BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF028F10

Length=465
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AFY26882.1|  catalase                                                162   3e-47   Ipomoea batatas [batate]
sp|P07145.1|CATA_IPOBA  RecName: Full=Catalase                          162   4e-44   Ipomoea batatas [batate]
gb|ADB03784.1|  catalase                                                162   5e-44   Ipomoea batatas [batate]
gb|AFR42412.1|  catalase                                                132   7e-36   Eperua falcata
gb|AFR42410.1|  catalase                                                130   3e-35   Eperua falcata
ref|XP_009624788.1|  PREDICTED: catalase isozyme 3                      133   1e-33   Nicotiana tomentosiformis
ref|XP_010907090.1|  PREDICTED: catalase isozyme 1-like                 132   4e-33   Elaeis guineensis
emb|CBI29556.3|  unnamed protein product                                123   8e-33   Vitis vinifera
gb|AGC65520.1|  catalase                                                128   6e-32   Eriobotrya japonica [loquat]
ref|XP_006435361.1|  hypothetical protein CICLE_v10000948mg             128   6e-32   Citrus clementina [clementine]
ref|XP_006473789.1|  PREDICTED: catalase-like isoform X1                128   6e-32   Citrus sinensis [apfelsine]
ref|XP_009794469.1|  PREDICTED: catalase isozyme 3                      128   7e-32   Nicotiana sylvestris
emb|CAB56850.1|  catalase                                               127   8e-32   Prunus persica
ref|XP_010061175.1|  PREDICTED: catalase-like                           128   1e-31   Eucalyptus grandis [rose gum]
dbj|BAF91369.1|  catalase                                               127   1e-31   Capsicum annuum
emb|CAD42908.1|  catalase                                               127   1e-31   Prunus persica
ref|XP_007209948.1|  hypothetical protein PRUPE_ppa004776mg             127   1e-31   Prunus persica
ref|XP_009600533.1|  PREDICTED: catalase isozyme 3-like                 127   1e-31   Nicotiana tomentosiformis
ref|XP_011041225.1|  PREDICTED: catalase isozyme 1                      127   1e-31   Populus euphratica
ref|XP_002306976.2|  catalase family protein                            127   1e-31   
ref|XP_007136018.1|  hypothetical protein PHAVU_009G011100g             127   1e-31   Phaseolus vulgaris [French bean]
gb|AGV54297.1|  peroxisomal catalase                                    127   1e-31   Phaseolus vulgaris [French bean]
ref|XP_010061172.1|  PREDICTED: catalase isozyme 3-like                 127   2e-31   Eucalyptus grandis [rose gum]
gb|AAR84578.1|  catalase 1a                                             127   2e-31   Lotus japonicus
ref|XP_008365915.1|  PREDICTED: catalase isozyme 1                      127   2e-31   
ref|XP_008348924.1|  PREDICTED: catalase isozyme 1                      127   2e-31   
gb|KJB57963.1|  hypothetical protein B456_009G187600                    127   2e-31   Gossypium raimondii
gb|AIS20825.1|  CAT                                                     127   2e-31   Pyrus x bretschneideri [bai li]
ref|XP_010061174.1|  PREDICTED: catalase isozyme 3-like isoform X2      127   2e-31   Eucalyptus grandis [rose gum]
gb|KCW68095.1|  hypothetical protein EUGRSUZ_F01777                     127   2e-31   Eucalyptus grandis [rose gum]
ref|XP_008373403.1|  PREDICTED: catalase isozyme 1                      127   2e-31   
gb|AFK46618.1|  unknown                                                 119   3e-31   Lotus japonicus
sp|Q9AXH0.1|CATA_AVIMR  RecName: Full=Catalase                          126   3e-31   Avicennia marina
ref|XP_010918244.1|  PREDICTED: catalase isozyme 1                      126   3e-31   Elaeis guineensis
dbj|BAH20283.1|  AT1G20620                                              120   4e-31   Arabidopsis thaliana [mouse-ear cress]
sp|Q9M5L6.1|CATA_CAPAN  RecName: Full=Catalase; AltName: Full=CaCat1    126   4e-31   Capsicum annuum
sp|P49317.1|CATA3_NICPL  RecName: Full=Catalase isozyme 3               126   5e-31   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|NP_001289779.1|  catalase isozyme 1                                 125   5e-31   Nelumbo nucifera [Indian lotus]
ref|XP_008237987.1|  PREDICTED: catalase isozyme 1                      125   6e-31   Prunus mume [ume]
ref|XP_009773579.1|  PREDICTED: catalase isozyme 3-like                 125   6e-31   Nicotiana sylvestris
ref|XP_008802866.1|  PREDICTED: catalase isozyme 1                      125   7e-31   Phoenix dactylifera
ref|XP_010242894.1|  PREDICTED: catalase isozyme 1-like isoform X1      125   8e-31   Nelumbo nucifera [Indian lotus]
ref|XP_010663966.1|  PREDICTED: catalase isozyme 1                      125   8e-31   Vitis vinifera
gb|AAA57551.1|  catalase                                                124   8e-31   Nicotiana sylvestris
ref|XP_008237989.1|  PREDICTED: catalase isozyme 1-like                 125   9e-31   Prunus mume [ume]
gb|ACJ73905.1|  CAT1                                                    120   1e-30   Solanum nigrum
gb|AIA61608.1|  catalase                                                125   1e-30   Gynostemma pentaphyllum [jiaogulan]
emb|CAA10286.1|  catalase                                               118   1e-30   Cicer arietinum [garbanzo]
ref|XP_009590727.1|  PREDICTED: catalase isozyme 1                      125   1e-30   Nicotiana tomentosiformis
ref|XP_009794245.1|  PREDICTED: catalase isozyme 1                      125   1e-30   Nicotiana sylvestris
ref|XP_009792372.1|  PREDICTED: catalase isozyme 1                      124   1e-30   Nicotiana sylvestris
sp|P49319.2|CATA1_TOBAC  RecName: Full=Catalase isozyme 1; AltNam...    124   1e-30   Nicotiana tabacum [American tobacco]
emb|CCP37650.1|  catalase-1                                             124   2e-30   Nicotiana tabacum [American tobacco]
gb|AFU48609.1|  catalase 1                                              124   2e-30   Nicotiana benthamiana
gb|ACL27272.1|  catalase                                                124   2e-30   Nicotiana benthamiana
ref|XP_008789355.1|  PREDICTED: catalase isozyme 1-like                 124   2e-30   Phoenix dactylifera
ref|XP_003631925.1|  PREDICTED: catalase isozyme 1-like                 124   2e-30   Vitis vinifera
ref|NP_001268098.1|  catalase                                           124   2e-30   Vitis vinifera
ref|XP_007210576.1|  hypothetical protein PRUPE_ppa004763mg             124   2e-30   Prunus persica
emb|CAD42909.1|  catalase                                               124   3e-30   Prunus persica
gb|AGE15298.2|  catalase 1                                              124   3e-30   Eriobotrya japonica [loquat]
gb|AAM97542.1|  catalase 3                                              124   3e-30   Capsicum annuum
sp|P32290.1|CATA_VIGRR  RecName: Full=Catalase                          124   3e-30   Vigna radiata var. radiata [golden gram]
dbj|BAD94702.1|  catalase                                               116   4e-30   Arabidopsis thaliana [mouse-ear cress]
gb|AAB71764.1|  catalase 1                                              123   4e-30   Nicotiana tabacum [American tobacco]
sp|O24339.1|CATA_SOLAP  RecName: Full=Catalase                          123   4e-30   Soldanella alpina
sp|P55311.1|CATA_SOLME  RecName: Full=Catalase                          123   5e-30   Solanum melongena [aubergine]
gb|KJB14249.1|  hypothetical protein B456_002G115900                    122   5e-30   Gossypium raimondii
gb|ADC95629.1|  catalase                                                123   6e-30   Bruguiera gymnorhiza [Burma mangrove]
ref|NP_001237571.1|  catalase-4                                         123   6e-30   Glycine max [soybeans]
