BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF028J09

Length=588
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004243704.1|  PREDICTED: subtilisin-like protease                268   2e-81   Solanum lycopersicum
ref|XP_006342387.1|  PREDICTED: subtilisin-like protease-like           268   4e-81   Solanum tuberosum [potatoes]
ref|XP_009782030.1|  PREDICTED: subtilisin-like protease                262   4e-79   Nicotiana sylvestris
ref|XP_009596091.1|  PREDICTED: subtilisin-like protease                258   2e-77   Nicotiana tomentosiformis
gb|ABK96588.1|  unknown                                                 241   8e-77   Populus trichocarpa x Populus deltoides
ref|XP_011078099.1|  PREDICTED: subtilisin-like protease                248   6e-74   Sesamum indicum [beniseed]
ref|XP_011093838.1|  PREDICTED: subtilisin-like protease                243   3e-72   Sesamum indicum [beniseed]
ref|XP_002516266.1|  Xylem serine proteinase 1 precursor, putative      243   9e-72   Ricinus communis
ref|XP_006381615.1|  subtilase family protein                           242   1e-71   
gb|KDP33922.1|  hypothetical protein JCGZ_07493                         240   7e-71   Jatropha curcas
ref|XP_011039978.1|  PREDICTED: subtilisin-like protease                239   3e-70   Populus euphratica
gb|EYU25845.1|  hypothetical protein MIMGU_mgv1a013289mg                222   4e-69   Erythranthe guttata [common monkey flower]
ref|XP_010047469.1|  PREDICTED: subtilisin-like protease                233   5e-68   Eucalyptus grandis [rose gum]
dbj|BAD94244.1|  serine protease like protein                           221   2e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008242250.1|  PREDICTED: subtilisin-like protease                230   3e-67   Prunus mume [ume]
ref|XP_007204263.1|  hypothetical protein PRUPE_ppa001798mg             229   7e-67   Prunus persica
ref|XP_010090170.1|  Subtilisin-like protease                           228   1e-66   Morus notabilis
gb|KHN12283.1|  Subtilisin-like protease                                219   1e-65   Glycine soja [wild soybean]
ref|XP_010049348.1|  PREDICTED: subtilisin-like protease                226   2e-65   Eucalyptus grandis [rose gum]
ref|XP_010042589.1|  PREDICTED: subtilisin-like protease                225   2e-65   Eucalyptus grandis [rose gum]
gb|KGN66306.1|  hypothetical protein Csa_1G597040                       222   2e-65   Cucumis sativus [cucumbers]
ref|XP_010051409.1|  PREDICTED: subtilisin-like protease                225   4e-65   
emb|CDY18042.1|  BnaC07g04280D                                          224   5e-65   Brassica napus [oilseed rape]
ref|NP_565330.1|  Subtilase-like protein                                224   6e-65   Arabidopsis thaliana [mouse-ear cress]
gb|KCW81959.1|  hypothetical protein EUGRSUZ_C03325                     224   7e-65   Eucalyptus grandis [rose gum]
ref|XP_002278292.1|  PREDICTED: subtilisin-like protease                223   1e-64   Vitis vinifera
emb|CDY33400.1|  BnaA07g04390D                                          223   1e-64   Brassica napus [oilseed rape]
ref|XP_010557668.1|  PREDICTED: subtilisin-like protease isoform X1     223   2e-64   Tarenaya hassleriana [spider flower]
ref|XP_002885806.1|  predicted protein                                  223   2e-64   Arabidopsis lyrata subsp. lyrata
ref|XP_009102354.1|  PREDICTED: subtilisin-like protease                223   2e-64   Brassica rapa
ref|XP_010412797.1|  PREDICTED: subtilisin-like protease                222   2e-64   Camelina sativa [gold-of-pleasure]
ref|XP_010666857.1|  PREDICTED: subtilisin-like protease                222   4e-64   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004144036.1|  PREDICTED: subtilisin-like protease-like           221   5e-64   
ref|XP_003533787.1|  PREDICTED: subtilisin-like protease-like           221   1e-63   Glycine max [soybeans]
ref|XP_010467108.1|  PREDICTED: subtilisin-like protease                220   1e-63   Camelina sativa [gold-of-pleasure]
ref|XP_010488783.1|  PREDICTED: subtilisin-like protease                220   2e-63   Camelina sativa [gold-of-pleasure]
ref|XP_006396129.1|  hypothetical protein EUTSA_v10002410mg             219   2e-63   Eutrema salsugineum [saltwater cress]
ref|XP_009767539.1|  PREDICTED: subtilisin-like protease                219   5e-63   Nicotiana sylvestris
ref|XP_009359724.1|  PREDICTED: subtilisin-like protease                218   8e-63   
gb|EYU25847.1|  hypothetical protein MIMGU_mgv1a001711mg                218   9e-63   Erythranthe guttata [common monkey flower]
ref|XP_008450936.1|  PREDICTED: subtilisin-like protease                218   9e-63   Cucumis melo [Oriental melon]
gb|KDO73903.1|  hypothetical protein CISIN_1g004261mg                   218   1e-62   Citrus sinensis [apfelsine]
ref|XP_006452813.1|  hypothetical protein CICLE_v10007510mg             218   1e-62   
ref|XP_006474722.1|  PREDICTED: subtilisin-like protease-like iso...    217   2e-62   Citrus sinensis [apfelsine]
ref|XP_009590702.1|  PREDICTED: subtilisin-like protease                217   2e-62   Nicotiana tomentosiformis
gb|KFK39884.1|  hypothetical protein AALP_AA3G301200                    217   2e-62   Arabis alpina [alpine rockcress]
ref|XP_006297042.1|  hypothetical protein CARUB_v10013038mg             216   4e-62   Capsella rubella
ref|XP_003595292.1|  Subtilisin-like protease                           216   5e-62   Medicago truncatula
gb|KHN06066.1|  Subtilisin-like protease                                213   7e-62   Glycine soja [wild soybean]
ref|XP_008337844.1|  PREDICTED: subtilisin-like protease                214   2e-61   Malus domestica [apple tree]
ref|XP_004488082.1|  PREDICTED: subtilisin-like protease-like           214   2e-61   Cicer arietinum [garbanzo]
ref|XP_007138654.1|  hypothetical protein PHAVU_009G226900g             214   2e-61   Phaseolus vulgaris [French bean]
gb|AHA84190.1|  subtilisin-like protease                                214   4e-61   Phaseolus vulgaris [French bean]
ref|XP_008792868.1|  PREDICTED: subtilisin-like protease                213   1e-60   Phoenix dactylifera
gb|EYU28325.1|  hypothetical protein MIMGU_mgv1a001748mg                213   1e-60   Erythranthe guttata [common monkey flower]
ref|XP_008388846.1|  PREDICTED: subtilisin-like protease                212   2e-60   
ref|XP_008782639.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    211   2e-60   
ref|XP_004245414.1|  PREDICTED: subtilisin-like protease                211   3e-60   
ref|XP_006356658.1|  PREDICTED: subtilisin-like protease-like           211   4e-60   Solanum tuberosum [potatoes]
ref|XP_007012625.1|  Subtilase family protein                           209   9e-60   
gb|KHG16003.1|  Subtilisin-like protease                                209   2e-59   Gossypium arboreum [tree cotton]
ref|XP_010273846.1|  PREDICTED: subtilisin-like protease                209   2e-59   Nelumbo nucifera [Indian lotus]
gb|KJB82990.1|  hypothetical protein B456_013G223900                    208   3e-59   Gossypium raimondii
gb|EPS65938.1|  hypothetical protein M569_08836                         207   9e-59   Genlisea aurea
ref|XP_009337216.1|  PREDICTED: subtilisin-like protease                207   1e-58   
ref|XP_010261834.1|  PREDICTED: subtilisin-like protease                206   3e-58   Nelumbo nucifera [Indian lotus]
ref|XP_010541995.1|  PREDICTED: subtilisin-like protease                204   1e-57   Tarenaya hassleriana [spider flower]
ref|XP_010917484.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    204   2e-57   
gb|KJB27210.1|  hypothetical protein B456_004G284900                    203   2e-57   Gossypium raimondii
ref|XP_010937330.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    201   2e-56   Elaeis guineensis
ref|XP_004287641.1|  PREDICTED: subtilisin-like protease                198   1e-55   Fragaria vesca subsp. vesca
ref|XP_003541310.1|  PREDICTED: subtilisin-like protease-like           196   8e-55   Glycine max [soybeans]
gb|KHN07895.1|  Subtilisin-like protease                                191   3e-54   Glycine soja [wild soybean]
ref|XP_002519362.1|  conserved hypothetical protein                     181   1e-53   
ref|XP_009391730.1|  PREDICTED: subtilisin-like protease                191   4e-53   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010050438.1|  PREDICTED: subtilisin-like protease                189   2e-52   Eucalyptus grandis [rose gum]
ref|XP_009380035.1|  PREDICTED: subtilisin-like protease                188   4e-52   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN17728.1|  Subtilisin-like protease                                177   1e-51   Glycine soja [wild soybean]
gb|AES92191.2|  subtilisin-like serine protease                         186   4e-51   Medicago truncatula
ref|XP_003609994.1|  Subtilisin-like protease                           186   4e-51   
ref|XP_004507999.1|  PREDICTED: subtilisin-like protease-like           185   5e-51   Cicer arietinum [garbanzo]
dbj|BAJ89916.1|  predicted protein                                      182   5e-50   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010238670.1|  PREDICTED: subtilisin-like protease isoform X1     180   3e-49   Brachypodium distachyon [annual false brome]
gb|KDP32432.1|  hypothetical protein JCGZ_13357                         181   6e-49   Jatropha curcas
ref|NP_001064523.2|  Os10g0394200                                       166   2e-47   
ref|XP_007154575.1|  hypothetical protein PHAVU_003G130300g             174   3e-47   Phaseolus vulgaris [French bean]
dbj|BAD36156.1|  putative serine protease                               174   7e-47   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006661279.1|  PREDICTED: subtilisin-like protease-like           171   2e-46   
gb|EMT16255.1|  Subtilisin-like protease                                172   3e-46   
gb|ACL52505.1|  unknown                                                 167   1e-45   Zea mays [maize]
ref|XP_004983113.1|  PREDICTED: subtilisin-like protease-like           170   1e-45   Setaria italica
gb|AGT17100.1|  serine protease                                         169   2e-45   Saccharum hybrid cultivar R570
gb|EMS60034.1|  Subtilisin-like protease                                167   3e-45   Triticum urartu
ref|XP_004956934.1|  PREDICTED: subtilisin-like protease-like           169   3e-45   Setaria italica
ref|XP_002460273.1|  hypothetical protein SORBIDRAFT_02g025810          169   4e-45   Sorghum bicolor [broomcorn]
tpg|DAA61658.1|  TPA: putative subtilase family protein                 167   6e-45   
emb|CAN71376.1|  hypothetical protein VITISV_001491                     168   7e-45   Vitis vinifera
dbj|BAK06243.1|  predicted protein                                      167   1e-44   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACF79126.1|  unknown                                                 166   2e-44   Zea mays [maize]
ref|XP_002467295.1|  hypothetical protein SORBIDRAFT_01g023190          166   3e-44   Sorghum bicolor [broomcorn]
ref|NP_001145743.1|  uncharacterized protein LOC100279250 precursor     166   4e-44   Zea mays [maize]
tpg|DAA50071.1|  TPA: putative subtilase family protein                 166   4e-44   
gb|EEE50901.1|  hypothetical protein OsJ_31407                          165   8e-44   Oryza sativa Japonica Group [Japonica rice]
gb|EAY78354.1|  hypothetical protein OsI_33442                          165   1e-43   Oryza sativa Indica Group [Indian rice]
gb|AAM22744.1|AC092388_28  putative cucumisin-like serine protease      165   1e-43   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001130775.1|  uncharacterized protein LOC100191879 precursor     164   1e-43   Zea mays [maize]
ref|XP_006662325.1|  PREDICTED: subtilisin-like protease-like           162   2e-43   
gb|EMT22975.1|  Subtilisin-like protease                                158   2e-42   
ref|XP_006849717.1|  hypothetical protein AMTR_s00024p00243520          161   3e-42   Amborella trichopoda
ref|XP_010238218.1|  PREDICTED: subtilisin-like protease                155   7e-40   Brachypodium distachyon [annual false brome]
gb|KJB70156.1|  hypothetical protein B456_011G061400                    152   3e-39   Gossypium raimondii
gb|EPS61652.1|  hypothetical protein M569_13143                         149   5e-38   Genlisea aurea
ref|XP_008462294.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    147   4e-37   Cucumis melo [Oriental melon]
ref|XP_007134944.1|  hypothetical protein PHAVU_010G088700g             145   2e-36   Phaseolus vulgaris [French bean]
gb|ABF70004.1|  subtilisin-like serine proteinase, putative             144   3e-36   Musa acuminata [banana]
ref|XP_010917483.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    144   4e-36   Elaeis guineensis
ref|XP_004141706.1|  PREDICTED: subtilisin-like protease-like           143   9e-36   Cucumis sativus [cucumbers]
ref|XP_006583358.1|  PREDICTED: subtilisin-like protease-like iso...    142   1e-35   
gb|KHN04600.1|  Subtilisin-like protease                                142   1e-35   Glycine soja [wild soybean]
ref|XP_003528890.1|  PREDICTED: subtilisin-like protease-like iso...    142   1e-35   Glycine max [soybeans]
emb|CDP20511.1|  unnamed protein product                                142   2e-35   Coffea canephora [robusta coffee]
gb|KCW79387.1|  hypothetical protein EUGRSUZ_C00799                     141   3e-35   Eucalyptus grandis [rose gum]
gb|EYU29564.1|  hypothetical protein MIMGU_mgv1a023796mg                141   3e-35   Erythranthe guttata [common monkey flower]
ref|XP_009416811.1|  PREDICTED: subtilisin-like protease                141   3e-35   Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU29364.1|  hypothetical protein MIMGU_mgv1a022867mg                140   7e-35   Erythranthe guttata [common monkey flower]
gb|EYU29552.1|  hypothetical protein MIMGU_mgv1a0178121mg               132   8e-35   Erythranthe guttata [common monkey flower]
gb|EYU29358.1|  hypothetical protein MIMGU_mgv1a024271mg                136   8e-35   Erythranthe guttata [common monkey flower]
gb|ACJ26761.1|  subtilisin-like protein                                 132   9e-35   Nicotiana benthamiana
ref|XP_004492670.1|  PREDICTED: subtilisin-like protease-like           140   1e-34   Cicer arietinum [garbanzo]
ref|XP_006576383.1|  PREDICTED: subtilisin-like protease-like iso...    139   1e-34   Glycine max [soybeans]
ref|XP_003554304.1|  PREDICTED: subtilisin-like protease SDD1-like      139   2e-34   Glycine max [soybeans]
gb|KHN13888.1|  Subtilisin-like protease                                139   2e-34   Glycine soja [wild soybean]
gb|KHN10783.1|  Subtilisin-like protease SDD1                           138   2e-34   Glycine soja [wild soybean]
ref|XP_006574858.1|  PREDICTED: subtilisin-like protease-like iso...    139   3e-34   Glycine max [soybeans]
ref|XP_003520616.1|  PREDICTED: subtilisin-like protease SDD1-like      139   3e-34   Glycine max [soybeans]
gb|KHN27220.1|  Subtilisin-like protease                                138   4e-34   Glycine soja [wild soybean]
gb|ACN28035.1|  unknown                                                 135   4e-34   Zea mays [maize]
gb|KHN04108.1|  Subtilisin-like protease                                138   4e-34   Glycine soja [wild soybean]
ref|XP_007051971.1|  Subtilase family protein                           138   5e-34   
ref|XP_008454762.1|  PREDICTED: subtilisin-like protease                137   9e-34   Cucumis melo [Oriental melon]
gb|EYU21314.1|  hypothetical protein MIMGU_mgv1a001662mg                137   1e-33   Erythranthe guttata [common monkey flower]
gb|EYU28960.1|  hypothetical protein MIMGU_mgv1a018215mg                137   1e-33   Erythranthe guttata [common monkey flower]
ref|XP_004140440.1|  PREDICTED: subtilisin-like protease-like           137   1e-33   Cucumis sativus [cucumbers]
ref|XP_004305758.1|  PREDICTED: subtilisin-like protease                137   1e-33   Fragaria vesca subsp. vesca
gb|EYU28963.1|  hypothetical protein MIMGU_mgv1a023216mg                133   1e-33   Erythranthe guttata [common monkey flower]
ref|XP_004308418.2|  PREDICTED: subtilisin-like protease                137   1e-33   Fragaria vesca subsp. vesca
ref|XP_011035007.1|  PREDICTED: subtilisin-like protease                137   1e-33   Populus euphratica
ref|XP_010686124.1|  PREDICTED: subtilisin-like protease                137   1e-33   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002320086.2|  subtilase family protein                           137   2e-33   Populus trichocarpa [western balsam poplar]
ref|XP_004140477.1|  PREDICTED: subtilisin-like protease-like           136   3e-33   
ref|XP_004171629.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    136   3e-33   
gb|EYU29555.1|  hypothetical protein MIMGU_mgv1a022042mg                135   3e-33   Erythranthe guttata [common monkey flower]
ref|XP_006841679.1|  hypothetical protein AMTR_s00003p00245290          136   3e-33   Amborella trichopoda
gb|EYU31528.1|  hypothetical protein MIMGU_mgv1a0212142mg               133   3e-33   Erythranthe guttata [common monkey flower]
ref|XP_009611962.1|  PREDICTED: subtilisin-like protease                135   3e-33   Nicotiana tomentosiformis
emb|CAN81091.1|  hypothetical protein VITISV_040911                     133   3e-33   Vitis vinifera
gb|EAY90937.1|  hypothetical protein OsI_12551                          133   4e-33   Oryza sativa Indica Group [Indian rice]
ref|XP_008454764.1|  PREDICTED: subtilisin-like protease                135   4e-33   Cucumis melo [Oriental melon]
ref|XP_007220042.1|  hypothetical protein PRUPE_ppa027143mg             135   4e-33   
ref|XP_008228179.1|  PREDICTED: subtilisin-like protease                135   5e-33   Prunus mume [ume]
gb|ACN27710.1|  unknown                                                 135   5e-33   Zea mays [maize]
tpg|DAA50265.1|  TPA: putative subtilase family protein                 135   6e-33   
ref|XP_007024651.1|  Subtilase family protein                           135   7e-33   
gb|KHN13887.1|  Subtilisin-like protease                                134   7e-33   Glycine soja [wild soybean]
ref|NP_001151549.1|  subtilisin-like protease precursor                 135   7e-33   
ref|XP_003551824.2|  PREDICTED: subtilisin-like protease-like           134   8e-33   Glycine max [soybeans]
ref|XP_010033727.1|  PREDICTED: subtilisin-like protease                135   9e-33   Eucalyptus grandis [rose gum]
ref|XP_008232840.1|  PREDICTED: subtilisin-like protease                134   1e-32   Prunus mume [ume]
ref|XP_007162604.1|  hypothetical protein PHAVU_001G165300g             135   1e-32   Phaseolus vulgaris [French bean]
ref|XP_009411443.1|  PREDICTED: subtilisin-like protease                134   1e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006357406.1|  PREDICTED: subtilisin-like protease-like           134   2e-32   Solanum tuberosum [potatoes]
ref|XP_009613479.1|  PREDICTED: subtilisin-like protease                134   2e-32   Nicotiana tomentosiformis
ref|XP_011072593.1|  PREDICTED: subtilisin-like protease                134   2e-32   Sesamum indicum [beniseed]
gb|ABR17987.1|  unknown                                                 134   2e-32   Picea sitchensis
ref|XP_010261833.1|  PREDICTED: subtilisin-like protease                133   2e-32   Nelumbo nucifera [Indian lotus]
gb|KDO64998.1|  hypothetical protein CISIN_1g045236mg                   132   3e-32   Citrus sinensis [apfelsine]
ref|XP_010685295.1|  PREDICTED: subtilisin-like protease                133   3e-32   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009407416.1|  PREDICTED: subtilisin-like protease                133   3e-32   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFB32958.1|  hypothetical protein 0_744_01                           124   3e-32   Pinus mugo [mountain pine]
ref|XP_010919194.1|  PREDICTED: subtilisin-like protease isoform X1     133   3e-32   
ref|XP_007139243.1|  hypothetical protein PHAVU_008G013300g             133   3e-32   Phaseolus vulgaris [French bean]
ref|XP_010919195.1|  PREDICTED: subtilisin-like protease isoform X2     133   3e-32   
ref|XP_007051969.1|  Subtilase family protein isoform 1                 132   4e-32   
ref|XP_009762581.1|  PREDICTED: subtilisin-like protease isoform X1     132   4e-32   Nicotiana sylvestris
ref|XP_009762584.1|  PREDICTED: subtilisin-like protease isoform X4     132   4e-32   Nicotiana sylvestris
ref|XP_006490976.1|  PREDICTED: subtilisin-like protease-like           132   5e-32   Citrus sinensis [apfelsine]
ref|NP_001050634.1|  Os03g0605300                                       132   6e-32   
gb|AFG70679.1|  hypothetical protein 0_744_01                           124   6e-32   Pinus taeda
ref|XP_009403290.1|  PREDICTED: subtilisin-like protease                132   6e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010685296.1|  PREDICTED: subtilisin-like protease                132   7e-32   Beta vulgaris subsp. vulgaris [field beet]
gb|AFG70691.1|  hypothetical protein 0_744_01                           124   7e-32   Pinus taeda
gb|AFB32953.1|  hypothetical protein 0_744_01                           124   7e-32   Abies alba [abete-blanco]
ref|XP_011036446.1|  PREDICTED: subtilisin-like protease                132   9e-32   Populus euphratica
ref|XP_002304129.2|  hypothetical protein POPTR_0003s06530g             132   9e-32   Populus trichocarpa [western balsam poplar]
gb|EYU29357.1|  hypothetical protein MIMGU_mgv1a021077mg                131   1e-31   Erythranthe guttata [common monkey flower]
gb|AFB32957.1|  hypothetical protein 0_744_01                           123   1e-31   Pinus mugo [mountain pine]
ref|XP_006426684.1|  hypothetical protein CICLE_v10024936mg             131   1e-31   Citrus clementina [clementine]
ref|XP_006445191.1|  hypothetical protein CICLE_v10018512mg             132   1e-31   
ref|XP_004229864.1|  PREDICTED: subtilisin-like protease                131   1e-31   Solanum lycopersicum
ref|XP_008780373.1|  PREDICTED: subtilisin-like protease                131   1e-31   
gb|AFB32959.1|  hypothetical protein 0_744_01                           122   2e-31   Pinus mugo [mountain pine]
ref|XP_007217156.1|  hypothetical protein PRUPE_ppa001739mg             131   2e-31   Prunus persica
ref|XP_006339499.1|  PREDICTED: subtilisin-like protease-like           130   2e-31   Solanum tuberosum [potatoes]
gb|EYU28634.1|  hypothetical protein MIMGU_mgv1a024623mg                130   2e-31   Erythranthe guttata [common monkey flower]
gb|EYU29554.1|  hypothetical protein MIMGU_mgv1a0256351mg               128   2e-31   Erythranthe guttata [common monkey flower]
gb|KCW53526.1|  hypothetical protein EUGRSUZ_J02805                     130   3e-31   Eucalyptus grandis [rose gum]
gb|KJB57037.1|  hypothetical protein B456_009G146000                    130   3e-31   Gossypium raimondii
ref|XP_010322825.1|  PREDICTED: subtilisin-like protease                130   3e-31   Solanum lycopersicum
ref|XP_008792869.1|  PREDICTED: subtilisin-like protease                130   3e-31   Phoenix dactylifera
emb|CDP09846.1|  unnamed protein product                                130   3e-31   Coffea canephora [robusta coffee]
ref|XP_004493834.1|  PREDICTED: subtilisin-like protease SDD1-like      130   4e-31   
ref|XP_003625390.1|  Subtilisin-like protease                           130   6e-31   
emb|CBI34784.3|  unnamed protein product                                126   6e-31   Vitis vinifera
ref|XP_004982450.1|  PREDICTED: subtilisin-like protease-like           129   6e-31   Setaria italica
gb|AFS34694.1|  subtilisin-like serine protease                         129   6e-31   Pisum sativum [garden pea]
ref|XP_003627323.1|  Cucumisin-like serine protease subtilisin-li...    129   7e-31   Medicago truncatula
ref|XP_006342924.1|  PREDICTED: subtilisin-like protease-like           129   7e-31   Solanum tuberosum [potatoes]
ref|XP_010091819.1|  Subtilisin-like protease SDD1                      129   7e-31   Morus notabilis
gb|AFB32956.1|  hypothetical protein 0_744_01                           121   7e-31   Pinus mugo [mountain pine]
gb|KDP25551.1|  hypothetical protein JCGZ_20707                         129   7e-31   Jatropha curcas
gb|EAZ04458.1|  hypothetical protein OsI_26606                          129   1e-30   Oryza sativa Indica Group [Indian rice]
ref|XP_009375850.1|  PREDICTED: subtilisin-like protease                129   1e-30   Pyrus x bretschneideri [bai li]
ref|NP_001060094.1|  Os07g0578300                                       129   1e-30   
ref|XP_011035735.1|  PREDICTED: subtilisin-like protease                128   1e-30   Populus euphratica
gb|AEW07410.1|  hypothetical protein 0_744_01                           120   2e-30   Pinus radiata
gb|AFB32955.1|  hypothetical protein 0_744_01                           120   2e-30   Larix decidua
ref|XP_003605881.1|  Subtilisin-like protease                           128   2e-30   
ref|XP_010087293.1|  Subtilisin-like protease                           128   2e-30   
ref|XP_004958126.1|  PREDICTED: subtilisin-like protease-like           128   2e-30   Setaria italica
ref|XP_006358406.1|  PREDICTED: subtilisin-like protease-like           128   2e-30   Solanum tuberosum [potatoes]
ref|XP_006298979.1|  hypothetical protein CARUB_v10015104mg             128   2e-30   Capsella rubella
ref|XP_004512212.1|  PREDICTED: subtilisin-like protease-like           127   2e-30   Cicer arietinum [garbanzo]
emb|CDP11276.1|  unnamed protein product                                127   3e-30   Coffea canephora [robusta coffee]
ref|XP_007051967.1|  Subtilase family protein                           127   3e-30   
ref|XP_004244717.1|  PREDICTED: subtilisin-like protease                127   4e-30   Solanum lycopersicum
ref|XP_008440346.1|  PREDICTED: subtilisin-like protease                127   4e-30   Cucumis melo [Oriental melon]
ref|XP_006358407.1|  PREDICTED: subtilisin-like protease-like           127   4e-30   Solanum tuberosum [potatoes]
emb|CDP10007.1|  unnamed protein product                                127   4e-30   Coffea canephora [robusta coffee]
gb|ABR18065.1|  unknown                                                 127   4e-30   Picea sitchensis
ref|XP_010111996.1|  Subtilisin-like protease                           127   5e-30   
ref|XP_009758461.1|  PREDICTED: subtilisin-like protease                127   5e-30   Nicotiana sylvestris
ref|XP_002303551.2|  hypothetical protein POPTR_0003s11870g             127   5e-30   
gb|KFK42754.1|  hypothetical protein AALP_AA1G035200                    126   6e-30   Arabis alpina [alpine rockcress]
gb|KDP26457.1|  hypothetical protein JCGZ_17615                         126   7e-30   Jatropha curcas
ref|XP_009391664.1|  PREDICTED: subtilisin-like protease SDD1           126   7e-30   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002275429.1|  PREDICTED: subtilisin-like protease                126   7e-30   Vitis vinifera
ref|XP_004510506.1|  PREDICTED: subtilisin-like protease-like iso...    126   7e-30   
emb|CDY43568.1|  BnaC02g16650D                                          120   7e-30   Brassica napus [oilseed rape]
gb|EMS49460.1|  Subtilisin-like protease SDD1                           126   7e-30   Triticum urartu
ref|XP_010931682.1|  PREDICTED: subtilisin-like protease                126   8e-30   Elaeis guineensis
ref|XP_004166310.1|  PREDICTED: subtilisin-like protease SDD1-like      126   8e-30   
ref|XP_010939822.1|  PREDICTED: subtilisin-like protease                126   9e-30   Elaeis guineensis
gb|EYU28633.1|  hypothetical protein MIMGU_mgv1a023843mg                126   9e-30   Erythranthe guttata [common monkey flower]
ref|XP_010654422.1|  PREDICTED: subtilisin-like protease                126   1e-29   Vitis vinifera
ref|XP_006465903.1|  PREDICTED: subtilisin-like protease-like           126   1e-29   Citrus sinensis [apfelsine]
ref|XP_002275410.2|  PREDICTED: subtilisin-like protease SDD1           125   1e-29   Vitis vinifera
gb|AES80028.2|  subtilisin-like serine protease                         125   1e-29   Medicago truncatula
ref|XP_002272824.2|  PREDICTED: subtilisin-like protease                125   1e-29   Vitis vinifera
ref|XP_002509668.1|  Xylem serine proteinase 1 precursor, putative      125   1e-29   Ricinus communis
ref|XP_010059854.1|  PREDICTED: subtilisin-like protease                125   1e-29   Eucalyptus grandis [rose gum]
ref|XP_008391410.1|  PREDICTED: subtilisin-like protease                125   1e-29   Malus domestica [apple tree]
ref|XP_003623810.1|  Subtilisin-like protease                           125   2e-29   
ref|XP_008447369.1|  PREDICTED: subtilisin-like protease SDD1           125   2e-29   Cucumis melo [Oriental melon]
gb|EMT24443.1|  Subtilisin-like protease                                125   2e-29   
gb|KGN58306.1|  hypothetical protein Csa_3G610820                       125   2e-29   Cucumis sativus [cucumbers]
ref|XP_004152066.1|  PREDICTED: subtilisin-like protease SDD1-like      125   2e-29   
ref|XP_006369129.1|  subtilase family protein                           125   2e-29   
gb|EMS68171.1|  Subtilisin-like protease                                122   2e-29   Triticum urartu
emb|CBI34785.3|  unnamed protein product                                125   2e-29   Vitis vinifera
ref|XP_008784364.1|  PREDICTED: subtilisin-like protease                125   3e-29   Phoenix dactylifera
ref|XP_008780900.1|  PREDICTED: subtilisin-like protease                125   3e-29   Phoenix dactylifera
gb|AES81608.2|  subtilisin-like serine protease                         125   3e-29   Medicago truncatula
emb|CDP10008.1|  unnamed protein product                                125   3e-29   Coffea canephora [robusta coffee]
ref|XP_008679257.1|  PREDICTED: subtilisin-like protease                125   3e-29   Zea mays [maize]
gb|EPS74243.1|  subtilase family protein                                124   3e-29   Genlisea aurea
ref|XP_004512211.1|  PREDICTED: subtilisin-like protease-like           124   3e-29   Cicer arietinum [garbanzo]
ref|XP_009760563.1|  PREDICTED: subtilisin-like protease                124   3e-29   Nicotiana sylvestris
gb|EAY87749.1|  hypothetical protein OsI_09164                          122   3e-29   Oryza sativa Indica Group [Indian rice]
gb|KHN01421.1|  Subtilisin-like protease                                121   3e-29   Glycine soja [wild soybean]
ref|XP_006358147.1|  PREDICTED: subtilisin-like protease SDD1-like      124   4e-29   
gb|AFK33735.1|  unknown                                                 117   4e-29   
emb|CDY15145.1|  BnaC05g00240D                                          124   4e-29   
gb|KJB49367.1|  hypothetical protein B456_008G115500                    124   4e-29   
ref|NP_001159342.1|  putative subtilase family protein precursor        124   4e-29   
gb|ADY38794.1|  serine protease                                         124   4e-29   
gb|ADE77855.1|  unknown                                                 121   4e-29   
ref|XP_003636375.1|  Subtilisin-like protease                           124   5e-29   
ref|XP_009789823.1|  PREDICTED: subtilisin-like protease                124   5e-29   
ref|XP_006383545.1|  hypothetical protein POPTR_0005s18880g             124   5e-29   
ref|XP_006418467.1|  hypothetical protein EUTSA_v10006878mg             124   6e-29   
emb|CAN75239.1|  hypothetical protein VITISV_014205                     124   6e-29   
ref|XP_011033844.1|  PREDICTED: subtilisin-like protease SDD1           124   6e-29   
gb|KJB10059.1|  hypothetical protein B456_001G182200                    124   6e-29   
ref|XP_006359680.1|  PREDICTED: subtilisin-like protease-like           124   6e-29   
ref|XP_010029506.1|  PREDICTED: subtilisin-like protease                124   7e-29   
gb|EYU33441.1|  hypothetical protein MIMGU_mgv1a022698mg                123   7e-29   
ref|XP_011079622.1|  PREDICTED: subtilisin-like protease                124   7e-29   
ref|XP_003608462.1|  Subtilisin-like protease                           123   7e-29   
ref|XP_006446947.1|  hypothetical protein CICLE_v10014389mg             123   7e-29   
ref|XP_007135429.1|  hypothetical protein PHAVU_010G128600g             123   8e-29   
emb|CDO99977.1|  unnamed protein product                                123   8e-29   
ref|XP_011091250.1|  PREDICTED: subtilisin-like protease                123   8e-29   
gb|ADE76648.1|  unknown                                                 120   8e-29   
ref|XP_010457444.1|  PREDICTED: subtilisin-like protease SDD1           123   9e-29   
gb|EMT32146.1|  Subtilisin-like protease                                117   1e-28   
gb|KFK26784.1|  hypothetical protein AALP_AA8G293000                    123   1e-28   
ref|XP_011010186.1|  PREDICTED: subtilisin-like protease                123   1e-28   
gb|ADW11233.1|  subtilisin-like protease 2                              123   1e-28   
gb|ABZ89187.1|  putative protein                                        123   1e-28   
dbj|BAK08126.1|  predicted protein                                      123   1e-28   
ref|XP_011081168.1|  PREDICTED: subtilisin-like protease SDD1           123   1e-28   
ref|XP_010255581.1|  PREDICTED: subtilisin-like protease                123   1e-28   
emb|CDY67452.1|  BnaCnng55020D                                          122   1e-28   
gb|KCW56428.1|  hypothetical protein EUGRSUZ_I02156                     123   1e-28   
ref|XP_002301847.2|  STOMATAL DENSITY AND DISTRIBUTION family pro...    122   1e-28   
ref|XP_007051968.1|  Subtilase family protein                           122   1e-28   
ref|XP_010483084.1|  PREDICTED: subtilisin-like protease SDD1           122   1e-28   
gb|ABD64827.1|  putative subtilisin serine protease of stomatal d...    122   2e-28   
ref|XP_009593174.1|  PREDICTED: subtilisin-like protease                122   2e-28   
ref|XP_009335230.1|  PREDICTED: subtilisin-like protease SDD1           122   2e-28   
gb|EYU29557.1|  hypothetical protein MIMGU_mgv1a0023062mg               118   2e-28   
ref|XP_002892197.1|  hypothetical protein ARALYDRAFT_470387             122   2e-28   
gb|KDP28707.1|  hypothetical protein JCGZ_14478                         122   2e-28   
emb|CDY63869.1|  BnaCnng42760D                                          116   2e-28   
emb|CDY33251.1|  BnaC01g37240D                                          122   2e-28   
ref|XP_011024491.1|  PREDICTED: subtilisin-like protease SDD1           122   2e-28   
ref|XP_004147596.1|  PREDICTED: subtilisin-like protease SDD1-like      122   2e-28   
ref|XP_010105482.1|  Subtilisin-like protease                           122   2e-28   
ref|XP_007050153.1|  Subtilase family protein isoform 1                 122   2e-28   
ref|XP_002452918.1|  hypothetical protein SORBIDRAFT_04g034950          122   2e-28   
gb|KJB43875.1|  hypothetical protein B456_007G221100                    122   2e-28   
ref|XP_008437181.1|  PREDICTED: subtilisin-like protease                122   2e-28   
gb|AGT16121.1|  hypothetical protein SHCRBa_028_H13_F_280               122   2e-28   
ref|XP_008439131.1|  PREDICTED: subtilisin-like protease                122   2e-28   
ref|XP_010262465.1|  PREDICTED: subtilisin-like protease SDD1           122   2e-28   
gb|EMS59706.1|  Subtilisin-like protease                                120   2e-28   
gb|KHN39620.1|  Subtilisin-like protease                                121   2e-28   
ref|XP_006304967.1|  hypothetical protein CARUB_v10012040mg             122   2e-28   
ref|XP_006358905.1|  PREDICTED: subtilisin-like protease SDD1-like      121   2e-28   
ref|XP_008462247.1|  PREDICTED: subtilisin-like protease                122   2e-28   
gb|ACN26674.1|  unknown                                                 120   3e-28   
gb|ACB87529.1|  subtilisin protease                                     120   3e-28   
ref|XP_006468883.1|  PREDICTED: subtilisin-like protease-like           122   3e-28   
ref|XP_009370534.1|  PREDICTED: subtilisin-like protease SDD1           122   3e-28   
ref|XP_010240288.1|  PREDICTED: subtilisin-like protease                122   3e-28   
gb|KHM99187.1|  Subtilisin-like protease                                115   3e-28   
gb|EYU28961.1|  hypothetical protein MIMGU_mgv1a020058mg                122   3e-28   
gb|KDO36038.1|  hypothetical protein CISIN_1g047896mg                   119   3e-28   
emb|CDX97539.1|  BnaA05g25400D                                          119   3e-28   
ref|XP_008356216.1|  PREDICTED: subtilisin-like protease SDD1           122   3e-28   
ref|XP_009758000.1|  PREDICTED: subtilisin-like protease                122   3e-28   
ref|XP_010558849.1|  PREDICTED: subtilisin-like protease SDD1           122   3e-28   
ref|XP_010089708.1|  Subtilisin-like protease                           122   3e-28   
ref|XP_003597117.1|  Subtilisin-like protease                           122   3e-28   
ref|XP_010273831.1|  PREDICTED: subtilisin-like protease                122   3e-28   
ref|XP_004231902.2|  PREDICTED: subtilisin-like protease                121   3e-28   
ref|XP_010932346.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    122   3e-28   
gb|EYU29561.1|  hypothetical protein MIMGU_mgv1a018614mg                121   3e-28   
gb|EPS74284.1|  hypothetical protein M569_00464                         121   3e-28   
ref|XP_002275381.2|  PREDICTED: subtilisin-like protease SDD1           122   4e-28   
ref|XP_010442681.1|  PREDICTED: subtilisin-like protease                121   4e-28   
ref|NP_563701.1|  subtilisin-like protease SDD1                         121   4e-28   
gb|KJB49366.1|  hypothetical protein B456_008G115400                    121   4e-28   
gb|ADZ55305.1|  serine protease                                         121   4e-28   
ref|XP_002511772.1|  Xylem serine proteinase 1 precursor, putative      121   4e-28   
ref|XP_003540860.1|  PREDICTED: subtilisin-like protease-like           121   4e-28   
ref|XP_009790650.1|  PREDICTED: subtilisin-like protease SDD1 iso...    121   5e-28   
ref|XP_003523991.1|  PREDICTED: subtilisin-like protease-like           121   5e-28   
ref|XP_009790648.1|  PREDICTED: subtilisin-like protease SDD1 iso...    121   5e-28   
ref|XP_010540256.1|  PREDICTED: subtilisin-like protease                121   5e-28   
ref|XP_003547763.1|  PREDICTED: subtilisin-like protease-like           121   5e-28   
ref|XP_010530892.1|  PREDICTED: subtilisin-like protease                121   5e-28   
ref|XP_009790649.1|  PREDICTED: subtilisin-like protease SDD1 iso...    120   5e-28   
ref|XP_004958127.1|  PREDICTED: subtilisin-like protease-like           121   5e-28   
ref|XP_004300738.1|  PREDICTED: subtilisin-like protease SDD1           121   5e-28   
ref|XP_004141727.1|  PREDICTED: subtilisin-like protease-like           121   6e-28   
gb|KHG02130.1|  Subtilisin-like protease                                121   6e-28   
ref|XP_004155899.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    120   6e-28   
ref|XP_004305780.1|  PREDICTED: subtilisin-like protease                120   7e-28   
ref|XP_010475053.1|  PREDICTED: subtilisin-like protease SDD1           120   7e-28   
ref|XP_003611185.1|  Subtilisin-like serine protease                    120   7e-28   
ref|XP_002885009.1|  subtilase family protein                           120   7e-28   
ref|XP_010109072.1|  Subtilisin-like protease                           120   8e-28   
ref|XP_009119746.1|  PREDICTED: subtilisin-like protease                120   8e-28   
ref|XP_004231026.1|  PREDICTED: subtilisin-like protease                120   8e-28   
ref|XP_002463079.1|  hypothetical protein SORBIDRAFT_02g037440          120   9e-28   
ref|XP_009610930.1|  PREDICTED: subtilisin-like protease                120   9e-28   
ref|XP_006583162.1|  PREDICTED: subtilisin-like protease-like iso...    120   1e-27   
ref|NP_001159284.1|  putative subtilase family protein precursor        120   1e-27   
ref|XP_009336065.1|  PREDICTED: subtilisin-like protease                120   1e-27   
ref|XP_011081104.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    120   1e-27   
ref|XP_009599383.1|  PREDICTED: subtilisin-like protease                120   1e-27   
dbj|BAJ93872.1|  predicted protein                                      120   1e-27   
ref|XP_010482516.1|  PREDICTED: subtilisin-like protease isoform X1     120   1e-27   
ref|XP_006477586.1|  PREDICTED: subtilisin-like protease SDD1-like      120   1e-27   
ref|XP_010105479.1|  Subtilisin-like protease                           120   1e-27   
ref|XP_009381912.1|  PREDICTED: subtilisin-like protease                120   1e-27   
ref|XP_007047459.1|  Subtilase family protein                           120   1e-27   
ref|XP_002526537.1|  Cucumisin precursor, putative                      120   1e-27   
gb|EYU29563.1|  hypothetical protein MIMGU_mgv1a022413mg                119   1e-27   
ref|XP_009117189.1|  PREDICTED: subtilisin-like protease                120   2e-27   
ref|XP_006347484.1|  PREDICTED: subtilisin-like protease SDD1-like      120   2e-27   
ref|XP_009410252.1|  PREDICTED: subtilisin-like protease                120   2e-27   
gb|KHN44005.1|  Subtilisin-like protease                                117   2e-27   
ref|XP_010684867.1|  PREDICTED: subtilisin-like protease SDD1           119   2e-27   
gb|AGN03879.1|  senescence-associated subtilisin protease               119   2e-27   
ref|XP_003581517.1|  PREDICTED: subtilisin-like protease                119   2e-27   
emb|CDY52259.1|  BnaC05g52030D                                          119   2e-27   
gb|KDP28200.1|  hypothetical protein JCGZ_13971                         119   2e-27   
emb|CDY39093.1|  BnaA01g29630D                                          119   2e-27   
ref|XP_002864127.1|  subtilase family protein                           119   2e-27   
ref|XP_010692334.1|  PREDICTED: subtilisin-like protease                119   2e-27   
ref|XP_009146419.1|  PREDICTED: subtilisin-like protease                119   2e-27   
gb|EPS72026.1|  serine protease                                         119   2e-27   
emb|CDO96926.1|  unnamed protein product                                119   2e-27   
gb|ACN27570.1|  unknown                                                 117   2e-27   
ref|XP_004954113.1|  PREDICTED: subtilisin-like protease-like           119   2e-27   
ref|XP_008792659.1|  PREDICTED: subtilisin-like protease                119   2e-27   
gb|KFK28394.1|  hypothetical protein AALP_AA8G509300                    119   3e-27   
ref|XP_004505786.1|  PREDICTED: subtilisin-like protease-like           119   3e-27   
gb|KHN45156.1|  Subtilisin-like protease                                119   3e-27   
ref|XP_002272999.1|  PREDICTED: subtilisin-like protease                119   3e-27   
ref|XP_003525925.1|  PREDICTED: subtilisin-like protease-like           119   3e-27   
ref|XP_004148149.1|  PREDICTED: subtilisin-like protease-like           119   3e-27   
ref|XP_006440474.1|  hypothetical protein CICLE_v10023558mg             119   3e-27   
ref|XP_006464862.1|  PREDICTED: subtilisin-like protease SDD1-like      119   3e-27   
ref|XP_006427879.1|  hypothetical protein CICLE_v10027438mg             119   3e-27   
gb|AFW73750.1|  putative subtilase family protein                       119   3e-27   
gb|KGN57311.1|  hypothetical protein Csa_3G178520                       119   3e-27   
ref|XP_009781099.1|  PREDICTED: subtilisin-like protease                119   3e-27   
gb|EMS46826.1|  Subtilisin-like protease                                116   3e-27   
ref|XP_006283144.1|  hypothetical protein CARUB_v10004172mg             119   3e-27   
emb|CAN75240.1|  hypothetical protein VITISV_014207                     117   3e-27   
ref|XP_010914489.1|  PREDICTED: subtilisin-like protease                119   3e-27   
gb|EYU46755.1|  hypothetical protein MIMGU_mgv1a001548mg                119   3e-27   
gb|EYU28956.1|  hypothetical protein MIMGU_mgv1a023117mg                119   3e-27   
gb|EYU33439.1|  hypothetical protein MIMGU_mgv1a026748mg                119   3e-27   
ref|XP_003538919.1|  PREDICTED: subtilisin-like protease-like           119   4e-27   
gb|EYU33437.1|  hypothetical protein MIMGU_mgv1a001845mg                119   4e-27   
gb|KJB49368.1|  hypothetical protein B456_008G115600                    119   4e-27   
gb|ACN34516.1|  unknown                                                 115   4e-27   
emb|CBI37888.3|  unnamed protein product                                119   4e-27   
ref|XP_006296785.1|  hypothetical protein CARUB_v10016006mg             118   4e-27   
ref|XP_010646965.1|  PREDICTED: subtilisin-like protease                118   4e-27   
gb|KHN41792.1|  Subtilisin-like protease                                118   4e-27   
ref|XP_009604592.1|  PREDICTED: subtilisin-like protease                118   4e-27   
ref|NP_001145849.1|  uncharacterized protein LOC100279360 precursor     118   4e-27   
ref|XP_009629568.1|  PREDICTED: subtilisin-like protease                118   4e-27   
ref|XP_006446945.1|  hypothetical protein CICLE_v10017946mg             118   4e-27   
gb|EEC76224.1|  hypothetical protein OsI_13631                          116   5e-27   
gb|EYU29361.1|  hypothetical protein MIMGU_mgv1a026567mg                118   5e-27   
ref|XP_006479431.1|  PREDICTED: subtilisin-like protease SDD1-like      118   5e-27   
ref|XP_004509085.1|  PREDICTED: subtilisin-like protease-like           118   5e-27   
ref|XP_006393933.1|  hypothetical protein EUTSA_v10003693mg             118   5e-27   
ref|XP_008392153.1|  PREDICTED: subtilisin-like protease                118   5e-27   
ref|XP_006446946.1|  hypothetical protein CICLE_v10017639mg             118   5e-27   
gb|EMS62253.1|  Subtilisin-like protease                                113   5e-27   
ref|XP_009357945.1|  PREDICTED: subtilisin-like protease                118   5e-27   
ref|XP_004954115.1|  PREDICTED: subtilisin-like protease-like           118   5e-27   
ref|XP_010501588.1|  PREDICTED: subtilisin-like protease                118   5e-27   
ref|XP_011088593.1|  PREDICTED: subtilisin-like protease                118   6e-27   
ref|XP_006579930.1|  PREDICTED: subtilisin-like protease-like iso...    118   6e-27   
ref|XP_007136744.1|  hypothetical protein PHAVU_009G070500g             118   6e-27   
ref|XP_009107228.1|  PREDICTED: subtilisin-like protease                118   6e-27   
dbj|BAD19523.1|  putative subtilisin-like proteinase                    117   6e-27   
emb|CDY00497.1|  BnaA10g07760D                                          118   6e-27   
ref|XP_010056250.1|  PREDICTED: subtilisin-like protease                118   6e-27   
ref|NP_001146035.1|  uncharacterized protein LOC100279566               116   6e-27   
ref|XP_009781097.1|  PREDICTED: subtilisin-like protease                118   6e-27   
ref|XP_006418166.1|  hypothetical protein EUTSA_v10006861mg             118   6e-27   
gb|KDP25552.1|  hypothetical protein JCGZ_20708                         118   6e-27   
ref|XP_003538985.1|  PREDICTED: subtilisin-like protease-like           118   7e-27   
ref|XP_007131701.1|  hypothetical protein PHAVU_011G034700g             118   7e-27   
ref|XP_004287970.1|  PREDICTED: subtilisin-like protease                118   7e-27   
gb|EYU39029.1|  hypothetical protein MIMGU_mgv1a019332mg                117   7e-27   
ref|XP_006352831.1|  PREDICTED: subtilisin-like protease SDD1-like      118   7e-27   
ref|XP_003550022.1|  PREDICTED: subtilisin-like protease-like           118   7e-27   
ref|XP_010542387.1|  PREDICTED: subtilisin-like protease                118   7e-27   
ref|XP_002892038.1|  predicted protein                                  118   7e-27   
ref|XP_010246830.1|  PREDICTED: subtilisin-like protease                118   7e-27   
gb|KHN12975.1|  Subtilisin-like protease                                118   7e-27   
gb|KFK38761.1|  hypothetical protein AALP_AA3G157200                    118   7e-27   
dbj|BAJ86110.1|  predicted protein                                      118   7e-27   
ref|XP_004234656.1|  PREDICTED: subtilisin-like protease                118   7e-27   
ref|XP_003538797.2|  PREDICTED: subtilisin-like protease-like           118   7e-27   
dbj|BAJ96698.1|  predicted protein                                      118   7e-27   
ref|XP_010108071.1|  Subtilisin-like protease SDD1                      118   8e-27   
ref|XP_002272791.1|  PREDICTED: subtilisin-like protease                117   8e-27   
ref|XP_002304250.2|  hypothetical protein POPTR_0003s06940g             116   8e-27   
emb|CDP15538.1|  unnamed protein product                                117   8e-27   
dbj|BAH20348.1|  AT3G14067                                              117   8e-27   
ref|XP_009404128.1|  PREDICTED: subtilisin-like protease                117   9e-27   
ref|XP_002981864.1|  hypothetical protein SELMODRAFT_115574             117   9e-27   
emb|CBI34800.3|  unnamed protein product                                115   9e-27   
tpg|DAA51518.1|  TPA: putative subtilase family protein                 117   9e-27   
emb|CDP05276.1|  unnamed protein product                                117   9e-27   
ref|XP_004510560.1|  PREDICTED: subtilisin-like protease-like           117   9e-27   
ref|XP_010070634.1|  PREDICTED: subtilisin-like protease                117   9e-27   
ref|XP_003611201.1|  Subtilisin-like serine protease                    117   1e-26   
ref|XP_004231903.1|  PREDICTED: subtilisin-like protease                117   1e-26   



