLYK
Sbjct  601  ENGDNEKNSSTSIFQKIAAFEEELKTLLPKEVERARTAYENGNSSVPNKIKECRSYPLYK  660

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+RE+LG  +LTGEK +SPGE CDKVFTA+C G IIDPLLECL  WNGAPLPIC
Sbjct  661  FVREDLGAGLLTGEKTRSPGEECDKVFTALCQGKIIDPLLECLGEWNGAPLPIC  714



>dbj|BAA21643.1| phenylalanine ammonia-lyase [Populus sieboldii x Populus grandidentata]
Length=715

 Score =   301 bits (770),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 140/174 (80%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            V+KR LT G NGELHPSRFCEK+LL+VVDRE VFAYADDPCSA YPLMQKLRQVLVDHAL
Sbjct  542  VSKRVLTTGANGELHPSRFCEKELLKVVDREDVFAYADDPCSATYPLMQKLRQVLVDHAL  601

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE+EKN STS+FQKIAAFEDELKALLPKEVE AR+A ++GN AI N+I ECRSYPLYK
Sbjct  602  ANGENEKNASTSVFQKIAAFEDELKALLPKEVESARAAYDSGNSAIENKIKECRSYPLYK  661

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGT +LTGE V+SPGE  DKVFTA+C G IIDP+LECL  WNGAPLPIC
Sbjct  662  FVREELGTGLLTGENVRSPGEEFDKVFTAMCQGKIIDPMLECLGEWNGAPLPIC  715



>ref|XP_010262867.1| PREDICTED: phenylalanine ammonia-lyase [Nelumbo nucifera]
Length=715

 Score =   301 bits (770),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 138/174 (79%), Positives = 157/174 (90%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            +AKR LTMGVNGELHPSRFCEKDLL+VVDREYVFAY DDPCSA YPLMQ LRQVLV HAL
Sbjct  542  LAKRVLTMGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQNLRQVLVQHAL  601

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE+EKN +TSIFQKI AFE+ELKALLPKEVEGAR A E+G+PA+PNRI ECRSYP+YK
Sbjct  602  LNGENEKNSNTSIFQKITAFEEELKALLPKEVEGARIAYESGSPAVPNRIKECRSYPIYK  661

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+RE+L T +LTGEKV+SPGE  DKVF+A+C+G +IDPLL+CL+ WNGAPLPIC
Sbjct  662  FVREQLHTGLLTGEKVRSPGEEFDKVFSAMCEGKMIDPLLDCLRDWNGAPLPIC  715



>gb|AIY26016.1| PAL [Jasminum sambac]
Length=712

 Score =   300 bits (769),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 140/174 (80%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLTMG NGELHPSRF EKDLLRVVDREY+FAY DDPCS  YPLMQKLRQVLV+HAL
Sbjct  539  VAKRTLTMGANGELHPSRFAEKDLLRVVDREYLFAYIDDPCSTTYPLMQKLRQVLVEHAL  598

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             N E+EK+ STSIFQKI AFEDELKA+LPKEVE +R ALE+GNPAIPNRI +CRSYPLYK
Sbjct  599  NNTENEKSGSTSIFQKIEAFEDELKAVLPKEVESSRVALESGNPAIPNRIKDCRSYPLYK  658

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+R+EL TE LTGE+V SPGEV DKVFTA+  G +IDP+LECLK WNGAPLPIC
Sbjct  659  FVRDELKTEFLTGERVTSPGEVLDKVFTAMSKGLMIDPMLECLKGWNGAPLPIC  712



>gb|KEH24019.1| phenylalanine ammonia-lyase-like protein [Medicago truncatula]
Length=724

 Score =   301 bits (770),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 139/174 (80%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAK+TLT+GVNGEL PSR CEKDLL+VVDRE+VFAY DDPCSA YPL QKLRQVLVDHAL
Sbjct  551  VAKKTLTIGVNGELQPSRLCEKDLLKVVDREHVFAYIDDPCSATYPLSQKLRQVLVDHAL  610

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE EKN++TSIFQKIA FE+ELK+LLPKEVE AR+A E+GNP IPN+I  CRSYPLYK
Sbjct  611  VNGESEKNLNTSIFQKIATFEEELKSLLPKEVESARTAYESGNPTIPNKINGCRSYPLYK  670

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGT +LTGE V SPGEVCDK+FTA+C G IIDPLLECL  WNGAPLPIC
Sbjct  671  FVREELGTGLLTGENVISPGEVCDKLFTAMCQGKIIDPLLECLGEWNGAPLPIC  724



>ref|XP_010426963.1| PREDICTED: phenylalanine ammonia-lyase 2-like [Camelina sativa]
Length=718

 Score =   301 bits (770),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 137/174 (79%), Positives = 152/174 (87%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAK+ LT GVNGELHPSRFCEKDLL+VVDRE VF Y DDPCSA YPLMQKLRQV+VDHAL
Sbjct  545  VAKKVLTTGVNGELHPSRFCEKDLLKVVDREQVFTYVDDPCSATYPLMQKLRQVIVDHAL  604

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE EKN  TSIFQKI AFE+ELKA+LPKEVE  R+A  NG  AIPNRITECRSYPLYK
Sbjct  605  SNGETEKNAGTSIFQKIGAFEEELKAVLPKEVEATRAAYGNGTAAIPNRITECRSYPLYK  664

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGT++LTGEKV SPGE  DKVFTA+C+G +IDPL++CLK WNGAP+PIC
Sbjct  665  FVREELGTKLLTGEKVVSPGEEFDKVFTAMCEGKMIDPLMDCLKEWNGAPIPIC  718



>gb|KHG29664.1| Phenylalanine ammonia-lyase [Gossypium arboreum]
Length=721

 Score =   301 bits (770),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 139/174 (80%), Positives = 151/174 (87%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            +AK+TLT G NGELHPSRFCEKDLL+ VDREYVF Y DDPCSA YPLMQKLRQVLV+HAL
Sbjct  548  IAKKTLTTGANGELHPSRFCEKDLLKAVDREYVFVYIDDPCSATYPLMQKLRQVLVEHAL  607

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE EKN STSIFQKIA FE+EL A+LPKEVE AR  LENGN AIPN I +CRSYPLYK
Sbjct  608  TNGESEKNTSTSIFQKIADFEEELHAVLPKEVESARVTLENGNAAIPNMIKDCRSYPLYK  667

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGT +LTGEKV+SPGE  DKVFTA+C G IIDP+LECLK WNGAPLPIC
Sbjct  668  FVREELGTGLLTGEKVKSPGEEFDKVFTAMCQGKIIDPMLECLKEWNGAPLPIC  721



>ref|XP_002519521.1| Phenylalanine ammonia-lyase, putative [Ricinus communis]
 gb|EEF42935.1| Phenylalanine ammonia-lyase, putative [Ricinus communis]
Length=714

 Score =   300 bits (769),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 137/174 (79%), Positives = 152/174 (87%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKR LT G NGELHPSRFCEKDLL+VVDREYVFAYADDPCSA YPLMQKLRQ+LV+HAL
Sbjct  541  VAKRVLTTGANGELHPSRFCEKDLLKVVDREYVFAYADDPCSATYPLMQKLRQILVEHAL  600

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE+EKN  TS+FQKI+AFE+ELK LLPKEVE  R A E+GNPA  NRI ECRSYPLYK
Sbjct  601  ANGENEKNAGTSVFQKISAFEEELKTLLPKEVESVRIAYESGNPATANRIKECRSYPLYK  660

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGT +LTG+KV SPGE  DKVFTA+C G IIDP+++CLK WNGAPLPIC
Sbjct  661  FVREELGTGLLTGDKVMSPGEEFDKVFTAMCQGKIIDPMMDCLKEWNGAPLPIC  714



>sp|P45730.1|PALY_POPTR RecName: Full=Phenylalanine ammonia-lyase [Populus trichocarpa]
 pir||JQ2265 phenylalanine ammonia-lyase (EC 4.3.1.5) - western balsam poplar 
x cottonwood
 gb|AAA33805.1| phenylalanine ammonia lyase [Populus trichocarpa x Populus deltoides]
Length=715

 Score =   300 bits (769),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 138/174 (79%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            V+KR LT G NGELHPSRFCEK+LL+VVDREYVFAY DDPCSA YPLMQKLRQV VDHAL
Sbjct  542  VSKRVLTTGANGELHPSRFCEKELLKVVDREYVFAYVDDPCSATYPLMQKLRQVFVDHAL  601

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
            +NGE+EKN STS+FQKI AFE+ELKALLPKEVE AR+A ++GN AI N+I ECRSYPLYK
Sbjct  602  ENGENEKNFSTSVFQKIEAFEEELKALLPKEVESARAAYDSGNSAIDNKIKECRSYPLYK  661

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGT +LTGEKVQSPGE  DKVFTA+C G IIDP+LECL  WNG+PLPIC
Sbjct  662  FVREELGTVLLTGEKVQSPGEEFDKVFTAMCQGKIIDPMLECLGEWNGSPLPIC  715



>gb|AIL23235.1| phenylalanine ammonia-lyase [Astragalus chrysochlorus]
Length=719