ref|XP_002301920.1|  catalase family protein                            122   7e-30   Populus trichocarpa [western balsam poplar]
ref|XP_006828715.1|  hypothetical protein AMTR_s00001p00024160          122   7e-30   Amborella trichopoda
emb|CAI43948.1|  catalase                                               122   7e-30   Populus deltoides
sp|P49316.1|CATA2_NICPL  RecName: Full=Catalase isozyme 2               122   8e-30   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
sp|P49315.1|CATA1_NICPL  RecName: Full=Catalase isozyme 1               122   8e-30   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
gb|ACJ11733.1|  catalase                                                122   9e-30   Gossypium hirsutum [American cotton]
ref|XP_009413057.1|  PREDICTED: catalase isozyme 2-like                 122   1e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011034872.1|  PREDICTED: catalase isozyme 1-like                 122   1e-29   Populus euphratica
gb|ABY19573.1|  catalase                                                119   1e-29   Manihot esculenta [manioc]
gb|AAB88173.1|  catalase                                                120   1e-29   Glycine max [soybeans]
sp|P17598.2|CATA1_GOSHI  RecName: Full=Catalase isozyme 1               122   1e-29   Gossypium hirsutum [American cotton]
gb|AAO17721.1|  catalase                                                122   1e-29   Hypericum perforatum
ref|XP_009400996.1|  PREDICTED: catalase isozyme 2                      122   1e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007160597.1|  hypothetical protein PHAVU_001G001000g             122   1e-29   Phaseolus vulgaris [French bean]
gb|AAX84671.1|  catalase CAT2                                           119   1e-29   Manihot esculenta [manioc]
ref|XP_006382992.1|  hypothetical protein POPTR_0005s10340g             121   2e-29   
ref|XP_002306427.1|  hypothetical protein POPTR_0005s10340g             121   2e-29   Populus trichocarpa [western balsam poplar]
gb|KJB14250.1|  hypothetical protein B456_002G115900                    121   2e-29   Gossypium raimondii
ref|XP_011022153.1|  PREDICTED: catalase-2-like isoform X2              121   2e-29   Populus euphratica
ref|XP_008452956.1|  PREDICTED: catalase isozyme 1                      121   2e-29   Cucumis melo [Oriental melon]
emb|CDP07287.1|  unnamed protein product                                121   2e-29   Coffea canephora [robusta coffee]
ref|XP_011074092.1|  PREDICTED: catalase isozyme 3 isoform X3           121   2e-29   Sesamum indicum [beniseed]
ref|XP_011022275.1|  PREDICTED: catalase-like                           121   2e-29   Populus euphratica
ref|XP_010536470.1|  PREDICTED: catalase-2-like                         121   2e-29   Tarenaya hassleriana [spider flower]
gb|AAB62892.1|  catalase-1                                              121   2e-29   Nicotiana glutinosa
ref|XP_011022152.1|  PREDICTED: catalase-2-like isoform X1              121   2e-29   Populus euphratica
gb|AJE26131.1|  catalase                                                121   2e-29   Salix matsudana [tortured willow]
ref|XP_010530333.1|  PREDICTED: catalase-2                              121   2e-29   Tarenaya hassleriana [spider flower]
ref|NP_001234827.1|  catalase isozyme 1                                 121   2e-29   Solanum lycopersicum
ref|XP_009597278.1|  PREDICTED: catalase isozyme 1                      121   3e-29   Nicotiana tomentosiformis
gb|KHG25152.1|  Catalase isozyme 1                                      121   3e-29   Gossypium arboreum [tree cotton]
ref|XP_011074091.1|  PREDICTED: catalase isozyme 3 isoform X2           121   3e-29   
gb|KGN55499.1|  hypothetical protein Csa_4G658590                       120   3e-29   Cucumis sativus [cucumbers]
gb|ACB11496.1|  catalase                                                120   3e-29   Pinus sylvestris [Scotch pine]
gb|KDP43757.1|  hypothetical protein JCGZ_22384                         120   4e-29   Jatropha curcas
ref|XP_009110221.1|  PREDICTED: catalase-3                              120   4e-29   Brassica rapa
ref|XP_010498496.1|  PREDICTED: catalase-3                              120   5e-29   Camelina sativa [gold-of-pleasure]
gb|AET97564.1|  catalase                                                120   5e-29   Ziziphus jujuba [Chinese jujube]
ref|NP_001031072.3|  catalase 3                                         119   6e-29   Arabidopsis thaliana [mouse-ear cress]
gb|ADZ45555.1|  catalase                                                120   6e-29   Vigna radiata [mung bean]
ref|NP_001240021.1|  catalase                                           120   6e-29   Glycine max [soybeans]
gb|AFR53082.1|  CAT                                                     120   6e-29   Anthurium andraeanum [flamingo-lily]
gb|ADZ45556.1|  catalase                                                120   6e-29   Vigna radiata [mung bean]
ref|XP_007018034.1|  Catalase 2                                         120   6e-29   
gb|AAR14052.2|  catalase                                                120   7e-29   Solanum tuberosum [potatoes]
gb|AAG43363.1|AF151368_1  catalase                                      120   7e-29   Hevea brasiliensis [jebe]
ref|XP_010094556.1|  Catalase isozyme 1                                 120   7e-29   Morus notabilis
gb|ABR15776.1|  catalase                                                117   8e-29   Litchi
gb|KFK44175.1|  hypothetical protein AALP_AA1G224300                    119   8e-29   Arabis alpina [alpine rockcress]
ref|NP_001234186.1|  catalase isozyme 2                                 119   8e-29   
dbj|BAH20307.1|  AT1G20620                                              119   8e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010536468.1|  PREDICTED: catalase-3-like                         119   9e-29   Tarenaya hassleriana [spider flower]
emb|CDY31488.1|  BnaC05g15970D                                          119   9e-29   Brassica napus [oilseed rape]
emb|CDY33636.1|  BnaC08g19360D                                          119   1e-28   Brassica napus [oilseed rape]
ref|XP_009103334.1|  PREDICTED: catalase-3-like                         119   1e-28   Brassica rapa
ref|NP_564120.1|  catalase 3                                            119   1e-28   Arabidopsis thaliana [mouse-ear cress]
emb|CDY29519.1|  BnaA06g14510D                                          119   1e-28   Brassica napus [oilseed rape]
ref|XP_006306495.1|  hypothetical protein CARUB_v10012481mg             119   1e-28   Capsella rubella
gb|AAM65021.1|  unknown                                                 119   1e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011074090.1|  PREDICTED: catalase isoform X1                     119   1e-28   Sesamum indicum [beniseed]
ref|XP_008791900.1|  PREDICTED: catalase isozyme 2                      119   1e-28   Phoenix dactylifera
gb|AAC48918.1|  salicylic acid binding catalase                         119   1e-28   Nicotiana tabacum [American tobacco]
ref|XP_010934843.1|  PREDICTED: catalase isozyme 2                      119   1e-28   
ref|XP_009149539.1|  PREDICTED: catalase-3                              119   1e-28   Brassica rapa
emb|CDY01364.1|  BnaA07g11370D                                          119   1e-28   
gb|AAF19965.1|AF207906_1  catalase 1                                    119   1e-28   Zantedeschia aethiopica [arum-lily]
gb|AHF27428.1|  catalase                                                118   1e-28   Cucurbita moschata [ayote]
emb|CDP01803.1|  unnamed protein product                                119   2e-28   Coffea canephora [robusta coffee]
gb|EYU30275.1|  hypothetical protein MIMGU_mgv1a005250mg                119   2e-28   Erythranthe guttata [common monkey flower]