>ref|XP_004243704.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=762

 Score =   268 bits (686),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 124/160 (78%), Positives = 140/160 (88%), Gaps = 0/160 (0%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHVDPHKALSPGLVYDI P +Y  FLCSLDY  + IQAIVK PN+TCAKK S+P Q+NYP
Sbjct  602  GHVDPHKALSPGLVYDIRPKEYIKFLCSLDYEMEHIQAIVKRPNVTCAKKFSDPGQINYP  661

Query  407  SFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTV  228
            SF+VLFGKSR+VR TR LTNVGAAG+ YEV I+APPSVTVTVKP+KLVFK VG+RLRYTV
Sbjct  662  SFAVLFGKSRVVRYTRTLTNVGAAGSTYEVVIDAPPSVTVTVKPSKLVFKKVGERLRYTV  721

Query  227  TFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQLF  108
            TFVSKKGV T S   FGS+SWNNAQNQVRSP+++SW+QLF
Sbjct  722  TFVSKKGVSTMSKTTFGSISWNNAQNQVRSPVSYSWSQLF  761



>ref|XP_006342387.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=767

 Score =   268 bits (684),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 124/160 (78%), Positives = 139/160 (87%), Gaps = 0/160 (0%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHVDPHKALSPGLVYDI P +Y  FLCSLDY    IQAIVK PN+TCAKK S+P Q+NYP
Sbjct  607  GHVDPHKALSPGLVYDIRPEEYIKFLCSLDYEMDHIQAIVKRPNVTCAKKFSDPGQINYP  666

Query  407  SFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTV  228
            SF+VLFGKSR+VR TR LTNVGAAG+ YEV I+APPSVTVTVKP+KLVFK VG+RLRYTV
Sbjct  667  SFAVLFGKSRVVRYTRTLTNVGAAGSTYEVVIDAPPSVTVTVKPSKLVFKRVGERLRYTV  726

Query  227  TFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQLF  108
            TFVSKKGV T S   FGS+SWNNAQNQVRSP+++SW+QLF
Sbjct  727  TFVSKKGVSTMSKTTFGSISWNNAQNQVRSPVSYSWSQLF  766



>ref|XP_009782030.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=764

 Score =   262 bits (670),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 119/160 (74%), Positives = 138/160 (86%), Gaps = 0/160 (0%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHVDPHKALSPGL+YDI P DY  FLCSLDY    IQAIVK PN+TC KK ++P Q+NYP
Sbjct  604  GHVDPHKALSPGLIYDITPEDYIKFLCSLDYELNHIQAIVKRPNVTCTKKFADPGQINYP  663

Query  407  SFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTV  228
            SFSVLFGKSR+VR TR +TNVGAAG++YEV ++APPSVTVTVKP+KLVFK VG+RLRYTV
Sbjct  664  SFSVLFGKSRVVRYTRAVTNVGAAGSVYEVTVDAPPSVTVTVKPSKLVFKRVGERLRYTV  723

Query  227  TFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQLF  108
            TFVSKKGV     +AFGS+SWNNAQNQVRSP+++SW+QL 
Sbjct  724  TFVSKKGVNMMRKSAFGSISWNNAQNQVRSPVSYSWSQLL  763



>ref|XP_009596091.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=764

 Score =   258 bits (658),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 117/160 (73%), Positives = 136/160 (85%), Gaps = 0/160 (0%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHVDPHKALSPGL+YDI P DY  FLCSLDY    IQAIVK PN+TCAKK ++P Q+NYP
Sbjct  604  GHVDPHKALSPGLIYDITPEDYIKFLCSLDYELNHIQAIVKRPNVTCAKKFADPGQINYP  663

Query  407  SFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTV  228
            SFSVLFGKSR+VR TR +TNV AAG++YEV ++APPSV VTVKP+KLVFK VG+RLRYTV
Sbjct  664  SFSVLFGKSRVVRYTRAVTNVAAAGSVYEVVVDAPPSVLVTVKPSKLVFKRVGERLRYTV  723

Query  227  TFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQLF  108
            TFVS KGV     +AFGS+SWNNAQNQVRSP+++SW+QL 
Sbjct  724  TFVSNKGVNMMRKSAFGSISWNNAQNQVRSPVSYSWSQLL  763



>gb|ABK96588.1| unknown [Populus trichocarpa x Populus deltoides]
Length=218

 Score =   241 bits (615),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 109/159 (69%), Positives = 132/159 (83%), Gaps = 0/159 (0%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHVDP KALSPGLVYDI+  +Y  FLCSLDYT + +QAIVK PNITC++K +NP  LNYP
Sbjct  60   GHVDPQKALSPGLVYDISADEYVAFLCSLDYTIEHVQAIVKRPNITCSRKFNNPGNLNYP  119

Query  407  SFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTV  228
            SFSV+F  +R+VR TRELTNVGAAG++YEVA+  P +V VTVKP+KLVFKNVGD+LRYTV
Sbjct  120  SFSVVFTNNRVVRYTRELTNVGAAGSIYEVAVTGPQAVQVTVKPSKLVFKNVGDKLRYTV  179

Query  227  TFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQL  111
            TFV++KG      + FG++ W NAQ+QVRSP+AFSWTQL
Sbjct  180  TFVARKGASLTGRSEFGAIVWRNAQHQVRSPVAFSWTQL  218



>ref|XP_011078099.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=758

 Score =   248 bits (634),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 115/159 (72%), Positives = 135/159 (85%), Gaps = 1/159 (1%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHV+PHKALSPGLVYD  P DY  FLCSL YT + IQAI K PNITCA+K  +P QLNYP
Sbjct  601  GHVNPHKALSPGLVYDATPEDYVAFLCSLRYTVEMIQAIAKRPNITCARKFRDPGQLNYP  660

Query  407  SFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTV  228
            SFSVLFGKSRIV+ +RELTNVGAAG++Y V++EAPP+V V+VKP+KLVFKNVGD+ RYTV
Sbjct  661  SFSVLFGKSRIVKYSRELTNVGAAGSVYLVSVEAPPTVAVSVKPSKLVFKNVGDKQRYTV  720

Query  227  TFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQL  111
            TF SKK  V P + AFGS++W NAQ+QV+SP+AFSWTQL
Sbjct  721  TFTSKKS-VNPVSHAFGSITWKNAQDQVKSPVAFSWTQL  758



>ref|XP_011093838.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=743

 Score =   243 bits (621),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 111/158 (70%), Positives = 132/158 (84%), Gaps = 1/158 (1%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHVDP KALSPGLVYD  P DY  FLCSLDYT + IQAIVK PN+TCA K  +P QLNYP
Sbjct  586  GHVDPQKALSPGLVYDAKPEDYIAFLCSLDYTMEMIQAIVKHPNVTCAAKFRDPGQLNYP  645

Query  407  SFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTV  228
            SFSV+FGKSR+VR TR LTNVGAAG++Y V++EAPP+V V+VKP+ LVF+NVGDR RYTV
Sbjct  646  SFSVVFGKSRVVRYTRRLTNVGAAGSVYRVSVEAPPNVVVSVKPSNLVFRNVGDRQRYTV  705

Query  227  TFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQ  114
            TFVS+KG V P +  FGS++W N Q+QVRSP+AFSW++
Sbjct  706  TFVSQKG-VDPLHNGFGSITWKNEQHQVRSPVAFSWSR  742



>ref|XP_002516266.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF46268.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=768

 Score =   243 bits (619),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 106/160 (66%), Positives = 131/160 (82%), Gaps = 0/160 (0%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHVDPHKA+SPGLVYD++  DY  FLCSL YT   +Q IVK PN+TCA+K S+P +LNYP
Sbjct  609  GHVDPHKAMSPGLVYDVSTEDYVAFLCSLGYTIDHVQLIVKRPNVTCARKFSDPGELNYP  668

Query  407  SFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTV  228
            SFSV+FG  R+VR TRELTNVG AG++YEV + AP +V V+VKPTKLVF+NVGD+LRYTV
Sbjct  669  SFSVVFGNKRVVRYTRELTNVGEAGSIYEVEVTAPSTVGVSVKPTKLVFRNVGDKLRYTV  728

Query  227  TFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQLF  108
            TFV+KKG+   +   FGS+ W NA++QVRSP+AF+WTQL 
Sbjct  729  TFVAKKGIRKAARNGFGSIVWRNAEHQVRSPVAFAWTQLL  768



>ref|XP_006381615.1| subtilase family protein [Populus trichocarpa]
 gb|ERP59412.1| subtilase family protein [Populus trichocarpa]
Length=768

 Score =   242 bits (617),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 109/159 (69%), Positives = 132/159 (83%), Gaps = 0/159 (0%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHVDP KALSPGLVYDI+  +Y  FLCSLDYT + +QAIVK PNITC++K +NP  LNYP
Sbjct  610  GHVDPQKALSPGLVYDISADEYVAFLCSLDYTIEHVQAIVKRPNITCSRKFNNPGNLNYP  669

Query  407  SFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTV  228
            SFSV+F  +R+VR TRELTNVGAAG++YEVA+  P +V VTVKP+KLVFKNVGD+LRYTV
Sbjct  670  SFSVVFTNNRVVRYTRELTNVGAAGSIYEVAVTGPQAVQVTVKPSKLVFKNVGDKLRYTV  729

Query  227  TFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQL  111
            TFV++KG      + FG++ W NAQ+QVRSP+AFSWTQL
Sbjct  730  TFVARKGASLTGRSEFGAIVWRNAQHQVRSPVAFSWTQL  768



>gb|KDP33922.1| hypothetical protein JCGZ_07493 [Jatropha curcas]
Length=765

 Score =   240 bits (613),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 108/160 (68%), Positives = 129/160 (81%), Gaps = 0/160 (0%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHVDPHKAL+PGLVYDI+  +Y  FLCSL YT   +QAIVK PN+TC+KK  +P +LNYP
Sbjct  606  GHVDPHKALTPGLVYDISTQEYEAFLCSLGYTIDHVQAIVKRPNVTCSKKFRDPGELNYP  665

Query  407  SFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTV  228
            SFSV+F   R+VR TRELTNVG AG++YEVA+  P +V VTVKPTKLVFKNVGD+LRYTV
Sbjct  666  SFSVVFASKRVVRYTRELTNVGEAGSIYEVAVNGPSTVGVTVKPTKLVFKNVGDKLRYTV  725

Query  227  TFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQLF  108
            TFV+KKG    + + FGS+ W NAQ+QVRSPIAF+WT L 
Sbjct  726  TFVAKKGANQDARSEFGSIVWRNAQHQVRSPIAFTWTHLL  765



>ref|XP_011039978.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=767

 Score =   239 bits (609),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 109/159 (69%), Positives = 131/159 (82%), Gaps = 1/159 (1%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHVDP KALSPGLVYDI+  DY  FLCSLDYT + +QAIVK PNITC++K  NP  LNYP
Sbjct  610  GHVDPQKALSPGLVYDISTDDYVAFLCSLDYTIEHVQAIVKRPNITCSRKF-NPGNLNYP  668

Query  407  SFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTV  228
            SFSV+F  +R+VR TRELTNVGAAG++YEVA+  P +V VTVKP+KLVFKN+GD+LRYTV
Sbjct  669  SFSVVFTNNRVVRYTRELTNVGAAGSIYEVAVTGPQAVQVTVKPSKLVFKNIGDKLRYTV  728

Query  227  TFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQL  111
            TFV++KG      + FG++ W NAQ+QVRSP+AFSWTQL
Sbjct  729  TFVARKGASLTGRSEFGAIMWRNAQHQVRSPVAFSWTQL  767



>gb|EYU25845.1| hypothetical protein MIMGU_mgv1a013289mg [Erythranthe guttata]
Length=225

 Score =   222 bits (565),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 106/163 (65%), Positives = 124/163 (76%), Gaps = 6/163 (4%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCA--KKLSNPAQLN  414
            GHVDPHKALSPGLVYD  P DY  FLCSLDYT   +Q I + PN TC+  ++  +P QLN
Sbjct  60   GHVDPHKALSPGLVYDATPDDYVSFLCSLDYTDDAVQLIARRPNATCSSSRRFRDPGQLN  119

Query  413  YPSFSVLFG----KSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGD  246
            YPSFSV+FG     SR+VR TRELTNVG AG+ Y   IEAPP+V  TVKP+KLVF NVGD
Sbjct  120  YPSFSVVFGGGKKNSRVVRYTRELTNVGPAGSAYVAEIEAPPTVVATVKPSKLVFGNVGD  179

Query  245  RLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWT  117
            +LRYTVTFVSKK V     + FGS++W NAQ+QVRSP++FSWT
Sbjct  180  KLRYTVTFVSKKDVDYSLTSGFGSITWKNAQHQVRSPVSFSWT  222



>ref|XP_010047469.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
 gb|KCW79384.1| hypothetical protein EUGRSUZ_C00797 [Eucalyptus grandis]
Length=768

 Score =   233 bits (593),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 105/159 (66%), Positives = 128/159 (81%), Gaps = 0/159 (0%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHVDP KALSPGLVYDI+  DY  FLCSLDYT  Q++A+ K PN+TC++K ++P QLNYP
Sbjct  609  GHVDPEKALSPGLVYDISTDDYVAFLCSLDYTIDQVRAVAKRPNVTCSRKFADPGQLNYP  668

Query  407  SFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTV  228
            SFSVLFG  RIVR TR+LTNVGAAG++Y V +  PP+V VTVKP KLVF  VGDR  YTV
Sbjct  669  SFSVLFGSKRIVRYTRQLTNVGAAGSVYAVTVMGPPAVEVTVKPPKLVFAKVGDRRSYTV  728

Query  227  TFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQL  111
            TFVSKKG+     + FGS+ W+NAQN+VRSP+A++WTQ+
Sbjct  729  TFVSKKGMNQTVRSDFGSIVWSNAQNEVRSPVAYAWTQI  767



>dbj|BAD94244.1| serine protease like protein [Arabidopsis thaliana]
Length=334

 Score =   221 bits (563),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 100/159 (63%), Positives = 127/159 (80%), Gaps = 0/159 (0%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHVDP KALSPGLVYDI+  +Y  FLCSLDYT   I AIVK P++ C+KK S+P QLNYP
Sbjct  176  GHVDPQKALSPGLVYDISTEEYIRFLCSLDYTVDHIVAIVKRPSVNCSKKFSDPGQLNYP  235

Query  407  SFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTV  228
            SFSVLFG  R+VR TR++TNVGAA ++Y+V +   PSV ++VKP+KL FK+VG++ RYTV
Sbjct  236  SFSVLFGGKRVVRYTRKVTNVGAASSVYKVTVNGAPSVGISVKPSKLSFKSVGEKKRYTV  295

Query  227  TFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQL  111
            TFVSKKGV   + A FGS++W+N Q++VRSP+AFSW + 
Sbjct  296  TFVSKKGVSMTNKAEFGSITWSNPQHEVRSPVAFSWNRF  334



>ref|XP_008242250.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=763

 Score =   230 bits (587),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 102/160 (64%), Positives = 128/160 (80%), Gaps = 0/160 (0%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHV+P KALSPGLVYDI+  DY  FLCSLDYT + +QAIVK PN+TC++K S+P QLNYP
Sbjct  603  GHVEPQKALSPGLVYDISTDDYVAFLCSLDYTLEHVQAIVKKPNVTCSRKYSDPGQLNYP  662

Query  407  SFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTV  228
            SFSV+FGK R+VR +RE TNVGAAG++Y VA+  P  V + VKPT+LVFKNVG++ +YTV
Sbjct  663  SFSVVFGKKRVVRYSREFTNVGAAGSIYRVAVTGPQMVRIAVKPTRLVFKNVGEKQKYTV  722

Query  227  TFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQLF  108
            TFV+ KG    + + FGS+ W N Q+QV+SPIAF+WTQL 
Sbjct  723  TFVANKGADKTARSEFGSIVWQNPQHQVKSPIAFAWTQLI  762



>ref|XP_007204263.1| hypothetical protein PRUPE_ppa001798mg [Prunus persica]
 gb|EMJ05462.1| hypothetical protein PRUPE_ppa001798mg [Prunus persica]
Length=763

 Score =   229 bits (584),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 102/160 (64%), Positives = 128/160 (80%), Gaps = 0/160 (0%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHV+P KALSPGLVYDI+  DY  FLCSLDYT + +QAIVK PN+TC++K S+P QLNYP
Sbjct  603  GHVEPQKALSPGLVYDISTDDYVAFLCSLDYTLEHVQAIVKKPNVTCSRKYSDPGQLNYP  662

Query  407  SFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTV  228
            SFSV+FG  R+VR +RELTNVGAAG++Y VA+  P  V + VKPT+LVFKNVG++ +YTV
Sbjct  663  SFSVVFGNKRVVRYSRELTNVGAAGSIYRVAVTGPQMVRIAVKPTRLVFKNVGEKQKYTV  722

Query  227  TFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQLF  108
            TFV+ KG    + + FGS+ W N Q+QV+SPIAF+WTQL 
Sbjct  723  TFVANKGADKTARSEFGSIVWANPQHQVKSPIAFAWTQLI  762



>ref|XP_010090170.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB38967.1| Subtilisin-like protease [Morus notabilis]
Length=761

 Score =   228 bits (582),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 106/159 (67%), Positives = 125/159 (79%), Gaps = 0/159 (0%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHVDP KALSPGLVYDI+  +Y  FLCSLDYTT  IQ IVK  N TC+KK S+P  LNYP
Sbjct  603  GHVDPQKALSPGLVYDISVDEYINFLCSLDYTTDHIQTIVKHRNFTCSKKFSDPGALNYP  662

Query  407  SFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTV  228
            SFSVLF   R+VR TR LTNVGAA ++Y VA+ APP+V VTVKP KL FK+VG+RLRYTV
Sbjct  663  SFSVLFANKRVVRYTRRLTNVGAAASVYTVAVNAPPTVKVTVKPAKLAFKSVGERLRYTV  722

Query  227  TFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQL  111
            TFV+ +G    S + FGS+ W+NA++QVRSP AF+WTQL
Sbjct  723  TFVASRGAARTSRSEFGSIVWSNAEHQVRSPAAFAWTQL  761



>gb|KHN12283.1| Subtilisin-like protease, partial [Glycine soja]
Length=438

 Score =   219 bits (558),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 102/159 (64%), Positives = 121/159 (76%), Gaps = 0/159 (0%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHV+PHKALSPGLVYD  P+DY  FLCSL+YT ++IQ I K   + C K+ S+P QLNYP
Sbjct  280  GHVNPHKALSPGLVYDATPSDYIKFLCSLEYTPERIQLITKRSGVNCTKRFSDPGQLNYP  339

Query  407  SFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTV  228
            SFSVLFG  R+VR TR LTNVG AG++Y V ++AP +VTVTVKP  LVF  VG+R RYT 
Sbjct  340  SFSVLFGGKRVVRYTRVLTNVGEAGSVYNVTVDAPSTVTVTVKPVALVFGKVGERQRYTA  399

Query  227  TFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQL  111
            TFVSK GV       FGS+ W+NAQ+QVRSP+AFSWT L
Sbjct  400  TFVSKNGVGDSVRYGFGSILWSNAQHQVRSPVAFSWTLL  438



>ref|XP_010049348.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
 gb|KCW81893.1| hypothetical protein EUGRSUZ_C03260 [Eucalyptus grandis]
Length=778

 Score =   226 bits (575),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 99/159 (62%), Positives = 127/159 (80%), Gaps = 0/159 (0%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHVDP KALSPGLVYD+   DY  FLCSLDYT   ++ IVK PN+TC++K S+P +LNYP
Sbjct  618  GHVDPQKALSPGLVYDLTAEDYIAFLCSLDYTIDHVKTIVKRPNVTCSRKFSDPGELNYP  677

Query  407  SFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTV  228
            SFSV+F   ++VR TRELTNVGAAG++Y V++  P +V VTVKP KL+F  VGD++RYTV
Sbjct  678  SFSVVFNDKKVVRYTRELTNVGAAGSMYNVSVTGPSTVGVTVKPMKLIFPKVGDKMRYTV  737

Query  227  TFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQL  111
            TFVSKKG    + + FGS+ W+NAQN+VRSP+A++WT+L
Sbjct  738  TFVSKKGTNPTTRSEFGSIVWSNAQNKVRSPVAYAWTKL  776



>ref|XP_010042589.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
Length=781

 Score =   225 bits (574),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 99/159 (62%), Positives = 127/159 (80%), Gaps = 0/159 (0%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHVDP KALSPGLVYD+   DY  FLCSLDYT   ++ IVK PN+TC++K S+P +LNYP
Sbjct  621  GHVDPQKALSPGLVYDLTAEDYIAFLCSLDYTIDHVKTIVKRPNVTCSRKFSDPGELNYP  680

Query  407  SFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTV  228
            SFSV+F   ++VR TRELTNVGAAG++Y V++  P +V VTVKP KL+F  VGD++RYTV
Sbjct  681  SFSVVFNDKKVVRYTRELTNVGAAGSMYNVSVTGPSTVGVTVKPMKLIFPKVGDKMRYTV  740

Query  227  TFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQL  111
            TFVSKKG    + + FGS+ W+NAQN+VRSP+A++WT+L
Sbjct  741  TFVSKKGTNPTTRSEFGSIVWSNAQNKVRSPVAYAWTKL  779



>gb|KGN66306.1| hypothetical protein Csa_1G597040 [Cucumis sativus]
Length=566

 Score =   222 bits (565),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/159 (63%), Positives = 125/159 (79%), Gaps = 0/159 (0%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHVDPHKALSPGL+YDI+  DY  FLCSLDY    +QAIVK  NITC++K ++P QLNYP
Sbjct  408  GHVDPHKALSPGLLYDISTNDYVAFLCSLDYGIDHVQAIVKRSNITCSRKFADPGQLNYP  467

Query  407  SFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTV  228
            SFSV+FG  R+VR TR +TNVGAAG++Y+VA  APP V VTVKP+KLVF  VG+R RYTV
Sbjct  468  SFSVVFGSKRVVRYTRIVTNVGAAGSVYDVATTAPPVVKVTVKPSKLVFTKVGERKRYTV  527

Query  227  TFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQL  111
            TFV+ +     +   FGS+ W+N Q+QVRSP++F+WT+L
Sbjct  528  TFVASRDAAQTTRFGFGSIVWSNDQHQVRSPVSFAWTRL  566



>ref|XP_010051409.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
Length=791

 Score =   225 bits (573),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 99/158 (63%), Positives = 127/158 (80%), Gaps = 0/158 (0%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHVDP KALSPGLVYD+   DY  FLCSLDYT   ++AIVK PN+TC++K S+P +LNYP
Sbjct  617  GHVDPQKALSPGLVYDLKAEDYIAFLCSLDYTIDHVKAIVKRPNVTCSRKFSDPGELNYP  676

Query  407  SFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTV  228
            SFSV+F   ++VR TRELTNVGAAG++Y V++  P +V VTVKP KL+F  VGD++RYTV
Sbjct  677  SFSVVFNDKKVVRYTRELTNVGAAGSMYNVSVTGPSTVGVTVKPMKLIFPKVGDKMRYTV  736

Query  227  TFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQ  114
            TFVSKKG    + + FGS+ W+NAQN+VRSP+A++WT+
Sbjct  737  TFVSKKGTNPTTRSEFGSIVWSNAQNKVRSPVAYAWTK  774



>emb|CDY18042.1| BnaC07g04280D [Brassica napus]
Length=737

 Score =   224 bits (570),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 101/159 (64%), Positives = 126/159 (79%), Gaps = 0/159 (0%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHVDP KALSPGLVYDI+  +Y  FLCSLDYT   I AIVK P++ C+ K SNP QLNYP
Sbjct  579  GHVDPQKALSPGLVYDISTEEYIRFLCSLDYTVDHIVAIVKRPSVNCSNKFSNPGQLNYP  638

Query  407  SFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTV  228
            SFSVLFG  R+VR TRE+TNVGAA ++Y+V +   PSV ++VKP+KL F++VG++ RYTV
Sbjct  639  SFSVLFGGKRVVRYTREVTNVGAANSVYKVVVNGAPSVGISVKPSKLAFRSVGEKKRYTV  698

Query  227  TFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQL  111
            TFVSKKGV   + A FGS++W+N Q+QVRSP+AFSW + 
Sbjct  699  TFVSKKGVSLTNKAEFGSITWSNPQHQVRSPVAFSWNRF  737



>ref|NP_565330.1| Subtilase-like protein [Arabidopsis thaliana]
 gb|AAC95169.1| subtilisin-like serine protease, putative [Arabidopsis thaliana]
 gb|AAK59595.1| putative subtilisin serine protease [Arabidopsis thaliana]
 gb|AAN13182.1| putative subtilisin serine protease [Arabidopsis thaliana]
 gb|AEC05985.1| Subtilase-like protein [Arabidopsis thaliana]
Length=754

 Score =   224 bits (571),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 101/159 (64%), Positives = 127/159 (80%), Gaps = 0/159 (0%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHVDP KALSPGLVYDI+  +Y  FLCSLDYT   I AIVK P++ C+KK S+P QLNYP
Sbjct  596  GHVDPQKALSPGLVYDISTEEYIRFLCSLDYTVDHIVAIVKRPSVNCSKKFSDPGQLNYP  655

Query  407  SFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTV  228
            SFSVLFG  R+VR TRE+TNVGAA ++Y+V +   PSV ++VKP+KL FK+VG++ RYTV
Sbjct  656  SFSVLFGGKRVVRYTREVTNVGAASSVYKVTVNGAPSVGISVKPSKLSFKSVGEKKRYTV  715

Query  227  TFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQL  111
            TFVSKKGV   + A FGS++W+N Q++VRSP+AFSW + 
Sbjct  716  TFVSKKGVSMTNKAEFGSITWSNPQHEVRSPVAFSWNRF  754



>gb|KCW81959.1| hypothetical protein EUGRSUZ_C03325 [Eucalyptus grandis]
Length=840

 Score =   224 bits (572),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 99/158 (63%), Positives = 127/158 (80%), Gaps = 0/158 (0%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHVDP KALSPGLVYD+   DY  FLCSLDYT   ++AIVK PN+TC++K S+P +LNYP
Sbjct  617  GHVDPQKALSPGLVYDLKAEDYIAFLCSLDYTIDHVKAIVKRPNVTCSRKFSDPGELNYP  676

Query  407  SFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTV  228
            SFSV+F   ++VR TRELTNVGAAG++Y V++  P +V VTVKP KL+F  VGD++RYTV
Sbjct  677  SFSVVFNDKKVVRYTRELTNVGAAGSMYNVSVTGPSTVGVTVKPMKLIFPKVGDKMRYTV  736

Query  227  TFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQ  114
            TFVSKKG    + + FGS+ W+NAQN+VRSP+A++WT+
Sbjct  737  TFVSKKGTNPTTRSEFGSIVWSNAQNKVRSPVAYAWTK  774



>ref|XP_002278292.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=761

 Score =   223 bits (568),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 103/162 (64%), Positives = 129/162 (80%), Gaps = 3/162 (2%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHVDP KALSPGLVYDI+  DY  FLCSLDYT + ++AIVK  NITC++K S+P +LNYP
Sbjct  600  GHVDPQKALSPGLVYDISTQDYVAFLCSLDYTIEHVRAIVKRQNITCSRKFSDPGELNYP  659

Query  407  SFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTV  228
            SFSVLFG    VR TRELTNVGAA ++Y+VA+  PPSV V V+P+ LVFKNVG++ RYTV
Sbjct  660  SFSVLFGSKGFVRYTRELTNVGAADSVYQVAVTGPPSVGVVVRPSTLVFKNVGEKKRYTV  719

Query  227  TFVSKKGVVTP---SNAAFGSVSWNNAQNQVRSPIAFSWTQL  111
            TFV+KKG       + +AFGS+ W+N Q+QV+SP+A++WTQL
Sbjct  720  TFVAKKGKKVQNRMTRSAFGSIVWSNTQHQVKSPVAYAWTQL  761



>emb|CDY33400.1| BnaA07g04390D [Brassica napus]
Length=751

 Score =   223 bits (568),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 101/159 (64%), Positives = 126/159 (79%), Gaps = 0/159 (0%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHVDP KALSPGLVYDI+  +Y  FLCSLDYT   I AIVK P++ C+KK SNP QLNYP
Sbjct  593  GHVDPQKALSPGLVYDISTEEYIRFLCSLDYTVDHIVAIVKRPSVNCSKKFSNPGQLNYP  652

Query  407  SFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTV  228
            SFSVLFG  R+VR TRE+TNVGA  ++Y+V +   PSV ++VKP+KL F++VG++ RYTV
Sbjct  653  SFSVLFGGKRVVRYTREVTNVGAPNSVYKVVVNGAPSVGISVKPSKLSFRSVGEKKRYTV  712

Query  227  TFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQL  111
            TFVSKKGV   + A FGS++W+N Q+QVRSP+AFSW + 
Sbjct  713  TFVSKKGVSLTNKAEFGSITWSNPQHQVRSPVAFSWNRF  751



>ref|XP_010557668.1| PREDICTED: subtilisin-like protease isoform X1 [Tarenaya hassleriana]
 ref|XP_010557669.1| PREDICTED: subtilisin-like protease isoform X1 [Tarenaya hassleriana]
 ref|XP_010557670.1| PREDICTED: subtilisin-like protease isoform X1 [Tarenaya hassleriana]
 ref|XP_010557671.1| PREDICTED: subtilisin-like protease isoform X2 [Tarenaya hassleriana]
Length=772

 Score =   223 bits (568),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 97/159 (61%), Positives = 128/159 (81%), Gaps = 0/159 (0%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHVDP KA+SPGLVYDI+  +Y  FLCSLDYT   IQAIVK P++ C++K S+P QLNYP
Sbjct  614  GHVDPQKAMSPGLVYDISTEEYIRFLCSLDYTVDHIQAIVKRPSVNCSRKFSDPGQLNYP  673

Query  407  SFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTV  228
            SFSVLFG  R+ R TRELTNVG  G++Y+VA++ P SV VTVKPT+LVF  VG++ RYTV
Sbjct  674  SFSVLFGDKRVARYTRELTNVGTPGSIYKVAVDGPASVAVTVKPTRLVFGAVGEKKRYTV  733

Query  227  TFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQL  111
            TF +K+G+   +++ FGS++W+N+++ VRSP+ FSWT+L
Sbjct  734  TFSAKRGMSLATSSEFGSITWSNSEHSVRSPVVFSWTRL  772



>ref|XP_002885806.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62065.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=752

 Score =   223 bits (567),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 99/159 (62%), Positives = 126/159 (79%), Gaps = 0/159 (0%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHVDP KALSPGLVYDI+  +Y  FLCSLDYT   I AIVK P++ C+KK S+P QLNYP
Sbjct  594  GHVDPQKALSPGLVYDISTEEYIRFLCSLDYTVDHIVAIVKRPSVNCSKKFSDPGQLNYP  653

Query  407  SFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTV  228
            SFSVLFG  R+VR TRE+TNVGA  ++Y+V +   PSV ++VKP+KL F++VG++ RYTV
Sbjct  654  SFSVLFGGKRVVRYTREVTNVGAENSVYKVTVNGAPSVAISVKPSKLAFRSVGEKKRYTV  713

Query  227  TFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQL  111
            TFVSKKGV   + A FGS++W+N Q++VRSP+AFSW + 
Sbjct  714  TFVSKKGVSMTNKAEFGSITWSNPQHEVRSPVAFSWNRF  752



>ref|XP_009102354.1| PREDICTED: subtilisin-like protease [Brassica rapa]
Length=763

 Score =   223 bits (567),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 101/159 (64%), Positives = 126/159 (79%), Gaps = 0/159 (0%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHVDP KALSPGLVYDI+  +Y  FLCSLDYT   I AIVK P++ C+KK SNP QLNYP
Sbjct  605  GHVDPQKALSPGLVYDISTEEYIRFLCSLDYTVDHIVAIVKRPSVNCSKKFSNPGQLNYP  664

Query  407  SFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTV  228
            SFSVLFG  R+VR TRE+TNVGA  ++Y+V +   PSV ++VKP+KL F++VG++ RYTV
Sbjct  665  SFSVLFGGKRVVRYTREVTNVGAPNSVYKVVVNGAPSVGISVKPSKLSFRSVGEKKRYTV  724

Query  227  TFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQL  111
            TFVSKKGV   + A FGS++W+N Q+QVRSP+AFSW + 
Sbjct  725  TFVSKKGVSLTNKAEFGSITWSNPQHQVRSPVAFSWNRF  763



>ref|XP_010412797.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=754

 Score =   222 bits (566),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 101/159 (64%), Positives = 125/159 (79%), Gaps = 0/159 (0%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHVDP KALSPGLVYDI+  +Y  FLCSL+YT   I AIVK P++ C+KK S+P QLNYP
Sbjct  596  GHVDPQKALSPGLVYDISTEEYIRFLCSLEYTVDHIVAIVKRPSVNCSKKFSDPGQLNYP  655