 Score =   300 bits (769),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 142/173 (82%), Positives = 152/173 (88%), Gaps = 0/173 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLTMGVNGELHPSRFCEKDLL+VVDREYVFAY DDPC A YP+MQKLRQVLVDHAL
Sbjct  546  VAKRTLTMGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCLATYPMMQKLRQVLVDHAL  605

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             N E EKN++TSIFQKIA FEDELKALLPKEVE  R+A ENG  AIPN+I ECRSYPLYK
Sbjct  606  ANAEAEKNMNTSIFQKIATFEDELKALLPKEVENTRAAYENGQCAIPNKIKECRSYPLYK  665

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPI  146
            F+R ELGTE+LTGEKV SPGE  DK+FTA+C G IIDPLLECL  WNGAPLPI
Sbjct  666  FVRGELGTELLTGEKVISPGEEFDKLFTAMCQGKIIDPLLECLGEWNGAPLPI  718



>gb|AFU90757.1| phenylalanine ammonia-lyase [Epimedium sagittatum]
Length=716

 Score =   300 bits (769),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 140/174 (80%), Positives = 156/174 (90%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAK+ LTMGVNGELHPSRFCEKDLL+VVDREYV+AY DDPCSA YPLMQKLRQVLV+HAL
Sbjct  543  VAKKVLTMGVNGELHPSRFCEKDLLQVVDREYVYAYIDDPCSAVYPLMQKLRQVLVEHAL  602

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE+EKN STSIFQKI+ FE+ELK LLPKEVE ARSA+E+ N AIPN+I +CRSYPLY+
Sbjct  603  SNGENEKNSSTSIFQKISLFEEELKVLLPKEVESARSAVESDNAAIPNQIKDCRSYPLYR  662

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            FIR ELGT +LTGEKV SPGE  DKVFTA+C+G +IDPLLECLK WNGAPLPIC
Sbjct  663  FIRGELGTALLTGEKVVSPGEEIDKVFTAMCEGKLIDPLLECLKEWNGAPLPIC  716



>gb|AHZ30594.1| phenylalanine ammonia lyase-2, partial [Prunus domestica]
Length=701

 Score =   300 bits (768),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 137/171 (80%), Positives = 154/171 (90%), Gaps = 0/171 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLT GVNGELHPSRFCEKDLL+VVDREYVFAY DDPCSA YPLMQKLRQVLV+HAL
Sbjct  531  VAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLRQVLVEHAL  590

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE+EKN STSIFQKI AFE+ELK LLPKEV+  R+AL++G+  +PNRITECR YPLYK
Sbjct  591  TNGENEKNASTSIFQKIVAFEEELKVLLPKEVDSXRAALDSGSAGVPNRITECRFYPLYK  650

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPL  152
            F+REELG E LTGEKV+SPGE CDKVF+A+C+G IIDP+LECL+ WNGAPL
Sbjct  651  FVREELGAEYLTGEKVRSPGEECDKVFSAICEGKIIDPILECLEGWNGAPL  701



>ref|XP_002322884.2| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
 gb|ACC63887.1| phenylalanine ammonia-lyase [Populus trichocarpa]
 gb|EEF04645.2| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
Length=715

 Score =   300 bits (769),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 138/174 (79%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            V+KR LT G NGELHPSRFCEK+LL+VVDREYVFAY DDPCSA YPLMQKLRQV VDHAL
Sbjct  542  VSKRVLTTGANGELHPSRFCEKELLKVVDREYVFAYVDDPCSATYPLMQKLRQVFVDHAL  601

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
            +NGE+EKN STS+FQKI AFE+ELKALLPKEVE AR+A ++GN AI N+I ECRSYPLYK
Sbjct  602  ENGENEKNFSTSVFQKIEAFEEELKALLPKEVESARAAYDSGNSAIDNKIKECRSYPLYK  661

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGT +LTGEKVQSPGE  DKVFTA+C G IIDP+LECL  WNG+PLPIC
Sbjct  662  FVREELGTVLLTGEKVQSPGEEFDKVFTAMCQGKIIDPMLECLGEWNGSPLPIC  715



>ref|XP_007144370.1| hypothetical protein PHAVU_007G150500g [Phaseolus vulgaris]
 gb|ESW16364.1| hypothetical protein PHAVU_007G150500g [Phaseolus vulgaris]
Length=712

 Score =   300 bits (768),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 140/174 (80%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLT GVNGELHPSRFCEKDLL+VV+REY FAY DDPCS  YPLMQKLRQVLVD+AL
Sbjct  539  VAKRTLTTGVNGELHPSRFCEKDLLKVVEREYTFAYIDDPCSGTYPLMQKLRQVLVDYAL  598

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE+EKN++TSIFQKIA+FE+ELK LLPKEVEGAR A EN   AIPN+I +CRSYPLYK
Sbjct  599  ANGENEKNLNTSIFQKIASFEEELKTLLPKEVEGARLAYENDQCAIPNKIKDCRSYPLYK  658

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGT +LTGEKV SPGE CDKVF+A+C G IIDPLLECL  WNGAPLPIC
Sbjct  659  FVREELGTSLLTGEKVISPGEECDKVFSAMCQGKIIDPLLECLGEWNGAPLPIC  712



>gb|KJB73539.1| hypothetical protein B456_011G238400 [Gossypium raimondii]
Length=710

 Score =   300 bits (768),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 138/174 (79%), Positives = 153/174 (88%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKR LTMG NGELHPSRFCEKDLLRVVDREY++AYADDPCSANYPL+QKLRQVLVDHAL
Sbjct  537  VAKRVLTMGSNGELHPSRFCEKDLLRVVDREYLYAYADDPCSANYPLIQKLRQVLVDHAL  596

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NG+ EK+ +TSIFQKI  FE+ELK  LPKEVE AR+  ENG+PAI N+I ECRSYPLYK
Sbjct  597  MNGDREKDSTTSIFQKIGVFEEELKTQLPKEVESARTEFENGSPAIANKIEECRSYPLYK  656

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+RE LGT +LTGEKV SPGE CDKVFTA+C G +IDPLL+CLK WNGAPLPIC
Sbjct  657  FVREVLGTHLLTGEKVISPGEECDKVFTAMCAGKLIDPLLDCLKDWNGAPLPIC  710



>ref|XP_003556238.1| PREDICTED: phenylalanine ammonia-lyase 2-like [Glycine max]
Length=717

 Score =   300 bits (768),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 138/174 (79%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKR LT+G+NGELHPSRFCEKDLL++VDREYV+AY DDPCSA YPLMQKLR VLVDHAL
Sbjct  544  VAKRVLTVGINGELHPSRFCEKDLLKIVDREYVYAYIDDPCSATYPLMQKLRLVLVDHAL  603

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
            QNG+ E N STSIFQKI AFE+EL ALLPKEVE +R  +ENGNPAIPNRI ECRSYPLYK
Sbjct  604  QNGDKEVNSSTSIFQKIGAFEEELNALLPKEVESSRIEVENGNPAIPNRIKECRSYPLYK  663

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+RE LGT +LTGEKV+SPGE  DKVFTA+C+G +IDPLL+CLK W GAPLPIC
Sbjct  664  FVRENLGTTLLTGEKVKSPGEEFDKVFTALCEGKLIDPLLDCLKEWKGAPLPIC  717



>gb|ACS71953.1| phenylalanine ammonia-lyase [Euphorbia pulcherrima]
Length=721

 Score =   300 bits (768),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 138/174 (79%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKR LT G NGELHPSRFCEK+LL+VVDREYVFAYADDPCS+ YPLMQKLRQV+VDHAL
Sbjct  548  VAKRVLTTGANGELHPSRFCEKELLKVVDREYVFAYADDPCSSTYPLMQKLRQVIVDHAL  607

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NG++EKN +TSIFQKI+AFE ELK LLPKEVE AR+A E+GN  IPNRI ECRSYPLYK
Sbjct  608  LNGDNEKNANTSIFQKISAFEAELKTLLPKEVEAARAAYESGNAPIPNRIMECRSYPLYK  667

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REE GT ILTG+KV+SPGE  DKVFTA+C G IIDPL++CLK WNGAPLPIC
Sbjct  668  FVREEQGTGILTGDKVRSPGEEFDKVFTAMCQGKIIDPLMDCLKEWNGAPLPIC  721



>gb|ACM44926.1| phenylalanine ammonia-lyase [Euphorbia pulcherrima]
Length=721

 Score =   300 bits (768),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 138/174 (79%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKR LT G NGELHPSRFCEK+LL+VVDREYVFAYADDPCS+ YPLMQKLRQV+VDHAL
Sbjct  548  VAKRVLTTGANGELHPSRFCEKELLKVVDREYVFAYADDPCSSTYPLMQKLRQVIVDHAL  607

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NG++EKN +TSIFQKI+AFE ELK LLPKEVE AR+A E+GN  IPNRI ECRSYPLYK
Sbjct  608  LNGDNEKNANTSIFQKISAFEAELKTLLPKEVEAARAAYESGNAPIPNRIMECRSYPLYK  667

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REE GT ILTG+KV+SPGE  DKVFTA+C G IIDPL++CLK WNGAPLPIC
Sbjct  668  FVREEQGTGILTGDKVRSPGEEFDKVFTAMCQGKIIDPLMDCLKEWNGAPLPIC  721



>gb|AAK60275.1|AF383152_1 phenylalanine ammonia-lyase 2 [Manihot esculenta]
Length=712