ref|XP_006340832.1|  PREDICTED: catalase isozyme 2                      119   2e-28   Solanum tuberosum [potatoes]
dbj|BAC79443.1|  catalase                                               119   2e-28   Acacia ampliceps
emb|CAC04509.1|  catalase                                               116   2e-28   Digitalis lanata [Grecian foxglove]
gb|ABC01913.1|  catalase isozyme 1-like protein                         118   2e-28   Solanum tuberosum [potatoes]
sp|P30567.1|CATA2_GOSHI  RecName: Full=Catalase isozyme 2               118   2e-28   Gossypium hirsutum [American cotton]
gb|AFU90822.1|  catalase                                                118   2e-28   Populus tomentosa [Chinese white poplar]
gb|KHG12976.1|  Catalase isozyme 2                                      118   2e-28   Gossypium arboreum [tree cotton]
ref|XP_010523643.1|  PREDICTED: catalase-2-like                         118   2e-28   Tarenaya hassleriana [spider flower]
gb|AHF27430.1|  catalase                                                118   3e-28   Cucurbita moschata [ayote]
ref|XP_004238430.1|  PREDICTED: catalase isozyme 3                      118   3e-28   Solanum lycopersicum
gb|AHF27433.1|  catalase                                                118   3e-28   Cucurbita maxima [Boston marrow]
dbj|BAJ33995.1|  unnamed protein product                                118   3e-28   Eutrema halophilum
gb|AIX10947.1|  putative catalase                                       118   3e-28   Gardenia jasminoides
ref|XP_006412153.1|  hypothetical protein EUTSA_v10024932mg             118   3e-28   Eutrema salsugineum [saltwater cress]
gb|ABK24453.1|  unknown                                                 118   3e-28   Picea sitchensis
gb|AAD30292.1|AF139539_1  catalase 3                                    118   3e-28   Raphanus sativus
gb|AEQ30070.1|  catalase                                                118   4e-28   Litchi chinensis [litchi]
gb|AAD37788.1|AF149283_1  catalase 1                                    117   4e-28   Phaseolus vulgaris [French bean]
emb|CDY17510.1|  BnaC03g65530D                                          117   4e-28   Brassica napus [oilseed rape]
gb|ACV30589.1|  catalase                                                113   4e-28   Carica papaya [mamon]
sp|P48350.1|CATA1_CUCPE  RecName: Full=Catalase isozyme 1               117   4e-28   Cucurbita pepo
pir||S40265  catalase (EC 1.11.1.6) - eggplant                          118   4e-28
sp|P48352.1|CATA3_CUCPE  RecName: Full=Catalase isozyme 3               117   4e-28   Cucurbita pepo
gb|ACJ73906.1|  CAT2                                                    116   4e-28   Solanum nigrum
ref|XP_006828714.1|  hypothetical protein AMTR_s00001p00022550          117   4e-28   Amborella trichopoda
ref|XP_007046520.1|  Catalase 2                                         117   5e-28   Theobroma cacao [chocolate]
ref|XP_010941422.1|  PREDICTED: catalase isozyme B                      117   5e-28   Elaeis guineensis
ref|NP_001237556.1|  catalase-1/2                                       117   5e-28   Glycine max [soybeans]
emb|CDY31878.1|  BnaC07g15280D                                          117   5e-28   Brassica napus [oilseed rape]
gb|AAM97541.1|  catalase 2                                              117   5e-28   Capsicum annuum
ref|XP_004500876.1|  PREDICTED: catalase-4-like isoform X1              117   5e-28   
gb|KFK30147.1|  catalase                                                117   6e-28   Arabis alpina [alpine rockcress]
ref|XP_004500877.1|  PREDICTED: catalase-4-like isoform X2              117   6e-28   Cicer arietinum [garbanzo]
emb|CDX76313.1|  BnaA08g10870D                                          117   6e-28   
gb|AAD30291.2|AF139538_1  catalase 2                                    117   6e-28   Raphanus sativus
ref|NP_001274863.1|  catalase isozyme 1                                 117   6e-28   Solanum tuberosum [potatoes]
gb|AFU90823.1|  catalase                                                117   6e-28   Populus x beijingensis
sp|P49284.1|CATA1_SOLTU  RecName: Full=Catalase isozyme 1               117   7e-28   Solanum tuberosum [potatoes]
gb|ACJ76836.3|  catalase                                                117   7e-28   Dimocarpus longan [longan]
ref|NP_001291326.1|  catalase isozyme 1                                 117   7e-28   Sesamum indicum [beniseed]
ref|XP_002437631.1|  hypothetical protein SORBIDRAFT_10g030840          117   7e-28   
emb|CDX72514.1|  BnaC07g45360D                                          117   7e-28   
gb|AAD17935.1|  catalase                                                117   7e-28   Brassica juncea [brown mustard]
ref|XP_002521709.1|  catalase, putative                                 117   7e-28   Ricinus communis
gb|ACV92695.1|  catalase                                                117   7e-28   Brassica oleracea
ref|XP_009106100.1|  PREDICTED: catalase-2                              117   8e-28   Brassica rapa
ref|XP_002867092.1|  hypothetical protein ARALYDRAFT_491144             117   8e-28   
prf||2104177A  catalase                                                 117   1e-27
gb|AAB86582.2|  catalase                                                116   1e-27   Raphanus sativus
gb|AAF79625.1|AC027665_26  F5M15.5                                      119   1e-27   Arabidopsis thaliana [mouse-ear cress]
gb|AAF71742.1|AF248491_1  catalase                                      116   1e-27   Raphanus sativus
sp|P45739.1|CATA_HELAN  RecName: Full=Catalase                          116   1e-27   Helianthus annuus
emb|CAA64220.1|  catalase                                               116   1e-27   Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ87148.1|  predicted protein                                      115   1e-27   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004300681.1|  PREDICTED: catalase isozyme 1                      116   1e-27   Fragaria vesca subsp. vesca
ref|NP_001235974.1|  catalase-3                                         116   1e-27   Glycine max [soybeans]
ref|XP_006283612.1|  hypothetical protein CARUB_v10004668mg             116   1e-27   Capsella rubella
emb|CDY40645.1|  BnaA03g53180D                                          116   1e-27   Brassica napus [oilseed rape]
gb|AIU99481.1|  catalase                                                116   1e-27   Saccharum spontaneum [fodder cane]
ref|XP_009138342.1|  PREDICTED: catalase-2                              116   1e-27   Brassica rapa
gb|AIU99480.1|  catalase                                                116   1e-27   Saccharum spontaneum [fodder cane]
emb|CDP07288.1|  unnamed protein product                                116   1e-27   Coffea canephora [robusta coffee]
sp|P55312.1|CATA2_SOLTU  RecName: Full=Catalase isozyme 2               116   1e-27   Solanum tuberosum [potatoes]
emb|CAA45564.1|  catalase                                               116   1e-27   Arabidopsis thaliana [mouse-ear cress]
emb|CAA85470.1|  catalase                                               116   1e-27   Solanum tuberosum [potatoes]
gb|AAR97905.1|  catalase                                                116   1e-27   Solanum tuberosum [potatoes]
gb|AIM43584.1|  catalase                                                116   1e-27   Saccharum hybrid cultivar Yacheng05-179
gb|AIU99485.1|  catalase                                                116   1e-27   Saccharum spontaneum [fodder cane]
ref|XP_010534184.1|  PREDICTED: catalase isozyme 3-like                 116   1e-27   Tarenaya hassleriana [spider flower]
gb|AAK96854.1|  catalase                                                116   1e-27   Arabidopsis thaliana [mouse-ear cress]