Query  407  SFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTV  228
            SFSVLFG  R+VR TRE+TNVGAA ++Y+V +   PSV ++VKPTKL FK VG++ RYTV
Sbjct  656  SFSVLFGGKRVVRYTREVTNVGAASSVYKVMVNGAPSVGISVKPTKLAFKRVGEKKRYTV  715

Query  227  TFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQL  111
            TFVSKKGV   + A FGS++W N Q++VRSP+AFSW + 
Sbjct  716  TFVSKKGVSMTNKAEFGSITWINPQHEVRSPVAFSWNRF  754



>ref|XP_010666857.1| PREDICTED: subtilisin-like protease [Beta vulgaris subsp. vulgaris]
Length=776

 Score =   222 bits (566),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 102/161 (63%), Positives = 130/161 (81%), Gaps = 1/161 (1%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHVDPHKA+SPGLVYDI+  DY  FLCSLDYT    Q I K PNITC++KLS+P QLNYP
Sbjct  615  GHVDPHKAISPGLVYDISVDDYIAFLCSLDYTPLHRQIIAKRPNITCSRKLSDPGQLNYP  674

Query  407  SFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTV  228
            SFS+ FGKSRIVR TRELTNVGAA TLY+V ++AP SV V V+P++L+F+++G++ +YTV
Sbjct  675  SFSIQFGKSRIVRYTRELTNVGAARTLYQVQVDAPRSVGVKVRPSRLLFRSIGEKKKYTV  734

Query  227  TFVSKKGVV-TPSNAAFGSVSWNNAQNQVRSPIAFSWTQLF  108
            TFV++KG    P+  AFGS+ W++  NQVRSP++F+WT L 
Sbjct  735  TFVARKGKTPPPTRTAFGSLLWSSKTNQVRSPVSFTWTTLL  775



>ref|XP_004144036.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
 ref|XP_004166699.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
Length=763

 Score =   221 bits (564),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 100/159 (63%), Positives = 125/159 (79%), Gaps = 0/159 (0%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHVDPHKALSPGL+YDI+  DY  FLCSLDY    +QAIVK  NITC++K ++P QLNYP
Sbjct  605  GHVDPHKALSPGLLYDISTNDYVAFLCSLDYGIDHVQAIVKRSNITCSRKFADPGQLNYP  664

Query  407  SFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTV  228
            SFSV+FG  R+VR TR +TNVGAAG++Y+VA  APP V VTVKP+KLVF  VG+R RYTV
Sbjct  665  SFSVVFGSKRVVRYTRIVTNVGAAGSVYDVATTAPPVVKVTVKPSKLVFTKVGERKRYTV  724

Query  227  TFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQL  111
            TFV+ +     +   FGS+ W+N Q+QVRSP++F+WT+L
Sbjct  725  TFVASRDAAQTTRFGFGSIVWSNDQHQVRSPVSFAWTRL  763



>ref|XP_003533787.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=770

 Score =   221 bits (562),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 102/159 (64%), Positives = 121/159 (76%), Gaps = 0/159 (0%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHV+PHKALSPGLVYD  P+DY  FLCSL+YT ++IQ I K   + C K+ S+P QLNYP
Sbjct  612  GHVNPHKALSPGLVYDATPSDYIKFLCSLEYTPERIQLITKRSGVNCTKRFSDPGQLNYP  671

Query  407  SFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTV  228
            SFSVLFG  R+VR TR LTNVG AG++Y V ++AP +VTVTVKP  LVF  VG+R RYT 
Sbjct  672  SFSVLFGGKRVVRYTRVLTNVGEAGSVYNVTVDAPSTVTVTVKPAALVFGKVGERQRYTA  731

Query  227  TFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQL  111
            TFVSK GV       FGS+ W+NAQ+QVRSP+AFSWT L
Sbjct  732  TFVSKNGVGDSVRYGFGSIMWSNAQHQVRSPVAFSWTLL  770



>ref|XP_010467108.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=756

 Score =   220 bits (561),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 100/159 (63%), Positives = 125/159 (79%), Gaps = 0/159 (0%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHVDP KALSPGLVYDI+  +Y  FLCSL+YT   I AIVK P++ C+KK S+P QLNYP
Sbjct  598  GHVDPQKALSPGLVYDISTEEYIRFLCSLEYTVDHIVAIVKRPSVNCSKKFSDPGQLNYP  657

Query  407  SFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTV  228
            SFSVLFG  R+VR TRE+TNVGAA ++Y+V +   PSV ++VKP KL FK+VG++ RYTV
Sbjct  658  SFSVLFGGKRVVRYTREVTNVGAASSVYKVMVNGAPSVGISVKPLKLAFKSVGEKKRYTV  717

Query  227  TFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQL  111
            TFVSKKGV   + A FGS++W N Q++VRSP+AFSW + 
Sbjct  718  TFVSKKGVSMTNKAEFGSITWINPQHEVRSPVAFSWNRF  756



>ref|XP_010488783.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=755

 Score =   220 bits (560),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 101/159 (64%), Positives = 125/159 (79%), Gaps = 0/159 (0%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHVDP KALSPGLVYDI+  +Y  FLCSL+YT   I AIVK P++ C+KK S+P QLNYP
Sbjct  597  GHVDPLKALSPGLVYDISTEEYIRFLCSLEYTVDHIVAIVKRPSVNCSKKFSDPGQLNYP  656

Query  407  SFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTV  228
            SFSVLFG  R+VR TRE+TNVGAA ++Y+V +   PSV V+VKP KL FK+VG++ RYTV
Sbjct  657  SFSVLFGGKRVVRYTREVTNVGAASSVYKVMVNGAPSVGVSVKPLKLAFKSVGEKKRYTV  716

Query  227  TFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQL  111
            TFVSKKGV   + A FGS++W N Q++VRSP+AFSW + 
Sbjct  717  TFVSKKGVSMTNKAEFGSITWINPQHEVRSPVAFSWNRF  755



>ref|XP_006396129.1| hypothetical protein EUTSA_v10002410mg [Eutrema salsugineum]
 gb|ESQ36908.1| hypothetical protein EUTSA_v10002410mg [Eutrema salsugineum]
Length=762

 Score =   219 bits (559),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 99/159 (62%), Positives = 123/159 (77%), Gaps = 0/159 (0%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHVDP KAL+PGLVYDI+  +Y  FLCSLDYT   I AIVK P++ C KK SNP QLNYP
Sbjct  604  GHVDPLKALTPGLVYDISTEEYIKFLCSLDYTVDHIVAIVKRPSVNCLKKFSNPGQLNYP  663

Query  407  SFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTV  228
            SFSVLFG  R+VR TRE+TNVGAA  +Y+V +   PSV ++VKP+KL F+ VG++ RYTV
Sbjct  664  SFSVLFGGKRVVRYTREVTNVGAANAVYKVVVSGAPSVGISVKPSKLAFRKVGEKKRYTV  723

Query  227  TFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQL  111
            TFVSKKGV   + A +GS++W N Q++VRSP+AFSW + 
Sbjct  724  TFVSKKGVSLTNKAEYGSITWTNTQHEVRSPVAFSWNRF  762



>ref|XP_009767539.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=761

 Score =   219 bits (557),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 109/158 (69%), Positives = 126/158 (80%), Gaps = 4/158 (3%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHV+P KALSPGLVYDI   D+  FLCSLDY   QIQAIVK  N TCA K ++  Q+NYP
Sbjct  601  GHVNPQKALSPGLVYDIRIQDHIKFLCSLDYPMDQIQAIVKRVNFTCANKFADAGQINYP  660

Query  407  SFSVLFG--KSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRY  234
            SFSVLFG   +R+VR TRE+TNVGAA ++YEVAI+AP SVT TVKP KLVFK VG++L Y
Sbjct  661  SFSVLFGINSTRVVRYTREVTNVGAAESVYEVAIDAPSSVTATVKPPKLVFKKVGEKLHY  720

Query  233  TVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
            TVTFVSKKGV T +  AFG +SW NA+NQVRSP+AFSW
Sbjct  721  TVTFVSKKGVKTGN--AFGWISWENAENQVRSPVAFSW  756



>ref|XP_009359724.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=764

 Score =   218 bits (556),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 101/162 (62%), Positives = 126/162 (78%), Gaps = 2/162 (1%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHVDP KALSPGLVYDIA  DY  FLCSL+YT + +QAIVK PN+TCA+K S+P QLNYP
Sbjct  602  GHVDPSKALSPGLVYDIATEDYIAFLCSLEYTNEHVQAIVKRPNVTCARKYSDPGQLNYP  661

Query  407  SFSVLF--GKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRY  234
            SFSV+F   K R+V  TRELTNVG AG++Y VA+ +P  V   VKPT+LVF NVG++ +Y
Sbjct  662  SFSVMFWNKKKRVVSYTRELTNVGPAGSVYRVAVTSPSMVRTIVKPTRLVFNNVGEKQKY  721

Query  233  TVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQLF  108
            TVTFV+ +G    S + FGS+ W+N Q+QV+SP+AF+WTQL 
Sbjct  722  TVTFVASQGAEKTSRSEFGSIMWSNPQHQVKSPVAFAWTQLI  763



>gb|EYU25847.1| hypothetical protein MIMGU_mgv1a001711mg [Erythranthe guttata]
Length=770

 Score =   218 bits (555),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 103/163 (63%), Positives = 123/163 (75%), Gaps = 6/163 (4%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCA--KKLSNPAQLN  414
            GHVDPHKALSPGLVYD  P DY  FLCSLDYT   +Q I + PN TC+  ++  +P QLN
Sbjct  605  GHVDPHKALSPGLVYDATPDDYVSFLCSLDYTDDAVQLIARRPNATCSSSRRFRDPGQLN  664

Query  413  YPSFSVLFG----KSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGD  246
            YPSFSV+FG     SR+VR TRELTNVG AG+ Y   +E PP+V  TVKP+KLVF NVG+
Sbjct  665  YPSFSVVFGGGKKNSRVVRYTRELTNVGPAGSAYVAELEVPPTVGATVKPSKLVFGNVGE  724

Query  245  RLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWT  117
            +LRYTVTFVSKK V     + FGS++W NAQ+QVRSP++FSWT
Sbjct  725  KLRYTVTFVSKKDVDYSLTSGFGSITWKNAQHQVRSPVSFSWT  767



>ref|XP_008450936.1| PREDICTED: subtilisin-like protease [Cucumis melo]
Length=765

 Score =   218 bits (555),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 99/159 (62%), Positives = 124/159 (78%), Gaps = 0/159 (0%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHVDPHKALSPGL+YDI+  DY  FLCSLDY    +QAIVK  NITC++K ++P QLNYP
Sbjct  607  GHVDPHKALSPGLLYDISTNDYIAFLCSLDYGIDHVQAIVKRSNITCSRKFADPGQLNYP  666

Query  407  SFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTV  228
            SFSV+FG  R+VR TR +TNVGAAG++Y+VA  AP  V VTVKP+KLVF  VG+R RYTV
Sbjct  667  SFSVVFGSKRVVRYTRIVTNVGAAGSVYDVATTAPSVVKVTVKPSKLVFTKVGERKRYTV  726

Query  227  TFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQL  111
            TFV+ +     +   FGS+ W+N Q+QVRSP++F+WT+L
Sbjct  727  TFVASRDAAQTTRFGFGSIVWSNDQHQVRSPVSFAWTRL  765



>gb|KDO73903.1| hypothetical protein CISIN_1g004261mg [Citrus sinensis]
Length=765

 Score =   218 bits (554),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 98/160 (61%), Positives = 122/160 (76%), Gaps = 0/160 (0%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHV+P KA+SPGLVYD +  DY  FLCSL YT + +QAIVK PNITC +K + P +LNYP
Sbjct  605  GHVNPQKAISPGLVYDASTEDYVAFLCSLGYTIEHVQAIVKRPNITCTRKFNTPGELNYP  664

Query  407  SFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTV  228
            SFSVLFG  R+VR TRELTNVG A +LY V  + P +V ++V+P +L+F+ VG++ RYTV
Sbjct  665  SFSVLFGDQRVVRYTRELTNVGPARSLYNVTADGPSTVGISVRPKRLLFRTVGEKKRYTV  724

Query  227  TFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQLF  108
            TFV+K G      AAFGS+ W NAQ+QVRSP+AFSWTQL 
Sbjct  725  TFVAKNGDQKMGGAAFGSIVWGNAQHQVRSPVAFSWTQLM  764



>ref|XP_006452813.1| hypothetical protein CICLE_v10007510mg [Citrus clementina]
 gb|ESR66053.1| hypothetical protein CICLE_v10007510mg [Citrus clementina]
Length=784

 Score =   218 bits (554),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 98/160 (61%), Positives = 122/160 (76%), Gaps = 0/160 (0%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHV+P KA+SPGLVYD +  DY  FLCSL YT + +QAIVK PNITC +K + P +LNYP
Sbjct  624  GHVNPQKAISPGLVYDASTEDYVAFLCSLGYTIEHVQAIVKRPNITCTRKFNTPGELNYP  683

Query  407  SFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTV  228
            SFSVLFG  R+VR TRELTNVG A +LY V  + P +V ++V+P +L+F+ VG++ RYTV
Sbjct  684  SFSVLFGDQRVVRYTRELTNVGPARSLYNVTADGPSTVGISVRPKRLLFRTVGEKKRYTV  743

Query  227  TFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQLF  108
            TFV+K G      AAFGS+ W NAQ+QVRSP+AFSWTQL 
Sbjct  744  TFVAKNGDQKMGGAAFGSIVWGNAQHQVRSPVAFSWTQLM  783



>ref|XP_006474722.1| PREDICTED: subtilisin-like protease-like isoform X1 [Citrus sinensis]
 ref|XP_006474723.1| PREDICTED: subtilisin-like protease-like isoform X2 [Citrus sinensis]
Length=765

 Score =   217 bits (553),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 97/160 (61%), Positives = 123/160 (77%), Gaps = 0/160 (0%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHV+P KA+SPGLVYD +  DY  FLCSL YT + ++AIVK PNITC +K + P +LNYP
Sbjct  605  GHVNPQKAISPGLVYDASTEDYIAFLCSLGYTIEHVKAIVKRPNITCTRKFNTPGELNYP  664

Query  407  SFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTV  228
            SFSVLFG  R+VR TRELTNVG A +LY V ++ P +V ++V+P +L+F+ VG++ RYTV
Sbjct  665  SFSVLFGDQRVVRYTRELTNVGPARSLYNVTVDGPSTVGISVRPKRLLFRTVGEKKRYTV  724

Query  227  TFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQLF  108
            TFV+K G      AAFGS+ W NAQ+QVRSP+AFSWTQL 
Sbjct  725  TFVAKNGDQKMGGAAFGSIVWGNAQHQVRSPVAFSWTQLM  764



>ref|XP_009590702.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=778

 Score =   217 bits (553),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 106/158 (67%), Positives = 126/158 (80%), Gaps = 4/158 (3%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHV+P KALSPGL+YDI   D+  FLCSL Y   QIQAIVK  N TCA K ++  Q+NYP
Sbjct  618  GHVNPQKALSPGLIYDIRIQDHIKFLCSLHYPMDQIQAIVKRVNFTCANKFADAGQINYP  677

Query  407  SFSVLFG--KSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRY  234
            SFSVLFG   +R+VR TRE+TNVGAAG++YEVAI+ P SVTVTVKP KLVFK VG++L Y
Sbjct  678  SFSVLFGVNSTRVVRYTREVTNVGAAGSVYEVAIDGPSSVTVTVKPPKLVFKKVGEKLHY  737

Query  233  TVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
            TVTFVSKKG+ T +  AFG +SW NA+NQVRSP+A+SW
Sbjct  738  TVTFVSKKGIKTGN--AFGWISWKNAENQVRSPVAYSW  773



>gb|KFK39884.1| hypothetical protein AALP_AA3G301200 [Arabis alpina]
Length=754

 Score =   217 bits (553),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 97/159 (61%), Positives = 124/159 (78%), Gaps = 0/159 (0%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHVDP KALSPGLVYDI+  +Y  FLCSLDYT   I AIVK P++ C+KK ++P QLNYP
Sbjct  596  GHVDPQKALSPGLVYDISTEEYIRFLCSLDYTVDHIVAIVKRPSVNCSKKFADPGQLNYP  655

Query  407  SFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTV  228
            SFSV+FG  R+VR TRE+TNVGAA ++Y+V +    SV ++VKP KL F+ VG++ RYTV
Sbjct  656  SFSVVFGGKRVVRYTREVTNVGAASSVYKVTVNGAASVGISVKPAKLAFRRVGEKKRYTV  715

Query  227  TFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQL  111
            TFVSKKGV   + A FGS++W+N Q++VRSP+AFSW + 
Sbjct  716  TFVSKKGVSLTNKAEFGSITWSNPQHEVRSPVAFSWNRF  754



>ref|XP_006297042.1| hypothetical protein CARUB_v10013038mg [Capsella rubella]
 gb|EOA29940.1| hypothetical protein CARUB_v10013038mg [Capsella rubella]
Length=757

 Score =   216 bits (551),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 98/159 (62%), Positives = 123/159 (77%), Gaps = 0/159 (0%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHVDP KALSPGLVYDI+  +Y  FLCSL+YT   I AIVK  ++ C KK S+P QLNYP
Sbjct  599  GHVDPQKALSPGLVYDISTEEYIRFLCSLEYTVDHIVAIVKRSSVNCTKKFSDPGQLNYP  658

Query  407  SFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTV  228
            SFSVLFG  R+VR TRE+TNVGAA ++Y+V +   P+V ++VKP+KL FK VG++ RYTV
Sbjct  659  SFSVLFGGKRVVRYTREVTNVGAANSVYKVMVNGAPTVEISVKPSKLTFKRVGEKKRYTV  718

Query  227  TFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQL  111
            TFVSKKGV   + A FGS++W N Q++VRSP+AFSW + 
Sbjct  719  TFVSKKGVSMTNKAEFGSITWINPQHEVRSPVAFSWNRF  757



>ref|XP_003595292.1| Subtilisin-like protease [Medicago truncatula]
 gb|AES65543.1| subtilisin-like serine protease [Medicago truncatula]
Length=779

 Score =   216 bits (551),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 99/161 (61%), Positives = 126/161 (78%), Gaps = 1/161 (1%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHV+P KALSPGLVYD +  DY  FLCSL+Y ++QIQ IVK P++ C KK +NP QLNYP
Sbjct  618  GHVNPQKALSPGLVYDASTKDYITFLCSLNYNSEQIQLIVKRPSVNCTKKFANPGQLNYP  677

Query  407  SFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTV  228
            SFSV+F   R+VR TR +TNVG AG++Y V ++ P SV +TVKP++LVF+ VG+R RYTV
Sbjct  678  SFSVVFSSKRVVRYTRIVTNVGEAGSVYNVVVDVPSSVGITVKPSRLVFEKVGERKRYTV  737

Query  227  TFVSKKGV-VTPSNAAFGSVSWNNAQNQVRSPIAFSWTQLF  108
            TFVSKKG   +   + FGS+ W+NAQ+QVRSPIAF+WT+L 
Sbjct  738  TFVSKKGADASKVRSGFGSILWSNAQHQVRSPIAFAWTELL  778



>gb|KHN06066.1| Subtilisin-like protease [Glycine soja]
Length=598

 Score =   213 bits (543),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 96/158 (61%), Positives = 120/158 (76%), Gaps = 0/158 (0%)
 Frame = -2

Query  584  HVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYPS  405
            H++PHKALSPGLVYD    DY  FLCSL+YT + IQ I K   + C KK S+P QLNYPS
Sbjct  441  HMNPHKALSPGLVYDAIAWDYVKFLCSLEYTPEHIQLITKRHGVNCTKKFSDPGQLNYPS  500

Query  404  FSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTVT  225
            FS+LFG  R+VR TR L NVG  G++Y V ++AP ++T+ VKPT+LVF+ VG+R RYTVT
Sbjct  501  FSILFGGKRVVRYTRVLINVGETGSIYNVTVDAPSTMTIKVKPTRLVFEKVGERQRYTVT  560

Query  224  FVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQL  111
            FVSK+GV   +   FGS+ W+NAQ+QVRSP+AFSWT L
Sbjct  561  FVSKRGVGDSARYGFGSIMWSNAQHQVRSPVAFSWTLL  598



>ref|XP_008337844.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=764

 Score =   214 bits (546),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 99/162 (61%), Positives = 125/162 (77%), Gaps = 2/162 (1%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GH+DP KALSPGLVYDIA  DY  FLCSL+YT + +QAIVK PN+TCA+K S+P QLNYP
Sbjct  602  GHIDPSKALSPGLVYDIATEDYIAFLCSLEYTKEHVQAIVKRPNVTCARKYSDPGQLNYP  661

Query  407  SFSVLF--GKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRY  234
            SFSV+F   K R+V  TRELTNVG AG++Y VA+ +P  V   VKPT+LVF NVG++ +Y
Sbjct  662  SFSVVFWNKKKRVVSYTRELTNVGPAGSVYRVAVTSPSMVRTIVKPTRLVFNNVGEKQKY  721

Query  233  TVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQLF  108
             VTFV+ +G    S + FGS+ W+N Q+QV+SP+AF+WTQL 
Sbjct  722  RVTFVASRGAEKTSRSEFGSIMWSNPQHQVKSPVAFAWTQLI  763



>ref|XP_004488082.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=774

 Score =   214 bits (546),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 99/160 (62%), Positives = 122/160 (76%), Gaps = 1/160 (1%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHV+P KA SPGLVYD +  DY  FLCSL+Y  +QIQ IVK P++ C  K +NP QLNYP
Sbjct  615  GHVNPQKAFSPGLVYDASTKDYITFLCSLNYNPEQIQLIVKRPDVNCTNKFANPGQLNYP  674

Query  407  SFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTV  228
            SFS++F   R+VR TR LTNVG AG++Y V ++ P  V +TVKP++LVF+ VGDR RYTV
Sbjct  675  SFSIMFSSKRVVRYTRILTNVGEAGSVYNVVVDGPSWVDITVKPSRLVFEKVGDRKRYTV  734

Query  227  TFVSKKGVVTPS-NAAFGSVSWNNAQNQVRSPIAFSWTQL  111
            TFVSKKGV T S    FGS+ W+N Q+QVRSPIAF+WT+L
Sbjct  735  TFVSKKGVDTSSVRNGFGSILWSNTQHQVRSPIAFAWTEL  774



>ref|XP_007138654.1| hypothetical protein PHAVU_009G226900g [Phaseolus vulgaris]
 gb|ESW10648.1| hypothetical protein PHAVU_009G226900g [Phaseolus vulgaris]
Length=761

 Score =   214 bits (545),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/159 (62%), Positives = 121/159 (76%), Gaps = 0/159 (0%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHV+PH+ALSPGLVYD + TDY  FLCSLDYT + IQ IVK   + C +K S+P QLNYP
Sbjct  603  GHVNPHRALSPGLVYDASITDYIKFLCSLDYTPEHIQLIVKRHAVNCTRKFSDPGQLNYP  662

Query  407  SFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTV  228
            SFS+ FG  R+VR TR LTNVG AG++Y+V ++AP +V VTV+P +LVF  +G+R RYTV
Sbjct  663  SFSIHFGGKRVVRYTRTLTNVGEAGSVYDVTVDAPSTVEVTVRPARLVFGKLGERKRYTV  722

Query  227  TFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQL  111
            TFVSKK         FGS+ W+NAQ+QVRSP+AFSWT L
Sbjct  723  TFVSKKSGGDSGRYGFGSIMWSNAQHQVRSPVAFSWTLL  761



>gb|AHA84190.1| subtilisin-like protease [Phaseolus vulgaris]
Length=760

 Score =   214 bits (544),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 98/159 (62%), Positives = 121/159 (76%), Gaps = 0/159 (0%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHV+PH+ALSPGLVYD + TDY  FLCSLDYT + IQ IVK   + C +K S+P QLNYP
Sbjct  602  GHVNPHRALSPGLVYDASITDYIKFLCSLDYTPEHIQLIVKRHAVNCTRKFSDPGQLNYP  661

Query  407  SFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTV  228
            SFS+ FG  R+VR TR LTNVG AG++Y+V ++AP +V VTV+P +LVF  +G+R RYTV
Sbjct  662  SFSIHFGGKRVVRYTRTLTNVGEAGSVYDVTVDAPSTVEVTVRPARLVFGKLGERKRYTV  721

Query  227  TFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQL  111
            TFVSKK         FGS+ W+NAQ+QVRSP+AFSWT L
Sbjct  722  TFVSKKSGGDSGRYGFGSIMWSNAQHQVRSPVAFSWTLL  760



>ref|XP_008792868.1| PREDICTED: subtilisin-like protease [Phoenix dactylifera]
Length=766

 Score =   213 bits (541),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 100/158 (63%), Positives = 126/158 (80%), Gaps = 3/158 (2%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            G+VDP KALSPGLVYDIA  DYT FLCSLDY+T  I AI ++PN TC+++LS+P  LNYP
Sbjct  608  GYVDPQKALSPGLVYDIAAEDYTAFLCSLDYSTNHILAISQSPNTTCSRRLSDPGNLNYP  667

Query  407  SFSVLFGKS--RIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRY  234
            SFSV+FG+   RIVR +RELTNVG +G++Y +    PPSV+VTV+PTKLVFK VG++L+Y
Sbjct  668  SFSVIFGRKSRRIVRYSRELTNVGLSGSVYNLTYSGPPSVSVTVRPTKLVFKQVGEKLKY  727

Query  233  TVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
            TVTF SKK    P++ AFG +SW N Q+QVRSPI++ W
Sbjct  728  TVTFTSKK-QGNPTDMAFGWISWKNEQHQVRSPISYMW  764



>gb|EYU28325.1| hypothetical protein MIMGU_mgv1a001748mg [Erythranthe guttata]
Length=765

 Score =   213 bits (541),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 97/159 (61%), Positives = 121/159 (76%), Gaps = 0/159 (0%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHVDPHKALSPGLVYD  P DY  FLCSL YT + +Q + K PNITC+K+  +P QLNYP
Sbjct  607  GHVDPHKALSPGLVYDATPEDYVSFLCSLGYTKEMVQIVAKHPNITCSKRFHDPGQLNYP  666

Query  407  SFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTV  228
            SFSV+F K+ +VR +RELTNVG AG  Y V+++APP+V V+V P+ LVFKNVGD+ R+ V
Sbjct  667  SFSVMFRKTGVVRYSRELTNVGPAGLTYRVSVDAPPNVEVSVSPSTLVFKNVGDKRRFRV  726

Query  227  TFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQL  111
            TFV KK V       FGS+ W+NA ++V SP+A+SWTQL
Sbjct  727  TFVWKKEVGPVVRHGFGSIVWSNALHRVSSPVAYSWTQL  765



>ref|XP_008388846.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=764

 Score =   212 bits (539),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 96/162 (59%), Positives = 123/162 (76%), Gaps = 2/162 (1%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHVDP KALSPGLVYD    DY  FLCSL+YT + +QAIVK PN+TCA+K S+P QLNYP
Sbjct  602  GHVDPSKALSPGLVYDTTAEDYIAFLCSLEYTNEHVQAIVKRPNVTCARKYSDPGQLNYP  661

Query  407  SFSVLFG--KSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRY  234
            SFS++FG    R+VR TRELTNVGAAG++Y  ++ +P +V   VKPT+LVF NVG++ +Y
Sbjct  662  SFSIVFGSKNKRVVRYTRELTNVGAAGSVYRASVTSPSTVRTIVKPTRLVFNNVGEKQKY  721

Query  233  TVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQLF  108
            TVTFV+  G    + + FGS+ W N Q+QV+SP+ F+WTQL 
Sbjct  722  TVTFVALPGAXKTARSEFGSIVWANPQHQVKSPVTFAWTQLI  763



>ref|XP_008782639.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Phoenix 
dactylifera]
Length=772

 Score =   211 bits (538),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 97/158 (61%), Positives = 124/158 (78%), Gaps = 3/158 (2%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHVDP KALSPGLVYDI   DY  FLCSLDYT Q IQ IVK PN+TC+++ SNP  LNYP
Sbjct  614  GHVDPRKALSPGLVYDITTDDYIAFLCSLDYTIQHIQVIVKRPNVTCSRRFSNPGDLNYP  673

Query  407  SFSVLFGKS--RIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRY  234
            SFSV+F K   ++V+  RELTNVG+AG++Y V I  P +++VTVKP KL+FK+VG +L+Y
Sbjct  674  SFSVIFEKKSRKVVKYRRELTNVGSAGSVYSVKITGPENISVTVKPAKLIFKHVGQKLKY  733

Query  233  TVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
            +V F SKKG   P NAAFG ++W+N Q++VRSP+A++W
Sbjct  734  SVIFASKKG-GNPKNAAFGWITWSNKQHKVRSPVAYTW  770



>ref|XP_004245414.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=768

 Score =   211 bits (537),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 105/158 (66%), Positives = 126/158 (80%), Gaps = 4/158 (3%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHV+P KA SPGLVYDI   D+  FLCSL+YT  QIQ+IV+  N TCAKK ++  Q+NYP
Sbjct  604  GHVNPQKAFSPGLVYDIRIQDHIKFLCSLNYTIDQIQSIVRRLNFTCAKKFADVGQINYP  663

Query  407  SFSVLF--GKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRY  234
            SFSVLF     R+VR TRE+TNVGAA ++YEVAI+APPSVTVTVKPTKLVFK VG++L Y
Sbjct  664  SFSVLFEINSKRVVRYTREVTNVGAASSVYEVAIDAPPSVTVTVKPTKLVFKKVGEKLHY  723

Query  233  TVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
            TVTFVS K  V P N AFG +SW NA+++VRSP+A+SW
Sbjct  724  TVTFVSMKD-VKPGN-AFGWISWKNAKHEVRSPVAYSW  759



>ref|XP_006356658.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=768

 Score =   211 bits (536),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 105/158 (66%), Positives = 126/158 (80%), Gaps = 4/158 (3%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHV+P KA SPGLVY+I   D+  FLCSL+YT  QIQ+IVK  N TCA K ++  Q+NYP
Sbjct  604  GHVNPQKAFSPGLVYNIRIHDHIKFLCSLNYTIDQIQSIVKRLNFTCANKFADAGQINYP  663

Query  407  SFSVLF--GKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRY  234
            SFSVLF     R+VR TRE+TNVGAA ++YEVA +APPSVTVTVKPTKLVFK VG++L Y
Sbjct  664  SFSVLFEINSKRVVRYTREVTNVGAASSVYEVATDAPPSVTVTVKPTKLVFKKVGEKLHY  723

Query  233  TVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
            TVTFVSKK  V P N AFG +SWNNA+++VRSP+A+SW
Sbjct  724  TVTFVSKKD-VKPGN-AFGWISWNNAKHEVRSPVAYSW  759



>ref|XP_007012625.1| Subtilase family protein [Theobroma cacao]
 gb|EOY30244.1| Subtilase family protein [Theobroma cacao]
Length=759

 Score =   209 bits (533),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 91/159 (57%), Positives = 123/159 (77%), Gaps = 0/159 (0%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHVDP KALSPGLVYDI+  +Y  FLCSL YT   ++ IVK PN+TC+ K  +P +LNYP
Sbjct  601  GHVDPQKALSPGLVYDISTEEYISFLCSLGYTIDHVKTIVKRPNVTCSTKFKDPGELNYP  660

Query  407  SFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTV  228
            SFSVLFG  R+VR TRELTNVG + ++Y+V +  P +V ++V+PT L+F++ G++ RYTV
Sbjct  661  SFSVLFGDKRVVRYTRELTNVGPSRSIYKVTVNGPSTVGISVRPTTLIFRSAGEKKRYTV  720

Query  227  TFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQL  111
            TFV+K+G    + + FGS+ W+NAQNQV+SP++FSWT L
Sbjct  721  TFVAKRGTSPMARSEFGSIVWSNAQNQVKSPVSFSWTLL  759



>gb|KHG16003.1| Subtilisin-like protease [Gossypium arboreum]
Length=760

 Score =   209 bits (531),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 89/159 (56%), Positives = 121/159 (76%), Gaps = 0/159 (0%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHVDP KALSPGL+YDI+  +Y  FLCSL YT   ++ IVK PN+TC+KK  +P +LNYP
Sbjct  602  GHVDPQKALSPGLIYDISTDEYITFLCSLGYTVDHVKTIVKRPNVTCSKKFKDPGELNYP  661

Query  407  SFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTV  228
            SFSV+FG  R+VR TRELTNVG A ++Y+V +  P +V ++V+P  L+F+ VG++ RYTV
Sbjct  662  SFSVMFGGKRVVRYTRELTNVGPARSMYKVTVNGPSTVGISVRPKTLIFRTVGEKKRYTV  721

Query  227  TFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQL  111
            TFV+K+G    +   FGS+ W NAQNQV+SP++FSW+ +
Sbjct  722  TFVAKRGTSPMAKPEFGSIVWGNAQNQVKSPVSFSWSLM  760



>ref|XP_010273846.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=761

 Score =   209 bits (531),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 99/158 (63%), Positives = 120/158 (76%), Gaps = 2/158 (1%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHVDPHKAL+PGLVYD  P DY  FLCSLDY+  Q++AI K  NITC+++ ++P +LNYP
Sbjct  601  GHVDPHKALNPGLVYDATPDDYITFLCSLDYSIDQVKAITKRQNITCSRRFADPGELNYP  660

Query  407  SFSVLFG-KSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYT  231
            SFSVLFG K R+VR TRELTNVG  G++Y VAI  P SV VTVKPTKLVFK VG+  +YT
Sbjct  661  SFSVLFGTKKRVVRYTRELTNVGPTGSVYNVAIGGPSSVGVTVKPTKLVFKEVGEMKKYT  720

Query  230  VTFVSKKGVV-TPSNAAFGSVSWNNAQNQVRSPIAFSW  120
            VTFV+KKG+      A FG + W N Q QVRSP+++ W
Sbjct  721  VTFVAKKGLSRMLGTAEFGWIVWRNEQYQVRSPVSYEW  758



>gb|KJB82990.1| hypothetical protein B456_013G223900 [Gossypium raimondii]
Length=760

 Score =   208 bits (530),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 91/159 (57%), Positives = 121/159 (76%), Gaps = 0/159 (0%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHVDP KALSPGLVYDI+  +Y  FLCSL YT   ++ IVK PNITC+ K  +P +LNYP
Sbjct  602  GHVDPQKALSPGLVYDISTEEYITFLCSLGYTVDHVKTIVKRPNITCSTKFKDPGELNYP  661

Query  407  SFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTV  228
            SFSVLFG  R+VR TRELTNVG A ++Y+V +  P +V ++V+P  L+F++VG++ RYTV
Sbjct  662  SFSVLFGGKRVVRYTRELTNVGPARSIYKVTVNGPSTVGISVRPKTLIFRSVGEKKRYTV  721

Query  227  TFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQL  111
            TFV+K+G    +   FGS+ W NAQNQV+SP++FSW+ +
Sbjct  722  TFVAKRGTSPMAKPEFGSIVWGNAQNQVKSPVSFSWSLM  760



>gb|EPS65938.1| hypothetical protein M569_08836, partial [Genlisea aurea]
Length=738

 Score =   207 bits (526),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 97/161 (60%), Positives = 122/161 (76%), Gaps = 5/161 (3%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHVDPH+ALSPGLVYD +P DY  FLCSLDY+ + +Q IV   N TC++K ++P QLNYP
Sbjct  578  GHVDPHRALSPGLVYDASPADYVAFLCSLDYSDEMLQMIVS--NATCSRKFADPGQLNYP  635

Query  407  SFSVLFGKSRIVRQTRELTNVGAAG--TLYEVAIEAPPS-VTVTVKPTKLVFKNVGDRLR  237
            SFSV+FGKSR+VR TRELTNV   G   +Y  ++EAPP  V  TVKP+ L F+N GD+ R
Sbjct  636  SFSVVFGKSRVVRYTRELTNVDPRGGSVIYRASVEAPPELVAATVKPSILEFRNAGDKRR  695

Query  236  YTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQ  114
            YTVTFVS++  V P   AFGSV W N+++QV+SP+AFSW +
Sbjct  696  YTVTFVSRRQNVKPMKNAFGSVVWKNSEHQVKSPVAFSWER  736



>ref|XP_009337216.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=764

 Score =   207 bits (526),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 94/162 (58%), Positives = 121/162 (75%), Gaps = 2/162 (1%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHVDP KALSPGLVYD    DY  FLCSL+YT + +QAIVK PN+TC +K S+P QLNYP
Sbjct  602  GHVDPSKALSPGLVYDTTAEDYIAFLCSLEYTNEHVQAIVKRPNVTCERKYSDPGQLNYP  661

Query  407  SFSVLFG--KSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRY  234
            SFS+ FG    R+VR TRELTNVGAAG++Y  ++ +P +V   VKPT+LVF NVG++ +Y
Sbjct  662  SFSIAFGSKNKRVVRYTRELTNVGAAGSVYRASVTSPSTVRTVVKPTRLVFNNVGEKQKY  721

Query  233  TVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQLF  108
            TVTF++  G    + + FGS+ W N Q+ V+SP+AF+WTQL 
Sbjct  722  TVTFMALPGAEKTARSEFGSIVWANPQHLVKSPVAFAWTQLI  763



>ref|XP_010261834.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=773

 Score =   206 bits (523),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 94/162 (58%), Positives = 123/162 (76%), Gaps = 4/162 (2%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHVDP KALSPGLVYD  P DY  FLCSLDY+  QIQ I K PNITC+++ ++P  LNYP
Sbjct  611  GHVDPQKALSPGLVYDATPEDYIAFLCSLDYSIAQIQMITKRPNITCSRRFADPGHLNYP  670

Query  407  SFSVLF-GKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYT  231
            SFSVLF  ++R+VR TRELTNVG AG++Y+V++  P SV +TVKP +LVF+ VG++ +Y+
Sbjct  671  SFSVLFSAETRMVRYTRELTNVGPAGSVYDVSVSGPASVGITVKPRRLVFREVGEKQKYS  730

Query  230  VTFVSKK---GVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQ  114
            V FV++K   G       AFG +SW+NAQ+QVRSPI++ W+ 
Sbjct  731  VMFVARKEGTGGRRVGTTAFGWLSWSNAQHQVRSPISYEWSH  772



>ref|XP_010541995.1| PREDICTED: subtilisin-like protease [Tarenaya hassleriana]
Length=765

 Score =   204 bits (519),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 98/159 (62%), Positives = 128/159 (81%), Gaps = 1/159 (1%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHVDP KALSPGLVYDI+  +Y  FLCSLDYT   IQAI+K PN+ C++K S+P QLNYP
Sbjct  608  GHVDPKKALSPGLVYDISTEEYIRFLCSLDYTLNHIQAIIKRPNVNCSRKFSDPGQLNYP  667

Query  407  SFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTV  228
            SFSVLF   R+VR TRELTNVGA G++Y+V ++   SV+VTV+P +LVF+  G++ RYTV
Sbjct  668  SFSVLFRDKRVVRYTRELTNVGAPGSVYKVTVDVSVSVSVTVRPKRLVFRTAGEKKRYTV  727

Query  227  TFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQL  111
            TF +K+G V+ + A FGS++W+N+Q+QVRSP+AFSWT+ 
Sbjct  728  TFSAKRG-VSGATAEFGSITWSNSQHQVRSPVAFSWTRF  765



>ref|XP_010917484.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Elaeis 
guineensis]
Length=767

 Score =   204 bits (518),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/158 (61%), Positives = 122/158 (77%), Gaps = 3/158 (2%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            G+V+P KALSPGLVYDIA  DY  FLCSLDY+   IQAI ++PN TC++KLS+P  LNYP
Sbjct  608  GYVNPQKALSPGLVYDIATEDYIGFLCSLDYSADHIQAISQSPNTTCSRKLSDPGNLNYP  667

Query  407  SFSVLFG--KSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRY  234
            SFSV+FG    R VR +RELTNVG AG++Y +    PPSV+VTV+P KLVFK VG++L+Y
Sbjct  668  SFSVVFGGKSRRPVRYSRELTNVGLAGSVYNLTYSGPPSVSVTVRPKKLVFKQVGEKLKY  727

Query  233  TVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
            TV F SKK    P++ AFG +SWNN Q+QV+SPI++ W
Sbjct  728  TVIFTSKK-EGNPTDVAFGWISWNNEQHQVQSPISYMW  764



>gb|KJB27210.1| hypothetical protein B456_004G284900 [Gossypium raimondii]
Length=762

 Score =   203 bits (517),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/160 (58%), Positives = 123/160 (77%), Gaps = 1/160 (1%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHVDP KALSPGL+YDI    Y  FLCSL YT  Q++ IVK PNITC+K+  +P +LNYP
Sbjct  603  GHVDPQKALSPGLIYDITTKQYISFLCSLGYTIDQVKTIVKRPNITCSKRFKDPGELNYP  662

Query  407  SFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTV  228
            SFSVLFG  R+VR TRELTNVG A ++Y+VA++ P SV ++V+P  LVF+++G++ RYTV
Sbjct  663  SFSVLFGDKRVVRYTRELTNVGPARSIYKVAVDGPSSVGISVRPRTLVFRHIGEKKRYTV  722

Query  227  TFVSK-KGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQL  111
            +FV+K K   +   + +GS+ W NAQ+QV+SP++FSWT L
Sbjct  723  SFVAKRKRRGSTVRSEYGSIVWGNAQHQVKSPVSFSWTFL  762



>ref|XP_010937330.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Elaeis 
guineensis]
Length=772