 Score =   300 bits (768),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 139/174 (80%), Positives = 152/174 (87%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKR LT G +GELHPSRFCEKDLL+VVDRE VF+Y DD CSA YPLMQKLRQVLVDHAL
Sbjct  539  VAKRILTTGASGELHPSRFCEKDLLKVVDREQVFSYVDDACSATYPLMQKLRQVLVDHAL  598

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE EKN STSIFQKI AFE+ELKALLPKEVE AR A ENGNPAI N+I ECRSYPLYK
Sbjct  599  ANGESEKNASTSIFQKIRAFEEELKALLPKEVESAREAYENGNPAIANKIKECRSYPLYK  658

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REE+GT +LTGEK++SPGE  DKVFTA+C G IIDP+L+CLK WNGAPLPIC
Sbjct  659  FVREEIGTGLLTGEKIRSPGEEFDKVFTAMCQGKIIDPMLDCLKEWNGAPLPIC  712



>gb|KDO50672.1| hypothetical protein CISIN_1g037382mg [Citrus sinensis]
Length=555

 Score =   295 bits (756),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 135/174 (78%), Positives = 151/174 (87%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VA++ LT+G NGELHPSRFCEKDLL+  DRE+VFAY DDPCSA YPLMQKLRQVLV+HAL
Sbjct  382  VARKVLTVGANGELHPSRFCEKDLLKAADREHVFAYIDDPCSATYPLMQKLRQVLVEHAL  441

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE+EKN ++SIFQKIAAFE+ELKA+LPKEVE AR  +ENGNP IPNRI ECRSYPLY+
Sbjct  442  NNGENEKNANSSIFQKIAAFEEELKAVLPKEVENARQTVENGNPTIPNRIKECRSYPLYR  501

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
             +REELGT  LTGEKV SPGE  DKVFTA+C G IIDP+LECL  WNGAPLPIC
Sbjct  502  LVREELGTNFLTGEKVTSPGEEFDKVFTAMCQGKIIDPMLECLWEWNGAPLPIC  555



>gb|AGW27206.1| phenylalanine ammonia-lyase 3 [Salvia miltiorrhiza]
Length=760

 Score =   301 bits (770),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 142/174 (82%), Positives = 153/174 (88%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLTMG NGELHPSRFCEKDLLRVVDREYVFAY DDPC A YPLMQKLRQVLVDHAL
Sbjct  587  VAKRTLTMGANGELHPSRFCEKDLLRVVDREYVFAYVDDPCLATYPLMQKLRQVLVDHAL  646

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
            +NG+ EKN STSIFQKI AFE EL+ LLPKEVEGARSALE GNPAI NRI ECRSYPLYK
Sbjct  647  KNGDGEKNPSTSIFQKIEAFEAELEVLLPKEVEGARSALEAGNPAIGNRIKECRSYPLYK  706

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELG E LTGEK  SPGE  +KVFTA+ +G ++DPLL+CL+SWNG PLPIC
Sbjct  707  FVREELGAEFLTGEKATSPGEEGEKVFTALSNGLLVDPLLKCLESWNGEPLPIC  760



>emb|CDY18464.1| BnaA04g21230D [Brassica napus]
Length=423

 Score =   291 bits (746),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 134/174 (77%), Positives = 149/174 (86%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAK+ LT GVNGELHPSRFCEKDLL+VVDRE V+ YADDPCSA YPL+QKLRQV+VDHAL
Sbjct  250  VAKKVLTTGVNGELHPSRFCEKDLLKVVDREQVYTYADDPCSATYPLIQKLRQVIVDHAL  309

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE EKN  TSIF KI AFE+ELKA+LP EVE AR A +NG  AIPNRI ECRSYPLY+
Sbjct  310  VNGESEKNAMTSIFHKIGAFEEELKAVLPDEVEAARVAYDNGTSAIPNRIKECRSYPLYR  369

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGTE+LTGEK  SPGE  DKVFTA+C+G IIDPL+ECL  WNGAP+PIC
Sbjct  370  FVREELGTELLTGEKATSPGEEFDKVFTAICEGKIIDPLMECLDEWNGAPIPIC  423



>ref|XP_010253912.1| PREDICTED: phenylalanine ammonia-lyase [Nelumbo nucifera]
Length=713

 Score =   300 bits (767),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 140/174 (80%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKR LTMGVNGELHPSRFCEKDLL+VVDRE+VFAY DDPCSA YPLMQKLRQVLV+HAL
Sbjct  540  VAKRVLTMGVNGELHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLMQKLRQVLVEHAL  599

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE+EKN +TSIFQKI A E++LK LLPKEVE AR A E+G+PAIPNRI ECRSYPLYK
Sbjct  600  LNGENEKNSNTSIFQKITALEEDLKTLLPKEVEAARIAYESGSPAIPNRIKECRSYPLYK  659

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
             +REEL T +LTGEKV+SPGE  DKVFTA+C G IIDPLL+CLK WNGAPLPIC
Sbjct  660  LVREELQTGLLTGEKVRSPGEEFDKVFTAICQGKIIDPLLDCLKGWNGAPLPIC  713



>gb|AAK15640.1|AF326116_1 phenylalanine ammonia-lyase [Agastache rugosa]
Length=716

 Score =   300 bits (767),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 141/174 (81%), Positives = 153/174 (88%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLTMGVNGELHPSRFCEK+L+RVVDREYVF Y DDPC A YPLMQKLRQVLVDHAL
Sbjct  543  VAKRTLTMGVNGELHPSRFCEKELIRVVDREYVFTYIDDPCLATYPLMQKLRQVLVDHAL  602

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
            +NGE EKNVSTSIF KI AFE+ELKALLPKEVE AR ALE+G+PA+ NRI ECRS+PLYK
Sbjct  603  KNGESEKNVSTSIFHKIEAFEEELKALLPKEVESARIALESGSPAVANRIEECRSFPLYK  662

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            FIREELGT  LTGEK  SPGE C+KVF A+ +G IIDPLLECL+ WNG PLPIC
Sbjct  663  FIREELGTGFLTGEKAVSPGEECEKVFAALSNGLIIDPLLECLQGWNGEPLPIC  716



>ref|XP_011048535.1| PREDICTED: phenylalanine ammonia-lyase-like [Populus euphratica]
Length=714

 Score =   300 bits (767),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 139/174 (80%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            V+KR LT G NGELHPSRFCEK+LL+VVDRE VFAYADDPCSANYPLM+KLRQVLVDHAL
Sbjct  541  VSKRILTTGANGELHPSRFCEKELLKVVDREDVFAYADDPCSANYPLMKKLRQVLVDHAL  600

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE+EKN STS+FQKI AFE+ELKALLPKEVE AR+A ++GN AI N+I ECRSYPLYK
Sbjct  601  ANGENEKNASTSVFQKIGAFEEELKALLPKEVESARAAYDSGNSAIENKIKECRSYPLYK  660

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGT +LTGEKV+SPGE  DKVFTA+C G IIDP+LECL  WNGAPLPIC
Sbjct  661  FVREELGTGLLTGEKVRSPGEEFDKVFTAMCQGKIIDPMLECLGEWNGAPLPIC  714



>gb|ADR78835.1| phenylalanine ammonia lyase [Ziziphus jujuba]
Length=559

 Score =   295 bits (756),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 136/174 (78%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKR LT+G NGELHPSRFCEK+LL+VVDREYVFAY DDPCSA YPLMQKLRQV+V+HAL
Sbjct  386  VAKRVLTLGSNGELHPSRFCEKELLQVVDREYVFAYIDDPCSATYPLMQKLRQVIVEHAL  445

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
            +NGE+E+N STSIFQKIAAFE+ELK LLPKEVE AR+  ENGNPAIPN+I E RSYPLYK
Sbjct  446  KNGENERNASTSIFQKIAAFEEELKTLLPKEVESARAEYENGNPAIPNKIKERRSYPLYK  505

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELG  +LTGEK +SPGE CDKVF+A+  G +IDP+LECLK WNGAPLPI 
Sbjct  506  FVREELGAGLLTGEKARSPGEECDKVFSAIYAGKLIDPMLECLKEWNGAPLPIS  559



>gb|AFZ78650.1| phenylalanine ammonia-lyase [Populus tomentosa]
Length=714

 Score =   300 bits (767),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 139/174 (80%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            V+KR LT G NGELHPSRFCEK+LL+VVDRE VFAYADDPCSA YPLMQKLRQV VDHAL
Sbjct  541  VSKRVLTTGANGELHPSRFCEKELLKVVDREDVFAYADDPCSATYPLMQKLRQVFVDHAL  600

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
            +NGE+EKN STS+FQKI AFE+ELKALLPKEVE AR+A ++GN AI N+I ECRSYPLYK
Sbjct  601  ENGENEKNFSTSVFQKIEAFEEELKALLPKEVESARAAYDSGNSAIDNKIKECRSYPLYK  660

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGT +LTGEKVQSPGE  DKVFTA+C G IIDP+LECL  WNGAPLPIC
Sbjct  661  FVREELGTVLLTGEKVQSPGEEFDKVFTAMCQGKIIDPMLECLGEWNGAPLPIC  714