gb|AIU99484.1|  catalase                                                116   1e-27   Saccharum arundinaceum
prf||1906388A  catalase                                                 116   2e-27
gb|AIU99488.1|  catalase                                                116   2e-27   Saccharum hybrid cultivar ROC22
ref|XP_010692544.1|  PREDICTED: catalase-like                           116   2e-27   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_195235.1|  catalase 2                                            116   2e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006656514.1|  PREDICTED: catalase isozyme B-like                 116   2e-27   Oryza brachyantha
gb|AFW69584.1|  catalase1                                               115   2e-27   
gb|AAD17936.1|  catalase                                                115   2e-27   Brassica juncea [brown mustard]
sp|Q01297.2|CATA1_RICCO  RecName: Full=Catalase isozyme 1               115   2e-27   Ricinus communis
gb|AAC49807.1|  catalase 3                                              115   2e-27   Arabidopsis thaliana [mouse-ear cress]
gb|ACL35349.1|  catalase                                                115   2e-27   Picea glauca
gb|AIU99479.1|  catalase                                                115   2e-27   Saccharum arundinaceum
gb|ADU56198.1|  catalase                                                115   2e-27   Musa acuminata AAA Group [Cavendish banana]
gb|ABM47415.1|  catalase                                                115   2e-27   Prunus avium [gean]
gb|AAD50974.1|AF170272_1  catalase CAT1                                 115   2e-27   Manihot esculenta [manioc]
ref|XP_002890395.1|  F5M15.5                                            118   2e-27   
gb|AHF21552.1|  catalase                                                115   2e-27   Hylocereus undatus [dragon fruit]
sp|A2YH64.2|CATA2_ORYSI  RecName: Full=Catalase isozyme B; Short=...    115   3e-27   Oryza sativa Indica Group [Indian rice]
gb|AAY59707.1|  catalase                                                115   3e-27   Oryza sativa Indica Group [Indian rice]
gb|AAC17729.1|  catalase 1                                              114   3e-27   Hordeum vulgare subsp. vulgare [two-rowed barley]
sp|P55307.1|CATA1_HORVU  RecName: Full=Catalase isozyme 1               115   3e-27   Hordeum vulgare [barley]
gb|ADU56199.1|  catalase                                                115   4e-27   Hevea brasiliensis [jebe]
ref|NP_001241808.1|  catalase isozyme B                                 115   4e-27   Zea mays [maize]
emb|CDY52649.1|  BnaAnng11640D                                          114   4e-27   Brassica napus [oilseed rape]
emb|CAA42720.1|  catalase-1                                             115   4e-27   Zea mays [maize]
gb|KGN55500.1|  hypothetical protein Csa_4G658600                       114   4e-27   Cucumis sativus [cucumbers]
ref|XP_006342134.1|  PREDICTED: catalase isozyme 3-like                 115   4e-27   Solanum tuberosum [potatoes]
gb|AIU99482.1|  catalase                                                115   5e-27   Saccharum hybrid cultivar ROC22
gb|KJB17473.1|  hypothetical protein B456_003G002800                    115   5e-27   Gossypium raimondii
ref|XP_006473794.1|  PREDICTED: catalase isozyme 1-like isoform X4      115   5e-27   Citrus sinensis [apfelsine]
ref|XP_009392261.1|  PREDICTED: catalase isozyme A-like isoform X2      115   5e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006435363.1|  hypothetical protein CICLE_v10000951mg             115   5e-27   Citrus clementina [clementine]
emb|CAG23920.1|  catalase                                               115   5e-27   Festuca arundinacea [tall fescue]
ref|XP_008452957.1|  PREDICTED: catalase isozyme 1-like                 114   5e-27   Cucumis melo [Oriental melon]
ref|XP_008464839.1|  PREDICTED: catalase isozyme 3                      114   6e-27   Cucumis melo [Oriental melon]
ref|XP_006473791.1|  PREDICTED: catalase isozyme 1-like isoform X1      114   6e-27   
ref|XP_010437527.1|  PREDICTED: catalase-2                              114   7e-27   Camelina sativa [gold-of-pleasure]
gb|AFN81243.1|  catalase 1                                              114   7e-27   Brassica rapa subsp. pekinensis [bai cai]
ref|XP_010432341.1|  PREDICTED: catalase-2-like                         114   7e-27   Camelina sativa [gold-of-pleasure]
ref|XP_004144240.1|  PREDICTED: catalase isozyme 3-like                 114   7e-27   
dbj|BAA34204.1|  catalase                                               114   8e-27   Oryza sativa Japonica Group [Japonica rice]
dbj|BAA05494.1|  catalase                                               114   8e-27   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001058635.1|  Os06g0727200                                       114   8e-27   
ref|XP_004158284.1|  PREDICTED: catalase isozyme 3-like                 114   8e-27   
gb|ADM96039.1|  catalase                                                114   8e-27   Cucumis sativus [cucumbers]
gb|AAL00886.1|  catalase                                                112   1e-26   Suaeda salsa
ref|XP_003563243.1|  PREDICTED: catalase isozyme 1                      114   1e-26   Brachypodium distachyon [annual false brome]
gb|AHF27429.1|  catalase                                                113   1e-26   Cucurbita moschata [ayote]
sp|Q43206.1|CATA1_WHEAT  RecName: Full=Catalase-1                       113   1e-26   Triticum aestivum [Canadian hard winter wheat]
sp|P48351.1|CATA2_CUCPE  RecName: Full=Catalase isozyme 2               113   1e-26   Cucurbita pepo
gb|AHF27432.1|  catalase                                                113   1e-26   Cucurbita maxima [Boston marrow]
gb|AAG61140.2|AF332973_1  catalase 2                                    113   2e-26   Zantedeschia aethiopica [arum-lily]
ref|XP_003558892.1|  PREDICTED: catalase-1                              113   2e-26   Brachypodium distachyon [annual false brome]
gb|EMT05040.1|  Catalase-1                                              114   2e-26   
ref|XP_002510677.1|  catalase, putative                                 115   2e-26   
sp|P49318.1|CATA2_RICCO  RecName: Full=Catalase isozyme 2               113   2e-26   Ricinus communis
gb|AIU99486.1|  catalase                                                113   2e-26   Saccharum spontaneum [fodder cane]
ref|XP_004145541.1|  PREDICTED: catalase isozyme 1-like                 115   2e-26   
emb|CDX69111.1|  BnaC01g03420D                                          113   2e-26   
sp|P55313.1|CATA2_WHEAT  RecName: Full=Catalase                         113   2e-26   Triticum aestivum [Canadian hard winter wheat]
gb|AAC19398.1|  root catalase                                           113   2e-26   Mesembryanthemum crystallinum
ref|NP_001105415.1|  catalase isozyme 1                                 113   2e-26   
dbj|BAA34714.1|  catalase                                               112   3e-26   Oryza sativa [red rice]
ref|NP_001048861.1|  Os03g0131200                                       112   3e-26   
dbj|BAJ88747.1|  predicted protein                                      113   3e-26   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAA34205.1|  catalase                                               112   3e-26   Oryza sativa Japonica Group [Japonica rice]
gb|ACJ22771.1|  catalase 1                                              112   3e-26   Jatropha curcas
ref|XP_010446982.1|  PREDICTED: catalase-2-like                         112   3e-26   Camelina sativa [gold-of-pleasure]
gb|AIU99487.1|  catalase                                                112   3e-26   Saccharum hybrid cultivar ROC22
gb|KEH36312.1|  catalase heme-binding enzyme                            112   4e-26   Medicago truncatula