 Score =   201 bits (510),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/158 (59%), Positives = 122/158 (77%), Gaps = 3/158 (2%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHVDP KALSPGL+YDI   DY  FLCSLDYT Q IQ IVK PN+TC++  SNP +LNYP
Sbjct  614  GHVDPRKALSPGLIYDITTEDYIAFLCSLDYTIQHIQVIVKRPNVTCSRSFSNPGELNYP  673

Query  407  SFSVLF-GKSR-IVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRY  234
            SFSV+F  KSR +V+  RELTNVG+AG++Y V I  P +V+VTVKP KL+FK+VG +L+Y
Sbjct  674  SFSVVFKKKSRNVVKYIRELTNVGSAGSVYNVRIRGPENVSVTVKPAKLIFKHVGQKLKY  733

Query  233  TVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
            ++ F SK G    +  AFG ++W+N Q++VRSP+A++W
Sbjct  734  SIIFASKNGGHLKTT-AFGWITWSNKQHEVRSPVAYTW  770



>ref|XP_004287641.1| PREDICTED: subtilisin-like protease [Fragaria vesca subsp. vesca]
Length=765

 Score =   198 bits (503),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 93/159 (58%), Positives = 117/159 (74%), Gaps = 1/159 (1%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHVDP +A+SPGLVYDI+  +Y  FLCSL YT QQ+Q+I K+ N+TCA+K S+P QLNYP
Sbjct  608  GHVDPSRAVSPGLVYDISSVEYVAFLCSLGYTIQQVQSIAKS-NVTCARKYSDPGQLNYP  666

Query  407  SFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTV  228
            SFSV+FG  R+VR TRELTNVG A +LY+V +  PP V   VKP+ L F  VG++ +YTV
Sbjct  667  SFSVVFGNKRVVRYTRELTNVGTARSLYKVIVSGPPGVRTIVKPSSLFFATVGEKKKYTV  726

Query  227  TFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQL  111
            TFVS K     S A FGS+ W N  + V+SP+AF+WT L
Sbjct  727  TFVSAKSGSRTSRAEFGSIVWANTLHLVKSPVAFAWTLL  765



>ref|XP_003541310.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=751

 Score =   196 bits (498),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 87/157 (55%), Positives = 116/157 (74%), Gaps = 0/157 (0%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHV+P KALSPGL+YD +  DY  FLCSL+YT   ++ +VK P+  C+KK ++P  LNYP
Sbjct  593  GHVNPQKALSPGLLYDASTQDYIYFLCSLNYTLDHLRLLVKHPDANCSKKFADPGDLNYP  652

Query  407  SFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTV  228
            SFSV+FG +++VR TR LTNVG  G+ Y+VA+ AP +V +TV P KL F  VG+R  YTV
Sbjct  653  SFSVVFGSNKVVRYTRTLTNVGEPGSAYDVAVSAPSTVDITVNPNKLEFGEVGERQTYTV  712

Query  227  TFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWT  117
            TFVS + V   + + FGS+ W+N Q+QVRSP+AF+WT
Sbjct  713  TFVSNRSVNDSATSGFGSIMWSNEQHQVRSPVAFTWT  749



>gb|KHN07895.1| Subtilisin-like protease [Glycine soja]
Length=519

 Score =   191 bits (486),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 86/157 (55%), Positives = 114/157 (73%), Gaps = 0/157 (0%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHV+P KALSPGL+YD +  DY  FLCSL+YT   ++ +VK P+  C+KK ++P  LNYP
Sbjct  361  GHVNPQKALSPGLLYDASTQDYIYFLCSLNYTLDHLRLLVKHPDANCSKKFADPGDLNYP  420

Query  407  SFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTV  228
            SFSV+FG +++VR TR LTNVG  G+ Y VA+ AP +V +TV P KL F  VG+R  YTV
Sbjct  421  SFSVVFGSNKVVRYTRTLTNVGEPGSAYNVAVSAPSTVDITVNPNKLEFGEVGERQTYTV  480

Query  227  TFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWT  117
            TFVS + V   + + FGS+ W+N Q+ VRSP+AF+WT
Sbjct  481  TFVSNRSVNDSATSGFGSIMWSNEQHLVRSPVAFTWT  517



>ref|XP_002519362.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42979.1| conserved hypothetical protein [Ricinus communis]
Length=208

 Score =   181 bits (460),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 91/159 (57%), Positives = 112/159 (70%), Gaps = 12/159 (8%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHVDP +ALSPGLVYDI+P DY  FLCSL+Y            N+TC +K S+  +LNYP
Sbjct  60   GHVDPKRALSPGLVYDISPQDYVTFLCSLNYDL----------NLTCPRKFSDLGELNYP  109

Query  407  SFSVLFGK-SRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYT  231
            SFSVLFGK +  VR +RELTNVG A   Y VA+ AP  V VTV P KLVFK VG++LRYT
Sbjct  110  SFSVLFGKKTTAVRYSRELTNVGTARATYRVAVTAPSEVAVTVAPAKLVFKKVGEKLRYT  169

Query  230  VTFVSKKGVVTPS-NAAFGSVSWNNAQNQVRSPIAFSWT  117
             TF +K+    P+  AAFGS+ W+NA+ +V SP+AF+WT
Sbjct  170  ATFAAKRNAKKPAGGAAFGSIVWSNAKYKVSSPVAFAWT  208



>ref|XP_009391730.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
 ref|XP_009391731.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=770

 Score =   191 bits (486),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 90/158 (57%), Positives = 114/158 (72%), Gaps = 3/158 (2%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHVDP KALSPGL+YDI   DY  FLCSL+Y+T  IQAI K+ N TC+++L NP  LNYP
Sbjct  611  GHVDPQKALSPGLIYDIGTGDYLAFLCSLEYSTDHIQAISKSTNKTCSRRLPNPGNLNYP  670

Query  407  SFSVLFGK--SRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRY  234
            SFSV+FG+   R V+  R LTNVG  G++Y V +  PP V VTVKPTKL+F  VG +LRY
Sbjct  671  SFSVVFGRRSRRFVKYNRVLTNVGVPGSVYNVKVGGPPGVKVTVKPTKLIFNQVGQKLRY  730

Query  233  TVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
             VTF S K    P + AFG ++W++ Q+QVRSP+++ W
Sbjct  731  KVTFTSTK-AGDPVDMAFGWITWSSEQHQVRSPVSYRW  767



>ref|XP_010050438.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
 gb|KCW79388.1| hypothetical protein EUGRSUZ_C00800 [Eucalyptus grandis]
Length=759

 Score =   189 bits (480),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/159 (55%), Positives = 119/159 (75%), Gaps = 4/159 (3%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GH+DP KALSPGLVYD+   DY  F+CSL+YT +Q+Q+ V+  N+TC+ KLS+P QLNYP
Sbjct  600  GHIDPRKALSPGLVYDLTADDYIAFVCSLNYTIKQVQSTVRRTNVTCSTKLSDPGQLNYP  659

Query  407  SFSVLFGKSR-IVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYT  231
            SFSVLF  +R +VR +RELTNVG AG++Y+VA++AP +V V VKP +LVF  VG++ RYT
Sbjct  660  SFSVLFRPNRKVVRYSRELTNVGDAGSVYKVAVQAPSTVAVRVKPRRLVFGKVGEKQRYT  719

Query  230  VTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQ  114
            VTFV++           GS++W N Q++VRSP+ F W +
Sbjct  720  VTFVARN---QTDETHGGSITWKNRQHRVRSPVGFLWGE  755



>ref|XP_009380035.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
 ref|XP_009380036.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
 ref|XP_009380037.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=767

 Score =   188 bits (478),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 89/158 (56%), Positives = 118/158 (75%), Gaps = 3/158 (2%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNI-TCAKKLSNPAQLNY  411
            GHVDP +ALSPGLVYDI   DY  FLCSL+YT   IQAI K PN+ TC+++ S+P  LNY
Sbjct  609  GHVDPQRALSPGLVYDITADDYIAFLCSLNYTIPHIQAITKRPNVTTCSRRFSDPGNLNY  668

Query  410  PSFSVLFGKS-RIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRY  234
            PSFSV+FGK  R+V+  RELTNVG+A + YE  +  P  V VTVKP KL+FK+V  +L+Y
Sbjct  669  PSFSVVFGKKWRVVKYRRELTNVGSASSTYEAKVSGPGGVAVTVKPAKLMFKHVNQKLKY  728

Query  233  TVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
            +VTF SK+   + +  AFG ++W+N Q++VRSP+A++W
Sbjct  729  SVTFASKERGRS-AGTAFGWITWSNKQHKVRSPVAYTW  765



>gb|KHN17728.1| Subtilisin-like protease [Glycine soja]
Length=224

 Score =   177 bits (448),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 76/157 (48%), Positives = 114/157 (73%), Gaps = 0/157 (0%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHV+P KALSPGLVY+ +  DY  FLCSL+YT   ++ +VK P+  C+KK ++PA+LNYP
Sbjct  66   GHVNPQKALSPGLVYEASTQDYIAFLCSLNYTLDHLRLVVKDPDANCSKKFADPAELNYP  125

Query  407  SFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTV  228
            SFS++FG ++++R TR LTNVG  G++Y++ +  P +V VTV P +L F+ +G+   YTV
Sbjct  126  SFSLVFGSNKLLRYTRTLTNVGEPGSVYDLVLSVPSTVHVTVNPRRLQFRQLGESQTYTV  185

Query  227  TFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWT  117
            TF+S + +     + FG++ W N  +QVR+P+AF+WT
Sbjct  186  TFLSNRTLNDSVTSDFGTIMWTNQLHQVRTPLAFTWT  222



>gb|AES92191.2| subtilisin-like serine protease [Medicago truncatula]
Length=756

 Score =   186 bits (471),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 89/161 (55%), Positives = 115/161 (71%), Gaps = 2/161 (1%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHV+P KALSPGLVYD    DY  FLCSL+Y+   ++ IVK PN+ C+  LS P  LNYP
Sbjct  596  GHVNPQKALSPGLVYDADIEDYIAFLCSLNYSLDHVKLIVKRPNVNCSTYLSGPGDLNYP  655

Query  407  SFSVLFG-KSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYT  231
            SFSV+FG  S +V+  R LTNVG A ++Y+VA+  P +V + V PTKLVF+ VG+R  Y 
Sbjct  656  SFSVVFGNNSGVVQYKRTLTNVGEAESVYDVAVSGPSTVGIIVNPTKLVFEQVGERQTYM  715

Query  230  VTFVSKKGVVTPS-NAAFGSVSWNNAQNQVRSPIAFSWTQL  111
            V F+S K +V  S  + FGS++W+N Q+QVRSPIAF+WT L
Sbjct  716  VKFISNKDIVDDSVTSEFGSITWSNKQHQVRSPIAFTWTIL  756



>ref|XP_003609994.1| Subtilisin-like protease [Medicago truncatula]
Length=756

 Score =   186 bits (471),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 89/161 (55%), Positives = 115/161 (71%), Gaps = 2/161 (1%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHV+P KALSPGLVYD    DY  FLCSL+Y+   ++ IVK PN+ C+  LS P  LNYP
Sbjct  596  GHVNPQKALSPGLVYDADIEDYIAFLCSLNYSLDHVKLIVKRPNVNCSTYLSGPGDLNYP  655

Query  407  SFSVLFG-KSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYT  231
            SFSV+FG  S +V+  R LTNVG A ++Y+VA+  P +V + V PTKLVF+ VG+R  Y 
Sbjct  656  SFSVVFGNNSGVVQYKRTLTNVGEAESVYDVAVSGPSTVGIIVNPTKLVFEQVGERQTYM  715

Query  230  VTFVSKKGVVTPS-NAAFGSVSWNNAQNQVRSPIAFSWTQL  111
            V F+S K +V  S  + FGS++W+N Q+QVRSPIAF+WT L
Sbjct  716  VKFISNKDIVDDSVTSEFGSITWSNKQHQVRSPIAFTWTIL  756



>ref|XP_004507999.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=753

 Score =   185 bits (470),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 87/161 (54%), Positives = 116/161 (72%), Gaps = 2/161 (1%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKK-LSNPAQLNY  411
            GHV P KALSPGL+YD    DY  FLCSL+YT   +Q IVK  ++ C+K   ++P  LNY
Sbjct  593  GHVSPQKALSPGLLYDTDTQDYIAFLCSLNYTLDHVQLIVKRHDVNCSKYYFADPGDLNY  652

Query  410  PSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYT  231
            PSFSV+FG + +V+ TR LTNVG A ++Y+V +  P +V +TVKPT+LVF+ VG+R  YT
Sbjct  653  PSFSVVFGNNSVVQYTRRLTNVGEAKSVYDVVVSGPSTVGITVKPTRLVFEQVGERQTYT  712

Query  230  VTFVSKKGVVTPS-NAAFGSVSWNNAQNQVRSPIAFSWTQL  111
            VTF+S K  V  S    FGS++W+N ++QVRSP+AF+WT L
Sbjct  713  VTFISNKDTVDDSVTYEFGSITWSNKRHQVRSPVAFTWTNL  753



>dbj|BAJ89916.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=772

 Score =   182 bits (463),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 90/160 (56%), Positives = 117/160 (73%), Gaps = 5/160 (3%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTT-QQIQAIVKAPNITCAKKLSNPAQLNY  411
            GHVDP KALSPGLVYD +  DY  FLC++   + +Q+QA+  APN TC +KLS+P  LNY
Sbjct  612  GHVDPVKALSPGLVYDTSIDDYVAFLCTVGGASPRQVQAVTGAPNATCQRKLSSPGDLNY  671

Query  410  PSFSVLFG--KSRI-VRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRL  240
            PSFSV+FG  KSR  VR  RELTNVGAAG++Y   +  PPS+ V+VKP +LVFK  GD+L
Sbjct  672  PSFSVVFGLRKSRTTVRYHRELTNVGAAGSVYAAKVTGPPSIVVSVKPARLVFKKAGDKL  731

Query  239  RYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
            RYTV F S      P++AAFG ++W++ +  VRSPI+++W
Sbjct  732  RYTVAFKSTA-QGGPTDAAFGWLTWSSGEQDVRSPISYTW  770



>ref|XP_010238670.1| PREDICTED: subtilisin-like protease isoform X1 [Brachypodium 
distachyon]
Length=769

 Score =   180 bits (457),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 93/162 (57%), Positives = 114/162 (70%), Gaps = 7/162 (4%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHVDPHKALSPGLVYDI+  DY +FLCSLDY+   I+ + K  NI+C +K S P  LNYP
Sbjct  611  GHVDPHKALSPGLVYDISTNDYVVFLCSLDYSVSHIRVVTKMSNISCPQK-SRPGDLNYP  669

Query  407  SFSVLFGKS--RIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRY  234
            SFSV+F      +VR  RELTNVG A ++Y V + +P SV+V V P KLVFK +G +LRY
Sbjct  670  SFSVVFRNKPKHVVRYRRELTNVGPAMSVYNVKVSSPASVSVKVSPEKLVFKKLGQKLRY  729

Query  233  TVTFVSKKGVVTPSNAA--FGSVSWNNAQNQVRSPIAFSWTQ  114
             VTF SK  VV P+ A   FG +SW N Q+ VRSP+AF+WT 
Sbjct  730  YVTFTSK--VVDPNRAKPDFGWISWVNNQHVVRSPVAFTWTM  769



>gb|KDP32432.1| hypothetical protein JCGZ_13357 [Jatropha curcas]
Length=1003

 Score =   181 bits (459),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 83/157 (53%), Positives = 113/157 (72%), Gaps = 0/157 (0%)
 Frame = -2

Query  587   GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
             GH+DP KA SPGL+YDI+  +Y  FLCSL++  + ++ I + P +TC+K+  +  +LNYP
Sbjct  847   GHIDPRKAFSPGLIYDISKEEYIKFLCSLNFPLEIVREITENPFLTCSKRFDDLGELNYP  906

Query  407   SFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTV  228
             SFSVLFG    V+ TR LTNVG A + YEV + APP++TVTVKP KLVFKNVG++  Y V
Sbjct  907   SFSVLFGNKTTVQYTRTLTNVGTAKSTYEVKVTAPPALTVTVKPRKLVFKNVGEKHSYRV  966

Query  227   TFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWT  117
             TF + K        AFGS++W +AQ++V SP+AF+WT
Sbjct  967   TFAAIKNRKPVGGVAFGSITWIDAQHKVSSPVAFTWT  1003


 Score =   144 bits (362),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 86/117 (74%), Gaps = 0/117 (0%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GH+D  KA SPGL+YDI+  +YT FLCSLDY  + I+ I   P ++C+ +  +  +LNYP
Sbjct  568  GHIDSRKAFSPGLIYDISKKEYTKFLCSLDYPLEFIRTITLNPKVSCSSRFDDLGELNYP  627

Query  407  SFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLR  237
            SFSVLFG   +V+ +R+LTN GAA + YEV + APP+VTVTVKP  LVFKNVG++ +
Sbjct  628  SFSVLFGNKTMVQYSRKLTNAGAANSAYEVIVAAPPAVTVTVKPRNLVFKNVGEKHK  684



>ref|NP_001064523.2| Os10g0394200 [Oryza sativa Japonica Group]
 dbj|BAF26437.2| Os10g0394200, partial [Oryza sativa Japonica Group]
Length=230

 Score =   166 bits (421),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 107/160 (67%), Gaps = 8/160 (5%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHVDP KALSPGL+YDI+  DY  FLCSL+YTT  IQ I K  NITC +K   P  LNYP
Sbjct  73   GHVDPQKALSPGLLYDISTKDYVSFLCSLNYTTPHIQVITKMSNITCPRKF-RPGDLNYP  131

Query  407  SFSVLFGK--SRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRY  234
            SFSV+F K    ++R  RE+TNVG A ++Y V +  P SV+V V P KLVF  VG + RY
Sbjct  132  SFSVVFKKKSKHVMRFRREVTNVGPAMSVYNVKVSGPASVSVKVTPAKLVFNKVGQKQRY  191

Query  233  TVTFVSKKGVVTPSNAA--FGSVSWNNAQNQVRSPIAFSW  120
             V F S    V  SNA   FG +SW ++Q+ VRSPIA++W
Sbjct  192  YVIFAS---TVDASNAKPDFGWISWMSSQHVVRSPIAYTW  228



>ref|XP_007154575.1| hypothetical protein PHAVU_003G130300g [Phaseolus vulgaris]
 gb|ESW26569.1| hypothetical protein PHAVU_003G130300g [Phaseolus vulgaris]
Length=761

 Score =   174 bits (442),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 110/157 (70%), Gaps = 0/157 (0%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHV+P KALSPGLVYD +  DY  FLCSL+YT   ++ +VK  +  C+ K ++P  LNYP
Sbjct  603  GHVNPQKALSPGLVYDASTQDYIAFLCSLNYTLDHLRLVVKHSDANCSTKFADPGDLNYP  662

Query  407  SFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTV  228
            SFSV+FG +++V+ TR LTNVG A ++Y+V +  P +V +TV P ++ F  VG+   Y V
Sbjct  663  SFSVVFGSNKVVQYTRTLTNVGKAASVYDVVVSTPSTVEITVNPNRVSFAEVGECQTYKV  722

Query  227  TFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWT  117
            TFVS + V     + FGS+ W+N +++VRSP+AF+WT
Sbjct  723  TFVSNRSVSDSVASEFGSIMWSNEEHEVRSPVAFTWT  759



>dbj|BAD36156.1| putative serine protease [Oryza sativa Japonica Group]
 gb|EAZ09256.1| hypothetical protein OsI_31529 [Oryza sativa Indica Group]
 gb|EAZ44882.1| hypothetical protein OsJ_29522 [Oryza sativa Japonica Group]
Length=770

 Score =   174 bits (440),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 84/162 (52%), Positives = 110/162 (68%), Gaps = 7/162 (4%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHVDP KALSPGLVYD +  DY  FLCS+  +  Q+QAI  APN+TC +KLS+P  LNYP
Sbjct  608  GHVDPVKALSPGLVYDTSVDDYVAFLCSVGTSPPQVQAITAAPNVTCQRKLSSPGDLNYP  667

Query  407  SFSVLFGKSR------IVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGD  246
            SFSV+FG+         V+  RELTNVG   ++Y   +  P  + V VKP +L FK  GD
Sbjct  668  SFSVVFGRRSSSSRSTTVKYRRELTNVGDGRSVYTARVTGPSDIAVAVKPARLAFKKAGD  727

Query  245  RLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
            +LRYTVTF S      P++AAFG ++W+N ++ VRSPI+++W
Sbjct  728  KLRYTVTFKSTT-PGGPTDAAFGWLTWSNGEHDVRSPISYTW  768



>ref|XP_006661279.1| PREDICTED: subtilisin-like protease-like [Oryza brachyantha]
Length=635

 Score =   171 bits (434),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 88/163 (54%), Positives = 116/163 (71%), Gaps = 10/163 (6%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHVDP KALSPGLVYD +  DY  FLCS+  + QQ+QAI  APN+TC +KLS+P  LNYP
Sbjct  474  GHVDPVKALSPGLVYDASVDDYVAFLCSVGTSPQQVQAITAAPNVTCQRKLSSPGDLNYP  533

Query  407  SFSVLFGK--SR-IVRQTRELTNVGA-AGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRL  240
            SFSV+FG+  SR  V+  RELTNVG   G++Y V +  P  + V VKP +L FK  GD+L
Sbjct  534  SFSVVFGRRSSRSSVKYRRELTNVGGDGGSVYTVRVTGPSDIAVAVKPARLAFKAAGDKL  593

Query  239  RYTVTFVSK--KGVVTPSNAAFGSVSWNN-AQNQVRSPIAFSW  120
            RYTVTF S   +G   P ++AFG ++W++  ++ VRSPI+++W
Sbjct  594  RYTVTFKSATPRG---PMDSAFGWLTWSDGGEHDVRSPISYTW  633



>gb|EMT16255.1| Subtilisin-like protease [Aegilops tauschii]
Length=761

 Score =   172 bits (435),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 86/162 (53%), Positives = 106/162 (65%), Gaps = 3/162 (2%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHVDP KALSPGLVYDI+  DY  FLCSLDY+   I+ I K  N++C  + S P  LNYP
Sbjct  530  GHVDPQKALSPGLVYDISTNDYVAFLCSLDYSATHIRVITKMSNVSCPPR-SRPGDLNYP  588

Query  407  SFSVLFGKS--RIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRY  234
            SFSV+F K    +VR  RELTNVG A  +Y+V +  P SV VTV P KLVFK VG + RY
Sbjct  589  SFSVVFRKKPRHVVRYRRELTNVGPAMAVYDVKVSGPASVGVTVTPAKLVFKKVGQKQRY  648

Query  233  TVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQLF  108
             VTF SK      +   FG +SW + ++ VRSP+A++W   F
Sbjct  649  YVTFESKAAGAGRAKPDFGWISWASDEHVVRSPVAYTWKMCF  690


 Score = 91.7 bits (226),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 49/68 (72%), Gaps = 1/68 (1%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHVDP KALSPGLVYDI+  DY  FLCSLDY+   I+ I K  N++C  + S P  LNYP
Sbjct  425  GHVDPQKALSPGLVYDISTNDYVAFLCSLDYSATHIRVITKMSNVSCPPR-SRPGDLNYP  483

Query  407  SFSVLFGK  384
            SFSV+F K
Sbjct  484  SFSVVFRK  491



>gb|ACL52505.1| unknown [Zea mays]
Length=421

 Score =   167 bits (422),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 84/165 (51%), Positives = 109/165 (66%), Gaps = 12/165 (7%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITC-AKKLSNPAQLNY  411
            GHVDP +ALSPGLVYDI+  DY  FLCSL+Y+   +Q I KA N++C A   S P  LNY
Sbjct  258  GHVDPQRALSPGLVYDISTHDYAAFLCSLNYSAPHVQVITKASNVSCGAPNKSRPGDLNY  317

Query  410  PSFSVLFGKSR------IVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVG  249
            PSFSV+FG+ R       +R  RELTNVG A ++Y+V +  P SV VTV P +L F+  G
Sbjct  318  PSFSVVFGQKRKTKPAAALRFRRELTNVGPAASVYDVKVVGPESVAVTVTPARLTFRQAG  377

Query  248  DRLRYTVTFVS--KKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
             +LRY VTF S  ++G   P    FG +SW N ++ VRSP+A++W
Sbjct  378  QKLRYYVTFASRARQGHAKPD---FGWISWVNDEHVVRSPVAYTW  419



>ref|XP_004983113.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=766

 Score =   170 bits (431),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 87/158 (55%), Positives = 107/158 (68%), Gaps = 4/158 (3%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHVDP KALSPGLVYDI+  DY  FLCSLDY+   IQ I K  N +C KK   P  LNYP
Sbjct  609  GHVDPQKALSPGLVYDISTNDYVAFLCSLDYSAPHIQVITKMSNFSCPKKF-RPGDLNYP  667

Query  407  SFSVLFGK--SRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRY  234
            SFSV+F +   R++R  RE+TNVG A ++Y V + +P SV+VTV PTKL FK VG + RY
Sbjct  668  SFSVVFKQKSKRVMRFRREVTNVGPATSVYNVKVTSPASVSVTVTPTKLTFKKVGQKQRY  727

Query  233  TVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
             VTF SK G    +   FG +SW N  + VRSP+A++W
Sbjct  728  YVTFASKAG-QGQAKPDFGWISWANDDHVVRSPVAYTW  764



>gb|AGT17100.1| serine protease [Saccharum hybrid cultivar R570]
Length=750

 Score =   169 bits (429),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 87/165 (53%), Positives = 116/165 (70%), Gaps = 8/165 (5%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKA-PNITCAKKLSNPAQLNY  411
            GHVDP  ALSPGLVYD +  DY  FLC++    +QIQAI  A PN+TC +KLS+P  LNY
Sbjct  583  GHVDPVSALSPGLVYDNSVDDYVAFLCTVGVAPRQIQAITAAGPNVTCTRKLSSPGDLNY  642

Query  410  PSFSVLFGK--SR-IVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRL  240
            PSFSV+FG+  SR  V+  RELTNVG AG  Y V +  P  ++V+VKP +L F+  GD+L
Sbjct  643  PSFSVVFGQRSSRSTVKYRRELTNVGNAGDTYTVKVTGPSDISVSVKPARLQFRRAGDKL  702

Query  239  RYTVTFVS--KKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQL  111
            RYTVTF S   +G + P  AAFG ++W++ ++ VRSPI+++W  +
Sbjct  703  RYTVTFRSANARGRMDP--AAFGWLTWSSDEHDVRSPISYTWGDV  745



>gb|EMS60034.1| Subtilisin-like protease [Triticum urartu]
Length=478

 Score =   167 bits (422),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 83/158 (53%), Positives = 105/158 (66%), Gaps = 3/158 (2%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHVDP KALSPGLVYDI+ +DY  FLCSLDY+   I+ I K  N++C  + S P  LNYP
Sbjct  320  GHVDPQKALSPGLVYDISTSDYVAFLCSLDYSAAHIRVITKMANVSCPPR-SRPGDLNYP  378

Query  407  SFSVLFGKS--RIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRY  234
            SFSV+F K    +VR  RELTNVG A  +Y+V +  P S  VTV P +LVFK VG + RY
Sbjct  379  SFSVVFRKKPRHVVRYRRELTNVGPAMAVYDVKVSGPASAGVTVTPARLVFKKVGQKQRY  438

Query  233  TVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
             VTF SK      +   FG +SW + ++ VRSP+A++W
Sbjct  439  YVTFESKAAGPGRAKPDFGWISWASDEHVVRSPVAYTW  476



>ref|XP_004956934.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=773

 Score =   169 bits (428),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 87/162 (54%), Positives = 115/162 (71%), Gaps = 8/162 (5%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKA-PNITCAKKLSNPAQLNY  411
            GHVDP +ALSPGLVYD    DY  FLC++  + +Q+QA+  A PN+TC +KLS+P  LNY
Sbjct  612  GHVDPVRALSPGLVYDATVDDYVAFLCTVGVSPRQVQAVAAAGPNVTCTRKLSSPGDLNY  671

Query  410  PSFSVLFGK--SR-IVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRL  240
            PSFSV+FG+  SR  V+  RELTNVG  G  Y V +  P  V V+VKP  L F+  GD+L
Sbjct  672  PSFSVVFGRRSSRSTVKYRRELTNVGDTGATYTVKVTGPSDVGVSVKPAMLQFRRPGDKL  731

Query  239  RYTVTFVSK--KGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
            RYTVTF SK  KG + P  AAFG ++W++ +++VRSPI+++W
Sbjct  732  RYTVTFRSKSAKGPMDP--AAFGWLTWSSDEHEVRSPISYTW  771



>ref|XP_002460273.1| hypothetical protein SORBIDRAFT_02g025810 [Sorghum bicolor]
 gb|EER96794.1| hypothetical protein SORBIDRAFT_02g025810 [Sorghum bicolor]
Length=774

 Score =   169 bits (428),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 87/162 (54%), Positives = 115/162 (71%), Gaps = 8/162 (5%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKA-PNITCAKKLSNPAQLNY  411
            GHVDP  ALSPGLVYD +  DY  FLC++    +QIQAI  A PN+TC +KLS+P  LNY
Sbjct  613  GHVDPVSALSPGLVYDASVDDYVAFLCAVGVAPRQIQAITAAGPNVTCTRKLSSPGDLNY  672

Query  410  PSFSVLFGK--SR-IVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRL  240
            PSFSV+FG+  SR  V+  RELTNVG AG  Y V +  P  ++V+VKP +L F+  GD+L
Sbjct  673  PSFSVVFGRRSSRSTVKYRRELTNVGNAGDTYTVKVTGPSDISVSVKPARLQFRRAGDKL  732

Query  239  RYTVTFVS--KKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
            RYTVTF S   +G + P  AAFG ++W++ ++ VRSPI+++W
Sbjct  733  RYTVTFRSANARGPMDP--AAFGWLTWSSDEHVVRSPISYTW  772



>tpg|DAA61658.1| TPA: putative subtilase family protein [Zea mays]
Length=548

 Score =   167 bits (422),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 84/162 (52%), Positives = 114/162 (70%), Gaps = 8/162 (5%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAI-VKAPNITCAKKLSNPAQLNY  411
            GHVDP  ALSPGLVYD +  DY  FLC++    +QIQAI  + PN+TC +KLS+P  LNY
Sbjct  387  GHVDPVSALSPGLVYDASVDDYVAFLCTVGVAPRQIQAITAEGPNVTCTRKLSSPGDLNY  446

Query  410  PSFSVLFGK--SR-IVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRL  240
            PSFSV+F +  SR  V+  R+LTNVG+AG  Y V +  P  ++V VKP +L F+  GD+L
Sbjct  447  PSFSVVFDRRSSRSTVKYRRDLTNVGSAGDTYTVKVTGPSDISVRVKPARLEFRRAGDKL  506

Query  239  RYTVTFVS--KKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
            RYTVTF S   +G + P  AAFG ++W++ ++ VRSPI+++W
Sbjct  507  RYTVTFRSANARGPMDP--AAFGWLTWSSGEHDVRSPISYTW  546



>emb|CAN71376.1| hypothetical protein VITISV_001491 [Vitis vinifera]
Length=734

 Score =   168 bits (425),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 86/141 (61%), Positives = 110/141 (78%), Gaps = 3/141 (2%)
 Frame = -2

Query  524  YTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNV  345
            Y  FLCSLDYT + ++AIVK  NITC++K S+P +LNYPSFSVLFG    VR TRELTNV
Sbjct  594  YVAFLCSLDYTIEHVRAIVKRQNITCSRKFSDPGELNYPSFSVLFGSKXFVRYTRELTNV  653

Query  344  GAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTP---SNAAFGS  174
            GAA ++Y+VA+  PPSV V V P+ LVFKNVG++ RYTVTFV+KKG       + +AFGS
Sbjct  654  GAAXSVYQVAVTGPPSVGVVVXPSTLVFKNVGEKXRYTVTFVAKKGKKVQNRMTRSAFGS  713

Query  173  VSWNNAQNQVRSPIAFSWTQL  111
            + W+N Q+QV+SP+A++WTQL
Sbjct  714  IVWSNTQHQVKSPVAYAWTQL  734



>dbj|BAK06243.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=769

 Score =   167 bits (424),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 85/158 (54%), Positives = 104/158 (66%), Gaps = 3/158 (2%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHVDP KALSPGLVYDI+  DY  FLCSLDY+   I+ I K  N++C  + S P  LNYP
Sbjct  611  GHVDPQKALSPGLVYDISTNDYAAFLCSLDYSATHIRVITKMSNVSCPPR-SRPGDLNYP  669

Query  407  SFSVLFGKS--RIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRY  234
            SFSV+F K     VR  RELTNVG A  +Y+V +  P SV VTV P KLVFK VG + RY
Sbjct  670  SFSVVFRKKARHAVRYRRELTNVGPAMAVYDVKVSGPASVGVTVTPAKLVFKKVGQKQRY  729

Query  233  TVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
             VTF SK      +   FG +SW + ++ VRSP+A++W
Sbjct  730  YVTFESKAAGAGRAKPDFGWISWVSDEHVVRSPVAYTW  767



>gb|ACF79126.1| unknown [Zea mays]
 tpg|DAA61657.1| TPA: putative subtilase family protein [Zea mays]
Length=766

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 84/162 (52%), Positives = 114/162 (70%), Gaps = 8/162 (5%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAI-VKAPNITCAKKLSNPAQLNY  411
            GHVDP  ALSPGLVYD +  DY  FLC++    +QIQAI  + PN+TC +KLS+P  LNY
Sbjct  605  GHVDPVSALSPGLVYDASVDDYVAFLCTVGVAPRQIQAITAEGPNVTCTRKLSSPGDLNY  664

Query  410  PSFSVLFGK--SR-IVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRL  240
            PSFSV+F +  SR  V+  R+LTNVG+AG  Y V +  P  ++V VKP +L F+  GD+L
Sbjct  665  PSFSVVFDRRSSRSTVKYRRDLTNVGSAGDTYTVKVTGPSDISVRVKPARLEFRRAGDKL  724

Query  239  RYTVTFVS--KKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
            RYTVTF S   +G + P  AAFG ++W++ ++ VRSPI+++W
Sbjct  725  RYTVTFRSANARGPMDP--AAFGWLTWSSGEHDVRSPISYTW  764



>ref|XP_002467295.1| hypothetical protein SORBIDRAFT_01g023190 [Sorghum bicolor]
 gb|EER94293.1| hypothetical protein SORBIDRAFT_01g023190 [Sorghum bicolor]
Length=767

 Score =   166 bits (421),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 88/158 (56%), Positives = 108/158 (68%), Gaps = 4/158 (3%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHVDP KALSPGLVYDI+  DY  FLCSL+Y+   IQ I K  N++C KK   P  LNYP
Sbjct  610  GHVDPQKALSPGLVYDISTNDYAAFLCSLNYSAPHIQVITKTSNVSCPKKF-RPGDLNYP  668

Query  407  SFSVLFG-KSRIV-RQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRY  234
            SFSV+F  KS+ V R  RELTNVG A ++Y V + +P SV VTV P KL FK  G +LRY
Sbjct  669  SFSVVFNQKSKPVQRFRRELTNVGPATSVYNVKVISPESVAVTVTPAKLTFKKAGQKLRY  728

Query  233  TVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
             VTF SK G  + +   FG +SW N ++ VRSP+A++W
Sbjct  729  HVTFASKAG-QSHAKPDFGWISWVNDEHVVRSPVAYTW  765



>ref|NP_001145743.1| uncharacterized protein LOC100279250 precursor [Zea mays]
 gb|ACN33223.1| unknown [Zea mays]
Length=773

 Score =   166 bits (420),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 84/165 (51%), Positives = 109/165 (66%), Gaps = 12/165 (7%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITC-AKKLSNPAQLNY  411
            GHVDP +ALSPGLVYDI+  DY  FLCSL+Y+   +Q I KA N++C A   S P  LNY
Sbjct  610  GHVDPQRALSPGLVYDISTHDYAAFLCSLNYSAPHVQVITKASNVSCGAPNKSRPGDLNY  669

Query  410  PSFSVLFGKSR------IVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVG  249
            PSFSV+FG+ R       +R  RELTNVG A ++Y+V +  P SV VTV P +L F+  G
Sbjct  670  PSFSVVFGQKRKTKPAAALRFRRELTNVGPAASVYDVKVVGPESVAVTVTPARLTFRQAG  729

Query  248  DRLRYTVTFVS--KKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
             +LRY VTF S  ++G   P    FG +SW N ++ VRSP+A++W
Sbjct  730  QKLRYYVTFASRARQGHAKPD---FGWISWVNDEHVVRSPVAYTW  771



>tpg|DAA50071.1| TPA: putative subtilase family protein [Zea mays]
Length=773

 Score =   166 bits (420),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 84/165 (51%), Positives = 109/165 (66%), Gaps = 12/165 (7%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITC-AKKLSNPAQLNY  411
            GHVDP +ALSPGLVYDI+  DY  FLCSL+Y+   +Q I KA N++C A   S P  LNY
Sbjct  610  GHVDPQRALSPGLVYDISTHDYAAFLCSLNYSAPHVQVITKASNVSCGAPNKSRPGDLNY  669

Query  410  PSFSVLFGKSR------IVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVG  249
            PSFSV+FG+ R       +R  RELTNVG A ++Y+V +  P SV VTV P +L F+  G
Sbjct  670  PSFSVVFGQKRKTKPAAALRFRRELTNVGPAASVYDVKVVGPESVAVTVTPARLTFRQAG  729

Query  248  DRLRYTVTFVS--KKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
             +LRY VTF S  ++G   P    FG +SW N ++ VRSP+A++W
Sbjct  730  QKLRYYVTFASRARQGHAKPD---FGWISWVNDEHVVRSPVAYTW  771



>gb|EEE50901.1| hypothetical protein OsJ_31407 [Oryza sativa Japonica Group]
Length=758

 Score =   165 bits (418),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 107/160 (67%), Gaps = 8/160 (5%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHVDP KALSPGL+YDI+  DY  FLCSL+YTT  IQ I K  NITC +K   P  LNYP
Sbjct  601  GHVDPQKALSPGLLYDISTKDYVSFLCSLNYTTPHIQVITKMSNITCPRKF-RPGDLNYP  659

Query  407  SFSVLFGK--SRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRY  234
            SFSV+F K    ++R  RE+TNVG A ++Y V +  P SV+V V P KLVF  VG + RY
Sbjct  660  SFSVVFKKKSKHVMRFRREVTNVGPAMSVYNVKVSGPASVSVKVTPAKLVFNKVGQKQRY  719

Query  233  TVTFVSKKGVVTPSNAA--FGSVSWNNAQNQVRSPIAFSW  120
             V F S    V  SNA   FG +SW ++Q+ VRSPIA++W
Sbjct  720  YVIFAS---TVDASNAKPDFGWISWMSSQHVVRSPIAYTW  756



>gb|EAY78354.1| hypothetical protein OsI_33442 [Oryza sativa Indica Group]
Length=773

 Score =   165 bits (417),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 107/160 (67%), Gaps = 8/160 (5%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHVDP KALSPGL+YDI+  DY  FLCSL+YTT  IQ I K  NITC +K   P  LNYP
Sbjct  616  GHVDPQKALSPGLLYDISTKDYVSFLCSLNYTTPHIQVITKMSNITCPRKF-RPGDLNYP  674

Query  407  SFSVLFGK--SRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRY  234
            SFSV+F K    ++R  RE+TNVG A ++Y V +  P SV+V V P KLVF  VG + RY
Sbjct  675  SFSVVFKKKSKHVMRFRREVTNVGPAMSVYNVKVSGPASVSVKVTPAKLVFNKVGQKQRY  734

Query  233  TVTFVSKKGVVTPSNAA--FGSVSWNNAQNQVRSPIAFSW  120
             V F S    V  SNA   FG +SW ++Q+ VRSPIA++W
Sbjct  735  YVIFAS---TVDASNAKPDFGWISWMSSQHVVRSPIAYTW  771



>gb|AAM22744.1|AC092388_28 putative cucumisin-like serine protease [Oryza sativa Japonica 
Group]
 gb|AAP53584.1| Subtilisin N-terminal Region family protein, expressed [Oryza 
sativa Japonica Group]
Length=773

 Score =   165 bits (417),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 107/160 (67%), Gaps = 8/160 (5%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHVDP KALSPGL+YDI+  DY  FLCSL+YTT  IQ I K  NITC +K   P  LNYP
Sbjct  616  GHVDPQKALSPGLLYDISTKDYVSFLCSLNYTTPHIQVITKMSNITCPRKF-RPGDLNYP  674

Query  407  SFSVLFGK--SRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRY  234
            SFSV+F K    ++R  RE+TNVG A ++Y V +  P SV+V V P KLVF  VG + RY
Sbjct  675  SFSVVFKKKSKHVMRFRREVTNVGPAMSVYNVKVSGPASVSVKVTPAKLVFNKVGQKQRY  734

Query  233  TVTFVSKKGVVTPSNAA--FGSVSWNNAQNQVRSPIAFSW  120
             V F S    V  SNA   FG +SW ++Q+ VRSPIA++W
Sbjct  735  YVIFAS---TVDASNAKPDFGWISWMSSQHVVRSPIAYTW  771



>ref|NP_001130775.1| uncharacterized protein LOC100191879 precursor [Zea mays]
 gb|ACG30165.1| subtilisin-like protease precursor [Zea mays]
Length=766

 Score =   164 bits (416),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 83/162 (51%), Positives = 113/162 (70%), Gaps = 8/162 (5%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAI-VKAPNITCAKKLSNPAQLNY  411
            GHVDP  ALSPGLVYD +  DY  FLC++    +QIQ I  + PN+TC +KLS+P  LNY
Sbjct  605  GHVDPVSALSPGLVYDASVDDYVAFLCTVGVAPRQIQVITAEGPNVTCTRKLSSPGDLNY  664