>ref|XP_007027354.1| PHE ammonia lyase 1 [Theobroma cacao]
 gb|EOY07856.1| PHE ammonia lyase 1 [Theobroma cacao]
Length=722

 Score =   300 bits (767),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 138/174 (79%), Positives = 152/174 (87%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            +AK+ LT G NGELHPSRF EKDLL+ VD EYVFAY DDPCSA YPLMQKLRQVLV+HAL
Sbjct  549  IAKKILTTGANGELHPSRFSEKDLLKAVDSEYVFAYIDDPCSATYPLMQKLRQVLVEHAL  608

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE+EKN STSIFQK+AAFE+ELKA+LPKEVE AR +LENGN  IPNRI ECRSYPLYK
Sbjct  609  ANGENEKNASTSIFQKVAAFEEELKAILPKEVESARLSLENGNAGIPNRIQECRSYPLYK  668

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGT +LTGE V+SPGE  DKVFTA+C G IIDP+LECLK WNGAPLPIC
Sbjct  669  FVREELGTGLLTGENVKSPGEEFDKVFTAMCQGKIIDPMLECLKEWNGAPLPIC  722



>ref|XP_010515816.1| PREDICTED: phenylalanine ammonia-lyase 2 [Camelina sativa]
Length=718

 Score =   300 bits (767),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 136/174 (78%), Positives = 152/174 (87%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAK+ LT GVNGELHPSRFCEKDLL+VVDRE VF Y DDPCSA YPLMQKLRQV+VDHAL
Sbjct  545  VAKKVLTTGVNGELHPSRFCEKDLLKVVDREQVFTYVDDPCSATYPLMQKLRQVIVDHAL  604

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE EKN  TSIFQKI AFE+ELKA+LPKEVE  R+A  NG  AIPNRITECRSYPLY+
Sbjct  605  SNGETEKNAGTSIFQKIGAFEEELKAVLPKEVEATRAAYGNGTAAIPNRITECRSYPLYR  664

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGT++LTGEKV SPGE  DKVFTA+C+G +IDPL++CLK WNGAP+PIC
Sbjct  665  FVREELGTKLLTGEKVVSPGEEFDKVFTAMCEGKLIDPLMDCLKEWNGAPIPIC  718



>ref|XP_004497516.1| PREDICTED: phenylalanine ammonia-lyase-like [Cicer arietinum]
Length=715

 Score =   299 bits (766),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 140/174 (80%), Positives = 152/174 (87%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLT GVNGELHPSRFCEKDLL+VVDREYVFAY DDPC + YPLMQKLRQVLVDHAL
Sbjct  542  VAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYVDDPCLSTYPLMQKLRQVLVDHAL  601

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             N + EKN++TSIFQKIA FEDELK LLPKEVE AR A ENG   IPN+I ECRSYPLYK
Sbjct  602  VNVDGEKNLNTSIFQKIATFEDELKTLLPKEVESARIAYENGQCGIPNKIKECRSYPLYK  661

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGTE+LTGEKV SPGE CDK+FTA+C G I+DPLLECL  WNG+PLPIC
Sbjct  662  FVREELGTELLTGEKVISPGEECDKLFTAMCQGKIVDPLLECLGEWNGSPLPIC  715



>ref|XP_006381441.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
 gb|ACC63888.1| phenylalanine ammonia-lyase [Populus trichocarpa]
 gb|ERP59238.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
Length=714

 Score =   299 bits (766),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 139/174 (80%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            V+KR LT G NGELHPSRFCEK+LL+VVDRE VFAYADDPCSA YPLMQKLRQVLVDHAL
Sbjct  541  VSKRVLTTGANGELHPSRFCEKELLKVVDREDVFAYADDPCSATYPLMQKLRQVLVDHAL  600

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE+EKN STS+FQKI AFE+ELKALLPKEVE AR+A ++GN AI N+I ECRSYPLYK
Sbjct  601  ANGENEKNTSTSVFQKITAFEEELKALLPKEVESARAAYDSGNSAIENKIKECRSYPLYK  660

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGT +LTGEKV+SPGE  DKVFTA+C G IIDP+LECL  WNGAPLPIC
Sbjct  661  FVREELGTGLLTGEKVRSPGEEFDKVFTAMCQGKIIDPMLECLGEWNGAPLPIC  714



>sp|O49835.1|PAL1_LITER RecName: Full=Phenylalanine ammonia-lyase 1; Short=PAL-1 [Lithospermum 
erythrorhizon]
 dbj|BAA24928.1| phenylalanine ammonia-lyase [Lithospermum erythrorhizon]
Length=710

 Score =   299 bits (766),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 138/174 (79%), Positives = 156/174 (90%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLT GVNGELHPSRF EKDLLRVVDREYVFAYADDPC   YPLMQKLR+ LV HAL
Sbjct  537  VAKRTLTTGVNGELHPSRFSEKDLLRVVDREYVFAYADDPCLTTYPLMQKLRETLVGHAL  596

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE+EK+V+TSIF KIA FE+ELKA+LPKEVE AR+++ENG PAI NRI ECRSYPLYK
Sbjct  597  DNGENEKDVNTSIFHKIAIFEEELKAILPKEVENARASVENGIPAISNRIEECRSYPLYK  656

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGTE+LTGEKV+SPGE  DKVFTA+C+G ++DPLL CL++WNGAPLPIC
Sbjct  657  FVREELGTELLTGEKVRSPGEELDKVFTAMCEGKLVDPLLACLEAWNGAPLPIC  710



>sp|Q40910.1|PAL4_POPKI RecName: Full=Phenylalanine ammonia-lyase G4, partial [Populus 
sieboldii x Populus grandidentata]
 dbj|BAA07861.1| phenylalanine ammonia-lyase [Populus sieboldii x Populus grandidentata]
Length=571

 Score =   295 bits (756),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 140/174 (80%), Positives = 149/174 (86%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKR LTMG NGELHPSRFCEKDLL+VVDREYVF Y DDPCSA YPLMQKLRQVLVDHAL
Sbjct  398  VAKRVLTMGFNGELHPSRFCEKDLLKVVDREYVFTYIDDPCSATYPLMQKLRQVLVDHAL  457

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE E+N STSIFQKI AFE+ELK LLPKEVE AR  LENGNPAIPNRIT+ RSYPLYK
Sbjct  458  MNGEKEQNSSTSIFQKIGAFEEELKILLPKEVESARLELENGNPAIPNRITDRRSYPLYK  517

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGT +LTGEKV SPGE  DKVFTA+C G +IDP    LK WNGAPLP+C
Sbjct  518  FVREELGTVLLTGEKVGSPGEEFDKVFTAICAGKLIDPCWSVLKEWNGAPLPLC  571



>pir||S60043 phenylalanine ammonia-lyase (EC 4.3.1.5) 4 - Japanese aspen x 
large-toothed aspen (fragment)
Length=582

 Score =   296 bits (757),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 140/174 (80%), Positives = 149/174 (86%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKR LTMG NGELHPSRFCEKDLL+VVDREYVF Y DDPCSA YPLMQKLRQVLVDHAL
Sbjct  409  VAKRVLTMGFNGELHPSRFCEKDLLKVVDREYVFTYIDDPCSATYPLMQKLRQVLVDHAL  468

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE E+N STSIFQKI AFE+ELK LLPKEVE AR  LENGNPAIPNRIT+ RSYPLYK
Sbjct  469  MNGEKEQNSSTSIFQKIGAFEEELKILLPKEVESARLELENGNPAIPNRITDRRSYPLYK  528

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGT +LTGEKV SPGE  DKVFTA+C G +IDP    LK WNGAPLP+C
Sbjct  529  FVREELGTVLLTGEKVGSPGEEFDKVFTAICAGKLIDPCWSVLKEWNGAPLPLC  582



>ref|XP_004304440.1| PREDICTED: phenylalanine ammonia-lyase 1 [Fragaria vesca subsp. 
vesca]
Length=724

 Score =   299 bits (766),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 137/174 (79%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            +AKR LT GVNGELHPSRFCEKDLL VV+REY+FAY DDPCSA YPLMQ+LRQVLV+HAL
Sbjct  551  LAKRLLTTGVNGELHPSRFCEKDLLMVVEREYLFAYIDDPCSATYPLMQRLRQVLVEHAL  610

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE+EKN +TSIFQKI+AFE+ELK +LPKEVE AR+A E+GN AIPNRI ECRSYPLYK
Sbjct  611  TNGENEKNANTSIFQKISAFEEELKTILPKEVESARAACESGNAAIPNRIIECRSYPLYK  670

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELG E LTGEKV+SPGE CDKVFTA+C G IIDP+L+CL  WNG PLPIC
Sbjct  671  FVREELGGEFLTGEKVRSPGEECDKVFTAMCQGKIIDPILDCLSGWNGEPLPIC  724



>gb|ADN32768.1| phenylalanine ammonia-lyase 2 [Scutellaria baicalensis]
Length=708

 Score =   299 bits (765),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 140/174 (80%), Positives = 153/174 (88%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLTMG NGELHPSRFCEKDL+RVVDREYVFAY DDPCS  YPLMQKLRQVLVDHAL
Sbjct  535  VAKRTLTMGPNGELHPSRFCEKDLIRVVDREYVFAYVDDPCSGTYPLMQKLRQVLVDHAL  594