gb|AAC19397.1|  leaf catalase                                           112   4e-26   
gb|AIU99483.1|  catalase                                                112   4e-26   
gb|ACA50528.1|  putative catalase 2                                     112   4e-26   
ref|XP_009108683.1|  PREDICTED: catalase-2-like isoform X2              112   5e-26   
emb|CDP01802.1|  unnamed protein product                                112   5e-26   
dbj|BAQ21275.1|  catalase                                               112   5e-26   
dbj|BAJ90861.1|  predicted protein                                      111   7e-26   
gb|AAD17933.1|  catalase                                                111   1e-25   
gb|AIZ77475.1|  catalase                                                111   1e-25   
gb|ABV55108.1|  catalase 2                                              110   1e-25   
sp|P25890.1|CATA_PEA  RecName: Full=Catalase                            110   2e-25   
ref|XP_009398521.1|  PREDICTED: catalase isozyme A                      110   2e-25   
dbj|BAH37035.1|  catalase 1                                             110   2e-25   
gb|EPS69543.1|  catalase                                                110   2e-25   
gb|ABB72796.1|  catalase isozyme 1-like protein                         110   2e-25   
gb|ABQ44283.1|  catalase                                                108   3e-25   
gb|EYU36566.1|  hypothetical protein MIMGU_mgv1a005245mg                110   3e-25   
gb|AFD29285.1|  catalase                                                110   3e-25   
gb|ADK25939.1|  catalase                                                107   4e-25   
gb|AHA50082.1|  catalase                                                109   5e-25   
ref|XP_004985840.1|  PREDICTED: catalase-1-like                         109   5e-25   
ref|XP_006649332.1|  PREDICTED: catalase-1-like                         109   6e-25   
ref|XP_004966515.1|  PREDICTED: catalase isozyme 1-like                 109   6e-25   
sp|P18122.1|CATA1_MAIZE  RecName: Full=Catalase isozyme 1               108   7e-25   
ref|XP_010063132.1|  PREDICTED: LOW QUALITY PROTEIN: catalase iso...    108   8e-25   
gb|ADN94253.1|  catalase                                                108   1e-24   
ref|XP_010061173.1|  PREDICTED: catalase isozyme 2-like isoform X1      108   1e-24   
gb|AAK67359.2|AF390210_1  catalase                                      108   1e-24   
ref|XP_010692546.1|  PREDICTED: catalase                                108   2e-24   
gb|AAZ29552.1|  catalase-C                                              108   2e-24   
gb|AHB72694.1|  catalase                                                107   2e-24   
ref|NP_001031073.1|  catalase 3                                         107   3e-24   
gb|KDO85095.1|  hypothetical protein CISIN_1g044386mg                   108   3e-24   
gb|AAF61732.1|AF243517_1  catalase 2                                    107   4e-24   
gb|ABY21704.1|  catalase-1 precursor                                    107   4e-24   
gb|KHG21219.1|  Catalase isozyme 1                                      105   8e-24   
gb|ACH63223.1|  catalase                                                106   8e-24   
gb|AIP93616.1|  CAT1                                                    106   9e-24   
emb|CDY01363.1|  BnaA07g11360D                                          105   1e-23   
gb|AAC17731.1|  catalase 1                                              105   2e-23   
ref|NP_564121.1|  catalase 1                                            105   2e-23   
gb|ACN36234.1|  unknown                                                 103   2e-23   
gb|AAB07026.1|  catalase 1                                              105   2e-23   
emb|CAE82295.1|  catalase                                               104   2e-23   
ref|XP_009103333.1|  PREDICTED: catalase-1                              104   3e-23   
emb|CDY31877.1|  BnaC07g15270D                                          104   3e-23   
tpg|DAA43177.1|  TPA: catalase2                                         103   5e-23   
ref|XP_006412154.1|  hypothetical protein EUTSA_v10024932mg             104   6e-23   
sp|P12365.3|CATA2_MAIZE  RecName: Full=Catalase isozyme 2               103   7e-23   
prf||1803522A  catalase                                                 103   8e-23
ref|NP_001105310.1|  catalase isozyme 2                                 103   1e-22   
gb|ABY68159.1|  catalase                                              97.8    1e-22   
ref|XP_008365914.1|  PREDICTED: catalase isozyme 3-like               97.4    1e-22   
gb|ABY68162.1|  catalase                                              97.8    1e-22   
gb|AAF61733.1|AF243518_1  catalase 3                                    102   1e-22   
ref|XP_002963086.1|  hypothetical protein SELMODRAFT_438313             102   2e-22   
gb|AFI48068.1|  catalase isozyme B                                    97.1    2e-22   
gb|ABY68160.1|  catalase                                              97.1    2e-22   
gb|AFI48131.1|  catalase isozyme B                                    97.1    2e-22   
gb|AFI48101.1|  catalase isozyme B                                    97.1    2e-22   
gb|ABY68158.1|  catalase                                              97.1    2e-22   
gb|AFI48111.1|  catalase isozyme B                                    97.1    2e-22   
ref|XP_008348923.1|  PREDICTED: catalase isozyme 3-like               96.3    3e-22   
tpg|DAA43178.1|  TPA: catalase2                                         102   3e-22   
ref|XP_006416378.1|  hypothetical protein EUTSA_v10007472mg             102   3e-22   
ref|XP_006382986.1|  hypothetical protein POPTR_0005s10340g             102   3e-22   
gb|AFI48098.1|  catalase isozyme B                                    95.9    5e-22   
gb|AFI48054.1|  catalase isozyme B                                    95.5    7e-22   
gb|AJF34884.1|  catalase                                                100   7e-22   
gb|ABS72010.1|  putative catalase                                     94.4    8e-22   
gb|ABY68161.1|  catalase                                              95.5    9e-22   
ref|XP_002980247.1|  hypothetical protein SELMODRAFT_178171             100   9e-22   
gb|KFK44176.1|  hypothetical protein AALP_AA1G224400                    100   9e-22   
ref|XP_010105996.1|  Catalase isozyme 1                               99.4    1e-21   
gb|ABY68163.1|  catalase                                              94.4    2e-21   
gb|AFI48130.1|  catalase isozyme B                                    94.4    2e-21   
ref|XP_010498497.1|  PREDICTED: catalase-1-like                       99.8    2e-21   
ref|XP_003573241.1|  PREDICTED: catalase isozyme 2                    99.8    2e-21   
emb|CAA42026.1|  catalase                                             93.2    2e-21   
gb|AAF61734.1|AF243519_1  catalase 4                                  99.4    2e-21   
dbj|BAD07937.1|  catalase catA-like protein                           94.7    3e-21   
dbj|BAH56915.1|  AT1G20620                                            99.0    3e-21   
ref|XP_002961779.1|  hypothetical protein SELMODRAFT_140901           99.0    4e-21   
ref|XP_009108684.1|  PREDICTED: catalase-2-like isoform X3            98.6    4e-21   
ref|XP_008778560.1|  PREDICTED: catalase isozyme 2-like               98.2    7e-21   
ref|XP_008812256.1|  PREDICTED: catalase isozyme B                    97.8    9e-21   
gb|ABY68164.1|  catalase                                              92.4    1e-20   
gb|EMS61345.1|  Catalase isozyme 1                                    98.2    1e-20   
gb|AGI65617.1|  catalase                                              97.1    2e-20   