Query  410  PSFSVLFGK--SR-IVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRL  240
            PSFSV+F +  SR  V+  R+LTNVG+AG  Y V +  P  ++V VKP +L F+  GD+L
Sbjct  665  PSFSVVFDRRSSRSTVKYRRDLTNVGSAGDTYTVKVTGPSDISVRVKPARLEFRRAGDKL  724

Query  239  RYTVTFVS--KKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
            RYTVTF S   +G + P  AAFG ++W++ ++ VRSPI+++W
Sbjct  725  RYTVTFRSANARGPMDP--AAFGWLTWSSGEHDVRSPISYTW  764



>ref|XP_006662325.1| PREDICTED: subtilisin-like protease-like [Oryza brachyantha]
Length=535

 Score =   162 bits (410),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 84/161 (52%), Positives = 110/161 (68%), Gaps = 9/161 (6%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHVDP KALSPGLVYDI+  DY  FLCSL+Y+T  IQ I K  NITC +K   P  LNYP
Sbjct  377  GHVDPQKALSPGLVYDISTKDYVSFLCSLNYSTPHIQVITKMSNITCPRKF-RPGDLNYP  435

Query  407  SFSVLFGKS--RIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRY  234
            SFSV+F K+   ++R  RE+TNVG A ++Y V + +P SV+V V P+++VF  VG + RY
Sbjct  436  SFSVVFKKNSRHVMRFRREVTNVGPAMSVYNVKVTSPASVSVKVTPSRIVFNRVGQKQRY  495

Query  233  TVTFVSK---KGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
             VTF +K    G V P    FG +SW + ++ VRSP+A++W
Sbjct  496  YVTFAAKVDDTGSVKPD---FGWISWLSNEHVVRSPVAYTW  533



>gb|EMT22975.1| Subtilisin-like protease [Aegilops tauschii]
Length=432

 Score =   158 bits (400),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 90/157 (57%), Positives = 111/157 (71%), Gaps = 5/157 (3%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTT-QQIQAIVKAPNITCAKKLSNPAQLNY  411
            GHVDP KALSPGLVYD +  DY  FLC++   + +Q+QAI  APN TC +KLS+P  LNY
Sbjct  204  GHVDPVKALSPGLVYDTSVDDYVAFLCTVGGASPRQVQAITGAPNATCQRKLSSPGDLNY  263

Query  410  PSFSVLFG--KSR-IVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRL  240
            PSFSV+FG  KSR  VR  RELTNVGAAG +Y   +  PPS+ V+VKP +LVFK  GD+L
Sbjct  264  PSFSVVFGLRKSRSTVRYHRELTNVGAAGAVYAAKVTGPPSIAVSVKPARLVFKKAGDKL  323

Query  239  RYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  129
            RYTV F S      P +AAFG ++W++    VRSPI+
Sbjct  324  RYTVAFKSTA-EGGPMDAAFGWLTWSSGGQDVRSPIS  359



>ref|XP_006849717.1| hypothetical protein AMTR_s00024p00243520 [Amborella trichopoda]
 gb|ERN11298.1| hypothetical protein AMTR_s00024p00243520 [Amborella trichopoda]
Length=780

 Score =   161 bits (407),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 78/158 (49%), Positives = 109/158 (69%), Gaps = 4/158 (3%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAK-KLSNPAQLNY  411
            GHVDP  AL PGL+YD++ +DY  FLCSL+Y+  Q++ + K  N +C + K+ +   LNY
Sbjct  621  GHVDPQNALDPGLIYDLSTSDYLDFLCSLNYSDTQVRIVSKHSNFSCPRDKVLDTGNLNY  680

Query  410  PSFSVLF-GKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRY  234
            PSFSV+F G  ++VR +R LTNVG   ++Y V++ AP  V +TVKP +LVFK VG++  Y
Sbjct  681  PSFSVIFRGYEKVVRYSRVLTNVGEPSSVYTVSVSAPEGVGITVKPQRLVFKGVGNKQGY  740

Query  233  TVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
            TV F SK     P +  FG + W+N +++VRSPIAFSW
Sbjct  741  TVEFASKIKTSGPMD--FGWILWSNQKHKVRSPIAFSW  776



>ref|XP_010238218.1| PREDICTED: subtilisin-like protease [Brachypodium distachyon]
Length=805

 Score =   155 bits (391),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 85/168 (51%), Positives = 114/168 (68%), Gaps = 13/168 (8%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTT--QQIQAIVKA----PNITCAKKLSNP  426
            GHVDP KALSPGLVYD +  DY  FLC++   +  +QIQAI  +     N TC +KLS+P
Sbjct  637  GHVDPVKALSPGLVYDTSIDDYVAFLCTVGGASSPRQIQAITGSRTAKGNATCQRKLSSP  696

Query  425  AQLNYPSFSVLF---GKSRIVRQTRELTNVGAAGTLYEVAIE-APPSVTVTVKPTKLVFK  258
              LNYPSFSV++        V+  RELTNVGAAG++Y V +   P SV+V VKP +LVFK
Sbjct  697  GDLNYPSFSVVYPLRKSHSTVKYRRELTNVGAAGSVYTVKVTGGPSSVSVAVKPARLVFK  756

Query  257  NVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNA--QNQVRSPIAFSW  120
              GD+L+YTV F S      P++AAFG ++W++A  ++ VRSPI+++W
Sbjct  757  KAGDKLKYTVAFKSSA-QGAPTDAAFGWLTWSSADGEHDVRSPISYTW  803



>gb|KJB70156.1| hypothetical protein B456_011G061400 [Gossypium raimondii]
Length=764

 Score =   152 bits (385),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 75/163 (46%), Positives = 107/163 (66%), Gaps = 5/163 (3%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNIT--CAKKLSNPAQLN  414
            GHVDP++AL+PGLVYD   +DY  FLCS+ Y +++I+  V+ PN +  CA KL+ P  LN
Sbjct  595  GHVDPNRALNPGLVYDTDSSDYIAFLCSIGYDSKRIEVFVREPNSSDVCATKLATPGDLN  654

Query  413  YPSFSVLFGKS-RIVRQTRELTNVG-AAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRL  240
            YPSFSV+F  +  +V+  R++ NVG +AG +YE  + APP V ++V P+KL F  V   L
Sbjct  655  YPSFSVVFNSNDHVVKYRRKVKNVGTSAGAVYEAKVNAPPGVKISVSPSKLEFSAVNQTL  714

Query  239  RYTVTFVSKK-GVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQ  114
             Y V+F S   G+ +  +  FGS+ W++  + VRSPIA  W Q
Sbjct  715  SYEVSFASDSLGLSSVESQGFGSIEWSDGVHLVRSPIAVRWIQ  757



>gb|EPS61652.1| hypothetical protein M569_13143, partial [Genlisea aurea]
Length=738

 Score =   149 bits (376),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 100/159 (63%), Gaps = 3/159 (2%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITC--AKKLSNPAQLN  414
            GHVDP KA+SPGLVYD   TDY  FLC  +YT + I  I    N+TC  A  + +P QLN
Sbjct  580  GHVDPAKAVSPGLVYDANVTDYVSFLCWSNYTAESISTIAGGRNVTCPEANGVDDPGQLN  639

Query  413  YPSFSVLF-GKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLR  237
            YPSFSV+F    R V  TR +TNVG   + Y V++ AP + T+ V P +LVF   G +L+
Sbjct  640  YPSFSVVFVSGGRPVSYTRVVTNVGNGPSTYVVSVTAPSAATIVVIPKELVFGAKGQKLQ  699

Query  236  YTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
            YT TF S +G    +  AFG++SW +   QV SP+AF+W
Sbjct  700  YTSTFGSNRGANATAGNAFGAISWISNTTQVTSPVAFTW  738



>ref|XP_008462294.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Cucumis 
melo]
Length=770

 Score =   147 bits (370),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 73/159 (46%), Positives = 100/159 (63%), Gaps = 5/159 (3%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNIT--CAKKLSNPAQLN  414
            GH+DP++AL+PGL+YD+ P DY  FLCS+ Y ++QI   VK  + +  C  KLSNP  LN
Sbjct  606  GHIDPNQALNPGLIYDLTPQDYVSFLCSIGYDSKQIAVFVKGSSYSQLCEHKLSNPGNLN  665

Query  413  YPSFSVLFGKSRIVRQTRELTNVG-AAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLR  237
            YPSFSV+F    +V+ TR +TNVG     +Y V +EAP  V ++V P KL F      L 
Sbjct  666  YPSFSVVFDDGEVVKYTRTVTNVGDETEVVYGVKVEAPQGVEISVVPNKLEFNKEKTTLS  725

Query  236  YTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
            Y +TF    G     +A+FGS+ W++  + VRSPIA S+
Sbjct  726  YEITFTKINGF--KESASFGSIQWSDGIHNVRSPIAVSF  762



>ref|XP_007134944.1| hypothetical protein PHAVU_010G088700g [Phaseolus vulgaris]
 gb|ESW06938.1| hypothetical protein PHAVU_010G088700g [Phaseolus vulgaris]
Length=764

 Score =   145 bits (365),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/160 (46%), Positives = 101/160 (63%), Gaps = 5/160 (3%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLS-NPAQLNY  411
            GHV+P +A  PGLVYDI   DY  +LCSL YT+ QI A++   N  CAKK +     LNY
Sbjct  605  GHVNPERASDPGLVYDITTKDYLNYLCSLKYTSSQI-ALLSKGNFKCAKKSALRAGDLNY  663

Query  410  PSFSVLFGKSRI---VRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRL  240
            PSF+VLFG S +   VR  R +TNVG     Y V +E P  V+V V+PT + F+  G++L
Sbjct  664  PSFAVLFGTSALNASVRYKRIVTNVGNPKISYAVKVEEPKGVSVRVEPTNISFRKTGEKL  723

Query  239  RYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
             Y V+FVS +      +++FGS++W + +  VRSPIA +W
Sbjct  724  SYKVSFVSNENTTVSGSSSFGSITWVSGKYAVRSPIAVTW  763



>gb|ABF70004.1| subtilisin-like serine proteinase, putative [Musa acuminata]
Length=757

 Score =   144 bits (363),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 80/160 (50%), Positives = 102/160 (64%), Gaps = 7/160 (4%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAK-KLSNPAQLNY  411
            GHVDP KAL PGLVYD+   DY  FLC+L+YT  QI  + +  N TC + K    + LNY
Sbjct  602  GHVDPPKALDPGLVYDLTTEDYLDFLCALNYTPLQIARLSRLTNYTCDRQKAYEVSDLNY  661

Query  410  PSFSVLFG-KSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRY  234
            PSF+V F   S  V+ TR LTNVGA GT Y+  + AP  V V V+PT L F  +G++  Y
Sbjct  662  PSFAVAFATASTTVKHTRTLTNVGAPGT-YKATVSAPEGVKVVVEPTALTFSALGEKKNY  720

Query  233  TVTFVSKKGVVTPSNA-AFGSVSWNNAQNQVRSPIAFSWT  117
            TVTF +      PS + AFG + W++AQ+ V SP+AFSWT
Sbjct  721  TVTFSTAS---QPSGSTAFGRLEWSDAQHVVASPLAFSWT  757



>ref|XP_010917483.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Elaeis 
guineensis]
Length=778

 Score =   144 bits (363),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 97/164 (59%), Gaps = 4/164 (2%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPN-ITC-AKKLSNPAQLN  414
            GHVDP+KAL PGL+YD    DY  FLC++ Y+TQQI    +    + C A  L++P  LN
Sbjct  611  GHVDPNKALDPGLIYDSQVEDYLAFLCAIGYSTQQIALFTRDETTVNCSAMTLASPGDLN  670

Query  413  YPSFSVLFGK-SRIVRQTRELTNVGA-AGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRL  240
            YP+FSV+F   S IV  +R + NVG     +YE  I  PP V VTV P+KLVF  V   L
Sbjct  671  YPAFSVVFSSTSDIVTFSRVVRNVGGPDDAVYEAEISGPPGVNVTVAPSKLVFDAVDQSL  730

Query  239  RYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQLF  108
             Y +TF S        +  FG +SW++  + VRSPIA SW Q F
Sbjct  731  SYEITFASIADAAVAGSNGFGGISWSDGTHSVRSPIAVSWRQSF  774



>ref|XP_004141706.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
 ref|XP_004155913.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
 gb|KGN45480.1| Subtilase family protein [Cucumis sativus]
Length=771

 Score =   143 bits (360),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 71/159 (45%), Positives = 99/159 (62%), Gaps = 5/159 (3%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNI--TCAKKLSNPAQLN  414
            GH++P++AL+PGL+YD+ P DY  FLCS+ Y ++QI   VK  +    C  KL+NP  LN
Sbjct  606  GHINPNQALNPGLIYDLTPQDYVSFLCSIGYDSKQIAVFVKGSSYFQLCEHKLTNPGNLN  665

Query  413  YPSFSVLFGKSRIVRQTRELTNVG-AAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLR  237
            YPSFSV+F +  +V+ TR +TNVG     +YEV +EAP  V ++V P KL F        
Sbjct  666  YPSFSVVFDEEEVVKYTRTVTNVGDETEVVYEVKVEAPQGVVISVVPNKLEFNKEKTTQS  725

Query  236  YTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
            Y +TF    G     +A+FGS+ W +  + VRSPIA S+
Sbjct  726  YEITFTKINGF--KESASFGSIQWGDGIHSVRSPIAVSF  762



>ref|XP_006583358.1| PREDICTED: subtilisin-like protease-like isoform X2 [Glycine 
max]
Length=734

 Score =   142 bits (359),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 75/160 (47%), Positives = 101/160 (63%), Gaps = 5/160 (3%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLS-NPAQLNY  411
            GHV+P +A  PGLVYDI   DY  +LCSL YT+ QI AI+   N  CAKK + +   LNY
Sbjct  575  GHVNPERASDPGLVYDITTKDYLNYLCSLKYTSSQI-AILSKGNFKCAKKSALHAGDLNY  633

Query  410  PSFSVLFGKSR---IVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRL  240
            PSF+VLFG S     V   R +TNVG   + Y V +E P  V+V+V+P  + F+ +GD+L
Sbjct  634  PSFAVLFGTSARNASVAYKRVVTNVGKPSSSYAVKVEEPKGVSVSVEPRNISFRKIGDKL  693

Query  239  RYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
             Y VTFVS        +++FGS++W + +  VRSPIA +W
Sbjct  694  SYKVTFVSYGRTAIAGSSSFGSLTWVSDKYTVRSPIAVTW  733



>gb|KHN04600.1| Subtilisin-like protease [Glycine soja]
Length=734

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/160 (46%), Positives = 102/160 (64%), Gaps = 5/160 (3%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLS-NPAQLNY  411
            GHV+P +A  PGLVYDI   DY  +LCSL YT+ QI AI+   N  CAKK + +   LNY
Sbjct  575  GHVNPERASDPGLVYDITTKDYLNYLCSLKYTSSQI-AILSKGNFKCAKKSALHAGDLNY  633

Query  410  PSFSVLFG---KSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRL  240
            PSF+VLFG   ++  V   R +TNVG   + Y V +E P  V+V+V+P  + F+ +GD+L
Sbjct  634  PSFAVLFGTSARNASVAYKRVVTNVGKPSSSYAVKVEEPKGVSVSVEPRNISFRKIGDKL  693

Query  239  RYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
             Y VTFVS        +++FGS++W + +  VRSPIA +W
Sbjct  694  SYKVTFVSYGRTAIAGSSSFGSLTWVSDKYTVRSPIAVTW  733



>ref|XP_003528890.1| PREDICTED: subtilisin-like protease-like isoform X1 [Glycine 
max]
Length=763

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/160 (46%), Positives = 102/160 (64%), Gaps = 5/160 (3%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLS-NPAQLNY  411
            GHV+P +A  PGLVYDI   DY  +LCSL YT+ QI AI+   N  CAKK + +   LNY
Sbjct  604  GHVNPERASDPGLVYDITTKDYLNYLCSLKYTSSQI-AILSKGNFKCAKKSALHAGDLNY  662

Query  410  PSFSVLFG---KSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRL  240
            PSF+VLFG   ++  V   R +TNVG   + Y V +E P  V+V+V+P  + F+ +GD+L
Sbjct  663  PSFAVLFGTSARNASVAYKRVVTNVGKPSSSYAVKVEEPKGVSVSVEPRNISFRKIGDKL  722

Query  239  RYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
             Y VTFVS        +++FGS++W + +  VRSPIA +W
Sbjct  723  SYKVTFVSYGRTAIAGSSSFGSLTWVSDKYTVRSPIAVTW  762



>emb|CDP20511.1| unnamed protein product [Coffea canephora]
Length=777

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 73/162 (45%), Positives = 105/162 (65%), Gaps = 6/162 (4%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVK---APNITCAKKLSNPAQL  417
            GHVDP++AL+PGLVYD+  +DY  FLC++ Y+  +I   V+    P    A+ +  P  L
Sbjct  607  GHVDPNRALNPGLVYDLGTSDYVAFLCAVGYSPGRIAVFVRDGPVPVDCGAQGMGTPGDL  666

Query  416  NYPSFSVLFG-KSRIVRQTRELTNVGA-AGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDR  243
            NYPSFSV+F   + +V+ TR + NVG+ A  +YEV + APPSV VTV P++LVF    D 
Sbjct  667  NYPSFSVVFSPGNSVVKYTRVVKNVGSNAEAVYEVKVNAPPSVEVTVSPSQLVFSQGNDT  726

Query  242  LRYTVTFVSKKGVVTPS-NAAFGSVSWNNAQNQVRSPIAFSW  120
            L Y V+F +  G++  +   AFGS+ W++ ++ VRSPIA  W
Sbjct  727  LSYEVSFTTASGILVGALKPAFGSLEWSDGEHLVRSPIAVVW  768



>gb|KCW79387.1| hypothetical protein EUGRSUZ_C00799 [Eucalyptus grandis]
Length=729

 Score =   141 bits (356),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 98/158 (62%), Gaps = 28/158 (18%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GH+DP KALSPGLVYD+   DY  F+CSL+YT +Q+Q+ V+  N                
Sbjct  599  GHIDPRKALSPGLVYDLTADDYVAFVCSLNYTIKQVQSTVRRTN----------------  642

Query  407  SFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTV  228
                     ++VR +RE+TNVG AG++Y+VA++AP +V V VKP +LVF  VG++ RYTV
Sbjct  643  ---------KVVRYSREVTNVGDAGSVYKVAVQAPSTVAVRVKPRRLVFGKVGEKQRYTV  693

Query  227  TFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQ  114
            TFV++           GS++W N Q++VRSP+ F W +
Sbjct  694  TFVARN---KTDETHGGSITWKNRQHRVRSPVGFLWGE  728



>gb|EYU29564.1| hypothetical protein MIMGU_mgv1a023796mg [Erythranthe guttata]
Length=738

 Score =   141 bits (356),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 78/155 (50%), Positives = 102/155 (66%), Gaps = 6/155 (4%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNP-AQLNY  411
            GHV+P +A  PGLVYDI P DY  +LC L+YT Q++  IV A  + C+K+ + P AQLNY
Sbjct  583  GHVNPSRANDPGLVYDIMPDDYIPYLCGLNYTNQEVGIIV-ARKVDCSKEKTIPEAQLNY  641

Query  410  PSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYT  231
            PSFS++FG S     TR LTNVG A + Y+V I +P  V V V+P KLVF  +GD+  Y+
Sbjct  642  PSFSIIFGSSPQT-YTRTLTNVGKANSSYDVEIGSPDGVNVKVEPKKLVFPKLGDKSSYS  700

Query  230  VTFV-SKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  129
            VTF  + KGV+  S   F  + W+ A+  VRSPIA
Sbjct  701  VTFTRTNKGVMNSSTQGF--IRWHTAEYSVRSPIA  733



>ref|XP_009416811.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=757

 Score =   141 bits (356),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 79/160 (49%), Positives = 102/160 (64%), Gaps = 7/160 (4%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAK-KLSNPAQLNY  411
            GHVDP KAL PGLVY++   DY  FLC+L+YT  QI  + +  N TC + K    + LNY
Sbjct  602  GHVDPPKALDPGLVYNLTNEDYLDFLCALNYTPLQIARLSRLTNYTCDRQKAYEVSDLNY  661

Query  410  PSFSVLFG-KSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRY  234
            PSF+V F   S  V+ TR LTNVGA GT Y+  + AP  V V V+PT L F  +G++  Y
Sbjct  662  PSFAVAFATASTTVKHTRTLTNVGAPGT-YKATVSAPEDVKVVVEPTALTFAALGEKKNY  720

Query  233  TVTFVSKKGVVTPSNA-AFGSVSWNNAQNQVRSPIAFSWT  117
            TVTF +      PS + AFG + W++AQ+ V SP+AFSWT
Sbjct  721  TVTFSTAS---QPSGSTAFGRLEWSDAQHVVASPLAFSWT  757



>gb|EYU29364.1| hypothetical protein MIMGU_mgv1a022867mg [Erythranthe guttata]
Length=672

 Score =   140 bits (352),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 77/155 (50%), Positives = 101/155 (65%), Gaps = 6/155 (4%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNP-AQLNY  411
            GHV+P +A  PGLVYDI P DY  ++C L+YT QQ+  IV   N+ C+K+ S P AQLNY
Sbjct  517  GHVNPSRADDPGLVYDILPDDYIPYVCGLNYTNQQVGIIV-GRNVDCSKEKSIPEAQLNY  575

Query  410  PSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYT  231
            PSFS++FG S     TR LTNVG A + Y+V I +P  V V V+P +LVF  +GD+  Y 
Sbjct  576  PSFSIIFGSSPQT-YTRTLTNVGKANSSYDVEIVSPDGVIVKVEPKQLVFPKLGDKSSYN  634

Query  230  VTFV-SKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  129
            VTF  + KG +  +   F  + W+NA+  VRSPIA
Sbjct  635  VTFTRTTKGAMNGTTQGF--IRWHNAEYSVRSPIA  667



>gb|EYU29552.1| hypothetical protein MIMGU_mgv1a0178121mg, partial [Erythranthe 
guttata]
Length=188

 Score =   132 bits (333),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 75/155 (48%), Positives = 97/155 (63%), Gaps = 6/155 (4%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNP-AQLNY  411
            GHV+P +A  PGLVYDI P DY  +LC L+Y  QQ+  I+    + C+K+ S P AQLNY
Sbjct  33   GHVNPSRANDPGLVYDILPDDYIPYLCGLNYPNQQV-GILVGRKVDCSKEKSIPEAQLNY  91

Query  410  PSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYT  231
            PSFS++FG S     TR LTNVG A + Y+V I +P  V V V+P KLVF  +GD+  Y+
Sbjct  92   PSFSIVFG-STPQTYTRMLTNVGKANSSYDVEIVSPDGVNVKVEPKKLVFPKLGDKSSYS  150

Query  230  VTFV-SKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  129
            VTF  + KG +  +   F  + W  A   VRSPIA
Sbjct  151  VTFTRTTKGAINSTTQGF--IRWYTADYSVRSPIA  183



>gb|EYU29358.1| hypothetical protein MIMGU_mgv1a024271mg [Erythranthe guttata]
Length=354

 Score =   136 bits (343),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 77/155 (50%), Positives = 102/155 (66%), Gaps = 6/155 (4%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNP-AQLNY  411
            GHV+P +A  P LVYDI P DY  +LC L+YT Q++  IV +  + C+K+ S P AQLNY
Sbjct  199  GHVNPSRANDPRLVYDIMPDDYIPYLCGLNYTNQEVGIIVGS-KVDCSKEKSIPEAQLNY  257

Query  410  PSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYT  231
            PSFS++FG S     TR LTNVG A + Y+V I +P  V V V+P KLVF  +GD+  Y+
Sbjct  258  PSFSIIFG-STPQTYTRTLTNVGKANSSYDVEIVSPDGVNVKVEPKKLVFPKLGDKSSYS  316

Query  230  VTFV-SKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  129
            VTF  + KGV+  S   F  + W++A+  VRSPIA
Sbjct  317  VTFTRTTKGVMNSSTQGF--IRWHSAKYSVRSPIA  349



>gb|ACJ26761.1| subtilisin-like protein [Nicotiana benthamiana]
Length=191

 Score =   132 bits (332),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 71/167 (43%), Positives = 99/167 (59%), Gaps = 9/167 (5%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVK-APNITCAKK-LSNPAQLN  414
            GHVDP++AL PGL+YDI  +DY  FLCS+ Y    +    + +  + C+++ L+ P  LN
Sbjct  18   GHVDPNRALDPGLIYDIETSDYVNFLCSIGYDGDDVAVFARDSSRVNCSERSLATPGDLN  77

Query  413  YPSFSVLF-GKSR-IVRQTRELTNVGA-AGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDR  243
            YPSFSV+F G+S  +V+  R + NVG     +YEV + AP SV V V P KLVF      
Sbjct  78   YPSFSVVFTGESNGVVKYKRVVKNVGKNTDAVYEVKVNAPSSVEVNVSPAKLVFSEEKQS  137

Query  242  LRYTVTFVSKKG----VVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQ  114
            L Y ++  SKK     +V    +AFGS+ W++  + VRSPIA  W  
Sbjct  138  LSYEISLKSKKSGDLQMVKGIESAFGSIEWSDGIHNVRSPIAVRWRH  184



>ref|XP_004492670.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=785

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 77/160 (48%), Positives = 101/160 (63%), Gaps = 6/160 (4%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHVDP  A  PGLVYDI+  DY  + CSL++T+ QI AI+      C+ K      LNYP
Sbjct  627  GHVDPESASDPGLVYDISTNDYLNYFCSLNFTSSQI-AILSKSKFNCSMKQVQVGDLNYP  685

Query  407  SFSVLF---GKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLR  237
            SFSV+F   GKS  V   R +TNVG + ++YEV +E P  V V+V+P KL F  +G +LR
Sbjct  686  SFSVIFSRTGKSASVTYKRVVTNVGKSESVYEVKVEQPNGVVVSVEPRKLKFDKLGQKLR  745

Query  236  YTVTFVS-KKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
            Y VTF    KG V  S ++FGS+ W + + +VRSPIA +W
Sbjct  746  YKVTFFGIGKGRVIGS-SSFGSLIWVSDKYKVRSPIAVTW  784



>ref|XP_006576383.1| PREDICTED: subtilisin-like protease-like isoform X1 [Glycine 
max]
 ref|XP_006576384.1| PREDICTED: subtilisin-like protease-like isoform X2 [Glycine 
max]
Length=766

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/160 (46%), Positives = 101/160 (63%), Gaps = 5/160 (3%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLS-NPAQLNY  411
            GHV+P +A  PGLVYDI   DY  +LCSL YT+ QI AI+   N  CAKK + +   LNY
Sbjct  607  GHVNPERASDPGLVYDITTKDYLNYLCSLKYTSSQI-AILSKGNFKCAKKSALHAGGLNY  665

Query  410  PSFSVLF---GKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRL  240
            PSF+VLF    ++  V   R +TNVG   + Y V +E P  V+VTV+P  + F+ +GD+L
Sbjct  666  PSFAVLFDTSARNASVTYKRVVTNVGNPSSSYAVKVEEPKGVSVTVEPRNIGFRKIGDKL  725

Query  239  RYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
             Y V+FVS        +++FGS++W + +  VRSPIA +W
Sbjct  726  SYKVSFVSYGRTAVAGSSSFGSLTWVSGKYAVRSPIAVTW  765



>ref|XP_003554304.1| PREDICTED: subtilisin-like protease SDD1-like [Glycine max]
 gb|KHN02462.1| Subtilisin-like protease SDD1 [Glycine soja]
Length=768

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 78/166 (47%), Positives = 107/166 (64%), Gaps = 12/166 (7%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAK--KLSNPAQLN  414
            GHV+P +AL+PGLVYDI P DY   LCSL YT  +I +I    N++C    K++    LN
Sbjct  602  GHVNPQRALNPGLVYDIRPDDYITHLCSLGYTKSEIFSITHR-NVSCNGIIKMNRGFSLN  660

Query  413  YPSFSVLFGKSRIVRQ--TRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRL  240
            YPSFSV+F K  + R+  +R LTNVG+A ++Y V ++AP  V V VKP +LVFK V   L
Sbjct  661  YPSFSVIF-KDEVRRKMFSRRLTNVGSANSIYSVEVKAPAGVKVIVKPKRLVFKQVNQSL  719

Query  239  RYTVTFVSKKGVVTPS---NAAFGSVSWNNAQN---QVRSPIAFSW  120
             Y V F+S+K V       N + GS++W ++QN   +VRSP+A +W
Sbjct  720  SYRVWFISRKKVKRGDGLVNHSEGSLTWVHSQNGSYRVRSPVAVTW  765



>gb|KHN13888.1| Subtilisin-like protease [Glycine soja]
Length=738

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 72/159 (45%), Positives = 98/159 (62%), Gaps = 3/159 (2%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHV+P  A  PGLVYDI+  DY  +LCS++YT+ QI  + +   +   K L     LNYP
Sbjct  579  GHVNPVNASDPGLVYDISTKDYLNYLCSINYTSSQIALLSRGKFVCSKKTLLQAGNLNYP  638

Query  407  SFSVLFGKS---RIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLR  237
            SFSVLFG+S     V   R +TNVG   + Y V +E P  V+VTV+P KL F+ VG +L 
Sbjct  639  SFSVLFGRSASNASVTYRRVVTNVGNPQSAYAVKLEQPNGVSVTVEPRKLKFEKVGQKLS  698

Query  236  YTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
            Y VTF+S  G      ++FGS+ W + + +VRSP+A +W
Sbjct  699  YKVTFLSIGGARVAGTSSFGSLVWVSGKYKVRSPMAVTW  737



>gb|KHN10783.1| Subtilisin-like protease SDD1 [Glycine soja]
Length=693

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 78/165 (47%), Positives = 105/165 (64%), Gaps = 10/165 (6%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITC--AKKLSNPAQLN  414
            GHV+P +AL+PGLVYDI P DY   LCSL YT  +I +I    N++C    K++    LN
Sbjct  527  GHVNPQRALNPGLVYDIRPDDYITHLCSLGYTKSEIFSITHR-NVSCNAIMKMNRGFSLN  585

Query  413  YPSFSVLF-GKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLR  237
            YPSFSV+F G  R    +R LTNVG+A ++Y + ++AP  V V VKP +LVFK V   L 
Sbjct  586  YPSFSVIFKGGVRRKMFSRRLTNVGSANSIYSMEVKAPEGVKVIVKPKRLVFKQVNQSLS  645

Query  236  YTVTFVSKKGVVTPS---NAAFGSVSWNNAQN---QVRSPIAFSW  120
            Y V F+S+K V       N A GS++W ++QN   +VRSP+A +W
Sbjct  646  YRVWFISRKRVKRGDDLVNYAEGSLTWVHSQNGSYRVRSPVAVTW  690



>ref|XP_006574858.1| PREDICTED: subtilisin-like protease-like isoform X1 [Glycine 
max]
 ref|XP_006574859.1| PREDICTED: subtilisin-like protease-like isoform X2 [Glycine 
max]
Length=772

 Score =   139 bits (349),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 71/159 (45%), Positives = 98/159 (62%), Gaps = 3/159 (2%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHV+P  A  PGLVYDI+  DY  +LCS++YT+ QI  + +   +   K +     LNYP
Sbjct  613  GHVNPVSASDPGLVYDISTKDYLNYLCSINYTSSQIALLSRGKFVCSKKAVLQAGDLNYP  672

Query  407  SFSVLFGKSRI---VRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLR  237
            SF+VL GKS +   V   R +TNVG   + Y V +E P  V+VTV+P KL F+ VG +L 
Sbjct  673  SFAVLLGKSALNVSVTYRRVVTNVGKPQSAYAVKLEQPNGVSVTVEPRKLKFEKVGQKLS  732

Query  236  YTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
            Y VTF+S  G      ++FGS+ W + + QVRSP+A +W
Sbjct  733  YKVTFLSIGGARVAGTSSFGSLIWVSGRYQVRSPMAVTW  771



>ref|XP_003520616.1| PREDICTED: subtilisin-like protease SDD1-like [Glycine max]
Length=768

 Score =   139 bits (349),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 78/165 (47%), Positives = 105/165 (64%), Gaps = 10/165 (6%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITC--AKKLSNPAQLN  414
            GHV+P +AL+PGLVYDI P DY   LCSL YT  +I +I    N++C    K++    LN
Sbjct  602  GHVNPQRALNPGLVYDIRPDDYITHLCSLGYTKSEIFSITHR-NVSCNAIMKMNRGFSLN  660

Query  413  YPSFSVLF-GKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLR  237
            YPSFSV+F G  R    +R LTNVG+A ++Y + ++AP  V V VKP +LVFK V   L 
Sbjct  661  YPSFSVIFKGGVRRKMFSRRLTNVGSANSIYSMEVKAPEGVKVIVKPKRLVFKQVNQSLS  720

Query  236  YTVTFVSKKGVVTPS---NAAFGSVSWNNAQN---QVRSPIAFSW  120
            Y V F+S+K V       N A GS++W ++QN   +VRSP+A +W
Sbjct  721  YRVWFISRKRVKRGDDLVNYAEGSLTWVHSQNGSYRVRSPVAVTW  765



>gb|KHN27220.1| Subtilisin-like protease [Glycine soja]
Length=741

 Score =   138 bits (348),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 71/159 (45%), Positives = 98/159 (62%), Gaps = 3/159 (2%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHV+P  A  PGLVYDI+  DY  +LCS++YT+ QI  + +   +   K +     LNYP
Sbjct  582  GHVNPVSASDPGLVYDISTKDYLNYLCSINYTSSQIALLSRGKFVCSKKAVLQAGDLNYP  641

Query  407  SFSVLFGKSRI---VRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLR  237
            SF+VL GKS +   V   R +TNVG   + Y V +E P  V+VTV+P KL F+ VG +L 
Sbjct  642  SFAVLLGKSALNVSVTYRRVVTNVGKPQSAYAVKLEQPNGVSVTVEPRKLNFEKVGQKLS  701

Query  236  YTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
            Y VTF+S  G      ++FGS+ W + + QVRSP+A +W
Sbjct  702  YKVTFLSIGGARVAGTSSFGSLIWVSGRYQVRSPMAVTW  740



>gb|ACN28035.1| unknown [Zea mays]
Length=380

 Score =   135 bits (340),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 75/168 (45%), Positives = 99/168 (59%), Gaps = 14/168 (8%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAK-KLSNPAQLNY  411
            GHVDP +AL PGLVYD+   DY  FLC+L Y++  I A+ ++    CA+ K  +   LNY
Sbjct  216  GHVDPARALDPGLVYDLGTRDYVDFLCALKYSSTMIAAVARSREYACAENKTYSVGALNY  275

Query  410  PSFSVLF--------GKSRIVRQTRELTNVGAAGTL-YEVAIEAPPSVTVTVKPTKLVFK  258
            PSFSV +        G S  V  TR LTNVG AGT     ++ A   V V V+P +L F 
Sbjct  276  PSFSVAYSTANGDGGGDSATVTHTRTLTNVGGAGTYKASTSLAAAKGVAVDVEPAELEFT  335

Query  257  NVGDRLRYTVTFVSKKGVVTPSN-AAFGSVSWNNAQNQVRSPIAFSWT  117
            +VG++  YTV F SK     PS  A FG + W++ ++ V SPIAF+WT
Sbjct  336  SVGEKKSYTVRFTSKS---QPSGTAGFGRLVWSDGKHSVASPIAFTWT  380



>gb|KHN04108.1| Subtilisin-like protease [Glycine soja]
Length=738

 Score =   138 bits (348),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 100/160 (63%), Gaps = 5/160 (3%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLS-NPAQLNY  411
            GHV+P +A  PGLVYDI   DY  +LCSL YT+ QI AI+   N  CAKK + +   LNY
Sbjct  579  GHVNPERASDPGLVYDITTKDYLNYLCSLKYTSSQI-AILSKGNFKCAKKSALHAGGLNY  637

Query  410  PSFSVLFG---KSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRL  240
            PSF+VLF    ++  V   R +TNVG   + Y V +E P  V+V V+P  + F+ +GD+L
Sbjct  638  PSFAVLFDTSTRNASVTYKRVVTNVGNPSSSYAVKVEEPKGVSVIVEPRNISFRKIGDKL  697

Query  239  RYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
             Y V+FVS        +++FGS++W + +  VRSPIA +W
Sbjct  698  SYKVSFVSYGRTAVAGSSSFGSLTWVSGKYHVRSPIAVTW  737



>ref|XP_007051971.1| Subtilase family protein [Theobroma cacao]
 gb|EOX96128.1| Subtilase family protein [Theobroma cacao]
Length=768

 Score =   138 bits (347),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 74/159 (47%), Positives = 95/159 (60%), Gaps = 5/159 (3%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKK-LSNPAQLNY  411
            GHVDP +A  PGL+YDI+P DY  +LCSL Y   QI   V   N TC K  +  P  LNY
Sbjct  611  GHVDPERASDPGLIYDISPKDYIYYLCSLKYNASQISLFVD--NFTCPKHAIMQPGDLNY  668

Query  410  PSFSVLFGKSRI--VRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLR  237
            PSF+V F  S    V   R +TNVG   + Y+V +E P  V+V VKP  L FK +G +L 
Sbjct  669  PSFAVNFKSSAAENVTYKRTVTNVGTPKSTYKVLVEEPKGVSVIVKPEILTFKMLGKKLS  728

Query  236  YTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
            Y VTF+  K     + ++FGS+ W + + +VRSPIA SW
Sbjct  729  YKVTFIGLKRTKPVAASSFGSLVWVSGKYRVRSPIAASW  767



>ref|XP_008454762.1| PREDICTED: subtilisin-like protease [Cucumis melo]
Length=764

 Score =   137 bits (345),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 75/161 (47%), Positives = 95/161 (59%), Gaps = 6/161 (4%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLS--NPAQLN  414
            GHVDP KA  PGL+YDI P DY  +LCSL Y + QI A+V   N+TC+ K +   P  LN
Sbjct  604  GHVDPEKASDPGLIYDITPQDYINYLCSLKYNSSQI-ALVSRGNLTCSSKRTVVKPGDLN  662

Query  413  YPSFSVLF---GKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDR  243
            YPSFSV      K   +   R +TNVG   + Y V I  P  VTV VKP KL F ++G++
Sbjct  663  YPSFSVFMKKKAKKVSITLKRTVTNVGITRSDYTVKINNPKGVTVIVKPEKLSFGSLGEQ  722

Query  242  LRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
            L Y V+FVS  G       +FGS+ W + +  VRSPI  +W
Sbjct  723  LSYKVSFVSLGGKEALDKFSFGSLVWISGKYAVRSPIVVTW  763



>gb|EYU21314.1| hypothetical protein MIMGU_mgv1a001662mg [Erythranthe guttata]
Length=777

 Score =   137 bits (345),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 74/167 (44%), Positives = 104/167 (62%), Gaps = 11/167 (7%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVK-APNITCAK-KLSNPAQLN  414
            GHVDP++A+ PGLVYD+  TDY  FLC++ Y +++I    K A ++ C K     P  LN
Sbjct  603  GHVDPNRAVDPGLVYDLDTTDYIAFLCTIGYDSRRISVFTKDASSVDCDKLGFKTPGNLN  662

Query  413  YPSFSVLF-GKSRIVRQTRELTNVGA-AGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRL  240
            YPSFSV+F G+  +V+  R +TNVG+    +YEV + APP V V+V P+KLVF    D+L
Sbjct  663  YPSFSVVFYGEESVVKYNRTVTNVGSEVDAVYEVRVGAPPGVEVSVSPSKLVFSETEDKL  722

Query  239  RYTVTFVSKKG------VVTPSNAAFGSVSWNNAQNQ-VRSPIAFSW  120
             Y VTF S         +V  + ++FGS+ W++  +  VRSPIA  W
Sbjct  723  SYEVTFKSSSSASSGLEIVGSAKSSFGSIEWSDGGSHLVRSPIAAVW  769



>gb|EYU28960.1| hypothetical protein MIMGU_mgv1a018215mg, partial [Erythranthe 
guttata]
Length=715

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 78/155 (50%), Positives = 102/155 (66%), Gaps = 6/155 (4%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNP-AQLNY  411
            GHV+P +A +PGLVYDI P DY  +LC L+YT Q+I  IV    + C+++ S P AQLNY
Sbjct  560  GHVNPSRANNPGLVYDIMPDDYIPYLCGLNYTNQEIGIIV-GRKVDCSEEKSIPEAQLNY  618

Query  410  PSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYT  231
            PSFS++FG S     TR LTNVG A + Y V I +P  V V V+P KLVF  +GD+  Y+
Sbjct  619  PSFSIIFG-STPQTYTRTLTNVGKANSSYVVEIASPDGVIVKVEPQKLVFPKLGDKSSYS  677

Query  230  VTFV-SKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  129
            VTF  + KGV+  +N   G + W+ A+  VRSPIA
Sbjct  678  VTFTRTNKGVM--NNTTQGFIRWHTAEYSVRSPIA  710



>ref|XP_004140440.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
 ref|XP_004167887.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
Length=766

 Score =   137 bits (345),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 75/161 (47%), Positives = 95/161 (59%), Gaps = 6/161 (4%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLS--NPAQLN  414
            GHVDP KA  PGL+YDI P DY  +LCSL Y + QI A+V   N TC+ K +   P  LN
Sbjct  606  GHVDPEKASDPGLIYDITPQDYINYLCSLKYNSTQI-ALVSRGNFTCSSKRTVVKPGDLN  664

Query  413  YPSFSVLF---GKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDR  243
            YPSFSV      K   +   R +TNVG + + Y V I  P  +TV VKP KL F ++G++
Sbjct  665  YPSFSVFMKKKAKKVSITLKRTVTNVGISRSDYTVKINNPKGITVIVKPEKLSFGSLGEQ  724