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
            +NGE EKN S+SIFQKI AFE+ELK+LLPKEVE AR ALE+GNP I NRI ECRSYPLY+
Sbjct  595  KNGEAEKNPSSSIFQKIEAFEEELKSLLPKEVESARVALESGNPTIANRIRECRSYPLYR  654

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGT +LTGEKV SPGE  DKVF A+  G I+DPLLECL++WNG PLPIC
Sbjct  655  FVREELGTGLLTGEKVISPGEESDKVFVALSKGLIVDPLLECLQTWNGQPLPIC  708



>gb|ACE95170.1| phenylalanine ammonia-lyase [Populus tomentosa]
Length=714

 Score =   299 bits (765),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 139/174 (80%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            V+KR LT G NGELHPSRFCEK+LL+VVDRE VFAYADDPCSA YPLMQKLRQVLVDHAL
Sbjct  541  VSKRVLTTGANGELHPSRFCEKELLKVVDREDVFAYADDPCSATYPLMQKLRQVLVDHAL  600

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE+EKN STS+FQKIA FE+ELKALLPKEVE AR+A ++GN AI N+I ECRSYPLYK
Sbjct  601  ANGENEKNASTSVFQKIATFEEELKALLPKEVESARAAYDSGNSAIENKIKECRSYPLYK  660

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGT +LTGEKV+SPGE  DKVFTA+C G IIDP+LECL  WNGAPLPIC
Sbjct  661  FVREELGTGLLTGEKVRSPGEEFDKVFTAMCQGKIIDPMLECLGEWNGAPLPIC  714



>ref|XP_006403711.1| hypothetical protein EUTSA_v10010153mg [Eutrema salsugineum]
 dbj|BAJ33750.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ45164.1| hypothetical protein EUTSA_v10010153mg [Eutrema salsugineum]
Length=725

 Score =   299 bits (766),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 138/174 (79%), Positives = 152/174 (87%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAK+ LT GVNGELHPSRFCEKDLL+VVDRE VF Y DDPCSA YPLMQKLRQV+VDHAL
Sbjct  552  VAKKVLTTGVNGELHPSRFCEKDLLKVVDREQVFTYVDDPCSATYPLMQKLRQVIVDHAL  611

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE EKNV+TSIFQKI AFE+ELKA LPKEVE  R+A  NG  AIPNRI ECRSYPLYK
Sbjct  612  CNGETEKNVATSIFQKIGAFEEELKATLPKEVEATRAAFGNGTAAIPNRIKECRSYPLYK  671

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGT++LTGEKV SPGE  DKVFTA+C+G IIDPL++CLK WNGAP+PIC
Sbjct  672  FVREELGTKLLTGEKVVSPGEEFDKVFTAMCEGKIIDPLMDCLKEWNGAPIPIC  725



>ref|XP_006481493.1| PREDICTED: phenylalanine ammonia-lyase-like [Citrus sinensis]
Length=721

 Score =   299 bits (766),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 135/174 (78%), Positives = 152/174 (87%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VA++ LT+G NGELHPSRFCEKDLL+  DRE+VFAY DDPCSA YPLMQKLRQVLV+HAL
Sbjct  548  VARKVLTVGANGELHPSRFCEKDLLKAADREHVFAYIDDPCSATYPLMQKLRQVLVEHAL  607

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE+EKN ++SIFQKIAAFE+ELKA+LPKEVE AR  +ENGNP IPNRI ECRSYPLY+
Sbjct  608  NNGENEKNANSSIFQKIAAFEEELKAVLPKEVENARQTVENGNPTIPNRIKECRSYPLYR  667

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
             +REELGT  LTGEKV SPGE  DKVFTA+C G IIDP+LECL+ WNGAPLPIC
Sbjct  668  LVREELGTNFLTGEKVTSPGEKFDKVFTAMCQGKIIDPMLECLREWNGAPLPIC  721



>emb|CAB42793.1| phenylalanine-ammonia lyase [Citrus clementina x Citrus reticulata]
Length=721

 Score =   299 bits (765),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 135/174 (78%), Positives = 152/174 (87%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VA++ LT+G NGELHPSRFCEKDLL+  DRE+VFAY DDPCSA YPLMQKLRQVLV+HAL
Sbjct  548  VARKVLTVGANGELHPSRFCEKDLLKAADREHVFAYIDDPCSATYPLMQKLRQVLVEHAL  607

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE+EKN ++SIFQKIAAFE+ELKA+LPKEVE AR  +ENGNP IPNRI ECRSYPLY+
Sbjct  608  NNGENEKNANSSIFQKIAAFEEELKAVLPKEVENARQTVENGNPTIPNRIKECRSYPLYR  667

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
             +REELGT  LTGEKV SPGE  DKVFTA+C G IIDP+LECL+ WNGAPLPIC
Sbjct  668  LVREELGTNFLTGEKVTSPGEKFDKVFTAMCQGKIIDPMLECLREWNGAPLPIC  721



>ref|XP_010107516.1| Phenylalanine ammonia-lyase 1 [Morus notabilis]
 gb|EXC16198.1| Phenylalanine ammonia-lyase 1 [Morus notabilis]
Length=534

 Score =   294 bits (752),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 136/174 (78%), Positives = 150/174 (86%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            V KR LT GVNGEL+PSRFCEKDLL+VVDREYV+ Y DDPCSA YPLMQ LRQVLV+HAL
Sbjct  361  VVKRVLTTGVNGELNPSRFCEKDLLKVVDREYVYTYIDDPCSATYPLMQTLRQVLVEHAL  420

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE EKN STSIFQKIAAFE+ELK+ LPKEVE AR A ENGN AI N+ITECRSYPLYK
Sbjct  421  TNGESEKNTSTSIFQKIAAFEEELKSFLPKEVESARIAYENGNAAISNKITECRSYPLYK  480

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGT +LTGEKV+SPGE  DKV+TA+C G +IDP+LECL  WNG PLPIC
Sbjct  481  FVREELGTSLLTGEKVRSPGEEFDKVYTAMCQGKLIDPMLECLSGWNGEPLPIC  534



>ref|XP_002315309.2| hypothetical protein POPTR_0010s23110g [Populus trichocarpa]
 gb|EEF01480.2| hypothetical protein POPTR_0010s23110g [Populus trichocarpa]
Length=707

 Score =   298 bits (764),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 137/174 (79%), Positives = 153/174 (88%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKR L MG NGELHPSRFCEKDLL+VVDRE+VF+Y DDPCSA YPLMQKLRQVLV+HAL
Sbjct  534  VAKRVLAMGFNGELHPSRFCEKDLLKVVDREHVFSYIDDPCSATYPLMQKLRQVLVEHAL  593

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE E+N +T+I QKI +FE+ELK LLPKEVE AR  +ENGNPAIPNRI ECRSYPLYK
Sbjct  594  VNGERERNSTTTILQKIGSFEEELKTLLPKEVESARLEVENGNPAIPNRIKECRSYPLYK  653

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGT +LTGEKV+SPGE  DKVFTA+C G +IDPLLECLK W+GAPLPIC
Sbjct  654  FVREELGTSLLTGEKVKSPGEEFDKVFTAICAGKLIDPLLECLKEWDGAPLPIC  707



>ref|XP_006293761.1| hypothetical protein CARUB_v10022721mg [Capsella rubella]
 gb|EOA26659.1| hypothetical protein CARUB_v10022721mg [Capsella rubella]
Length=726

 Score =   299 bits (765),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 136/174 (78%), Positives = 152/174 (87%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAK+ LT GVNGELHPSRFCEKDLL+VVDRE V+ YADDPCSA YPL+QKLRQV+VDHAL
Sbjct  553  VAKKVLTTGVNGELHPSRFCEKDLLKVVDREQVYTYADDPCSATYPLIQKLRQVIVDHAL  612

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE EKN  TSIF KI AFE+ELKA+LPKEVE AR+A +NG  AIPNRI ECRSYPLY+
Sbjct  613  INGESEKNAVTSIFHKIGAFEEELKAVLPKEVEAARAAYDNGTSAIPNRIKECRSYPLYR  672

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGTE+LTGEKV SPGE  DKVFTA+C+G IIDP++ECL  WNGAPLPIC
Sbjct  673  FVREELGTELLTGEKVTSPGEEFDKVFTAICEGKIIDPMMECLNEWNGAPLPIC  726



>gb|AEW43005.1| phenylalanine ammonia lyase, partial [Leucaena leucocephala]
Length=365

 Score =   288 bits (738),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 136/174 (78%), Positives = 150/174 (86%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAK+ LTMGVNGEL PSRFCEKDLL VVDRE+VF Y DDPCSA YPLMQKLRQVLVDHAL
Sbjct  192  VAKKVLTMGVNGELLPSRFCEKDLLTVVDREHVFDYIDDPCSATYPLMQKLRQVLVDHAL  251

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
            QNG  E + +TSIF KIAAFE ELK LLPKEVE AR  +ENG  AIPNRI ECRSYPLY+
Sbjct  252  QNGNRENDANTSIFLKIAAFEKELKTLLPKEVESARIEVENGKSAIPNRIKECRSYPLYR  311