gb|AAX88799.1|  catalase                                              97.1    2e-20   
dbj|BAH19523.1|  AT4G35090                                            96.7    2e-20   
ref|NP_001031791.1|  catalase 2                                       96.7    2e-20   
ref|XP_010477308.1|  PREDICTED: catalase-1                            96.7    2e-20   
ref|XP_010459749.1|  PREDICTED: catalase-1-like                       96.3    4e-20   
ref|XP_009149540.1|  PREDICTED: catalase-1                            95.5    7e-20   
emb|CDY29518.1|  BnaA06g14520D                                        95.1    7e-20   
emb|CDY31490.1|  BnaC05g15990D                                        95.1    8e-20   
dbj|BAJ92414.1|  predicted protein                                    95.1    9e-20   
gb|AAC17730.1|  catalase 2                                            93.2    2e-19   
gb|ADY02963.1|  catalase                                              94.0    2e-19   
emb|CAH61266.1|  catalase                                             94.0    2e-19   
gb|EMS51034.1|  Catalase isozyme 2                                    94.0    2e-19   
gb|ACL81498.1|  catalase                                              93.6    3e-19   
gb|EAZ21490.1|  hypothetical protein OsJ_05114                        93.6    3e-19   
sp|P55308.1|CATA2_HORVU  RecName: Full=Catalase isozyme 2             93.6    4e-19   
ref|XP_001779509.1|  predicted protein                                93.2    4e-19   
ref|NP_001045673.1|  Os02g0115700                                     93.2    4e-19   
gb|ABN71233.2|  catalase                                              92.4    8e-19   
gb|EMT06167.1|  Catalase isozyme 2                                    92.0    2e-18   
gb|ABK24449.1|  unknown                                               90.9    3e-18   
ref|XP_001784759.1|  predicted protein                                89.7    7e-18   
gb|ADQ28492.1|  catalase                                              89.4    1e-17   
ref|XP_004952158.1|  PREDICTED: catalase isozyme 3-like isoform X2    88.6    2e-17   
gb|KCW70315.1|  hypothetical protein EUGRSUZ_F03557                   88.2    3e-17   
gb|AID50071.1|  catalase                                              83.2    4e-17   
emb|CDY43951.1|  BnaC04g21590D                                        84.7    4e-17   
ref|XP_001752315.1|  predicted protein                                87.0    7e-17   
ref|XP_005645077.1|  catalase                                         86.7    1e-16   
gb|ABR16304.1|  unknown                                               85.5    2e-16   
gb|ABK24543.1|  unknown                                               85.5    3e-16   
emb|CDY31866.1|  BnaC07g15160D                                        82.0    3e-16   
sp|P55310.1|CATA_SECCE  RecName: Full=Catalase                        85.1    4e-16   
ref|XP_002453177.1|  hypothetical protein SORBIDRAFT_04g001130        84.3    5e-16   
ref|XP_006646781.1|  PREDICTED: LOW QUALITY PROTEIN: catalase iso...  84.0    8e-16   
emb|CAA43814.1|  catalase                                             83.2    2e-15   
pir||CSRZ  catalase (EC 1.11.1.6) catA - rice                         83.2    2e-15
gb|AGT16203.1|  catalase                                              82.8    2e-15   
ref|XP_002963084.1|  hypothetical protein SELMODRAFT_404656           79.3    2e-15   
gb|AII23739.1|  catalase                                              82.0    3e-15   
ref|XP_002980252.1|  hypothetical protein SELMODRAFT_112333           77.8    3e-15   
gb|ABK41476.1|  catalase                                              80.5    1e-14   
gb|KIY96954.1|  catalase                                              76.6    9e-14   
gb|ABR25882.1|  catalase isozyme b                                    72.0    2e-13   
ref|XP_005847557.1|  hypothetical protein CHLNCDRAFT_57817            75.9    5e-13   
gb|AFW66785.1|  catalase3 isoform 1                                   76.3    5e-13   
sp|P18123.2|CATA3_MAIZE  RecName: Full=Catalase isozyme 3             75.1    9e-13   
gb|AFW66787.1|  catalase3                                             75.1    9e-13   
gb|AHZ13843.1|  catalase                                              74.3    2e-12   
gb|AGT16188.1|  catalase                                              74.3    2e-12   
gb|AGT15888.1|  catalase                                              74.3    2e-12   
gb|AGT16310.1|  catalase                                              74.3    2e-12   
gb|AGT16054.1|  catalase                                              74.3    2e-12   
gb|AAY34915.1|  catalase                                              67.8    4e-12   
ref|XP_011396830.1|  Catalase isozyme 2                               72.4    7e-12   
gb|AFN85536.1|  catalase                                              67.4    8e-12   
ref|XP_002950455.1|  catalase                                         72.0    1e-11   
gb|EMS35721.1|  Catalase isozyme 1                                    68.6    4e-11   
ref|XP_004952157.1|  PREDICTED: catalase isozyme 3-like isoform X1    70.5    4e-11   
ref|XP_006382990.1|  hypothetical protein POPTR_0005s10340g           69.7    5e-11   
ref|XP_001696763.1|  catalase/peroxidase                              69.3    8e-11   
gb|KJB10391.1|  hypothetical protein B456_001G198700                  69.3    8e-11   
emb|CAA73663.1|  catalase                                             69.3    8e-11   
ref|NP_001105416.1|  catalase isozyme 3                               69.3    9e-11   
gb|AAR84577.1|  catalase 1b                                           68.6    1e-10   
gb|AAA33441.1|  catalase isozyme 3 (EC 1.11.1.6)                      68.9    1e-10   
gb|AEY70510.1|  catalase                                              66.6    2e-10   
ref|XP_009108682.1|  PREDICTED: catalase-2-like isoform X1            67.4    4e-10   
gb|AAB70006.1|  catalase                                              67.4    4e-10   
pir||A55092  catalase (EC 1.11.1.6) CAT-2 - maize (fragment)          66.6    6e-10
gb|AFW66789.1|  catalase3                                             63.5    3e-09   
gb|AFW66788.1|  catalase3                                             63.9    5e-09   
ref|XP_005708279.1|  catalase                                         63.5    7e-09   
gb|ABB88582.1|  catalase                                              63.5    8e-09   
ref|XP_009392260.1|  PREDICTED: catalase isozyme A-like isoform X1    63.2    1e-08   
gb|AGS17821.1|  catalase 2                                            56.2    1e-08   
emb|CCQ26769.2|  perixode catalase                                    57.0    4e-08   
gb|KCW70319.1|  hypothetical protein EUGRSUZ_F03561                   60.5    4e-08   
gb|KJB17474.1|  hypothetical protein B456_003G002800                  60.8    5e-08   
ref|XP_006306503.1|  hypothetical protein CARUB_v10012491mg           55.1    1e-06   
gb|KDD77132.1|  catalase                                              56.6    1e-06   
ref|XP_002963082.1|  hypothetical protein SELMODRAFT_79329            52.0    3e-06   
ref|XP_005712277.1|  unnamed protein product                          55.5    3e-06   
ref|XP_002980255.1|  hypothetical protein SELMODRAFT_112561           50.1    9e-06   
gb|AAO16182.1|  catalase-1                                            50.8    1e-05   
ref|XP_005536240.1|  catalase                                         51.6    6e-05   
gb|AAP57673.1|  catalase                                              50.1    1e-04   
ref|XP_004366029.2|  catalase isozyme 2                               50.1    2e-04   
gb|KJE89728.1|  catalase isozyme 2                                    49.7    2e-04   