Query  242  LRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
            L Y V FVS  G       +FGS+ W + +  VRSPIA +W
Sbjct  725  LSYQVRFVSLGGKEALDTFSFGSLVWISGKYAVRSPIAVTW  765



>ref|XP_004305758.1| PREDICTED: subtilisin-like protease [Fragaria vesca subsp. vesca]
Length=773

 Score =   137 bits (345),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/163 (43%), Positives = 105/163 (64%), Gaps = 7/163 (4%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVK--APNITCAKK-LSNPAQL  417
            GHVDP++AL+PGLVYDI   DY  F+CS+ Y  +QI   ++  A +  CA+  L++P  L
Sbjct  606  GHVDPNRALNPGLVYDIDVNDYVAFMCSIGYGPRQIAVFMRELAGDDICARNSLASPGDL  665

Query  416  NYPSFSVLFGKSR-IVRQTRELTNVGA-AGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDR  243
            NYPSF+V+F   R +V+  R +TNVG+    +YEV ++AP  V ++V+P+KLVF  V   
Sbjct  666  NYPSFAVVFKPGRELVKYKRVVTNVGSVVDAVYEVNVDAPAGVEISVEPSKLVFSEVNQT  725

Query  242  LRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQ  114
              Y VTF   KG+   +   +GS+ W++ ++ VRSP+A  W+ 
Sbjct  726  QSYEVTFA--KGIGYVNGERYGSIEWSDGRHHVRSPVAVRWSN  766



>gb|EYU28963.1| hypothetical protein MIMGU_mgv1a023216mg [Erythranthe guttata]
Length=341

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 76/155 (49%), Positives = 100/155 (65%), Gaps = 6/155 (4%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNP-AQLNY  411
            GHV+P  A  P LVYDI P DY  +LC L+YT Q++  IV +  + C+K+ S P AQLNY
Sbjct  186  GHVNPSLANDPRLVYDIMPDDYIPYLCGLNYTNQEVGIIVGS-KVDCSKEKSIPEAQLNY  244

Query  410  PSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYT  231
            PSFS++FG S     TR L NVG A + Y+V I +P  V V V+P KLVF  +GD+  Y+
Sbjct  245  PSFSIIFG-STPQTYTRTLANVGKANSSYDVEIVSPDGVNVKVEPKKLVFPKLGDKSSYS  303

Query  230  VTFV-SKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  129
            VTF  + KGV+  S   F  + W++A+  VRSPIA
Sbjct  304  VTFTRTTKGVMNSSTQGF--IRWHSAKYSVRSPIA  336



>ref|XP_004308418.2| PREDICTED: subtilisin-like protease [Fragaria vesca subsp. vesca]
Length=773

 Score =   137 bits (345),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 75/163 (46%), Positives = 100/163 (61%), Gaps = 10/163 (6%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKA-PNITCAKKLS--NPAQL  417
            GH DP  A  PGL+YDI   DY ++LCSL+YT+ QI        N TC    +   P  L
Sbjct  613  GHADPESAADPGLIYDITTNDYLLYLCSLNYTSPQIALFSSGISNFTCPSNSTVLQPGNL  672

Query  416  NYPSFSVLF---GKSRIVRQTRELTNVGAAG-TLYEVAIEAPPSVTVTVKPTKLVFKNVG  249
            NYPS SV+F   G+      TR +TNVGA   + Y V +EAP  V+VTV+P KLVFK +G
Sbjct  673  NYPSLSVVFRRDGRKMSATYTRTVTNVGAINPSTYAVQVEAPIGVSVTVEPRKLVFKKMG  732

Query  248  DRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
            ++L Y V+FV   G+   +N++FGS+ W + + +VRSPIA  W
Sbjct  733  EKLSYKVSFV---GMSATTNSSFGSLVWVSEKYRVRSPIAVIW  772



>ref|XP_011035007.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=769

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 74/160 (46%), Positives = 97/160 (61%), Gaps = 5/160 (3%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITC-AKKLSNPAQLNY  411
            GHVDP +A  PGL+YDI   DY  + CSLDYT+ QI A V   N+TC   K   P  LNY
Sbjct  610  GHVDPERASDPGLIYDITIEDYLNYFCSLDYTSSQI-AQVSRRNVTCPDNKALQPGDLNY  668

Query  410  PSFSVLF-GKSR--IVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRL  240
            PSF+V F G +R   V+  R LTNVG   + Y V +E P  V+V ++P  L F+ +G +L
Sbjct  669  PSFAVNFEGNARNNRVKYKRTLTNVGTPSSTYAVKVEEPNGVSVILEPKSLSFEKLGQKL  728

Query  239  RYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
             Y VTFVS  G     +++ GS+ W + +  VRSPIA +W
Sbjct  729  SYNVTFVSSGGKGREGSSSIGSLVWLSGKYSVRSPIAVTW  768



>ref|XP_010686124.1| PREDICTED: subtilisin-like protease [Beta vulgaris subsp. vulgaris]
Length=771

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 104/160 (65%), Gaps = 8/160 (5%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPN-ITCA-KKLSNPAQLN  414
            GH+DP+KA+ PGLVYD+  +DY  FLC+  YT   I+ I KAP  I CA +KLS+P  LN
Sbjct  605  GHIDPNKAVDPGLVYDLQVSDYIAFLCTAGYTKNMIRVIFKAPAVIDCASQKLSSPGNLN  664

Query  413  YPSFSVLF-GKSRIVRQTRELTNVGAA-GTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRL  240
            YPSFSV+F G +  V+ TR + NVG++   +Y+V ++AP +V ++V P+ L F +    L
Sbjct  665  YPSFSVVFRGATNKVKYTRVVKNVGSSKNAVYKVNVKAPLNVQISVAPSTLTFTSTVQTL  724

Query  239  RYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
             Y +TF S     +   ++FGS+ W++  + VRSPIA  W
Sbjct  725  SYDITFTS----TSRGASSFGSIEWSDGNHHVRSPIAIQW  760



>ref|XP_002320086.2| subtilase family protein [Populus trichocarpa]
 gb|EEE98401.2| subtilase family protein [Populus trichocarpa]
Length=769

 Score =   137 bits (344),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 74/160 (46%), Positives = 98/160 (61%), Gaps = 5/160 (3%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITC-AKKLSNPAQLNY  411
            GHVDP  A  PGL+YDI   DY  + CSL+YT+ QI A V   N+TC   K   P  LNY
Sbjct  610  GHVDPESASDPGLIYDITIEDYLNYFCSLNYTSSQI-AQVSRRNVTCPDNKALQPGDLNY  668

Query  410  PSFSVLF-GKSR--IVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRL  240
            PSF+V F G +R   V+  R LTNVG   + Y V +E P  V+V ++P  L F+ +G +L
Sbjct  669  PSFAVNFEGNARNNRVKYKRTLTNVGTPWSTYAVKVEEPNGVSVILEPKSLSFEKLGQKL  728

Query  239  RYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
             Y VTFVS +G     +++FGS+ W + +  VRSPIA +W
Sbjct  729  SYNVTFVSSRGKGREGSSSFGSLVWLSGKYSVRSPIAVTW  768



>ref|XP_004140477.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
Length=739

 Score =   136 bits (342),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 73/160 (46%), Positives = 95/160 (59%), Gaps = 5/160 (3%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKK--LSNPAQLN  414
            GHVDP KA  PGL+YDIAP DY  +LCSL YT+ QI ++V     TC+ K   S P  LN
Sbjct  580  GHVDPEKASHPGLIYDIAPQDYITYLCSLKYTSTQI-SLVSRGKFTCSSKNTFSQPGDLN  638

Query  413  YPSFSVLFGKSRIVRQT--RELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRL  240
            YPSFSV   K + V  T  R +TNVG   + Y V I  P  + + VKP KL F  +G++L
Sbjct  639  YPSFSVFMKKGKNVNSTFKRTVTNVGIPRSDYTVRINNPKGIRIIVKPEKLNFVKLGEKL  698

Query  239  RYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
             Y V+F +     +    +FGS+ W++    VRSPIA +W
Sbjct  699  SYKVSFYALGKRESLDEFSFGSLVWHSGTYAVRSPIAVTW  738



>ref|XP_004171629.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease-like 
[Cucumis sativus]
Length=769

 Score =   136 bits (342),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 73/160 (46%), Positives = 95/160 (59%), Gaps = 5/160 (3%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKK--LSNPAQLN  414
            GHVDP KA  PGL+YDIAP DY  +LCSL YT+ QI ++V     TC+ K   S P  LN
Sbjct  610  GHVDPEKASHPGLIYDIAPQDYITYLCSLKYTSTQI-SLVSRGKFTCSSKNTFSQPGDLN  668

Query  413  YPSFSVLFGKSRIVRQT--RELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRL  240
            YPSFSV   K + V  T  R +TNVG   + Y V I  P  + + VKP KL F  +G++L
Sbjct  669  YPSFSVFMKKGKNVNSTFKRTVTNVGIPRSDYTVRINNPKGIRIIVKPEKLNFVKLGEKL  728

Query  239  RYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
             Y V+F +     +    +FGS+ W++    VRSPIA +W
Sbjct  729  SYKVSFYALGKRESLDEFSFGSLVWHSGTYAVRSPIAVTW  768



>gb|EYU29555.1| hypothetical protein MIMGU_mgv1a022042mg [Erythranthe guttata]
Length=720

 Score =   135 bits (341),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 77/155 (50%), Positives = 98/155 (63%), Gaps = 6/155 (4%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNP-AQLNY  411
            GHV+P +A  PGLVYDI P DY  ++C L+YT QQ+  IV   N+ C+K+ S P AQLNY
Sbjct  565  GHVNPSRADDPGLVYDILPDDYIPYVCGLNYTNQQVGIIV-GRNVDCSKEKSIPEAQLNY  623

Query  410  PSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYT  231
            PSFS++FG S     TR LTNVG A + Y+V I +P  VTV V+P KLVF  +GD+  Y 
Sbjct  624  PSFSIIFGSSPQT-YTRTLTNVGKANSSYDVEIVSPNGVTVKVEPKKLVFPKLGDKSSYN  682

Query  230  VTFV-SKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  129
            VTF  + KG +      F  + W  A   VRSPI+
Sbjct  683  VTFTRTTKGAMNSITQGF--IRWYTADYSVRSPIS  715



>ref|XP_006841679.1| hypothetical protein AMTR_s00003p00245290 [Amborella trichopoda]
 gb|ERN03354.1| hypothetical protein AMTR_s00003p00245290 [Amborella trichopoda]
Length=765

 Score =   136 bits (342),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 68/158 (43%), Positives = 97/158 (61%), Gaps = 3/158 (2%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITC-AKKLSNPAQLNY  411
            GHVDP++AL PGLVYDI P DY  +LC+L Y + +I       ++ C     +    LNY
Sbjct  601  GHVDPNRALDPGLVYDIKPEDYVAYLCALGYDSVRIAVFTGGKSVDCRVVGFAKSGDLNY  660

Query  410  PSFSVLFGKSRIVRQ-TRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRY  234
            PSFS++FG  + V + +R +TNVG A + Y  +I  P SV + V P KLVF      L Y
Sbjct  661  PSFSMVFGPGKTVAKFSRTVTNVGDARSAYAASINGPDSVRIRVDPEKLVFCAQNQSLSY  720

Query  233  TVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
            +VTF   +G  +P +  FG ++W++ ++ V+SPIAFSW
Sbjct  721  SVTFEYVEG-YSPLDTCFGLLTWSDGRHDVKSPIAFSW  757



>gb|EYU31528.1| hypothetical protein MIMGU_mgv1a0212142mg, partial [Erythranthe 
guttata]
Length=435

 Score =   133 bits (335),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 74/155 (48%), Positives = 98/155 (63%), Gaps = 6/155 (4%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNP-AQLNY  411
            GHV+P +A  PGLVYDI P DY  +LC L+Y  Q++  +V    + C+K+ S P AQLNY
Sbjct  280  GHVNPSRANDPGLVYDILPDDYLQYLCGLNYPNQEVSILV-GRKVDCSKEKSIPEAQLNY  338

Query  410  PSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYT  231
            PSFS++FG S     TR LTNVG A + Y+V I +P  V V V+P KLVF  +GD+  Y+
Sbjct  339  PSFSIVFG-STPQTYTRTLTNVGKANSSYDVEIVSPDGVNVKVEPKKLVFPKLGDKSSYS  397

Query  230  VTFV-SKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  129
            VTF  + KG +  +   F  + W +A   VRSPIA
Sbjct  398  VTFTRTTKGAINSTTQGF--IRWYSADYSVRSPIA  430



>ref|XP_009611962.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
 ref|XP_009611971.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=767

 Score =   135 bits (341),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 74/160 (46%), Positives = 104/160 (65%), Gaps = 6/160 (4%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITC-AKKLSNPAQLNY  411
            GHVDP KA +PGL+YDI+  DY  ++CSL+Y + QI  +++  N TC +  + +P  LNY
Sbjct  609  GHVDPEKASNPGLIYDISTEDYLHYICSLNYNSSQIALLLRK-NYTCPSHAIQSPGDLNY  667

Query  410  PSFSVLF-GKSRIVRQT--RELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRL  240
            PSF+VLF  KSR + QT  R  TNVG   + Y V + AP  V+VTVKP  L F+  G +L
Sbjct  668  PSFAVLFDSKSRNLIQTFKRSATNVGNPMSTYVVQVNAPSGVSVTVKPKILKFEKKGQKL  727

Query  239  RYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
            RY + FV+ +G  +  ++ FGS+ W +  + VRSPIA +W
Sbjct  728  RYKMRFVA-RGKRSAGDSTFGSLVWFSKIHIVRSPIAITW  766



>emb|CAN81091.1| hypothetical protein VITISV_040911 [Vitis vinifera]
Length=430

 Score =   133 bits (334),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 71/161 (44%), Positives = 100/161 (62%), Gaps = 5/161 (3%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSN--PAQLN  414
            GHV+P KA +PGL+YDI   DY  +LCS++YT+ QI  + +  + TC     +  P  LN
Sbjct  269  GHVNPEKASNPGLIYDITTEDYLNYLCSVNYTSSQIARVSRRISFTCPNDTVHLQPGDLN  328

Query  413  YPSFSVLF-GKSRIVRQT--RELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDR  243
            YPSF+VLF G ++  R T  R +TNVG   T Y   ++ P  V+V VKP  L FK +  +
Sbjct  329  YPSFAVLFNGNAQKNRATYKRSVTNVGYPTTTYVAQVQEPEGVSVMVKPNVLKFKELNQK  388

Query  242  LRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
            L Y V+FV+ +   T SN +FGS+ W + + +VRSPIA +W
Sbjct  389  LSYKVSFVASRKTSTSSNWSFGSLVWVSRKYRVRSPIAVTW  429



>gb|EAY90937.1| hypothetical protein OsI_12551 [Oryza sativa Indica Group]
Length=470

 Score =   133 bits (335),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 73/171 (43%), Positives = 102/171 (60%), Gaps = 18/171 (11%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAK-KLSNPAQLNY  411
            GHVDP  A+ PGLVYD+   DY  FLC+L+YT+  I A+ ++ +  C + K  +   LNY
Sbjct  304  GHVDPASAVDPGLVYDLGTADYVDFLCALNYTSTMIAAVARSKSYGCTEGKAYSVYNLNY  363

Query  410  PSFSVLF------------GKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKL  267
            PSF+V +              +  V   R LTNVGAAGT Y+V+  A P V V V+PT+L
Sbjct  364  PSFAVAYSTASSQAAEGSGAAATTVTHKRTLTNVGAAGT-YKVSAAAMPGVAVAVEPTEL  422

Query  266  VFKNVGDRLRYTVTFVSKKGVVTPSN-AAFGSVSWNNAQNQVRSPIAFSWT  117
             F + G++  YTV+F +K     PS  A FG + W++ ++ V SPIAF+WT
Sbjct  423  AFTSAGEKKSYTVSFTAKS---QPSGTAGFGRLVWSDGKHSVASPIAFTWT  470



>ref|XP_008454764.1| PREDICTED: subtilisin-like protease [Cucumis melo]
 ref|XP_008454765.1| PREDICTED: subtilisin-like protease [Cucumis melo]
Length=768

 Score =   135 bits (340),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 74/160 (46%), Positives = 96/160 (60%), Gaps = 5/160 (3%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLS--NPAQLN  414
            GHVDP KA  PGLVYDIAP DY  +LCSL Y + QI A+V     TC+ K +   P  LN
Sbjct  609  GHVDPEKASDPGLVYDIAPQDYITYLCSLKYNSTQI-ALVSRGKFTCSSKRTFFQPGDLN  667

Query  413  YPSFSVLFGKSRIVRQT--RELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRL  240
            YPSFSV   K + V  T  R +TNVG   + Y V I  P  + + VKP KL F  +G++L
Sbjct  668  YPSFSVFMKKGKNVNSTFKRTVTNVGIPRSDYTVRIYNPKGIRIIVKPEKLSFVKLGEKL  727

Query  239  RYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
             Y V+FV+     +  + +FGS+ W++    VRSPIA +W
Sbjct  728  SYKVSFVALGKRKSLDDFSFGSLVWHSGTYVVRSPIAVTW  767



>ref|XP_007220042.1| hypothetical protein PRUPE_ppa027143mg [Prunus persica]
 gb|EMJ21241.1| hypothetical protein PRUPE_ppa027143mg [Prunus persica]
Length=765

 Score =   135 bits (340),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 97/160 (61%), Gaps = 5/160 (3%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKK-LSNPAQLNY  411
            GHVDP  A  PGLVYDI   DY  +LCSL Y + QI       N TC K  +  P  LNY
Sbjct  606  GHVDPENAADPGLVYDITAEDYLFYLCSLSYNSSQIALFSSGVNFTCPKNAVLQPGDLNY  665

Query  410  PSFSVLFGK---SRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRL  240
            PSFSVLF K   +  V   R + NVG   + Y V ++ P  V+VTV+P  L FK +G++L
Sbjct  666  PSFSVLFSKDARNMSVTYKRTVKNVGKIPSTYAVQVKEPTGVSVTVEPRSLRFKKMGEKL  725

Query  239  RYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
             Y V+FV+  G  T +N++FG+++W + + +V SPIA +W
Sbjct  726  SYKVSFVALGG-PTLTNSSFGTLTWVSGKYRVGSPIAVTW  764



>ref|XP_008228179.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=810

 Score =   135 bits (341),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 72/162 (44%), Positives = 99/162 (61%), Gaps = 7/162 (4%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP---NITCAKKLSNPAQL  417
            GHVDP++AL+PGLVYD+   DY  FLCS+ Y+ +QI   V  P   +I     L++P  L
Sbjct  643  GHVDPNRALNPGLVYDLNVNDYVAFLCSIGYSPRQIAVFVGKPTGSDICTRNSLASPGDL  702

Query  416  NYPSFSVLFGKSR-IVRQTRELTNVGA-AGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDR  243
            NYPSFSV+    + +V+  R  TNVGA A  +YEV + AP  V ++V+P KLVF      
Sbjct  703  NYPSFSVVLSSDQGLVKYKRIATNVGADADAVYEVTVNAPAGVEISVEPRKLVFSAENQT  762

Query  242  LRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWT  117
              Y VTF  K+GV   S   +GS+ W + ++ VRSP+A  W+
Sbjct  763  QSYEVTF--KRGVGYDSGERYGSIEWTDGRHLVRSPVAVRWS  802



>gb|ACN27710.1| unknown [Zea mays]
Length=701

 Score =   135 bits (339),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 75/168 (45%), Positives = 99/168 (59%), Gaps = 14/168 (8%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAK-KLSNPAQLNY  411
            GHVDP +AL PGLVYD+   DY  FLC+L Y++  I A+ ++    CA+ K  +   LNY
Sbjct  537  GHVDPARALDPGLVYDLGTRDYVDFLCALKYSSTMIAAVARSREYACAENKTYSVGALNY  596

Query  410  PSFSVLF--------GKSRIVRQTRELTNVGAAGTL-YEVAIEAPPSVTVTVKPTKLVFK  258
            PSFSV +        G S  V  TR LTNVG AGT     ++ A   V V V+P +L F 
Sbjct  597  PSFSVAYSTANGDGGGDSATVTHTRTLTNVGGAGTYKASTSLAAAKGVAVDVEPAELEFT  656

Query  257  NVGDRLRYTVTFVSKKGVVTPSN-AAFGSVSWNNAQNQVRSPIAFSWT  117
            +VG++  YTV F SK     PS  A FG + W++ ++ V SPIAF+WT
Sbjct  657  SVGEKKSYTVRFTSKS---QPSGTAGFGRLVWSDGKHSVASPIAFTWT  701



>tpg|DAA50265.1| TPA: putative subtilase family protein [Zea mays]
Length=764

 Score =   135 bits (339),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 75/168 (45%), Positives = 99/168 (59%), Gaps = 14/168 (8%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAK-KLSNPAQLNY  411
            GHVDP +AL PGLVYD+   DY  FLC+L Y++  I A+ ++    CA+ K  +   LNY
Sbjct  600  GHVDPARALDPGLVYDLGTRDYVDFLCALKYSSTMIAAVARSREYACAENKTYSVGALNY  659

Query  410  PSFSVLF--------GKSRIVRQTRELTNVGAAGTL-YEVAIEAPPSVTVTVKPTKLVFK  258
            PSFSV +        G S  V  TR LTNVG AGT     ++ A   V V V+P +L F 
Sbjct  660  PSFSVAYSTANGDGGGDSATVTHTRTLTNVGGAGTYKASTSLAAAKGVAVDVEPAELEFT  719

Query  257  NVGDRLRYTVTFVSKKGVVTPSN-AAFGSVSWNNAQNQVRSPIAFSWT  117
            +VG++  YTV F SK     PS  A FG + W++ ++ V SPIAF+WT
Sbjct  720  SVGEKKSYTVRFTSKS---QPSGTAGFGRLVWSDGKHSVASPIAFTWT  764



>ref|XP_007024651.1| Subtilase family protein [Theobroma cacao]
 gb|EOY27273.1| Subtilase family protein [Theobroma cacao]
Length=767

 Score =   135 bits (339),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 71/163 (44%), Positives = 95/163 (58%), Gaps = 5/163 (3%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPN--ITCAKKLSNPAQLN  414
            GHVDP+ AL PGLVYDI   DY  FLCS+ Y +++I   V+ P     C  KL+ P  LN
Sbjct  599  GHVDPNIALMPGLVYDIDDGDYVAFLCSIGYDSKRIAIFVREPTGPDVCEGKLATPGNLN  658

Query  413  YPSFSVLF-GKSRIVRQTRELTNVG-AAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRL  240
            YPSFSV+F     +V+  R + NVG +   +YE  + APP V ++V P+KL F      L
Sbjct  659  YPSFSVVFDSNDHVVKYKRTVKNVGPSVDAVYEAKVNAPPGVEISVSPSKLEFSAENQTL  718

Query  239  RYTVTFVSKK-GVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQ  114
             Y +TF S    +   +  AFGS+ W++  + VRSPIA  W Q
Sbjct  719  SYEITFASDGLALFAVALEAFGSIEWSDGVHLVRSPIAVRWLQ  761



>gb|KHN13887.1| Subtilisin-like protease [Glycine soja]
Length=687

 Score =   134 bits (338),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 99/160 (62%), Gaps = 5/160 (3%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKK-LSNPAQLNY  411
            GHV+P  A  PGLVYDI   DY  +LCSL+YT+ QI A++      C+KK +     LNY
Sbjct  528  GHVNPVSAFDPGLVYDIGTEDYLNYLCSLNYTSSQI-ALLSRGKFACSKKAVLQAGDLNY  586

Query  410  PSFSVLFGKSRI---VRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRL  240
            PSF+VLF +S +   V  TR +TNVG   + Y V ++ P  V+VTV+P  L F+ VG +L
Sbjct  587  PSFAVLFDRSALNANVTYTRVVTNVGKPQSAYAVKVKQPDGVSVTVEPRVLKFEKVGQKL  646

Query  239  RYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
             Y VTF++         ++FGS+ W + + QVRSPIA +W
Sbjct  647  SYKVTFLAVGKARVAGTSSFGSLIWVSGRYQVRSPIALTW  686



>ref|NP_001151549.1| subtilisin-like protease precursor [Zea mays]
 gb|ACG43281.1| subtilisin-like protease precursor [Zea mays]
Length=764

 Score =   135 bits (339),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 75/168 (45%), Positives = 99/168 (59%), Gaps = 14/168 (8%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAK-KLSNPAQLNY  411
            GHVDP +AL PGLVYD+   DY  FLC+L Y++  I A+ ++    CA+ K  +   LNY
Sbjct  600  GHVDPARALDPGLVYDLGTRDYVDFLCALKYSSTMIAAVARSREYACAENKTYSVGALNY  659

Query  410  PSFSVLF--------GKSRIVRQTRELTNVGAAGTL-YEVAIEAPPSVTVTVKPTKLVFK  258
            PSFSV +        G S  V  TR LTNVG AGT     ++ A   V V V+P +L F 
Sbjct  660  PSFSVAYSTANGDGGGDSATVTHTRTLTNVGGAGTYKASTSLAAAKGVAVDVEPAELEFT  719

Query  257  NVGDRLRYTVTFVSKKGVVTPSN-AAFGSVSWNNAQNQVRSPIAFSWT  117
            +VG++  YTV F SK     PS  A FG + W++ ++ V SPIAF+WT
Sbjct  720  SVGEKKSYTVRFTSKS---QPSGTAGFGRLVWSDGKHSVASPIAFTWT  764



>ref|XP_003551824.2| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=767

 Score =   134 bits (338),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 99/160 (62%), Gaps = 5/160 (3%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKK-LSNPAQLNY  411
            GHV+P  A  PGLVYDI   DY  +LCSL+YT+ QI A++      C+KK +     LNY
Sbjct  608  GHVNPVSAFDPGLVYDIGTEDYLNYLCSLNYTSSQI-ALLSRGKFACSKKAVLQAGDLNY  666

Query  410  PSFSVLFGKSRI---VRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRL  240
            PSF+VLF +S +   V  TR +TNVG   + Y V ++ P  V+VTV+P  L F+ VG +L
Sbjct  667  PSFAVLFDRSALNANVTYTRVVTNVGKPQSAYAVKVKQPDGVSVTVEPRVLKFEKVGQKL  726

Query  239  RYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
             Y VTF++         ++FGS+ W + + QVRSPIA +W
Sbjct  727  SYKVTFLAVGKARVAGTSSFGSLIWVSGRYQVRSPIALTW  766



>ref|XP_010033727.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
Length=829

 Score =   135 bits (339),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 72/163 (44%), Positives = 101/163 (62%), Gaps = 8/163 (5%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP--NITCAKKLSNPAQLN  414
            GHVDP++AL+PGLVYDI   DY  FLC++ Y  ++I   ++ P  +  CA +++ P +LN
Sbjct  664  GHVDPNRALNPGLVYDIDVDDYVGFLCAIGYEPRRIAVFLREPMSSTVCANRMATPGELN  723

Query  413  YPSFS-VLFGKSRIVRQTRELTNVG-AAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRL  240
            YPSFS VL     +V+  R + NVG +A  +YEV ++AP +V V+V P+KL F      L
Sbjct  724  YPSFSVVLTSNGDVVKYRRVVKNVGSSADAVYEVKVDAPENVEVSVSPSKLEFSAENQIL  783

Query  239  RYTVTFVS-KKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQ  114
             Y +TF S   G  TP    FGS+ W +  ++VRSPIA  W Q
Sbjct  784  SYEITFSSIALGSSTPK---FGSIEWTDGTHRVRSPIAVKWHQ  823



>ref|XP_008232840.1| PREDICTED: subtilisin-like protease [Prunus mume]
 ref|XP_008232841.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=765

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 71/160 (44%), Positives = 96/160 (60%), Gaps = 5/160 (3%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKK-LSNPAQLNY  411
            GHVDP  A  PGLVYDI   DY  +LCSL Y + QI       N TC K  +  P  LNY
Sbjct  606  GHVDPENAADPGLVYDITAEDYLFYLCSLSYNSSQIALFSSGVNFTCPKNAVLQPGDLNY  665

Query  410  PSFSVLFGK---SRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRL  240
            PSFSVLF K   +  V   R + NVG   + Y V ++ P  V+VTV+P  L FK +G++L
Sbjct  666  PSFSVLFSKDARNMSVTYKRTVKNVGKIPSTYAVQVKEPTGVSVTVEPRSLGFKKMGEKL  725

Query  239  RYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
             Y V+FV+  G    +N++FG+++W + + +V SPIA +W
Sbjct  726  SYKVSFVALGGPAL-TNSSFGTLTWVSGKYRVGSPIAVTW  764



>ref|XP_007162604.1| hypothetical protein PHAVU_001G165300g, partial [Phaseolus vulgaris]
 gb|ESW34598.1| hypothetical protein PHAVU_001G165300g, partial [Phaseolus vulgaris]
Length=1214

 Score =   135 bits (339),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 79/169 (47%), Positives = 109/169 (64%), Gaps = 18/169 (11%)
 Frame = -2

Query  587   GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITC--AKKLSNPAQLN  414
             GHV+P +AL+PGLVYDI P DY + LCSL YT  +I +I    N++C    K++    LN
Sbjct  1048  GHVNPQRALNPGLVYDIRPDDYIIHLCSLGYTRSEIFSITHR-NVSCNAVMKMNRGFSLN  1106

Query  413   YPSFSVLF--GKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRL  240
             YPSFSV+F  G+ R + + R LTNVG+A ++Y V + AP  V V VKP +LVFK V   L
Sbjct  1107  YPSFSVIFKDGERRKMFR-RRLTNVGSANSIYSVEVMAPEGVKVIVKPKRLVFKQVNQSL  1165

Query  239   RYTVTFVSKK------GVVTPSNAAFGSVSWNNAQ---NQVRSPIAFSW  120
              Y V F+S+K      G+VT    A G+++W ++Q   N+VRSP+A +W
Sbjct  1166  TYRVWFISRKRVKRGDGLVT---YAEGNLTWVHSQNGFNRVRSPVAVTW  1211



>ref|XP_009411443.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=765

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 73/160 (46%), Positives = 90/160 (56%), Gaps = 9/160 (6%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAK-KLSNPAQLNY  411
            GHVDP KA  PGL+YDIAP DY  +LCSL YT QQ+ A        C K K+     LNY
Sbjct  610  GHVDPEKASKPGLIYDIAPDDYLNYLCSLKYTPQQL-ATFAGKKYNCPKNKIIRARDLNY  668

Query  410  PSFSVLFGKSR---IVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRL  240
            PSFSVLF   R    +  TR +TNVG A   Y V +  P  V +TVKP  L F  VG ++
Sbjct  669  PSFSVLFDSGRKKATLTHTRTVTNVGQAPCGYTVNVREPQGVRITVKPKVLTFNKVGQKM  728

Query  239  RYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
            RY VTF +  G      +AFG ++W      +RSP+  +W
Sbjct  729  RYMVTFSTVGG----HGSAFGELAWVGDDATIRSPVTVTW  764



>ref|XP_006357406.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=776

 Score =   134 bits (337),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/164 (43%), Positives = 101/164 (62%), Gaps = 8/164 (5%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVK-APNITCAKK-LSNPAQLN  414
            GHVDP++AL PGLVYDI  +DY  FLC++ Y    I   V+ +  + C+++ L+ P  LN
Sbjct  605  GHVDPNRALDPGLVYDIETSDYVNFLCTIGYDGDDIAVFVRDSSRVNCSERSLATPGDLN  664

Query  413  YPSFSVLF--GKSRIVRQTRELTNVGA-AGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDR  243
            YPSFSV F    + +V+  R + NVG  +  +YEV + AP +V V+V P KLVF    + 
Sbjct  665  YPSFSVDFTSDSNGVVKYKRVVKNVGGDSNAVYEVKVNAPSAVEVSVSPAKLVFSEENNS  724

Query  242  LRYTVTFVSKKG---VVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
            L Y ++F SK+    +V    +AFGS+ W++  + VRSPIA  W
Sbjct  725  LSYEISFTSKRSEDIMVKGIQSAFGSIEWSDGIHSVRSPIAVRW  768



>ref|XP_009613479.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=774

 Score =   134 bits (336),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 73/167 (44%), Positives = 101/167 (60%), Gaps = 9/167 (5%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVK-APNITCAKK-LSNPAQLN  414
            GHVDP++AL PGLVYDI  +DY  FLCS+ Y    +   V+ +  + C+++ L+ P  LN
Sbjct  602  GHVDPNRALDPGLVYDIETSDYVNFLCSIGYDGDDVAVFVRDSSRVNCSEQNLATPGDLN  661

Query  413  YPSFSVLF-GKSR-IVRQTRELTNVGA-AGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDR  243
            YPSFSV+F G+S  +V+  R + NVG     +YEV + AP SV V+V P KLVF      
Sbjct  662  YPSFSVVFTGESNGVVKYKRVMKNVGKNTDAVYEVKVNAPSSVEVSVSPAKLVFSEEKKS  721

Query  242  LRYTVTFVSKKG----VVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQ  114
            L Y ++F SK      +V    +AFGS+ W++  + VRSPIA  W  
Sbjct  722  LSYEISFKSKSSGDLEMVKGIESAFGSIEWSDGIHNVRSPIAVRWRH  768



>ref|XP_011072593.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=774

 Score =   134 bits (336),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 74/167 (44%), Positives = 101/167 (60%), Gaps = 9/167 (5%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVK-APNITC-AKKLSNPAQLN  414
            GHVDP++A+ PGLVYD+  TDY  FLC++ Y +++I    K A ++ C A     P  LN
Sbjct  602  GHVDPNRAVDPGLVYDLEITDYVAFLCTIGYDSRRISVFTKQASSVDCDALGFKTPGNLN  661

Query  413  YPSFSVLF-GKSRIVRQTRELTNVG-AAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRL  240
            YPSFSV+F G   +V+  R + NVG  A  +YEV +  P  V V+V P+KLVF    D+L
Sbjct  662  YPSFSVVFSGSESVVKYKRTVKNVGKEANAVYEVKVNTPLGVEVSVSPSKLVFSEKEDKL  721

Query  239  RYTVTFVSKKGVV----TPSNAAFGSVSWNNAQNQ-VRSPIAFSWTQ  114
             Y VTF S    V    T S ++FGS+ W++  +  VRSPIA  W +
Sbjct  722  SYEVTFKSSANAVGFEITGSKSSFGSIEWSDGGSHLVRSPIAVLWRR  768



>gb|ABR17987.1| unknown [Picea sitchensis]
Length=772

 Score =   134 bits (336),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 73/162 (45%), Positives = 97/162 (60%), Gaps = 7/162 (4%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHV+P+ AL PGLVYD+   DY  FLCSL+YT + IQ + K    +C K  S P  LNYP
Sbjct  609  GHVNPNAALDPGLVYDLGIDDYVSFLCSLNYTAKHIQILTKNAT-SCPKLRSRPGDLNYP  667

Query  407  SFSVLFGKSRIVRQTRE-LTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYT  231
            SFSV+F    +VR TR  +TNVG A ++YE+A+E+P +V V V+P  L F    ++  YT
Sbjct  668  SFSVVFKPRSLVRVTRRTVTNVGGAPSVYEMAVESPENVNVIVEPRTLAFTKQNEKATYT  727

Query  230  VTFVSKKGVVTPS--NAAFGSVSWNNAQNQ---VRSPIAFSW  120
            V F SK      S  +  FG + W   +     VRSP+A +W
Sbjct  728  VRFESKIASDNKSKRHRGFGQILWKCVKGGTQVVRSPVAIAW  769



>ref|XP_010261833.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=783

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 74/171 (43%), Positives = 102/171 (60%), Gaps = 18/171 (11%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPN--ITC-AKKLSNPAQL  417
            GHVDP++AL PGLVYDI+  DY  FLCS+ Y  + I   ++  N  + C A+ L +P  L
Sbjct  608  GHVDPNRALDPGLVYDISVNDYVEFLCSIGYDEKMIALFIRDGNTSVNCSAQSLPSPGDL  667

Query  416  NYPSFSVLF---GKSRIVRQTRELTNVG-AAGTLYEVAIEAPPSVTVTVKPTKLVFKNVG  249
            NYPSFSV+F   G   +V+  R +TNVG +   +YE  +  P SV ++V P+KLVF    
Sbjct  668  NYPSFSVVFKLNGGKDVVKYRRVVTNVGDSVDAVYEAKVWGPDSVEISVSPSKLVFSGEE  727

Query  248  DRLRYTVTFVSKKGVVTP--------SNAAFGSVSWNNAQNQVRSPIAFSW  120
            +R  Y +TF   K VV P        S + FG + W++  ++VRSPIAF W
Sbjct  728  ERQSYEITF---KSVVPPNETEERTASASKFGWIEWSDGSHRVRSPIAFWW  775



>gb|KDO64998.1| hypothetical protein CISIN_1g045236mg, partial [Citrus sinensis]
Length=604

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 72/165 (44%), Positives = 103/165 (62%), Gaps = 9/165 (5%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP--NITCAKKLSNPAQLN  414
            GHVDP++AL+PGLVYDI  ++Y  FLCS+ Y  ++I   V+ P  +  C + L+ P  LN
Sbjct  436  GHVDPNRALNPGLVYDIDVSEYVAFLCSIGYDVKRISVFVREPVSSDICTRALATPGNLN  495

Query  413  YPSFSVLFGKSR-IVRQTRELTNVGAA-GTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRL  240
            YPSFSV+F  +  +V+  R + NVG++   +YEV + APP+V V V P+KL F      L
Sbjct  496  YPSFSVVFNSNNDVVKYKRVVKNVGSSVDAVYEVKVNAPPNVAVNVWPSKLAFSAEKKAL  555

Query  239  RYTVTF--VSKKGV-VTPSNAAFGSVSWNNAQNQVRSPIAFSWTQ  114
             Y +TF  V   G+ V+P  +  GS+ W++  + VRSPIA  W Q
Sbjct  556  AYEITFSSVGLDGLGVSPQQS--GSIEWSDGVHLVRSPIAVRWIQ  598



>ref|XP_010685295.1| PREDICTED: subtilisin-like protease [Beta vulgaris subsp. vulgaris]
Length=808

 Score =   133 bits (335),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 75/169 (44%), Positives = 103/169 (61%), Gaps = 11/169 (7%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP-NITC-AKKLSNPAQLN  414
            GHVDP+KAL+PGLVYDI   DY   LC++ Y + +I   +K P  I C AK LS    LN
Sbjct  630  GHVDPNKALNPGLVYDINANDYISLLCAMGYNSTRIAIFLKEPTTIDCAAKNLSTAGNLN  689

Query  413  YPSFSVLFGKSR-IVRQTRELTNVG-AAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRL  240
            YPSFSV+F   + +V+ TR + NVG +A  +YEV++ AP +V V+V P KL F      L
Sbjct  690  YPSFSVVFESGKNVVKYTRVVKNVGSSADAVYEVSVNAPLNVDVSVSPRKLEFSADKQTL  749

Query  239  RYTVTFVSKK-----GVVTP--SNAAFGSVSWNNAQNQVRSPIAFSWTQ  114
             Y ++F S       G V P    ++FGS+ W++  ++VRSPIA  W +
Sbjct  750  SYEISFTSISETYLTGKVKPILGTSSFGSIEWSDGSHRVRSPIAVRWVE  798



>ref|XP_009407416.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=769

 Score =   133 bits (334),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 75/169 (44%), Positives = 100/169 (59%), Gaps = 16/169 (9%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCA-KKLSNPAQLNY  411
            GHVDP KAL PGLVYD+   DY  FLC+L+YTT QI ++ +  N  C  KK    + LNY
Sbjct  605  GHVDPPKALDPGLVYDLTVDDYLDFLCALNYTTLQIASVSRRSNFNCDNKKAYAVSDLNY  664

Query  410  PSFSVLF----------GKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVF  261
            PSF+V F            +  V+ TR LTNVGA GT Y+  + AP    VTV P++L F
Sbjct  665  PSFAVAFATASGAGGGGSAATTVKHTRTLTNVGAPGT-YKATVSAPQEAKVTVDPSELSF  723

Query  260  KNVGDRLRYTVTFVSKKGVVTPSN-AAFGSVSWNNAQNQVRSPIAFSWT  117
               G++  YTV F +      PS  AAFG + W++ ++ V SP++F+WT
Sbjct  724  AAAGEKKSYTVAFSAAS---QPSGTAAFGRLEWSDGKHVVASPLSFTWT  769



>gb|AFB32958.1| hypothetical protein 0_744_01, partial [Pinus mugo]
 gb|AFG70680.1| hypothetical protein 0_744_01, partial [Pinus taeda]
 gb|AFG70681.1| hypothetical protein 0_744_01, partial [Pinus taeda]
 gb|AFG70682.1| hypothetical protein 0_744_01, partial [Pinus taeda]
 gb|AFG70683.1| hypothetical protein 0_744_01, partial [Pinus taeda]
 gb|AFG70684.1| hypothetical protein 0_744_01, partial [Pinus taeda]
 gb|AFG70685.1| hypothetical protein 0_744_01, partial [Pinus taeda]
 gb|AFG70686.1| hypothetical protein 0_744_01, partial [Pinus taeda]
 gb|AFG70687.1| hypothetical protein 0_744_01, partial [Pinus taeda]
 gb|AFG70688.1| hypothetical protein 0_744_01, partial [Pinus taeda]
 gb|AFG70689.1| hypothetical protein 0_744_01, partial [Pinus taeda]
 gb|AFG70690.1| hypothetical protein 0_744_01, partial [Pinus taeda]
Length=152

 Score =   124 bits (312),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 66/142 (46%), Positives = 88/142 (62%), Gaps = 4/142 (3%)
 Frame = -2

Query  581  VDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYPSF  402
            V+P+ AL PGL+YD+   DY  FLCSL+YT +QI  + +    +C K  S P  LNYPSF
Sbjct  1    VNPNAALDPGLIYDLGMDDYVSFLCSLNYTAKQIHILTRNA-TSCPKLSSAPGDLNYPSF  59