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGT +LTGEKV+SPGE  DKVFTA+C+G +IDPLL+CLK WNGAPLP+C
Sbjct  312  FVREELGTGLLTGEKVRSPGEEFDKVFTAMCEGKLIDPLLDCLKGWNGAPLPLC  365



>gb|ABR14606.1| phenylalanine ammonia-lyase [Salvia miltiorrhiza]
Length=711

 Score =   298 bits (764),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 140/174 (80%), Positives = 152/174 (87%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLTMGVNGELHPSRFCEKDL+RVVDREYVFAY DDP SA YPLMQKLRQVLVDHAL
Sbjct  538  VAKRTLTMGVNGELHPSRFCEKDLIRVVDREYVFAYIDDPSSATYPLMQKLRQVLVDHAL  597

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
            +NG+ EKN STSIFQKI AFE+ELKALLPKEV  AR ALE+G+P + NRI ECRSYPLYK
Sbjct  598  KNGDLEKNASTSIFQKIEAFEEELKALLPKEVGSARMALESGSPTVANRIAECRSYPLYK  657

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            FIRE+LG   LTGEK  SPGE C+KVFTA+ +G IIDPLLECL+ WNG PLPIC
Sbjct  658  FIREQLGAGFLTGEKAVSPGEECEKVFTALSNGLIIDPLLECLQGWNGQPLPIC  711



>sp|P45731.1|PAL1_POPKI RecName: Full=Phenylalanine ammonia-lyase G1 [Populus sieboldii 
x Populus grandidentata]
 dbj|BAA06337.1| phenylalanine ammonia-lyase [Populus sieboldii x Populus grandidentata]
Length=682

 Score =   298 bits (762),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 136/174 (78%), Positives = 152/174 (87%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKR LTMG NGELHPSR CEKDLL++VD+E+VFAY DDPCSA YPLMQKLRQVLV+HAL
Sbjct  509  VAKRVLTMGFNGELHPSRLCEKDLLKLVDKEHVFAYIDDPCSATYPLMQKLRQVLVEHAL  568

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE E N +TSIFQKI +FE+ELK LLPKEVE AR  +ENGNP +PNRI ECRSYPLYK
Sbjct  569  VNGERETNSTTSIFQKIRSFEEELKTLLPKEVESARLEVENGNPVVPNRIKECRSYPLYK  628

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGT +LTGEKV+SPGE  DKVFTA+C G ++DPLLECLK WNGAPLPIC
Sbjct  629  FVREELGTSLLTGEKVKSPGEDFDKVFTAICAGKLMDPLLECLKEWNGAPLPIC  682



>gb|AAC18870.1| phenylalanine ammonia lyase [Arabidopsis thaliana]
Length=725

 Score =   298 bits (764),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 135/174 (78%), Positives = 152/174 (87%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAK+ LT GVNGELHPSRFCEKDLL+VVDRE V+ YADDPCSA YPL+QKLRQV+VDHAL
Sbjct  552  VAKKVLTTGVNGELHPSRFCEKDLLKVVDREQVYTYADDPCSATYPLIQKLRQVIVDHAL  611

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE EKN  TSIF KI AFE+ELKA+LPKEVE AR+A +NG  AIPNRI ECRSYPLY+
Sbjct  612  VNGESEKNAVTSIFHKIGAFEEELKAVLPKEVEAARAAYDNGTSAIPNRIKECRSYPLYR  671

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGTE+LTGEKV SPGE  DKVFTA+C+G IIDP++ECL  WNGAP+PIC
Sbjct  672  FVREELGTELLTGEKVTSPGEEFDKVFTAICEGKIIDPMMECLNEWNGAPIPIC  725



>ref|NP_181241.1| phenylalanine ammonia-lyase 1 [Arabidopsis thaliana]
 sp|P35510.3|PAL1_ARATH RecName: Full=Phenylalanine ammonia-lyase 1 [Arabidopsis thaliana]
 gb|AAK76593.1| putative phenylalanine ammonia lyase PAL1 [Arabidopsis thaliana]
 gb|AAL85094.1| putative phenylalanine ammonia lyase PAL1 [Arabidopsis thaliana]
 gb|AAM15324.1| phenylalanine ammonia lyase (PAL1) [Arabidopsis thaliana]
 gb|AAO29949.1| Unknown protein [Arabidopsis thaliana]
 gb|AAP59438.1| phenylalanine ammonia lyase [Arabidopsis thaliana]
 gb|AEC09341.1| phenylalanine ammonia-lyase 1 [Arabidopsis thaliana]
 gb|AGA15805.1| PAL1 [Expression vector pUDE172]
Length=725

 Score =   298 bits (763),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 135/174 (78%), Positives = 152/174 (87%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAK+ LT GVNGELHPSRFCEKDLL+VVDRE V+ YADDPCSA YPL+QKLRQV+VDHAL
Sbjct  552  VAKKVLTTGVNGELHPSRFCEKDLLKVVDREQVYTYADDPCSATYPLIQKLRQVIVDHAL  611

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE EKN  TSIF KI AFE+ELKA+LPKEVE AR+A +NG  AIPNRI ECRSYPLY+
Sbjct  612  INGESEKNAVTSIFHKIGAFEEELKAVLPKEVEAARAAYDNGTSAIPNRIKECRSYPLYR  671

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGTE+LTGEKV SPGE  DKVFTA+C+G IIDP++ECL  WNGAP+PIC
Sbjct  672  FVREELGTELLTGEKVTSPGEEFDKVFTAICEGKIIDPMMECLNEWNGAPIPIC  725



>ref|XP_002881488.1| hypothetical protein ARALYDRAFT_482690 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57747.1| hypothetical protein ARALYDRAFT_482690 [Arabidopsis lyrata subsp. 
lyrata]
Length=725

 Score =   298 bits (763),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 135/174 (78%), Positives = 152/174 (87%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAK+ LT GVNGELHPSRFCEKDLL+VVDRE V+ YADDPCSA YPL+QKLRQV+VDHAL
Sbjct  552  VAKKVLTTGVNGELHPSRFCEKDLLKVVDREQVYTYADDPCSATYPLIQKLRQVIVDHAL  611

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE EKN  TSIF KI AFE+ELKA+LPKEVE AR+A +NG  AIPNRI ECRSYPLY+
Sbjct  612  INGESEKNAVTSIFHKIGAFEEELKAVLPKEVEAARAAYDNGTSAIPNRIKECRSYPLYR  671

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGTE+LTGEKV SPGE  DKVFTA+C+G IIDP++ECL  WNGAP+PIC
Sbjct  672  FVREELGTELLTGEKVTSPGEEFDKVFTAICEGKIIDPMMECLNEWNGAPIPIC  725



>ref|XP_010504083.1| PREDICTED: phenylalanine ammonia-lyase 2-like [Camelina sativa]
Length=718

 Score =   298 bits (762),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 135/174 (78%), Positives = 151/174 (87%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAK+ LT GVNGELHPSRFCEKDLL+VVDRE VF Y DDPCSA YPLMQKLRQV+VDHAL
Sbjct  545  VAKKVLTTGVNGELHPSRFCEKDLLKVVDREQVFTYVDDPCSATYPLMQKLRQVIVDHAL  604

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE EKN  TSIFQKI AFE+ELKA+LPKEVE  R+A  NG  AIPNRI ECRSYPLY+
Sbjct  605  SNGETEKNAGTSIFQKIGAFEEELKAVLPKEVEATRAAYGNGTAAIPNRIAECRSYPLYR  664

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGT++LTGEKV SPGE  DKVFTA+C+G +IDPL++CLK WNGAP+PIC
Sbjct  665  FVREELGTKLLTGEKVVSPGEEFDKVFTAMCEGKLIDPLMDCLKEWNGAPIPIC  718



>ref|XP_008366650.1| PREDICTED: phenylalanine ammonia-lyase 1 [Malus domestica]
Length=720

 Score =   298 bits (762),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 137/174 (79%), Positives = 152/174 (87%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKR LTMG NGELHPSRFCEKDLL+VVDREYVFAY DDPCSA YPLMQKLR VLV+HAL
Sbjct  547  VAKRVLTMGFNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLRHVLVEHAL  606

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NG+ E + STSIFQKIAAFE+ELK LLPKEVE  R+  ENG  AIPNRI ECRSYPLYK
Sbjct  607  SNGDKEMSTSTSIFQKIAAFEEELKTLLPKEVETTRAEYENGKTAIPNRIKECRSYPLYK  666

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGT++LTGEKV+SPGE CDKVF+A+C G +I+PLL+CLK WNGAPLPI 
Sbjct  667  FVREELGTDLLTGEKVRSPGEECDKVFSAMCAGKLINPLLDCLKEWNGAPLPIS  720



>ref|XP_010658395.1| PREDICTED: phenylalanine ammonia-lyase G1 [Vitis vinifera]
Length=723

 Score =   298 bits (762),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 138/174 (79%), Positives = 149/174 (86%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKR LT+G NGELHPSRFCEKDLL++VDRE+VFAY DDPCS+ YPLMQKLRQVLV+HAL
Sbjct  550  VAKRVLTIGFNGELHPSRFCEKDLLKIVDREHVFAYIDDPCSSTYPLMQKLRQVLVEHAL  609

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE EKN STSIFQKI AFEDELKALLPKEVE  R   ENGN AI NRI +CRSYPLYK
Sbjct  610  INGEREKNSSTSIFQKIVAFEDELKALLPKEVESTRIDYENGNSAISNRIKDCRSYPLYK  669