>gb|AFY26882.1| catalase, partial [Ipomoea batatas]
Length=173

 Score =   162 bits (411),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 84/107 (79%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEVD FP K DNT  AERFP PLRIVTG+RDKCVIEKE  FKQ GDR RS APDRQDR
Sbjct  67   RDEEVDYFPSKFDNTRNAERFPTPLRIVTGQRDKCVIEKENNFKQPGDRYRSWAPDRQDR  126

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FINRWVK+L EPRV  EI ST ISYL Q DR  G KVAS LNIRP M
Sbjct  127  FINRWVKALSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  173



>sp|P07145.1|CATA_IPOBA RecName: Full=Catalase [Ipomoea batatas]
 emb|CAA29063.1| unnamed protein product [Ipomoea batatas]
Length=492

 Score =   162 bits (410),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 84/107 (79%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEVD FP K DNT  AERFP PLRIVTG+RDKCVIEKE  FKQ GDR RS APDRQDR
Sbjct  386  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGQRDKCVIEKENNFKQPGDRYRSWAPDRQDR  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FINRWVK+L EPRV  EI ST ISYL Q DR  G KVAS LNIRP M
Sbjct  446  FINRWVKALSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  492



>gb|ADB03784.1| catalase [Ipomoea batatas]
Length=492

 Score =   162 bits (409),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 84/107 (79%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEVD FP K DNT  AERFP PLRIVTG+RDKCVIEKE  FKQ GDR RS APDRQDR
Sbjct  386  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGQRDKCVIEKENNFKQPGDRYRSWAPDRQDR  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FINRWVK+L EPRV  EI ST ISYL Q DR  G KVAS LNIRP M
Sbjct  446  FINRWVKALSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  492



>gb|AFR42412.1| catalase, partial [Eperua falcata]
Length=131

 Score =   132 bits (331),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 77/107 (72%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEE+D FP + D    AERFP P  IVTG+R++C+IEKE  FKQ G+R RS APDRQDR
Sbjct  25   RDEEIDYFPSRFDPVRHAERFPIPPAIVTGKRERCIIEKENDFKQPGERYRSWAPDRQDR  84

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            F+ RWV+ L +PRV  EI S  ISYL Q DR  G KVAS LN+RP +
Sbjct  85   FVRRWVEVLADPRVTHEIRSIWISYLSQADRSLGQKVASHLNMRPSI  131



>gb|AFR42410.1| catalase, partial [Eperua falcata]
Length=135

 Score =   130 bits (327),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/107 (60%), Positives = 77/107 (72%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEE+D FP + D    A+RFP P  IVTG+R++C+IEKE  FKQ G+R RS APDRQDR
Sbjct  29   RDEEIDYFPSRFDPVRHAKRFPIPPAIVTGKRERCIIEKENDFKQPGERYRSWAPDRQDR  88

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            F+ RWV+ L +PRV  EI S  ISYL Q DR  G KVAS LN+RP +
Sbjct  89   FVRRWVEVLADPRVTHEIRSIWISYLSQADRSLGQKVASHLNMRPSI  135



>ref|XP_009624788.1| PREDICTED: catalase isozyme 3 [Nicotiana tomentosiformis]
Length=492