Query  401  SVLFGKSRIVRQT-RELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTVT  225
            SV+F    +VR T R +TNVG A  +YE+A+E+P +V +TV+PT L F+   D+  YTV 
Sbjct  60   SVVFKPRSLVRVTKRTVTNVGGAPCVYEMAVESPENVNITVEPTTLAFEKQNDKATYTVK  119

Query  224  FVSKKGVVTPSNA--AFGSVSW  165
            F SK      S    AFG + W
Sbjct  120  FESKIAADNKSKGGQAFGQILW  141



>ref|XP_010919194.1| PREDICTED: subtilisin-like protease isoform X1 [Elaeis guineensis]
Length=774

 Score =   133 bits (334),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 70/161 (43%), Positives = 98/161 (61%), Gaps = 10/161 (6%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCA--KKLSNPAQLN  414
            GHVDP +A +PGLVYDI+P DY  +LCSL+YT+ Q+  + +  N +C   + L N   LN
Sbjct  618  GHVDPERASNPGLVYDISPKDYLDYLCSLNYTSAQLATLARK-NYSCPNNRILGNIRDLN  676

Query  413  YPSFSVLFGKSR---IVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDR  243
            YPSFSVLF +      V QTR +TNVG A   Y V +  P  VT+ V P +L F  +G +
Sbjct  677  YPSFSVLFDRGSPNFTVTQTRIVTNVGQARCRYTVKVHEPKGVTMNVDPKELDFVELGQK  736

Query  242  LRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
            L Y V+F+  +G    ++ +FG + W   +  VRSP+A +W
Sbjct  737  LSYKVSFLGLRG----TDTSFGELVWVCGEYSVRSPVAVTW  773



>ref|XP_007139243.1| hypothetical protein PHAVU_008G013300g [Phaseolus vulgaris]
 ref|XP_007139244.1| hypothetical protein PHAVU_008G013300g [Phaseolus vulgaris]
 gb|ESW11237.1| hypothetical protein PHAVU_008G013300g [Phaseolus vulgaris]
 gb|ESW11238.1| hypothetical protein PHAVU_008G013300g [Phaseolus vulgaris]
Length=770

 Score =   133 bits (334),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 70/160 (44%), Positives = 100/160 (63%), Gaps = 5/160 (3%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKK-LSNPAQLNY  411
            GHV+P  A  PGLVYDI+  DY  + CS++YT+ QI A++      C+KK +     LNY
Sbjct  611  GHVNPVSASDPGLVYDISTKDYLNYFCSINYTSSQI-ALLSRRKFVCSKKAVLQAGDLNY  669

Query  410  PSFSVLFGKSRI---VRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRL  240
            PSF+VLFG+S     V   R +TNVG + + Y V +E P  V+V+V+P KL F+ +G +L
Sbjct  670  PSFAVLFGRSAFNASVTYMRVVTNVGKSKSSYAVKVEQPNGVSVSVEPRKLKFEKLGQKL  729

Query  239  RYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
             Y VTF +  G      ++FGS+ W + + +VRSPIA +W
Sbjct  730  SYNVTFFATGGPKVGGTSSFGSLIWVSDRYKVRSPIAITW  769



>ref|XP_010919195.1| PREDICTED: subtilisin-like protease isoform X2 [Elaeis guineensis]
Length=767

 Score =   133 bits (334),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 70/161 (43%), Positives = 98/161 (61%), Gaps = 10/161 (6%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCA--KKLSNPAQLN  414
            GHVDP +A +PGLVYDI+P DY  +LCSL+YT+ Q+  + +  N +C   + L N   LN
Sbjct  611  GHVDPERASNPGLVYDISPKDYLDYLCSLNYTSAQLATLARK-NYSCPNNRILGNIRDLN  669

Query  413  YPSFSVLFGKSR---IVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDR  243
            YPSFSVLF +      V QTR +TNVG A   Y V +  P  VT+ V P +L F  +G +
Sbjct  670  YPSFSVLFDRGSPNFTVTQTRIVTNVGQARCRYTVKVHEPKGVTMNVDPKELDFVELGQK  729

Query  242  LRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
            L Y V+F+  +G    ++ +FG + W   +  VRSP+A +W
Sbjct  730  LSYKVSFLGLRG----TDTSFGELVWVCGEYSVRSPVAVTW  766



>ref|XP_007051969.1| Subtilase family protein isoform 1 [Theobroma cacao]
 gb|EOX96126.1| Subtilase family protein isoform 1 [Theobroma cacao]
Length=773

 Score =   132 bits (333),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 72/164 (44%), Positives = 93/164 (57%), Gaps = 7/164 (4%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKK-LSNPAQLNY  411
            GH DP +A  PGL+YDI+P DY  +LCSL YT  QI   V   N TC K  +  P  LNY
Sbjct  611  GHADPERASDPGLIYDISPKDYIYYLCSLKYTDSQISGFVY--NFTCPKDAIMQPGDLNY  668

Query  410  PSFSVLFGKSRIVRQT----RELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDR  243
            PSF V F  S     T    R +TNVG   + Y+V +E P  V+V V P  L F  +G++
Sbjct  669  PSFVVNFKSSAAENITLTYHRTVTNVGTPKSTYDVLVEEPEGVSVVVTPKVLTFNMLGEK  728

Query  242  LRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQL  111
            L Y VTF   K     + ++FGS+ W +   +VRSPIA SW ++
Sbjct  729  LSYKVTFTGLKRTKPVAASSFGSLVWVSGNYRVRSPIAASWLKM  772



>ref|XP_009762581.1| PREDICTED: subtilisin-like protease isoform X1 [Nicotiana sylvestris]
 ref|XP_009762582.1| PREDICTED: subtilisin-like protease isoform X2 [Nicotiana sylvestris]
 ref|XP_009762583.1| PREDICTED: subtilisin-like protease isoform X3 [Nicotiana sylvestris]
Length=769

 Score =   132 bits (333),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 73/160 (46%), Positives = 103/160 (64%), Gaps = 6/160 (4%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITC-AKKLSNPAQLNY  411
            GHVDP KA +PGL+YDI+  DY  ++CSL+Y + QI  +++  N TC +  L +P  LNY
Sbjct  611  GHVDPEKASNPGLIYDISTEDYLRYICSLNYNSSQIALLLRK-NYTCPSHVLKSPGDLNY  669

Query  410  PSFSVLF-GKSRIVRQT--RELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRL  240
            PSF+VLF  KSR + QT  R +TNVG   + Y V +  P  V+VTVKP  L F+  G +L
Sbjct  670  PSFAVLFDSKSRNLIQTFKRSVTNVGNPMSTYVVQVNTPSGVSVTVKPKILKFQKKGQKL  729

Query  239  RYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
            RY +  V+ +G  +  ++ FGS+ W +  + VRSPIA +W
Sbjct  730  RYKMRVVA-RGKRSAGDSTFGSLVWFSRTHIVRSPIAITW  768



>ref|XP_009762584.1| PREDICTED: subtilisin-like protease isoform X4 [Nicotiana sylvestris]
 ref|XP_009762585.1| PREDICTED: subtilisin-like protease isoform X4 [Nicotiana sylvestris]
Length=767

 Score =   132 bits (333),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 73/160 (46%), Positives = 103/160 (64%), Gaps = 6/160 (4%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITC-AKKLSNPAQLNY  411
            GHVDP KA +PGL+YDI+  DY  ++CSL+Y + QI  +++  N TC +  L +P  LNY
Sbjct  609  GHVDPEKASNPGLIYDISTEDYLRYICSLNYNSSQIALLLRK-NYTCPSHVLKSPGDLNY  667

Query  410  PSFSVLF-GKSRIVRQT--RELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRL  240
            PSF+VLF  KSR + QT  R +TNVG   + Y V +  P  V+VTVKP  L F+  G +L
Sbjct  668  PSFAVLFDSKSRNLIQTFKRSVTNVGNPMSTYVVQVNTPSGVSVTVKPKILKFQKKGQKL  727

Query  239  RYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
            RY +  V+ +G  +  ++ FGS+ W +  + VRSPIA +W
Sbjct  728  RYKMRVVA-RGKRSAGDSTFGSLVWFSRTHIVRSPIAITW  766



>ref|XP_006490976.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
 gb|KDO85943.1| hypothetical protein CISIN_1g004242mg [Citrus sinensis]
Length=766

 Score =   132 bits (333),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 99/160 (62%), Gaps = 8/160 (5%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLS-NPAQLNY  411
            GHVDP  A  PGL+YDIA  DY  +LCSL+YT+ Q+ A+    N TC    + +P +LNY
Sbjct  610  GHVDPESASDPGLIYDIATEDYLDYLCSLNYTSLQL-ALFAGGNFTCPNPSAFHPGKLNY  668

Query  410  PSFSVLFG---KSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRL  240
            PSF+V F    K+  +   R +TNVG +   Y V +E P  V VT+ P  L F+ +G+ L
Sbjct  669  PSFAVNFKGNVKNMSLEYERSVTNVGTSYCTYAVKVEEPNGVLVTITPPILSFQKIGEIL  728

Query  239  RYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
             Y VTFVS +G    SN +FGS++W + +  V+SPIA +W
Sbjct  729  SYKVTFVSLRGA---SNESFGSLTWVSGKYAVKSPIAVTW  765



>ref|NP_001050634.1| Os03g0605300 [Oryza sativa Japonica Group]
 gb|AAR87229.1| putaive subtilisin-like proteinase [Oryza sativa Japonica Group]
 gb|AAT78773.1| putative serine protease [Oryza sativa Japonica Group]
 gb|ABF97524.1| cucumisin-like serine protease, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF12548.1| Os03g0605300 [Oryza sativa Japonica Group]
 gb|EAZ27735.1| hypothetical protein OsJ_11683 [Oryza sativa Japonica Group]
Length=765

 Score =   132 bits (332),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 72/171 (42%), Positives = 102/171 (60%), Gaps = 18/171 (11%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAK-KLSNPAQLNY  411
            GHVDP  A+ PGLVYD+   DY  FLC+L+YT+  I A+ ++ +  C + K  +   LNY
Sbjct  599  GHVDPASAVDPGLVYDLGTADYVDFLCALNYTSTMIAAVARSKSYGCTEGKAYSVYNLNY  658

Query  410  PSFSVLF------------GKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKL  267
            PSF+V +              +  V   R LTNVGAAGT Y+V+  A P V V V+PT+L
Sbjct  659  PSFAVAYSTASSQAAESSGAAATTVTHRRTLTNVGAAGT-YKVSAAAMPGVAVAVEPTEL  717

Query  266  VFKNVGDRLRYTVTFVSKKGVVTPSN-AAFGSVSWNNAQNQVRSPIAFSWT  117
             F + G++  YTV+F +K     PS  A FG + W++ ++ V SP+AF+WT
Sbjct  718  AFTSAGEKKSYTVSFTAKS---QPSGTAGFGRLVWSDGKHSVASPMAFTWT  765



>gb|AFG70679.1| hypothetical protein 0_744_01, partial [Pinus taeda]
Length=152

 Score =   124 bits (310),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 66/142 (46%), Positives = 87/142 (61%), Gaps = 4/142 (3%)
 Frame = -2

Query  581  VDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYPSF  402
            V+P+ AL PGL+YD+   DY  FLCSL+YT +QI  + +    +C K  S P  LNYPSF
Sbjct  1    VNPNAALDPGLIYDLGMDDYVSFLCSLNYTAKQIHILTRNA-TSCPKLSSAPGDLNYPSF  59

Query  401  SVLFGKSRIVRQT-RELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTVT  225
            SV+F    +VR T R +TNVG A  +YE A+E+P +V +TV+PT L F+   D+  YTV 
Sbjct  60   SVVFKPRSLVRVTKRTVTNVGGAPCVYETAVESPENVNITVEPTTLAFEKQNDKATYTVK  119

Query  224  FVSKKGVVTPSNA--AFGSVSW  165
            F SK      S    AFG + W
Sbjct  120  FESKIAADNKSKGGQAFGQILW  141



>ref|XP_009403290.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=773

 Score =   132 bits (332),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 69/160 (43%), Positives = 96/160 (60%), Gaps = 4/160 (3%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP-NITCA-KKLSNPAQLN  414
            GHVDP++AL PGLVYD    DY  FLC+++Y+  QI    +   ++ C+   L +P  LN
Sbjct  606  GHVDPNRALDPGLVYDSNVDDYLAFLCAMEYSPAQIAVFTRNEISVNCSTAALDSPGDLN  665

Query  413  YPSFSVLFGK-SRIVRQTRELTNVG-AAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRL  240
            YP+FSV+F   S +V   R + NVG +A   YE  + +PP V VTV P+ LVF  V   L
Sbjct  666  YPAFSVIFSSNSDVVTYKRVVRNVGTSAAAAYEARVSSPPGVDVTVTPSTLVFDAVNVSL  725

Query  239  RYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
             Y +TF S        + A+GS+SW++  + VRSPIA +W
Sbjct  726  SYEITFTSLASQAVAGSYAYGSISWSDGDHDVRSPIAVTW  765



>ref|XP_010685296.1| PREDICTED: subtilisin-like protease [Beta vulgaris subsp. vulgaris]
Length=767

 Score =   132 bits (332),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 70/160 (44%), Positives = 102/160 (64%), Gaps = 8/160 (5%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNIT-CAKK-LSNPAQLN  414
            GH+DP+KA+ PGLVYD+  +DY  FLC++ Y T++I  + K P +  CA + LS+P  LN
Sbjct  607  GHIDPNKAVDPGLVYDLQISDYIAFLCTIGYDTKRIHVLFKEPAVVDCASQILSSPGNLN  666

Query  413  YPSFSVLF-GKSRIVRQTRELTNVGAA-GTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRL  240
            YPSFSV+F G +  V+ TR + NVG++   +Y+V ++ P +V ++V PT L F +    L
Sbjct  667  YPSFSVVFRGDTNKVKYTRVVKNVGSSKNAVYKVNVKVPLNVHISVAPTTLAFTSTVQTL  726

Query  239  RYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
             Y +TF S   +  PS   FGS+ W +  + VRSPIA  W
Sbjct  727  SYDITFTSTS-IGPPS---FGSIEWTDGSHHVRSPIAVQW  762



>gb|AFG70691.1| hypothetical protein 0_744_01, partial [Pinus taeda]
Length=152

 Score =   124 bits (310),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 66/142 (46%), Positives = 87/142 (61%), Gaps = 4/142 (3%)
 Frame = -2

Query  581  VDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYPSF  402
            V+P+ AL PGL+YD+   DY  FLCSL+YT +QI  + +    +C K  S P  LNYPSF
Sbjct  1    VNPNAALDPGLIYDLGMDDYVSFLCSLNYTAKQIHILTRNA-TSCPKLSSAPGDLNYPSF  59

Query  401  SVLFGKSRIVRQT-RELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTVT  225
            SV+F    +VR T R +TNVG A  +YE+A+E P +V +TV+PT L F+   D+  YTV 
Sbjct  60   SVVFKPRSLVRVTKRTVTNVGGAPCVYEMAVENPENVNITVEPTTLAFEKQNDKATYTVK  119

Query  224  FVSKKGVVTPSNA--AFGSVSW  165
            F SK      S    AFG + W
Sbjct  120  FESKIAADNKSKGGQAFGQILW  141



>gb|AFB32953.1| hypothetical protein 0_744_01, partial [Abies alba]
 gb|AFB32954.1| hypothetical protein 0_744_01, partial [Abies alba]
Length=152

 Score =   124 bits (310),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 63/142 (44%), Positives = 90/142 (63%), Gaps = 4/142 (3%)
 Frame = -2

Query  581  VDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYPSF  402
            V+P+ AL PGLVYD    +Y  FLCSL+YTT+QI  + +  + +C K    P  LNYPSF
Sbjct  1    VNPNAALDPGLVYDAGMQEYVRFLCSLNYTTKQIHLLTRKAS-SCPKLPGQPGDLNYPSF  59

Query  401  SVLFGKSRIVRQTRE-LTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTVT  225
            SV+F +  +VR TR  +TNVGA  ++YE+A+E+P +V + V+P+KL FK   ++  + V 
Sbjct  60   SVVFKQRDLVRVTRRTVTNVGAVPSVYEMAVESPANVNIIVEPSKLAFKKQNEKASFKVR  119

Query  224  FVSK--KGVVTPSNAAFGSVSW  165
            F SK      +  N  FG +SW
Sbjct  120  FESKVASDFKSSGNKEFGQISW  141



>ref|XP_011036446.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=774

 Score =   132 bits (331),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 69/163 (42%), Positives = 101/163 (62%), Gaps = 5/163 (3%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP--NITCAKKLSNPAQLN  414
            GHVDP+ AL PGLVYD+  +DY  FLC++ Y +++I   V+ P  +  C+ K+ +P  LN
Sbjct  605  GHVDPNSALDPGLVYDMDTSDYIAFLCAIGYDSKRIAVFVREPPSSDICSGKVGSPGNLN  664

Query  413  YPSFSVLF-GKSRIVRQTRELTNVG-AAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRL  240
            YPSFSV+F   S +V   R + +VG +   +YEV + AP +V + V P++LVF      +
Sbjct  665  YPSFSVVFQSNSDVVTYRRTVKSVGNSPDAVYEVEVNAPANVDIKVSPSRLVFNAENKTV  724

Query  239  RYTVTFVSKKGVVTPSNAA-FGSVSWNNAQNQVRSPIAFSWTQ  114
             Y +TF S     +  N+A FGS+ W+N  ++VRSPIA  W Q
Sbjct  725  SYEITFSSVSSGWSSINSATFGSIEWSNGIHRVRSPIAVKWRQ  767



>ref|XP_002304129.2| hypothetical protein POPTR_0003s06530g [Populus trichocarpa]
 gb|EEE79108.2| hypothetical protein POPTR_0003s06530g [Populus trichocarpa]
Length=774

 Score =   132 bits (331),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 71/163 (44%), Positives = 100/163 (61%), Gaps = 5/163 (3%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP--NITCAKKLSNPAQLN  414
            GHVDP+ AL+PGLVYD+  +DY  FLC++ Y +++I   V+ P  +  C+ K  +P  LN
Sbjct  605  GHVDPNSALNPGLVYDMDTSDYIAFLCAIGYDSKRIAVFVREPPSSDICSGKEGSPGNLN  664

Query  413  YPSFSVLF-GKSRIVRQTRELTNVG-AAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRL  240
            YPSFSV+F   S  V   R + NVG +   +YEV + AP +V + V P+KLVF      +
Sbjct  665  YPSFSVVFQSNSDEVTYRRTVKNVGNSLDAVYEVEVNAPANVDIKVSPSKLVFNAENKTV  724

Query  239  RYTVTFVSKKGVVTPSNAA-FGSVSWNNAQNQVRSPIAFSWTQ  114
             Y +TF S     +  N+A FGS+ W+N  ++VRSPIA  W Q
Sbjct  725  SYDITFSSVSSGWSSINSATFGSIEWSNGIHRVRSPIAVKWRQ  767



>gb|EYU29357.1| hypothetical protein MIMGU_mgv1a021077mg [Erythranthe guttata]
Length=719

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 75/154 (49%), Positives = 97/154 (63%), Gaps = 6/154 (4%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNP-AQLNY  411
            GHV+P +A  PGLVYDI P DY  +LC L+YT Q++  IVK   + C+KK S P AQLNY
Sbjct  564  GHVNPSRANDPGLVYDILPDDYIPYLCGLNYTNQEVGIIVKC-KVDCSKKKSIPEAQLNY  622

Query  410  PSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYT  231
            PSFS++FG S     TR LTNVG A + Y+V I +   V V V+P KLVF  +GD+  Y+
Sbjct  623  PSFSIIFG-STPQTYTRTLTNVGKANSSYDVEIVSSHGVNVKVEPHKLVFPKLGDKSSYS  681

Query  230  VTFV-SKKGVVTPSNAAFGSVSWNNAQNQVRSPI  132
            VTF  + K  +  +   F  + W  A + VRSPI
Sbjct  682  VTFTRTTKEAMNSTTQGF--IRWYTADHSVRSPI  713



>gb|AFB32957.1| hypothetical protein 0_744_01, partial [Pinus mugo]
Length=152

 Score =   123 bits (308),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/142 (46%), Positives = 88/142 (62%), Gaps = 4/142 (3%)
 Frame = -2

Query  581  VDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYPSF  402
            V+P+ AL PGL+YD+   DY  FLCSL+YT +QI  + +    +C K  S P  LNYPSF
Sbjct  1    VNPNAALDPGLIYDLGMDDYVSFLCSLNYTAKQIHILTRNA-TSCPKLSSAPGDLNYPSF  59

Query  401  SVLFGKSRIVRQT-RELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTVT  225
            SV+F    +VR T R +TNVG A  +YE+A+++P +V +TV+PT L F+   D+  YTV 
Sbjct  60   SVVFKPRSLVRVTKRTVTNVGGAPCVYEMAVQSPENVNITVEPTTLAFEKQNDKATYTVK  119

Query  224  FVSKKGVVTPSNA--AFGSVSW  165
            F SK      S    AFG + W
Sbjct  120  FESKIAADNKSKGGQAFGQILW  141



>ref|XP_006426684.1| hypothetical protein CICLE_v10024936mg [Citrus clementina]
 gb|ESR39924.1| hypothetical protein CICLE_v10024936mg [Citrus clementina]
Length=776

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 72/165 (44%), Positives = 103/165 (62%), Gaps = 9/165 (5%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP--NITCAKKLSNPAQLN  414
            GHVDP++AL+PGLVYDI  ++Y  FLCS+ Y  ++I   V+ P  +  C + L+ P  LN
Sbjct  608  GHVDPNRALNPGLVYDIDVSEYVAFLCSIGYDVKRISVFVREPASSDICTRALATPGNLN  667

Query  413  YPSFSVLFGKSR-IVRQTRELTNVGAA-GTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRL  240
            YPSFSV+F  +  +V+  R + NVG++   +YEV + APP+V V V P+KL F      L
Sbjct  668  YPSFSVVFNSNNDVVKYKRVVKNVGSSVDAVYEVKVNAPPNVAVNVWPSKLAFSAEKKAL  727

Query  239  RYTVTF--VSKKGV-VTPSNAAFGSVSWNNAQNQVRSPIAFSWTQ  114
             Y +TF  V   G+ V+P  +  GS+ W++  + VRSPIA  W Q
Sbjct  728  AYEITFSSVGLDGLGVSPQQS--GSIEWSDGVHLVRSPIAVRWIQ  770



>ref|XP_006445191.1| hypothetical protein CICLE_v10018512mg [Citrus clementina]
 gb|ESR58431.1| hypothetical protein CICLE_v10018512mg [Citrus clementina]
Length=1364

 Score =   132 bits (332),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 99/160 (62%), Gaps = 8/160 (5%)
 Frame = -2

Query  587   GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLS-NPAQLNY  411
             GHVDP  A  PGL+YDIA  DY  +LCSL+YT+ Q+ A+    N TC    + +P +LNY
Sbjct  1208  GHVDPESASDPGLIYDIATEDYLDYLCSLNYTSLQL-ALFAGGNFTCPNPSAFHPGKLNY  1266

Query  410   PSFSVLFG---KSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRL  240
             PSF+V F    K+  +   R +TNVG +   Y V +E P  V VT+ P  L F+ +G+ L
Sbjct  1267  PSFAVNFKGNVKNMSLEYERSVTNVGTSYCTYAVKVEEPNGVLVTITPPILSFQKIGEIL  1326

Query  239   RYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
              Y VTFVS +G    SN +FGS++W + +  V+SPIA +W
Sbjct  1327  SYKVTFVSLRGA---SNESFGSLTWVSGKYAVKSPIAVTW  1363


 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 51/159 (32%), Positives = 76/159 (48%), Gaps = 8/159 (5%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPA--QLN  414
            G V+P KA+SPGLVYD+    Y  FLC   Y    +  +V + +I C   +       LN
Sbjct  488  GQVNPQKAVSPGLVYDMDDMSYIQFLCHEGYNGSSLAVLVGSKSINCTSLIPGVGYDALN  547

Query  413  YPSFSVLF---GKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDR  243
            YP+  V     G+       R +TNVG   ++Y   I+AP  V +TVKP  L F     +
Sbjct  548  YPTMQVSLKSNGELTTAIFRRRVTNVGPRLSIYNATIKAPKGVNITVKPMSLSFSRTSHK  607

Query  242  LRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAF  126
              ++V  V K   ++ +    GS+ W + +  V S + F
Sbjct  608  RSFSV--VVKAKPMSSTQVLSGSLEWKSPR-HVPSDVCF  643



>ref|XP_004229864.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
 ref|XP_010326049.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
 ref|XP_010326050.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=764

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 103/160 (64%), Gaps = 6/160 (4%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITC-AKKLSNPAQLNY  411
            GHVDP +A  PGL+YDI+  DY  ++CSL+Y + QI  +++  N TC +    +   LNY
Sbjct  606  GHVDPERASDPGLIYDISTEDYLHYICSLNYNSSQIALLLRE-NYTCPSHSFQSLGNLNY  664

Query  410  PSFSVLF-GKSRIVRQT--RELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRL  240
            PSFSVLF   ++ + QT  R +TNVG   + Y V ++ P  V+VTVKP  L F   G +L
Sbjct  665  PSFSVLFDSNNQHLIQTFKRTVTNVGTPRSTYIVQVKTPYGVSVTVKPKILKFHKKGQKL  724

Query  239  RYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
            RY V FV+ KG  +P+++ FGS++W +  + VRSPIA +W
Sbjct  725  RYKVRFVT-KGKRSPADSTFGSLTWISRTHIVRSPIAVTW  763



>ref|XP_008780373.1| PREDICTED: subtilisin-like protease [Phoenix dactylifera]
Length=765

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 71/161 (44%), Positives = 95/161 (59%), Gaps = 10/161 (6%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKK--LSNPAQLN  414
            GHV+P +A +PGLVYDI+P DY  +LCSL+YT+ Q+  + +  N  C K   L N   LN
Sbjct  609  GHVNPERASNPGLVYDISPKDYLDYLCSLNYTSPQLATLARK-NYRCPKNRILRNIRDLN  667

Query  413  YPSFSVLFGKS---RIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDR  243
            YPSFSVLF        V Q R +TNVG A   Y V +  P  VT+ V P +L F  +G +
Sbjct  668  YPSFSVLFESGSPYSTVTQPRTVTNVGQARCRYTVKVREPKGVTINVDPKELAFVEMGQK  727

Query  242  LRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
            L Y V+F+   G    SN++FG + W   +  VRSP+A +W
Sbjct  728  LSYKVSFLGLSG----SNSSFGELVWVCGEFSVRSPVAVTW  764



>gb|AFB32959.1| hypothetical protein 0_744_01, partial [Pinus mugo]
Length=152

 Score =   122 bits (307),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 65/142 (46%), Positives = 87/142 (61%), Gaps = 4/142 (3%)
 Frame = -2

Query  581  VDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYPSF  402
            V+P+ AL PGL+YD+   DY  FLCSL+YT +QI  + +    +C K  S P  LNYPSF
Sbjct  1    VNPNAALDPGLIYDLGMDDYVSFLCSLNYTAKQIHILTRNA-TSCPKLSSAPGDLNYPSF  59

Query  401  SVLFGKSRIVRQT-RELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTVT  225
            SV+F    +VR T R +TNVG A  +YE+ +E+P +V +TV+PT L F+   D+  YTV 
Sbjct  60   SVVFKPRSLVRVTKRTVTNVGGAPCVYEMTVESPENVNITVEPTTLAFEKQNDKATYTVK  119

Query  224  FVSKKGVVTPSNA--AFGSVSW  165
            F SK      S    AFG + W
Sbjct  120  FESKIAADNKSKGGQAFGQILW  141



>ref|XP_007217156.1| hypothetical protein PRUPE_ppa001739mg [Prunus persica]
 gb|EMJ18355.1| hypothetical protein PRUPE_ppa001739mg [Prunus persica]
Length=772

 Score =   131 bits (329),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 67/162 (41%), Positives = 97/162 (60%), Gaps = 7/162 (4%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP---NITCAKKLSNPAQL  417
            GHVDP++AL+PGL+YD+   DY  FLCS+ Y+ +QI   V  P   ++     L++P  L
Sbjct  605  GHVDPNRALNPGLIYDLNVNDYVAFLCSIGYSPRQIAVFVGKPTGSDMCTRNSLASPGDL  664

Query  416  NYPSFSVLFGKSR-IVRQTRELTNVGA-AGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDR  243
            NYPSFSV+    + +++  R  TNVG  A  +YEV + AP  V ++V+P KLVF      
Sbjct  665  NYPSFSVVLSSDQGLIKYKRIATNVGGDADAVYEVTVNAPAGVEISVEPRKLVFSAENQT  724

Query  242  LRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWT  117
              Y VTF  K+GV       +GS+ W + ++ VRSP+A  W+
Sbjct  725  QSYEVTF--KRGVGYDGGERYGSIEWTDGRHLVRSPVAVRWS  764



>ref|XP_006339499.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=765

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 70/160 (44%), Positives = 103/160 (64%), Gaps = 6/160 (4%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITC-AKKLSNPAQLNY  411
            GHVDP +A  PGL+YDI+  DY  ++CSL+Y + QI  +++  N TC +    +   LNY
Sbjct  607  GHVDPERASDPGLIYDISTEDYLHYICSLNYNSSQIALLLRE-NYTCPSHSFQSLGDLNY  665

Query  410  PSFSVLF-GKSRIVRQT--RELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRL  240
            PSF+VLF   ++ + QT  R +TNVG   + Y V ++ P  V+VTVKP  L F+  G +L
Sbjct  666  PSFAVLFDSNNQHLIQTFKRTVTNVGTPRSTYSVQVKTPYGVSVTVKPKILKFQKKGQKL  725

Query  239  RYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
            RY V FV+ +G  +P ++ FGS++W +  + VRSPIA +W
Sbjct  726  RYKVRFVT-RGKRSPGDSTFGSLTWISRTHIVRSPIAVTW  764



>gb|EYU28634.1| hypothetical protein MIMGU_mgv1a024623mg, partial [Erythranthe 
guttata]
Length=699

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 73/155 (47%), Positives = 96/155 (62%), Gaps = 6/155 (4%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNP-AQLNY  411
            GHV+P +A  PGLVYDI P DY  +LC L+Y  Q++  +V    + C+K+ S P AQLNY
Sbjct  544  GHVNPSRANDPGLVYDILPDDYLQYLCGLNYPNQEVSILV-GRKVDCSKEKSIPEAQLNY  602

Query  410  PSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYT  231
            PSFS++ G S     TR LTNVG A + Y+V I +P  V V V+P KLVF  +GD+  Y+
Sbjct  603  PSFSIVLG-STPQTYTRTLTNVGKANSSYDVKIVSPDGVNVKVEPKKLVFPKLGDKSSYS  661

Query  230  VTFV-SKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  129
            VTF  + KG +  +   F  + W  A   VRSPIA
Sbjct  662  VTFTRTTKGAINSTTQGF--IRWYTADYSVRSPIA  694



>gb|EYU29554.1| hypothetical protein MIMGU_mgv1a0256351mg, partial [Erythranthe 
guttata]
Length=434

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 75/155 (48%), Positives = 97/155 (63%), Gaps = 6/155 (4%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNP-AQLNY  411
            GHV+  +A  PGLVYDI P DY  F+C L+YT QQ+  IV   ++ C+K+ S P AQLNY
Sbjct  279  GHVNLSRADDPGLVYDILPDDYIPFVCGLNYTNQQVGIIV-GRDVDCSKEKSIPEAQLNY  337

Query  410  PSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYT  231
            PSFS++FG S     TR LTNVG   + Y+V I +P +V V V+P KLVF  +GD+  Y 
Sbjct  338  PSFSIIFG-STPQTYTRTLTNVGKPDSSYDVEIVSPDNVIVKVEPKKLVFPKLGDKSSYN  396

Query  230  VTFV-SKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  129
            VTF  + K V+  +   F  + W  A   VRSPIA
Sbjct  397  VTFTRTTKEVMNSTTQGF--IRWYTADYSVRSPIA  429



>gb|KCW53526.1| hypothetical protein EUGRSUZ_J02805 [Eucalyptus grandis]
Length=778

 Score =   130 bits (328),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 72/163 (44%), Positives = 101/163 (62%), Gaps = 8/163 (5%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP--NITCAKKLSNPAQLN  414
            GHVDP++AL+PGLVYDI   DY  FLC++ Y  ++I   ++ P  +  CA +++ P +LN
Sbjct  613  GHVDPNRALNPGLVYDIDVDDYVGFLCAIGYEPRRIAVFLREPMSSTVCANRMATPGELN  672

Query  413  YPSFS-VLFGKSRIVRQTRELTNVG-AAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRL  240
            YPSFS VL     +V+  R + NVG +A  +YEV ++AP +V V+V P+KL F      L
Sbjct  673  YPSFSVVLTSNGDVVKYRRVVKNVGSSADAVYEVKVDAPENVEVSVSPSKLEFSAENQIL  732

Query  239  RYTVTFVS-KKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQ  114
             Y +TF S   G  TP    FGS+ W +  ++VRSPIA  W Q
Sbjct  733  SYEITFSSIALGSSTPK---FGSIEWTDGTHRVRSPIAVKWHQ  772



>gb|KJB57037.1| hypothetical protein B456_009G146000 [Gossypium raimondii]
Length=768

 Score =   130 bits (327),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 71/164 (43%), Positives = 93/164 (57%), Gaps = 6/164 (4%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNIT--CAKKLSNPAQLN  414
            GHVDP++AL+PGLVYDI   DY  FLCS+ Y   +I   V+ P  +  C  KL+ P  LN
Sbjct  599  GHVDPNRALNPGLVYDIDNDDYIAFLCSIGYDLNRIAVFVRGPTGSDICEGKLATPGDLN  658

Query  413  YPSFSVLF-GKSRIVRQTRELTNVG-AAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRL  240
            YPSFSV+F     +V+  R + NVG +   +Y   + AP  V + V P KL F      L
Sbjct  659  YPSFSVVFYSNDHVVKYKRTVKNVGTSVDVVYTAKVNAPAGVEINVSPCKLEFSGENKTL  718

Query  239  RYTVTFVSKK-GV-VTPSNAAFGSVSWNNAQNQVRSPIAFSWTQ  114
             Y +TF S   G+    S  AFGS+ W++  + VRSPIA  W Q
Sbjct  719  SYEITFASDGLGLHAVDSLQAFGSIEWSDGVHLVRSPIAVRWAQ  762



>ref|XP_010322825.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=776

 Score =   130 bits (327),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 69/165 (42%), Positives = 101/165 (61%), Gaps = 9/165 (5%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVK-APNITCAKK-LSNPAQLN  414
            GHVDP++AL+PGLVYDI  +DY  FLC++ Y    I   V+ +  + C+++ L+ P  LN
Sbjct  604  GHVDPNRALNPGLVYDIETSDYVNFLCTIGYDGDDIAVFVRDSSRVNCSERSLATPGDLN  663

Query  413  YPSFSVLF--GKSRIVRQTRELTNVGA-AGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDR  243
            YPSF+V F    + +V+  R + NVG     +YEV + AP  V V+V P KLVF    + 
Sbjct  664  YPSFAVDFTSDSNGVVKYKRVVKNVGGNPNAVYEVKVNAPLGVEVSVSPAKLVFSEENNS  723

Query  242  LRYTVTFVSKKG----VVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
            L Y ++F SK+     +V  + +AFGS+ W++  + VRSPIA  W
Sbjct  724  LSYEISFTSKRSEDNIMVKGTPSAFGSIEWSDGIHSVRSPIAVRW  768



>ref|XP_008792869.1| PREDICTED: subtilisin-like protease [Phoenix dactylifera]
Length=781

 Score =   130 bits (327),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 70/162 (43%), Positives = 93/162 (57%), Gaps = 4/162 (2%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP-NITC-AKKLSNPAQLN  414
            GHVDP+KAL PGLVYD    DY  FLC++ Y+ QQI    +    + C A  L++P  LN
Sbjct  614  GHVDPNKALDPGLVYDSQVEDYLAFLCAIGYSPQQIALFTRDEIAVNCSALTLASPGDLN  673

Query  413  YPSFSVLFGK-SRIVRQTRELTNVGA-AGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRL  240
            YP+FS +F   S +V  +R + NVG      YE  +  PP V VTV P+KLVF  V   L
Sbjct  674  YPAFSAVFSSASDVVTYSRVVRNVGGPDDAAYEAEVSCPPGVNVTVTPSKLVFDAVEQSL  733

Query  239  RYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQ  114
             Y +T  S        + +FG +SW++  + VRSPIA SW +
Sbjct  734  SYKITLASMADAAVAGSRSFGWISWSDGAHIVRSPIAVSWRE  775



>emb|CDP09846.1| unnamed protein product [Coffea canephora]
Length=729

 Score =   130 bits (326),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 75/163 (46%), Positives = 101/163 (62%), Gaps = 6/163 (4%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNP-AQLNY  411
            GHV+P KA +PGL+YDI P DY  +LC L+YT +++  +V+   + C  + S P AQLNY
Sbjct  570  GHVNPAKANNPGLIYDIEPKDYIPYLCGLNYTNREVSHLVQR-KVNCTAESSIPEAQLNY  628

Query  410  PSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYT  231
            PSFS++FG S I + TR +TNVG A ++Y V +  P  V VTVKP  L F  V  +L Y 
Sbjct  629  PSFSIVFGSS-IQKYTRTVTNVGEAKSVYTVKVAPPAGVNVTVKPNTLSFSEVNQKLTYE  687

Query  230  VTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIA--FSWTQLF  108
            VTF S       +  + GS++W +A+  VRSPI   F  TQ F
Sbjct  688  VTF-SLLASSANNTVSQGSLAWTSAKYSVRSPIVALFGATQRF  729



>ref|XP_004493834.1| PREDICTED: subtilisin-like protease SDD1-like [Cicer arietinum]
Length=763

 Score =   130 bits (326),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 71/164 (43%), Positives = 102/164 (62%), Gaps = 10/164 (6%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITC--AKKLSNPAQLN  414
            G+V+P +AL+PGLVYDI P DY   LCS+ YT  +I +I    N++C    +++    LN
Sbjct  599  GNVNPQRALNPGLVYDIRPDDYVNHLCSIGYTRSEIFSITHR-NVSCHAMMQMNRGFSLN  657

Query  413  YPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRY  234
            YPS SV+F K  + R+ R ++NVG   ++Y V + AP  V V VKP +LVFK +   L Y
Sbjct  658  YPSISVIF-KDGMTRKIRRVSNVGGPNSIYSVEVVAPQGVKVIVKPKRLVFKQINQSLSY  716

Query  233  TVTFVSKKGVVTPSNA---AFGSVSWNNAQN---QVRSPIAFSW  120
             V F+S+KG    ++    A G ++W ++QN   +VRSPIA SW
Sbjct  717  RVWFISRKGAKRGADTMDFAEGHLTWVHSQNGSYRVRSPIAVSW  760



>ref|XP_003625390.1| Subtilisin-like protease [Medicago truncatula]
Length=932

 Score =   130 bits (326),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 76/166 (46%), Positives = 103/166 (62%), Gaps = 12/166 (7%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCA--KKLSNPAQLN  414
            G+V+P +AL+PGL+YDI P DY   LCS+ YT  +I +I    NI+C    +++    LN
Sbjct  599  GNVNPQRALNPGLIYDIKPDDYVNHLCSIGYTKSEIFSITHK-NISCHTIMRMNRGFSLN  657

Query  413  YPSFSVLFGKSRIVRQ--TRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRL  240
            YPS SV+F K  I R+  +R +TNVG   ++Y V + AP  V V VKP KL+FK +   L
Sbjct  658  YPSISVIF-KDGIRRKMFSRRVTNVGNPNSIYSVEVVAPQGVKVIVKPKKLIFKKINQSL  716

Query  239  RYTVTFVSKKGVVTPS---NAAFGSVSWNNAQN---QVRSPIAFSW  120
             Y V F+S+K V   S   N A G ++W N+QN   +VRSPIA SW
Sbjct  717  SYRVYFISRKRVKKGSDTMNFAEGHLTWINSQNGSYRVRSPIAVSW  762



>emb|CBI34784.3| unnamed protein product [Vitis vinifera]
Length=370

 Score =   126 bits (317),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 74/155 (48%), Positives = 94/155 (61%), Gaps = 4/155 (3%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNP-AQLNY  411
            GHV+P +A  PGL+YDI P DY  +LC L Y   Q++AI++   + C+K+ S P AQLNY
Sbjct  214  GHVNPSRANDPGLIYDIQPNDYIPYLCGLGYNDTQVRAIIRH-KVQCSKESSIPEAQLNY  272

Query  410  PSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYT  231
            PSFSV  G S +  Q R +TNVG A   Y V I AP  V V+VKP KL F     +  YT
Sbjct  273  PSFSVAMGSSALKLQ-RTVTNVGEAKASYIVKISAPQGVDVSVKPRKLDFTQTNQKKTYT  331

Query  230  VTFVSKKGVVTPSNA-AFGSVSWNNAQNQVRSPIA  129
            VTF  K    T S   A G + W +A++ VRSPI+
Sbjct  332  VTFERKDDGKTGSKPFAQGFLEWVSAKHSVRSPIS  366



>ref|XP_004982450.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=775

 Score =   129 bits (325),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 74/172 (43%), Positives = 101/172 (59%), Gaps = 18/172 (10%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAK-KLSNPAQLNY  411
            GHVDP +A+ PGLVYD+   DY  FLC+L Y+   I  + ++ + +CA+ +  +   LNY
Sbjct  607  GHVDPSRAVDPGLVYDLGTRDYVDFLCALKYSPAMIATVARSRDFSCAENRTYSVGGLNY  666