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELG   LTGEK  SPGE CDKVFTA+C G +IDPLL+CLK WNGAPLPIC
Sbjct  670  FVREELGASFLTGEKTTSPGEECDKVFTAMCAGKLIDPLLDCLKEWNGAPLPIC  723



>gb|KHG30005.1| Phenylalanine ammonia-lyase [Gossypium arboreum]
Length=718

 Score =   297 bits (761),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 136/174 (78%), Positives = 152/174 (87%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAK+TLT G NGELHPSRFCEKDLL+ VD EYVF+Y DDPCSA YPLMQKLRQVLV+HAL
Sbjct  545  VAKKTLTTGPNGELHPSRFCEKDLLKAVDHEYVFSYIDDPCSATYPLMQKLRQVLVEHAL  604

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NG +E N STSIFQKIAAFE+ELK LLPKEVE +R ++ENGN AIPN+I ECRSYPLYK
Sbjct  605  SNGNNENNASTSIFQKIAAFEEELKTLLPKEVENSRVSVENGNAAIPNKIMECRSYPLYK  664

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGT +LTGEKV+SPGE  DKVF A+C G +IDP+LECLK WNGAPLPIC
Sbjct  665  FVREELGTGLLTGEKVKSPGEEFDKVFIAICQGKVIDPMLECLKEWNGAPLPIC  718



>sp|P19142.1|PAL2_PHAVU RecName: Full=Phenylalanine ammonia-lyase class 2; AltName: Full=Phenylalanine 
ammonia-lyase class II [Phaseolus vulgaris]
 prf||1807329A Phe ammonia lyase
Length=712

 Score =   297 bits (761),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 139/174 (80%), Positives = 153/174 (88%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLT GVNGELHPSRFCEK LL+VV+REY FAY DDPCS  YPLMQKLRQVLVD+AL
Sbjct  539  VAKRTLTTGVNGELHPSRFCEKALLKVVEREYTFAYIDDPCSGTYPLMQKLRQVLVDYAL  598

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE+EKN++TSIFQKIA+FE+ELK LLPKEVEGAR A EN   AIPN+I +CRSYPLYK
Sbjct  599  ANGENEKNLNTSIFQKIASFEEELKTLLPKEVEGARLAYENDQCAIPNKIKDCRSYPLYK  658

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGT +LTGEKV SPGE CDKVF+A+C G IIDPLLECL  WNGAPLPIC
Sbjct  659  FVREELGTSLLTGEKVISPGEECDKVFSAMCQGKIIDPLLECLGEWNGAPLPIC  712



>gb|AGY49231.1| phenylalanine ammonia lyase [Ricinus communis]
Length=714

 Score =   297 bits (761),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 136/174 (78%), Positives = 151/174 (87%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKR LT G NGELHPSRFCEKDLL+VVDREYVFAYADDPCSA YPLMQKLRQ+LV+HAL
Sbjct  541  VAKRVLTAGANGELHPSRFCEKDLLKVVDREYVFAYADDPCSATYPLMQKLRQILVEHAL  600

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE+EKN  TS+FQKI+AFE+ELK LLPKEVE  R A E+GNPA  NRI ECRSYPLYK
Sbjct  601  ANGENEKNAGTSVFQKISAFEEELKTLLPKEVESVRIAYESGNPATANRIKECRSYPLYK  660

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGT +LTG+KV S GE  DKVFTA+C G IIDP+++CLK WNGAPLPIC
Sbjct  661  FVREELGTGLLTGDKVMSSGEEFDKVFTAMCQGKIIDPMMDCLKEWNGAPLPIC  714



>dbj|BAE71252.1| putative phenylalanine ammonia lyase [Trifolium pratense]
Length=712

 Score =   297 bits (761),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 140/174 (80%), Positives = 150/174 (86%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLT GVNGELHPSRFCEKDLL+VVDREYVFAYADDPC A YPLMQKLRQVLVDHAL
Sbjct  539  VAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYADDPCLATYPLMQKLRQVLVDHAL  598

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             N + EKN +TSIFQKIA FEDELKA+LPKEVE  R A ENG   I N+I ECRSYPLYK
Sbjct  599  VNVDGEKNSNTSIFQKIATFEDELKAILPKEVESTRVAYENGQCGISNKIKECRSYPLYK  658

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGT +LTGEKV SPGE CDK+FTA+C G I+DPLLECL  WNGAPLPIC
Sbjct  659  FVREELGTALLTGEKVISPGEECDKLFTAMCQGKIVDPLLECLGEWNGAPLPIC  712



>gb|ADL09136.1| phenylanlanine ammonia-lyase [Brassica oleracea var. botrytis]
Length=723

 Score =   297 bits (761),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 137/174 (79%), Positives = 150/174 (86%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAK+ LT GVNGELHPSRFCEKDLL+VVDRE VF Y DDPCSA YPLMQKLRQV+VDHAL
Sbjct  550  VAKKVLTTGVNGELHPSRFCEKDLLKVVDREQVFTYVDDPCSATYPLMQKLRQVIVDHAL  609

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE EKN  TSIFQKI AFE+ELK +LPKEV+ AR A  NG  AIPNRI ECRSYPLYK
Sbjct  610  SNGETEKNAVTSIFQKIGAFEEELKMVLPKEVDAAREAYGNGTAAIPNRIKECRSYPLYK  669

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGT++LTGEKV SPGE  DKVFTA+C+G IIDPL+ECLK WNGAP+PIC
Sbjct  670  FVREELGTKLLTGEKVVSPGEEFDKVFTAMCEGKIIDPLMECLKEWNGAPIPIC  723



>ref|XP_006428758.1| hypothetical protein CICLE_v10011134mg [Citrus clementina]
 gb|ESR41998.1| hypothetical protein CICLE_v10011134mg [Citrus clementina]
Length=757

 Score =   298 bits (763),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 135/174 (78%), Positives = 152/174 (87%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VA++ LT+G NGELHPSRFCEKDLL+  DRE+VFAY DDPCSA YPLMQKLRQVLV+HAL
Sbjct  584  VARKVLTVGANGELHPSRFCEKDLLKAADREHVFAYIDDPCSATYPLMQKLRQVLVEHAL  643

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE+EKN ++SIFQKIAAFE+ELKA+LPKEVE AR  +ENGNP IPNRI ECRSYPLY+
Sbjct  644  NNGENEKNANSSIFQKIAAFEEELKAVLPKEVENARQTVENGNPTIPNRIKECRSYPLYR  703

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
             +REELGT  LTGEKV SPGE  DKVFTA+C G IIDP+LECL+ WNGAPLPIC
Sbjct  704  LVREELGTNFLTGEKVTSPGEKFDKVFTAMCQGKIIDPMLECLREWNGAPLPIC  757



>gb|ACM62741.1| phenylalanine ammonia-lyase [Garcinia mangostana]
Length=718

 Score =   297 bits (760),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 137/174 (79%), Positives = 151/174 (87%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKR LT G NGELHPSRFCEKDLL+VVDREYVFAYADDPCSA YPLMQKLRQVLVDHAL
Sbjct  545  VAKRVLTTGANGELHPSRFCEKDLLKVVDREYVFAYADDPCSATYPLMQKLRQVLVDHAL  604

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE E+N +TS+FQKIAAFE+ELK LLPKE+EG R A E+GN AIPNRI ECRSYPLYK
Sbjct  605  ANGEGERNPNTSVFQKIAAFEEELKDLLPKEIEGVRLAYESGNTAIPNRIKECRSYPLYK  664

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+RE  GT +LTGEKV SPGE  DKVFTA+C G IIDP+L+CL+ W+G PLPIC
Sbjct  665  FVREVAGTSLLTGEKVTSPGEELDKVFTAICQGKIIDPILDCLEEWDGTPLPIC  718



>gb|ADF59062.1| phenylalanine ammonia-lyase 2 precursor [Pyrus x bretschneideri]
Length=720

 Score =   297 bits (760),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 136/174 (78%), Positives = 152/174 (87%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKR LT+G NGELHPSRFCEKDLL+VVDREYVFAY DDPCSA YPLMQKLR VLV+HAL
Sbjct  547  VAKRVLTVGFNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLRHVLVEHAL  606

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NG+ E++ STSIFQKIA FE+ELK LLPKEVE  R+  ENG  AIPNRI ECRSYPLYK
Sbjct  607  SNGDKERSTSTSIFQKIATFEEELKTLLPKEVETTRAEYENGKTAIPNRIKECRSYPLYK  666

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGT++LTGEKV+SPGE CDKVF+A+C G +IDPLL+CLK WNGAPLPI 
Sbjct  667  FVREELGTDLLTGEKVRSPGEECDKVFSAMCAGKLIDPLLDCLKEWNGAPLPIS  720



>ref|XP_010516949.1| PREDICTED: phenylalanine ammonia-lyase 1 [Camelina sativa]
Length=727

 Score =   297 bits (760),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 134/174 (77%), Positives = 152/174 (87%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAK+ LT GVNGELHPSRFCEKDLL+VVDRE V+ YADDPCSA YPL+QKLRQV+VDHAL
Sbjct  554  VAKKVLTTGVNGELHPSRFCEKDLLKVVDREQVYTYADDPCSATYPLIQKLRQVIVDHAL  613