Query  410  PSFSVLF-------GKSR---IVRQTRELTNVGAAGTLY---EVAIEAPPSVTVTVKPTK  270
            PSFSV F       G+S     V  TR LTNVG AGT      VA  A   VTV V+PT+
Sbjct  667  PSFSVAFSTANGEGGESSAAATVTHTRTLTNVGGAGTYKVSTSVAGAAAQGVTVAVEPTE  726

Query  269  LVFKNVGDRLRYTVTFVSKKGVVTPSN-AAFGSVSWNNAQNQVRSPIAFSWT  117
            L F + G++  YTV F S+     PS  + FG + W++ ++ V SPIAF+WT
Sbjct  727  LAFTSAGEKKSYTVRFTSRS---QPSGTSGFGRLVWSDGKHSVASPIAFTWT  775



>gb|AFS34694.1| subtilisin-like serine protease [Pisum sativum]
Length=793

 Score =   129 bits (325),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 71/158 (45%), Positives = 101/158 (64%), Gaps = 5/158 (3%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHVDP  AL+PGLVYD+   DY  FLC+LDYT  QI+ + +       KK  +   LNYP
Sbjct  636  GHVDPVSALNPGLVYDLRVDDYLSFLCALDYTPAQIEIVARRKYTCDPKKQYSVTNLNYP  695

Query  407  SFSVLF-GKSRIVRQTRELTNVGAAGTLYEVAIEAP-PSVTVTVKPTKLVFKNVGDRLRY  234
            SF+V+F G+   ++ TR LTNVGA GT Y+V+I +  P++ ++V+P  L FK   ++  Y
Sbjct  696  SFAVVFKGEHDEIKHTRTLTNVGAEGT-YKVSINSDNPAIKISVEPKVLSFKK-KEKKSY  753

Query  233  TVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
            T+TF +  G     N +FG + W++ +  VRSPIAF+W
Sbjct  754  TITFTT-SGSKQNINQSFGGLEWSDGRTVVRSPIAFTW  790



>ref|XP_003627323.1| Cucumisin-like serine protease subtilisin-like protease [Medicago 
truncatula]
 gb|AET01799.1| subtilisin-like serine protease [Medicago truncatula]
Length=785

 Score =   129 bits (325),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 70/166 (42%), Positives = 99/166 (60%), Gaps = 9/166 (5%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPN----ITCAKKLSNPAQ  420
            GHVDP+KAL+PGLVYD+   DY  FLCS+ Y  ++IQ   + P         +K ++P  
Sbjct  618  GHVDPNKALNPGLVYDLNINDYLAFLCSIGYDAKEIQIFTREPTSYNVCENERKFTSPGD  677

Query  419  LNYPSFSVLFGKSR-IVRQTRELTNVG-AAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGD  246
            LNYPSFSV+FG +  +V+  R LTNVG +   +Y V + AP  V V+V P+KLVF +   
Sbjct  678  LNYPSFSVVFGANNGLVKYKRVLTNVGDSVDAVYTVKVNAPFGVDVSVSPSKLVFSSENK  737

Query  245  RLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQLF  108
               + VTF     +    + +FGS+ W++  + VRSPIA  W+  F
Sbjct  738  TQAFEVTFTR---IGYGGSQSFGSLEWSDGSHIVRSPIAARWSNGF  780



>ref|XP_006342924.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=767

 Score =   129 bits (324),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 69/160 (43%), Positives = 97/160 (61%), Gaps = 4/160 (3%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVK-APNITCAKK-LSNPAQLN  414
            GHVDP++AL PGLVYDI  +DY  FLC++ Y   +I    K   ++ C++  L++P  LN
Sbjct  601  GHVDPNRALHPGLVYDIESSDYVGFLCAIGYGPSRISPFTKDTSSVNCSEHSLASPGDLN  660

Query  413  YPSFSVLFGKSRIVRQTRELTNVGA-AGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLR  237
            YPSFSV+F    +V+  R + NVG  A  +Y+V + AP SV V V P+KL F    + L 
Sbjct  661  YPSFSVVFMSENVVKYKRVVKNVGRNANVVYKVKVNAPSSVEVKVTPSKLSFSEEKNSLS  720

Query  236  YTVTFVS-KKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
            Y ++F S     V    +AFGS+ W++  + VRSPIA  W
Sbjct  721  YEISFSSVGSERVKGLESAFGSIEWSDGIHSVRSPIAVRW  760



>ref|XP_010091819.1| Subtilisin-like protease SDD1 [Morus notabilis]
 gb|EXB46027.1| Subtilisin-like protease SDD1 [Morus notabilis]
Length=771

 Score =   129 bits (324),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 72/166 (43%), Positives = 106/166 (64%), Gaps = 12/166 (7%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLS--NPAQLN  414
            GHV+P +AL PGLVYDI P +Y   LC+L YT  ++ ++    N++C + L+      LN
Sbjct  607  GHVNPQRALDPGLVYDIRPGEYVTHLCTLGYTDLEVFSVTHK-NVSCREILTINKGFSLN  665

Query  413  YPSFSVLFGK---SRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDR  243
            YPS SV+F +   S++++  R LTNVG+  ++Y + IEAP  V V VKP +LVF  +   
Sbjct  666  YPSISVIFKRGTGSKMIK--RRLTNVGSPNSIYSLEIEAPQDVKVRVKPRRLVFTRINQV  723

Query  242  LRYTVTFVSKKGVVTPSNA-AFGSVSWNNAQN---QVRSPIAFSWT  117
            L Y V F+S+K  V  S++ A G ++W NA+N   +VRSPI+ +WT
Sbjct  724  LSYRVWFISRKRSVVQSHSYAQGHLTWVNAKNSLYRVRSPISIAWT  769



>gb|AFB32956.1| hypothetical protein 0_744_01, partial [Pinus mugo]
Length=152

 Score =   121 bits (303),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 64/142 (45%), Positives = 86/142 (61%), Gaps = 4/142 (3%)
 Frame = -2

Query  581  VDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYPSF  402
            V+P+ AL PGL+YD+   DY  FLCSL+YT +QI  + +    +C K  S P  LNYPSF
Sbjct  1    VNPNAALDPGLIYDLGMDDYVSFLCSLNYTAKQIHILTRNAT-SCPKLRSAPGDLNYPSF  59

Query  401  SVLFGKSRIVRQT-RELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTVT  225
            SV+F    +VR T R +TNVG A  +YE+ +E+P +V +TV+P  L F+   D+  YTV 
Sbjct  60   SVVFKPRSLVRVTKRTVTNVGGAPCVYEMTVESPENVNITVEPMTLAFEKQNDKATYTVK  119

Query  224  FVSKKGVVTPSNA--AFGSVSW  165
            F SK      S    AFG + W
Sbjct  120  FESKIAADNKSKGGQAFGQILW  141



>gb|KDP25551.1| hypothetical protein JCGZ_20707 [Jatropha curcas]
Length=757

 Score =   129 bits (324),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 70/154 (45%), Positives = 95/154 (62%), Gaps = 4/154 (3%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNP-AQLNY  411
            GHV+P +A  PGL+YDI P DY  +LC L Y  +Q+ +I+    I C++KLS P  QLNY
Sbjct  603  GHVNPSRANDPGLIYDIQPDDYIPYLCGLGYKEEQV-SIIAHRRIKCSEKLSIPEGQLNY  661

Query  410  PSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYT  231
            PSFSV  G S+    TR +TNVG A ++Y   I  PP V VTV+P +L F  V  ++ Y+
Sbjct  662  PSFSVTLGASQTF--TRTVTNVGEANSVYAATIVPPPGVAVTVEPYRLYFSQVNQKVTYS  719

Query  230  VTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  129
            VTF         S  A G + W++A++ VRSPI+
Sbjct  720  VTFSPTGSSGKTSEFAQGYILWSSAKHLVRSPIS  753



>gb|EAZ04458.1| hypothetical protein OsI_26606 [Oryza sativa Indica Group]
Length=770

 Score =   129 bits (323),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 73/160 (46%), Positives = 90/160 (56%), Gaps = 6/160 (4%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNIT-CAKKL--SNPAQL  417
            GHV P  A+ PGLVYD    DY  FLCSL+YT +Q++  V  P+   CA  L    PA L
Sbjct  612  GHVRPQLAVDPGLVYDAGVEDYVDFLCSLNYTVEQLRVFV--PDTAGCAPALPGGGPANL  669

Query  416  NYPSFSVLF-GKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRL  240
            NYPSF V F G +R+   TR +T V      Y VA+ AP  V VTV+P  L FK   +  
Sbjct  670  NYPSFVVAFNGSTRVRTLTRTVTKVYEKPETYSVAVSAPAGVKVTVRPATLEFKEKNEEK  729

Query  239  RYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
             YTV F S  G     +  FG +SW N ++QVRSP+ F W
Sbjct  730  SYTVEFTSVAGGHVNQSWDFGHISWENRKHQVRSPVVFMW  769



>ref|XP_009375850.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=764

 Score =   129 bits (323),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 68/160 (43%), Positives = 95/160 (59%), Gaps = 5/160 (3%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITC-AKKLSNPAQLNY  411
            GHVDP  A  PGLVYDI   DY ++LCSL+Y + QI       N TC    +     LNY
Sbjct  605  GHVDPESAADPGLVYDITTEDYLLYLCSLNYNSSQIALFSNGVNFTCPGTSVVQSGDLNY  664

Query  410  PSFSVLFGKSR---IVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRL  240
            PSFSV+F + R    V   R + NVG+  + Y V ++ P  V+V+V+P  L FK +G+++
Sbjct  665  PSFSVIFDQDRRKTSVTYKRTVKNVGSIPSTYAVQVKEPAGVSVSVEPKTLRFKKMGEKM  724

Query  239  RYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
             Y V FV+  G  T +N++FGS++    + +VRSPIA  W
Sbjct  725  SYKVRFVALGG-ATSTNSSFGSLTLVAEKYRVRSPIAVLW  763



>ref|NP_001060094.1| Os07g0578300 [Oryza sativa Japonica Group]
 dbj|BAC83078.1| putative subtilisin-like serine protease [Oryza sativa Japonica 
Group]
 dbj|BAD30472.1| putative subtilisin-like serine protease [Oryza sativa Japonica 
Group]
 dbj|BAF22008.1| Os07g0578300 [Oryza sativa Japonica Group]
 gb|EAZ40414.1| hypothetical protein OsJ_24865 [Oryza sativa Japonica Group]
Length=770

 Score =   129 bits (323),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 73/160 (46%), Positives = 90/160 (56%), Gaps = 6/160 (4%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNIT-CAKKL--SNPAQL  417
            GHV P  A+ PGLVYD    DY  FLCSL+YT +Q++  V  P+   CA  L    PA L
Sbjct  612  GHVRPQLAVDPGLVYDAGVEDYVDFLCSLNYTVEQLRVFV--PDTAGCAPALPGGGPANL  669

Query  416  NYPSFSVLF-GKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRL  240
            NYPSF V F G +R+   TR +T V      Y VA+ AP  V VTV+P  L FK   +  
Sbjct  670  NYPSFVVAFNGSTRVRTLTRTVTKVYEKPETYSVAVSAPAGVKVTVRPATLEFKEKNEEK  729

Query  239  RYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
             YTV F S  G     +  FG +SW N ++QVRSP+ F W
Sbjct  730  SYTVEFTSVAGGHVNQSWDFGHISWENRKHQVRSPVVFMW  769



>ref|XP_011035735.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=774

 Score =   128 bits (322),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 69/164 (42%), Positives = 101/164 (62%), Gaps = 7/164 (4%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP--NITCAKKLSNPAQLN  414
            GHVDP+ AL PGLVYD+  +DY  FLC++ Y + +I   V+ P  +  C+ K+S+P  LN
Sbjct  605  GHVDPNSALDPGLVYDMDTSDYISFLCAIGYDSNRIAVFVREPPSSDICSGKVSSPGNLN  664

Query  413  YPSFSVLF-GKSRIVRQTRELTNVGAA-GTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRL  240
            YPSFSV+F   S +V   R + NVG++   +YEV + +P +V + V P+KLVF      L
Sbjct  665  YPSFSVVFQSTSDVVTCKRVVKNVGSSLDAVYEVKVNSPANVDIKVSPSKLVFSAENKTL  724

Query  239  RYTVTFVSKKGVVTPS--NAAFGSVSWNNAQNQVRSPIAFSWTQ  114
             Y +TF S  G+  P+   + +GS+ W++  + VR PIA  W Q
Sbjct  725  SYEITF-SSVGLDWPTIIPSTYGSIEWSDGIHGVRGPIAVKWRQ  767



>gb|AEW07410.1| hypothetical protein 0_744_01, partial [Pinus radiata]
Length=152

 Score =   120 bits (301),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/142 (46%), Positives = 86/142 (61%), Gaps = 4/142 (3%)
 Frame = -2

Query  581  VDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYPSF  402
            V+P+ AL PGL+YD+   DY  FLCSL+YT +QI  + +    +C K  S P  LNYPSF
Sbjct  1    VNPNAALDPGLIYDLGMDDYVSFLCSLNYTAKQIHILTRNA-TSCPKLSSAPGDLNYPSF  59

Query  401  SVLFGKSRIVRQT-RELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTVT  225
            SV+F    +VR T R +TNVG A  +YE+A+E P +V +TV+PT L F+   D+  YTV 
Sbjct  60   SVVFKPRSLVRVTKRTVTNVGGAPCVYEMAVENPENVNITVEPTTLAFEKQNDKATYTVK  119

Query  224  FVSKKGVVTPSNA--AFGSVSW  165
              SK      S    AFG + W
Sbjct  120  SESKIAADNKSKGGQAFGQILW  141



>gb|AFB32955.1| hypothetical protein 0_744_01, partial [Larix decidua]
Length=148

 Score =   120 bits (300),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/140 (44%), Positives = 88/140 (63%), Gaps = 4/140 (3%)
 Frame = -2

Query  581  VDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYPSF  402
            V+P+ AL PGLVYD    +Y  FLCSL+YT +QI  + K  + +C K  + P  LNYPSF
Sbjct  1    VNPNAALDPGLVYDAGMEEYVSFLCSLNYTAKQIYLLTKRTS-SCPKLRARPGDLNYPSF  59

Query  401  SVLFGKSRIVRQTRE-LTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTVT  225
            SV+F    +VR TR  + NVG A + YE+A+E+PP+V + V+P+ L FK   ++  +TV 
Sbjct  60   SVVFKPRDLVRVTRRTVKNVGQAFSEYEMAVESPPNVNIIVEPSTLTFKKQNEKANFTVR  119

Query  224  FVSKKGVVTPSNAAFGSVSW  165
            F SK  + +     FG +SW
Sbjct  120  FKSK--IASSGRPEFGQISW  137



>ref|XP_003605881.1| Subtilisin-like protease [Medicago truncatula]
 gb|KEH17073.1| subtilisin-like serine protease [Medicago truncatula]
Length=760

 Score =   128 bits (322),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 101/160 (63%), Gaps = 7/160 (4%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHVDP  AL+PGLVYD+   DY  FLC+L+Y++ +I+ + +       KK  +   LNYP
Sbjct  602  GHVDPVSALNPGLVYDLTVDDYLSFLCALNYSSNEIEMVARRKYTCDPKKQYSVENLNYP  661

Query  407  SFSVLFGKSRIV---RQTRELTNVGAAGTLYEVAIEA-PPSVTVTVKPTKLVFKNVGDRL  240
            SF+V+F     V   + TR LTNVG  GT Y+V++++  PS+ ++V+P  L FK    +L
Sbjct  662  SFAVVFEDEHGVEEIKHTRTLTNVGVEGT-YKVSVKSDAPSIKISVEPEVLSFKKNEKKL  720

Query  239  RYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
             YT++F S  G    S  +FGSV W+N +  VRSPIAFSW
Sbjct  721  -YTISF-SSAGSKPNSTQSFGSVEWSNGKTIVRSPIAFSW  758



>ref|XP_010087293.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB28740.1| Subtilisin-like protease [Morus notabilis]
Length=743

 Score =   128 bits (321),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 69/161 (43%), Positives = 101/161 (63%), Gaps = 6/161 (4%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GH DP  AL PGLVYD+   DY  FLC+L+YT  QI  + +      AKK  +   LNYP
Sbjct  585  GHADPVAALDPGLVYDLTVDDYLDFLCALNYTDDQISGLTRKEFSCDAKKKYSVTDLNYP  644

Query  407  SFSVLF---GKSRIVRQTRELTNVGAAGTLYEVAIEAP-PSVTVTVKPTKLVFKNVGDRL  240
            SF+V F   G S +   +R LTNVG AGT Y++++++   SV ++V+P  L F +  ++ 
Sbjct  645  SFAVNFQSNGGSSVYNYSRTLTNVGPAGT-YKLSLKSETQSVKISVEPETLSFSHANEKK  703

Query  239  RYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWT  117
             YTVTF +  G ++P + +FG + W++ ++ V SPIAFSW+
Sbjct  704  SYTVTFTA-VGSMSPDSKSFGRIEWSDGKHIVGSPIAFSWS  743



>ref|XP_004958126.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=780

 Score =   128 bits (321),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 70/159 (44%), Positives = 93/159 (58%), Gaps = 5/159 (3%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPN-ITCAKKLSN-PAQLN  414
            G+V P+ AL PGLVYD    DY  FLC+L+YT +Q++  V  P+ + C + L+  PA LN
Sbjct  622  GYVHPNLALDPGLVYDAGERDYVDFLCALNYTPEQLRVFV--PDFVKCTRTLAGGPADLN  679

Query  413  YPSFSVLFGKSRIVRQ-TRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLR  237
            YPSF V+F     +R  TR LT V      Y V + AP  V V + PT L FK   +   
Sbjct  680  YPSFVVVFDDRTAIRTLTRTLTKVFEEAETYNVTVMAPEHVKVIITPTTLEFKEPKETRS  739

Query  236  YTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
            YTV FV++ G    S   FG +SW N +++VRSP+AF W
Sbjct  740  YTVEFVNEAGGNRKSGWDFGHISWENEKHRVRSPVAFQW  778



>ref|XP_006358406.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=742

 Score =   128 bits (321),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 72/154 (47%), Positives = 97/154 (63%), Gaps = 4/154 (3%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNP-AQLNY  411
            GHV+P +A  PGL+YD    DY  +LC L+YT QQ+ +IVK   + C K    P AQLNY
Sbjct  583  GHVNPSRANDPGLIYDTPVKDYLPYLCGLNYTNQQVGSIVKH-KVDCNKVKHIPEAQLNY  641

Query  410  PSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYT  231
            PSFS+ FG+S     TR +TN+G A + Y V I++PP VTV VKP+ L F  +  +L+Y 
Sbjct  642  PSFSIKFGESSQTY-TRTVTNIGEANSSYSVEIDSPPGVTVIVKPSTLKFSQLNQKLKYQ  700

Query  230  VTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  129
            VTF +++   T S  A G + W+  +  VRSPIA
Sbjct  701  VTF-TRRDNSTNSGIAQGFLKWSWKKYSVRSPIA  733



>ref|XP_006298979.1| hypothetical protein CARUB_v10015104mg [Capsella rubella]
 gb|EOA31877.1| hypothetical protein CARUB_v10015104mg [Capsella rubella]
Length=784

 Score =   128 bits (321),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 69/166 (42%), Positives = 97/166 (58%), Gaps = 8/166 (5%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCA---KKLSNPAQL  417
            GHVDP+KAL+PGLVYDI   +Y  FLC++ Y    I   ++ P++  A    KL     L
Sbjct  612  GHVDPNKALNPGLVYDIEVKEYVAFLCAVGYEFPGILVFLQDPSLYDACETSKLRTAGDL  671

Query  416  NYPSFSVLFGKS-RIVRQTRELTNVGA-AGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDR  243
            NYPSFSV+FG +  + +  R + NVG+    +YEV +++P +V + V P+KLVF      
Sbjct  672  NYPSFSVVFGSTGEVAKYRRVVKNVGSNVDAVYEVGVKSPANVEIEVSPSKLVFSKEKRE  731

Query  242  LRYTVTFVS---KKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQ  114
            L Y VTF S     GV +     FGS+ W +  + V+SP+AF W Q
Sbjct  732  LEYEVTFKSVVLGGGVGSMPGQEFGSIEWTDGDHVVKSPVAFQWGQ  777



>ref|XP_004512212.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=757

 Score =   127 bits (320),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 75/160 (47%), Positives = 100/160 (63%), Gaps = 9/160 (6%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHVDP  AL+PGLVYD+   DY  FLC+ +Y    I+ +V+       K   +   LNYP
Sbjct  601  GHVDPVLALNPGLVYDLTVDDYLKFLCASNYDDSSIEIVVRRKYTCDPKTKYSVTDLNYP  660

Query  407  SFSVLFGKSRIVRQ---TRELTNVGAAGTLYEVAIEAP-PSVTVTVKPTKLVFKNVGDRL  240
            SF+V+F  +  V++   TR LTNVG AGT Y+V+I++  PSV + V+PT L FK   ++ 
Sbjct  661  SFAVVFESANGVKEIKYTRTLTNVGEAGT-YKVSIKSDVPSVKILVEPTVLSFKQ-NEKK  718

Query  239  RYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
             YTVTF +     TPS   FGS+ W+N +  VRSPIAFSW
Sbjct  719  SYTVTFTTSGSQDTPS---FGSLEWSNGKTIVRSPIAFSW  755



>emb|CDP11276.1| unnamed protein product [Coffea canephora]
Length=753

 Score =   127 bits (320),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 74/155 (48%), Positives = 97/155 (63%), Gaps = 8/155 (5%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNP-AQLNY  411
            GHV+P KA +PGL+YDI P DY  +LC L+YT ++I  ++K   + CA +L  P AQLNY
Sbjct  597  GHVNPSKATNPGLIYDIEPKDYIPYLCGLNYTNREIGILLKR-KVNCAVELLMPEAQLNY  655

Query  410  PSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYT  231
            PSFS++FG S + R TR +TNV  A + Y V I  P  V +TVKPT L F     +L Y 
Sbjct  656  PSFSIIFG-SPVQRYTRMVTNVDEANSTYTVKIIPPAGVNLTVKPTTLGFSQANQKLTYE  714

Query  230  VTFVSKKGVVTP--SNAAFGSVSWNNAQNQVRSPI  132
            VTF     V +P  S  + GS+SW + +  VRSPI
Sbjct  715  VTFTL---VASPAKSRVSQGSLSWTSTKFSVRSPI  746



>ref|XP_007051967.1| Subtilase family protein [Theobroma cacao]
 gb|EOX96124.1| Subtilase family protein [Theobroma cacao]
Length=771

 Score =   127 bits (320),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 70/161 (43%), Positives = 92/161 (57%), Gaps = 7/161 (4%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLS-NPAQLNY  411
            GHVDP KA  PGL+YDI P DY  +LCSL Y+   I A     + TC + L+  P  LNY
Sbjct  613  GHVDPEKASDPGLIYDITPEDYLNYLCSLKYSASDI-AKFAGKDFTCPQNLTMQPGDLNY  671

Query  410  PSFSVLFGKS---RIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRL  240
            PSF+V F +S     V  TR +T+VG     YEV    P  V++TV+P  L F+N G +L
Sbjct  672  PSFAVNFKRSIDNNTVTFTRTVTHVGIPNVTYEVRGTEPDGVSITVEPEILKFENPGQKL  731

Query  239  RYTVTFVSKKGVVTPSNAAFGSVSWNNAQN-QVRSPIAFSW  120
             Y +TF  + G V P   +FG + W+      VRSP+A +W
Sbjct  732  SYKITFTQRNGTV-PRKTSFGYIKWSYLDKYHVRSPVAVTW  771



>ref|XP_004244717.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=744

 Score =   127 bits (319),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 73/156 (47%), Positives = 99/156 (63%), Gaps = 8/156 (5%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNP-AQLNY  411
            GHV+P +A  PGL+YDI+  DY  +LC L+YT QQ+ +IVK   + C K    P AQLNY
Sbjct  585  GHVNPLRANDPGLIYDISIEDYLPYLCGLNYTNQQVGSIVKH-KVDCNKVKHIPEAQLNY  643

Query  410  PSFSVLFGKSRIVRQ--TRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLR  237
            PSFS+  G    + Q  TR +TNVG A + Y V I++PP VTV VKP+ L F  +  +L+
Sbjct  644  PSFSITLGD---ISQTYTRTVTNVGEAKSSYTVEIDSPPRVTVIVKPSTLKFSQLDQKLK  700

Query  236  YTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  129
            Y VTF +++   T S  A G + W++ +  VRSPIA
Sbjct  701  YQVTF-TRRDDSTSSGIAQGFLKWSSKKYSVRSPIA  735



>ref|XP_008440346.1| PREDICTED: subtilisin-like protease [Cucumis melo]
Length=761

 Score =   127 bits (319),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 72/167 (43%), Positives = 99/167 (59%), Gaps = 12/167 (7%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITC-AKKLSNPAQLNY  411
            GHVDP  AL+PGLVYD+   DY  FLC+L+YT  QI ++ +  + TC +KK  +   LNY
Sbjct  597  GHVDPVSALNPGLVYDLTVDDYLNFLCALNYTPSQINSLARK-DFTCDSKKKYSVNDLNY  655

Query  410  PSFSVLFGKSRIV--------RQTRELTNVGAAGTLYEVAIEAP-PSVTVTVKPTKLVFK  258
            PSF+V+F              + TR LTNVG+ GT Y+V+I +   SV ++V+P  L F 
Sbjct  656  PSFAVVFDGVLGGGGSGSSVVKHTRTLTNVGSPGT-YKVSISSETKSVKISVEPESLSFT  714

Query  257  NVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWT  117
               ++  YTVTF S       S   FG + W++ ++ V SPIAFSWT
Sbjct  715  GANEKKSYTVTFTSNGSAAPSSAEGFGRIEWSDGKHVVGSPIAFSWT  761



>ref|XP_006358407.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=743

 Score =   127 bits (318),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 72/154 (47%), Positives = 97/154 (63%), Gaps = 4/154 (3%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNP-AQLNY  411
            GHV+P +A  PGL+YD    DY  +LC L+YT QQ+ +IVK   + C K    P AQLNY
Sbjct  584  GHVNPSRANDPGLIYDTPFDDYLPYLCGLNYTNQQVGSIVKH-KVDCKKVKHIPEAQLNY  642

Query  410  PSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYT  231
            PSFS+ FG+S     TR +TNVG A + Y V I++PP VTV VKP+ L F  +  +L+Y 
Sbjct  643  PSFSIEFGESSQTY-TRTVTNVGEAKSSYTVEIDSPPGVTVIVKPSTLKFSQLNQKLKYQ  701

Query  230  VTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  129
            V F +++   T S  A G + W++ +  VRSPIA
Sbjct  702  VMF-TRRDNSTNSGIAQGFLKWSSKKYSVRSPIA  734



>emb|CDP10007.1| unnamed protein product [Coffea canephora]
Length=744

 Score =   127 bits (318),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 68/153 (44%), Positives = 96/153 (63%), Gaps = 4/153 (3%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHV+P +A +PGL+YDI P DY  +LC L+Y+ +++  I++      A+   +  QLNYP
Sbjct  587  GHVNPARANNPGLIYDIEPKDYIPYLCGLNYSDREVGRILQRKANCKAESRISETQLNYP  646

Query  407  SFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTV  228
            SFS++ G S I + TR +TNVG A ++Y V I+ P  V VTVKP  L F  V  +L Y +
Sbjct  647  SFSIVVG-STIQKYTRTVTNVGDANSIYRVKIDQPGGVNVTVKPRILSFSKVNQKLSYDI  705

Query  227  TFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  129
            TF       TPS+   GS++W +A+  VRSPIA
Sbjct  706  TFTPLSPYETPSD---GSLTWTSAKYSVRSPIA  735



>gb|ABR18065.1| unknown [Picea sitchensis]
Length=783

 Score =   127 bits (319),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 70/162 (43%), Positives = 90/162 (56%), Gaps = 6/162 (4%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHV+P  AL PGLVYD    DY  FLCSL+YT  QI  + +  +         P  LNYP
Sbjct  621  GHVNPSAALDPGLVYDADFDDYVSFLCSLNYTRSQIHILTRKASSCTRIHSQQPGDLNYP  680

Query  407  SFSVLFGKSRIVRQTRE-LTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYT  231
            SFSV+F    +VR  R  +TNVG A  +YEV++E+PP V + V+P  LVFK   ++  YT
Sbjct  681  SFSVVFKPLNLVRALRRTVTNVGGAPCVYEVSMESPPGVNIIVEPRTLVFKEQNEKASYT  740

Query  230  VTFVSKKGVVTPSNA--AFGSVSWNNAQNQ---VRSPIAFSW  120
            V F SK      S+    FG + W   +     VRSP+A  W
Sbjct  741  VRFESKTASHNKSSGRQEFGQIWWKCVKGGTQVVRSPVAIVW  782



>ref|XP_010111996.1| Subtilisin-like protease [Morus notabilis]
 gb|EXC32307.1| Subtilisin-like protease [Morus notabilis]
Length=826

 Score =   127 bits (318),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 69/166 (42%), Positives = 98/166 (59%), Gaps = 12/166 (7%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNIT--CAK------KLS  432
            GHVDP++AL+PGLVYD    DY  FLCS+ Y +  I   V+ P  +  CAK       L 
Sbjct  655  GHVDPNRALNPGLVYDAGVNDYVAFLCSIGYDSALISIFVREPTSSDICAKTFDKIGALI  714

Query  431  NPAQLNYPSFSVLFGKSR-IVRQTRELTNVGA-AGTLYEVAIEAPPSVTVTVKPTKLVFK  258
            +   LNYPSFSV+F  +R +V+  R +TNVG+    +YEV++  P  V + V P++LVF+
Sbjct  715  SSGDLNYPSFSVVFDSNRQVVKYKRVVTNVGSETDAVYEVSVSEPAGVDIKVSPSRLVFR  774

Query  257  NVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
                +  + VTF +    +  S   FGSV W +  ++VRSP+AF W
Sbjct  775  ADNQKQTFEVTFTTSVDYIKSSR--FGSVVWTDGTHRVRSPVAFKW  818



>ref|XP_009758461.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=774

 Score =   127 bits (318),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 69/167 (41%), Positives = 98/167 (59%), Gaps = 9/167 (5%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVK-APNITCAKK-LSNPAQLN  414
            GHVDP++AL PGLVYDI  +DY  FLCS+ Y    +    + +  + C+++ L+ P  LN
Sbjct  602  GHVDPNRALDPGLVYDIETSDYVNFLCSIGYDGTDVAVFARDSSRVNCSERSLATPGDLN  661

Query  413  YPSFSVLF-GKSR-IVRQTRELTNVGA-AGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDR  243
            YPSFSV+F G++  +V+  R + NVG     +YEV + AP SV V+V P KLVF      
Sbjct  662  YPSFSVVFTGETNGVVKYKRVVKNVGKNTDAVYEVKVNAPSSVEVSVSPAKLVFSEEKQS  721

Query  242  LRYTVTFVSKKG----VVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQ  114
            L Y ++   K      +V    +AFGS+ W++  + VRSPIA  W  
Sbjct  722  LSYEISLKGKSSGDLEMVKGIESAFGSIEWSDGIHNVRSPIAVRWRH  768



>ref|XP_002303551.2| hypothetical protein POPTR_0003s11870g [Populus trichocarpa]
 gb|EEE78530.2| hypothetical protein POPTR_0003s11870g [Populus trichocarpa]
Length=764

 Score =   127 bits (318),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 71/154 (46%), Positives = 93/154 (60%), Gaps = 4/154 (3%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNP-AQLNY  411
            GHV+P +A +PGLVYDI P DY  +LC L Y   ++  IV    + C++K S P  +LNY
Sbjct  603  GHVNPSRANNPGLVYDIQPDDYIPYLCGLGYADNEVSIIVHE-QVKCSEKPSIPEGELNY  661

Query  410  PSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYT  231
            PSF+V  G S+    TR +TNVG   + YEVAI +PP V VTVKP+KL F  V  +  Y+
Sbjct  662  PSFAVTLGPSQTF--TRTVTNVGDVNSAYEVAIVSPPGVDVTVKPSKLYFSKVNQKATYS  719

Query  230  VTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  129
            V F   +     S  A G + W +A+  VRSPIA
Sbjct  720  VAFSRTEYGGKTSETAQGYIVWASAKYTVRSPIA  753



>gb|KFK42754.1| hypothetical protein AALP_AA1G035200 [Arabis alpina]
Length=781

 Score =   126 bits (317),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 72/161 (45%), Positives = 101/161 (63%), Gaps = 9/161 (6%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKL-SNPA-QLN  414
            GHV+P KA++PGLVY+I P DY  +LC+L +T   I AI    N++C+  L  NP   LN
Sbjct  616  GHVNPRKAINPGLVYNIQPVDYITYLCTLGFTRSDILAITHK-NVSCSGILRKNPGFSLN  674

Query  413  YPSFSVLFGKSRIVRQ-TRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLR  237
            YPS SV+F + + +   TR +TNVG+   +Y V ++AP  + VTVKP +LVFK+    L 
Sbjct  675  YPSISVIFKRGKTMEMITRRVTNVGSPNAIYSVNVKAPEGIKVTVKPKRLVFKHADQTLS  734

Query  236  YTVTFVSKKGVVTPSNAAF--GSVSWNNAQN---QVRSPIA  129
            Y V FV KK       A+F  G ++W N++N   +VRSPI+
Sbjct  735  YRVWFVMKKRNRGEKVASFAQGQLTWVNSRNLIQRVRSPIS  775



>gb|KDP26457.1| hypothetical protein JCGZ_17615 [Jatropha curcas]
Length=693

 Score =   126 bits (316),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 68/165 (41%), Positives = 104/165 (63%), Gaps = 12/165 (7%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAK--KLSNPAQLN  414
            GHV+P +A+SPGL+YDI P DY + LC+L YT  +I  I    N++C +  +++    LN
Sbjct  529  GHVNPERAISPGLIYDIKPADYVIHLCTLGYTRSEIFTITHR-NVSCNELLRMNKGFSLN  587

Query  413  YPSFSVLFGK---SRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDR  243
            YPS SV+F     S++++  R+LTNVG+  ++Y V + AP  V V VKP KL+FK++   
Sbjct  588  YPSISVIFKHGMTSKMIK--RQLTNVGSPNSIYSVEVMAPEGVKVRVKPQKLLFKHINQS  645

Query  242  LRYTVTFVSKKGVVTPSNA-AFGSVSWNNAQN---QVRSPIAFSW  120
            L Y V F S+K +     + A G ++W ++QN   + RSPI+ +W
Sbjct  646  LSYKVWFTSRKTIRREQQSFAQGHLTWVHSQNNFYRTRSPISVTW  690



>ref|XP_009391664.1| PREDICTED: subtilisin-like protease SDD1 [Musa acuminata subsp. 
malaccensis]
Length=772

 Score =   126 bits (317),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 72/162 (44%), Positives = 92/162 (57%), Gaps = 7/162 (4%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQ--LN  414
            GHV+P +A+ PGLVYD+ P DY   +CSL Y   +I  I    NI+C K L    Q  LN
Sbjct  610  GHVNPARAVDPGLVYDVQPEDYIAHICSLGYNQAEIFTITHR-NISCGKLLKGQKQFNLN  668

Query  413  YPSFSVLFGKSRIVRQT-RELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLR  237
            YPS SV F + R      R+LTNVG   ++Y V + APP VTVTV P  L F  + +   
Sbjct  669  YPSISVSFTQGRTSTTIQRKLTNVGLPDSIYTVQVTAPPGVTVTVTPKILAFGGINEIKS  728

Query  236  YTVTFVSKKGVVTPSNAAFGSVSW---NNAQNQVRSPIAFSW  120
            YTV F SKKGV    + A G + W      + +VRSPI+ +W
Sbjct  729  YTVVFESKKGVQEEGSVAGGQLMWVHSGRKKYKVRSPISVTW  770



>ref|XP_002275429.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=740

 Score =   126 bits (317),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 74/155 (48%), Positives = 94/155 (61%), Gaps = 4/155 (3%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNP-AQLNY  411
            GHV+P +A  PGL+YDI P DY  +LC L Y   Q++AI++   + C+K+ S P AQLNY
Sbjct  584  GHVNPSRANDPGLIYDIQPNDYIPYLCGLGYNDTQVRAIIRH-KVQCSKESSIPEAQLNY  642

Query  410  PSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYT  231
            PSFSV  G S +  Q R +TNVG A   Y V I AP  V V+VKP KL F     +  YT
Sbjct  643  PSFSVAMGSSALKLQ-RTVTNVGEAKASYIVKISAPQGVDVSVKPRKLDFTQTNQKKTYT  701

Query  230  VTFVSKKGVVTPSNA-AFGSVSWNNAQNQVRSPIA  129
            VTF  K    T S   A G + W +A++ VRSPI+
Sbjct  702  VTFERKDDGKTGSKPFAQGFLEWVSAKHSVRSPIS  736



>ref|XP_004510506.1| PREDICTED: subtilisin-like protease-like isoform X1 [Cicer arietinum]
 ref|XP_004510507.1| PREDICTED: subtilisin-like protease-like isoform X2 [Cicer arietinum]
Length=769

 Score =   126 bits (317),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 69/164 (42%), Positives = 97/164 (59%), Gaps = 9/164 (5%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNI--TCAK--KLSNPAQ  420
            GHVDP++AL+PGLVYD+   DY  FLCS+ Y  ++IQ   + P     C K  KL +P  
Sbjct  602  GHVDPNRALNPGLVYDLNSNDYLSFLCSIGYDAKKIQIFTREPTSFDVCEKREKLVSPGN  661

Query  419  LNYPSFSVLFG-KSRIVRQTRELTNVGA-AGTLYEVAIEAPPSVTVTVKPTKLVFKNVGD  246
            LNYPSFSV+FG  + +V+  R +TNVG     +Y V + +P  V V+V P+KLVF     
Sbjct  662  LNYPSFSVVFGVNNGLVKYKRVVTNVGGYVDAVYTVKVNSPFGVDVSVSPSKLVFSGENK  721

Query  245  RLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQ  114
               + +TF     V    + +FGS+ W++  + VRSPIA  W+ 
Sbjct  722  TQAFEITFAR---VGYGGSQSFGSIEWSDGSHIVRSPIAVRWSN  762



>emb|CDY43568.1| BnaC02g16650D [Brassica napus]
Length=215

 Score =   120 bits (301),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 66/159 (42%), Positives = 100/159 (63%), Gaps = 5/159 (3%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCA-KKLSNPAQLNY  411
            GHV P  A++PGL+YD+   DY  FLC+L+YT  QI+++ +  N TC   K  + A LNY
Sbjct  60   GHVSPTTAINPGLIYDLTTVDYLGFLCALNYTPSQIRSVSRR-NYTCDPSKSYSVADLNY  118

Query  410  PSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPS-VTVTVKPTKLVFKNVGDRLRY  234
            PSF+V    S + + TR +T+VG AG+ Y V + +  + V ++V+P  L FK + ++  Y
Sbjct  119  PSFAVNVDGSGVFKYTRTVTSVGGAGS-YSVKVNSETTEVKISVEPAVLNFKEINEKKSY  177

Query  233  TVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWT  117
            TVTF       + SN +FGS+ W++ ++ V SP+A SWT
Sbjct  178  TVTFTVNSSKASRSN-SFGSIEWSDGKHVVASPVAISWT  215



>gb|EMS49460.1| Subtilisin-like protease SDD1 [Triticum urartu]
Length=815

 Score =   126 bits (317),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 68/155 (44%), Positives = 95/155 (61%), Gaps = 6/155 (4%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVK-APNITCAKKLS-NPAQLN  414
            GHV+P KA+ PGLVY+++ +DY  +LC L+YT QQ+ +I+   P + C K        LN
Sbjct  544  GHVNPKKAMDPGLVYNLSASDYVPYLCGLNYTDQQVNSIIHPEPAVDCTKITKIGEKDLN  603

Query  413  YPSFSVLFGKSRI-VRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLR  237
            YPS +++  K+   V  TR +TNVG A + YE+ +E P SVTV V PTKL FK + + L 
Sbjct  604  YPSITIIIDKADTTVNATRAVTNVGVASSTYEMEVEVPKSVTVEVTPTKLEFKELDEVLN  663

Query  236  YTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPI  132
            YT   VS K    P  A  G + W ++++ VRSPI
Sbjct  664  YT---VSVKAAAVPEGAVEGQLKWVSSKHIVRSPI  695



>ref|XP_010931682.1| PREDICTED: subtilisin-like protease [Elaeis guineensis]
Length=794

 Score =   126 bits (317),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 67/166 (40%), Positives = 97/166 (58%), Gaps = 11/166 (7%)
 Frame = -2

Query  587  GHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYP  408
            GHVDP KA+ PGLVYD+   DY  FLCS +Y++  I  I + P + C+ K+  P  LNYP
Sbjct  630  GHVDPEKAVDPGLVYDLTVDDYLDFLCSSNYSSATIGMIARRP-VNCSNKIGRPWDLNYP  688

Query  407  SFSVLFGKSR------IVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGD  246
            S +V+   S       +VR+T  + NVG     Y V I+ P  V + V+P KLVF+  G 
Sbjct  689  SIAVVLEGSNTRKLEAVVRRT--VRNVGEEKAEYSVGIKEPEGVRLVVEPRKLVFRGKGQ  746

Query  245  RLRYTVTFVSKKGVVTPSNA--AFGSVSWNNAQNQVRSPIAFSWTQ  114
            +  + V   ++   + P N+   FGSV+W++ ++ VRSPIA +W Q
Sbjct  747  KQEFAVKVFTEPKKLLPWNSWTEFGSVTWSDGKHTVRSPIAVTWQQ  792



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 751271412925