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE EKN  TSIF KI AFE+ELKA+LPKEVE AR+A +NG  AIPNRI ECRSYPLY+
Sbjct  614  INGESEKNAVTSIFHKIGAFEEELKAVLPKEVEAARAAYDNGTSAIPNRIKECRSYPLYR  673

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REE+GTE+LTGEKV SPGE  DKVFTA+C+G IIDP++ECL  WNGAP+PIC
Sbjct  674  FVREEIGTELLTGEKVTSPGEEFDKVFTAICEGKIIDPMMECLNEWNGAPIPIC  727



>ref|XP_009606373.1| PREDICTED: phenylalanine ammonia-lyase G4-like [Nicotiana tomentosiformis]
Length=717

 Score =   296 bits (759),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 139/174 (80%), Positives = 151/174 (87%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAK+ LTMG NG LHPSRFCEKDLL VVDREYVFAYADDPCS NYPL+QKLRQVLVDHAL
Sbjct  544  VAKKVLTMGQNGGLHPSRFCEKDLLNVVDREYVFAYADDPCSCNYPLIQKLRQVLVDHAL  603

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE E N STSIFQKI AFE+ELKA+LPKEVE AR  LEN  P IPNRI ECRSYPLYK
Sbjct  604  LNGEGEMNSSTSIFQKIGAFEEELKAILPKEVESARCDLENSKPTIPNRIQECRSYPLYK  663

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+R+ELGT +LTGE VQSPGEV DKVFTA+ +G +IDPLL+CLK WNGAPLP+C
Sbjct  664  FVRKELGTNLLTGENVQSPGEVFDKVFTAINEGKLIDPLLDCLKEWNGAPLPLC  717



>ref|XP_003591877.1| Phenylalanine ammonia-lyase [Medicago truncatula]
 gb|AES62128.1| phenylalanine ammonia-lyase-like protein [Medicago truncatula]
Length=722

 Score =   297 bits (760),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 137/174 (79%), Positives = 150/174 (86%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKR LT+GVNGELHPSRFCEKDLL VV+ EYVF Y DDPCS  YPLMQKLR VLVDHAL
Sbjct  549  VAKRILTVGVNGELHPSRFCEKDLLNVVEGEYVFTYIDDPCSPIYPLMQKLRYVLVDHAL  608

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
            QNG+ E N STSIFQKI AFE+ELKALLPKEVE AR  +ENGNPA+PN I ECRSYPLYK
Sbjct  609  QNGDKEANSSTSIFQKIGAFEEELKALLPKEVENARVEIENGNPAVPNMIKECRSYPLYK  668

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+RE LGT +LTGEK++SPGE CDKVFTA+CDG  IDP+L+CLK WNG PLPIC
Sbjct  669  FMRETLGTSLLTGEKIRSPGEDCDKVFTAMCDGRFIDPMLDCLKEWNGVPLPIC  722



>gb|ABC69916.1| phenylalanine ammonia-lyase [Brassica napus]
Length=722

 Score =   296 bits (759),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 135/174 (78%), Positives = 151/174 (87%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAK+ LT GVNGELHPSRFCEKDLL+VVDRE V+ YADDPCSA YPL+QKLRQV+VDHAL
Sbjct  549  VAKKVLTTGVNGELHPSRFCEKDLLKVVDREQVYTYADDPCSATYPLIQKLRQVIVDHAL  608

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE EKN  TSIF KI AFE+ELKA+LPKEVE AR+A +NG  AIPNRI ECRSYPLY+
Sbjct  609  VNGESEKNAMTSIFHKIGAFEEELKAVLPKEVEAARAAYDNGTAAIPNRIKECRSYPLYR  668

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGTE+LTGEK  SPGE  DKVFTA+C+G IIDPL+ECL  WNGAP+PIC
Sbjct  669  FVREELGTELLTGEKATSPGEEFDKVFTAICEGKIIDPLMECLDEWNGAPIPIC  722



>gb|AAZ29733.1| phenylalanine ammonia lyase [Trifolium pratense]
Length=712

 Score =   296 bits (759),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 139/174 (80%), Positives = 150/174 (86%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLT GVNGELHPSRFCEKDLL+VVDREYVFAYADDPC A YPLMQKLRQVLVDHAL
Sbjct  539  VAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYADDPCLATYPLMQKLRQVLVDHAL  598

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             N + EKN +TSIFQKIA FEDELKA+LPKEVE  R A ENG   I N+I ECRSYPLYK
Sbjct  599  VNVDGEKNSNTSIFQKIATFEDELKAILPKEVESTRVAYENGQCGISNKIKECRSYPLYK  658

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGT +LTGEKV SPGE CDK+FTA+C G I+DPLLEC+  WNGAPLPIC
Sbjct  659  FVREELGTALLTGEKVISPGEECDKLFTAMCQGKIVDPLLECMGEWNGAPLPIC  712



>ref|XP_011010447.1| PREDICTED: phenylalanine ammonia-lyase [Populus euphratica]
Length=715

 Score =   296 bits (759),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 136/174 (78%), Positives = 153/174 (88%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            V+KR LT G NGELHPSRFCEK+LL+VVDREYVFAY DDPCSA YPLMQKLRQVLVDHAL
Sbjct  542  VSKRVLTTGANGELHPSRFCEKELLKVVDREYVFAYVDDPCSATYPLMQKLRQVLVDHAL  601

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
            +NGE+EKN+STS+FQKI AFE+ELKALLPKEVE AR+A ++GN AI N+I ECRSYPLYK
Sbjct  602  ENGENEKNLSTSVFQKIGAFEEELKALLPKEVESARAAYDSGNSAIDNKIKECRSYPLYK  661

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELG  +LTGEKVQSPGE  DKVF A+C G IIDP+LECL  WNG+PLPI 
Sbjct  662  FVREELGAVLLTGEKVQSPGEEFDKVFAAMCQGKIIDPMLECLGEWNGSPLPIS  715



>ref|XP_009141625.1| PREDICTED: phenylalanine ammonia-lyase 1 [Brassica rapa]
Length=722

 Score =   296 bits (759),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 135/174 (78%), Positives = 151/174 (87%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAK+ LT GVNGELHPSRFCEKDLL+VVDRE V+ YADDPCSA YPL+QKLRQV+VDHAL
Sbjct  549  VAKKVLTTGVNGELHPSRFCEKDLLKVVDREQVYTYADDPCSATYPLIQKLRQVIVDHAL  608

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE EKN  TSIF KI AFE+ELKA+LPKEVE AR+A +NG  AIPNRI ECRSYPLY+
Sbjct  609  VNGESEKNAMTSIFHKIGAFEEELKAVLPKEVEAARAAYDNGTAAIPNRIKECRSYPLYR  668

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGTE+LTGEK  SPGE  DKVFTA+C+G IIDPL+ECL  WNGAP+PIC
Sbjct  669  FVREELGTELLTGEKATSPGEEFDKVFTAICEGKIIDPLMECLDEWNGAPIPIC  722



>gb|ABE03772.1| phenylalanine ammonia-lyase [Arnebia euchroma]
Length=709

 Score =   296 bits (759),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 139/174 (80%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAKRTLT GVNGELHPSRF EKDLL VVDREYVFAYADDPC A YPLMQKLR VLV HAL
Sbjct  536  VAKRTLTTGVNGELHPSRFSEKDLLLVVDREYVFAYADDPCLATYPLMQKLRDVLVGHAL  595

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE+EK+V+TSIF KIA FEDELKA+LPKEVE AR+++ENG PAI NRI ECRSYPLYK
Sbjct  596  ANGENEKDVNTSIFHKIAIFEDELKAILPKEVENARASVENGTPAILNRIEECRSYPLYK  655

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGTE LTGEKV+SPGE  DKVFTA+C+G ++DPLL CL++WN APLPIC
Sbjct  656  FVREELGTEFLTGEKVRSPGEELDKVFTALCEGKLVDPLLACLEAWNVAPLPIC  709



>gb|ABY89691.1| phenylalanine ammonialyase 2 protein [Brassica rapa subsp. oleifera]
Length=722

 Score =   296 bits (759),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 135/174 (78%), Positives = 151/174 (87%), Gaps = 0/174 (0%)
 Frame = -3

Query  664  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  485
            VAK+ LT GVNGELHPSRFCEKDLL+VVDRE V+ YADDPCSA YPL+QKLRQV+VDHAL
Sbjct  549  VAKKVLTTGVNGELHPSRFCEKDLLKVVDREQVYTYADDPCSATYPLIQKLRQVIVDHAL  608

Query  484  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  305
             NGE EKN  TSIF KI AFE+ELKA+LPKEVE AR+A +NG  AIPNRI ECRSYPLY+
Sbjct  609  VNGESEKNAMTSIFHKIGAFEEELKAVLPKEVEAARAAYDNGTAAIPNRIKECRSYPLYR  668

Query  304  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  143
            F+REELGTE+LTGEK  SPGE  DKVFTA+C+G IIDPL+ECL  WNGAP+PIC
Sbjct  669  FVREELGTELLTGEKATSPGEEFDKVFTAICEGKIIDPLMECLDEWNGAPIPIC  722



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1050626367960