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 78/107 (73%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AE++P PLR++TG+RDKC++EKE  FKQ G+R RS APDRQ+R
Sbjct  386  RDEEVNYFPSRFDPCRHAEQYPIPLRVLTGKRDKCIVEKENNFKQPGERYRSWAPDRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RWV +L +PRV  EI S  ISY  Q D+  G K+AS LNIRP M
Sbjct  446  FICRWVDALSDPRVTHEIRSIWISYWSQADKSLGQKIASRLNIRPTM  492



>ref|XP_010907090.1| PREDICTED: catalase isozyme 1-like [Elaeis guineensis]
Length=492

 Score =   132 bits (331),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 77/107 (72%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AERFP P RI+TGRR+KCVI KE  FKQ G+R RS APDRQ+R
Sbjct  386  RDEEVNYFPSRYDPVRHAERFPIPFRILTGRREKCVIHKENNFKQPGERYRSWAPDRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RWV++L +PRV  EI +  ISY  Q DR  G K+A+ LN++P M
Sbjct  446  FICRWVEALSDPRVTYEIRTIWISYWSQCDRSLGQKIATRLNVKPSM  492



>emb|CBI29556.3| unnamed protein product [Vitis vinifera]
 emb|CBI37653.3| unnamed protein product [Vitis vinifera]
Length=112

 Score =   123 bits (309),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 73/105 (70%), Gaps = 0/105 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEVD FP + D    AE FP P  I  G+R+K VIEKE  FKQ G+R RS APDRQ+R
Sbjct  6    RDEEVDYFPSRFDPVRHAETFPIPSTICHGKREKVVIEKENNFKQPGERYRSFAPDRQER  65

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRP  148
            FINRWV++L +PRV  EI S  ISY  Q DR  G K+AS LN++P
Sbjct  66   FINRWVETLSDPRVTYEIRSIWISYWSQADRSLGQKLASRLNVKP  110



>gb|AGC65520.1| catalase [Eriobotrya japonica]
 gb|AGC65522.1| catalase [Eriobotrya japonica]
 gb|AGC65523.1| catalase [Eriobotrya japonica]
 gb|AGC65524.1| catalase [Eriobotrya japonica]
 gb|AGE15297.2| catalase 2 [Eriobotrya japonica]
Length=492

 Score =   128 bits (322),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 74/107 (69%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEVD FP +      AE FP P  I+TG+RDKCVIEKE  FKQ G+R RS APDRQ+R
Sbjct  386  RDEEVDYFPSRYQPARHAETFPIPSNIITGKRDKCVIEKENNFKQPGERYRSWAPDRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            F++RWV  L EPRV  EI S  ISY  Q DR  G K+A+ LN+RP +
Sbjct  446  FLHRWVDVLSEPRVTYEIRSIWISYWSQADRSFGQKLATRLNVRPSI  492



>ref|XP_006435361.1| hypothetical protein CICLE_v10000948mg [Citrus clementina]
 ref|XP_006473790.1| PREDICTED: catalase-like isoform X2 [Citrus sinensis]
 gb|ESR48601.1| hypothetical protein CICLE_v10000948mg [Citrus clementina]
Length=493

 Score =   128 bits (322),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 77/107 (72%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEVD FP + D T  AER+P P  ++TGRR+K  IEKE  FKQ G+R RS APDRQ+R
Sbjct  387  RDEEVDYFPSRYDPTRHAERYPIPSDVITGRREKACIEKENNFKQPGERYRSWAPDRQER  446

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            F+NRW+K+L +PRV  E+ S  +SY  Q DR  G K+AS LN+RP +
Sbjct  447  FLNRWIKALCDPRVTHEVRSIWVSYWSQADRSLGQKLASRLNVRPSI  493



>ref|XP_006473789.1| PREDICTED: catalase-like isoform X1 [Citrus sinensis]
Length=477

 Score =   128 bits (322),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 77/107 (72%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEVD FP + D T  AER+P P  ++TGRR+K  IEKE  FKQ G+R RS APDRQ+R
Sbjct  371  RDEEVDYFPSRYDPTRHAERYPIPSDVITGRREKACIEKENNFKQPGERYRSWAPDRQER  430

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            F+NRW+K+L +PRV  E+ S  +SY  Q DR  G K+AS LN+RP +
Sbjct  431  FLNRWIKALCDPRVTHEVRSIWVSYWSQADRSLGQKLASRLNVRPSI  477



>ref|XP_009794469.1| PREDICTED: catalase isozyme 3 [Nicotiana sylvestris]
 emb|CCP37652.1| catalase-3 [Nicotiana tabacum]
Length=492

 Score =   128 bits (322),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 76/107 (71%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AE+ P P R++TG+RDKC+IEKE  FKQ G+R RS APDRQ+R
Sbjct  386  RDEEVNYFPSRFDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWAPDRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RWV +L +PRV  EI S  ISY  Q D+  G K+AS LN+RP M
Sbjct  446  FICRWVDALSDPRVTHEIRSIWISYWSQADKTLGQKIASRLNVRPTM  492



>emb|CAB56850.1| catalase [Prunus persica]
Length=423

 Score =   127 bits (320),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 77/107 (72%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AER+P P  I++G+R+KCVIEKE  FKQ G+R RS APDRQ+R
Sbjct  317  RDEEVNYFPSRHDPVRHAERYPIPSNILSGKREKCVIEKENNFKQPGERYRSWAPDRQER  376

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI+RWV +L +PRV  EI S  ISY  Q D+  G K+AS LN+RP +
Sbjct  377  FIHRWVDALSDPRVTHEIRSVWISYWSQADKSLGQKLASRLNVRPSI  423



>ref|XP_010061175.1| PREDICTED: catalase-like [Eucalyptus grandis]
Length=492

 Score =   128 bits (321),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 77/107 (72%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D+   AE+FP P  ++ G+RD+C+IEKE  FKQ G+R RS APDRQ+R
Sbjct  386  RDEEVNYFPSRFDSVRHAEKFPIPPPVLNGKRDRCMIEKENNFKQPGERYRSWAPDRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RWV++L +PRV  EI S  ISY  Q D+  G K+AS LN+RP M
Sbjct  446  FIGRWVEALSDPRVTQEIRSIWISYWTQADKSLGQKIASCLNVRPSM  492



>dbj|BAF91369.1| catalase [Capsicum annuum]
Length=492

 Score =   127 bits (320),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 76/107 (71%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEVD  P + D    AE++P P  ++TGRR+KCVI KE  FKQ G+R RS APDRQDR
Sbjct  386  RDEEVDYLPSRFDPCRPAEQYPIPSCVLTGRREKCVIPKENNFKQAGERYRSWAPDRQDR  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            +IN+WV+SL +PRV  EI S  ISYL Q D+  G KVAS L ++P M
Sbjct  446  YINKWVESLSDPRVTHEIRSIWISYLSQADKSCGQKVASRLTVKPTM  492



>emb|CAD42908.1| catalase [Prunus persica]
Length=492

 Score =   127 bits (320),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 77/107 (72%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AERFP P  I++G+R+KC+IEKE  FKQ G+R RS APDRQ+R
Sbjct  386  RDEEVNYFPSRYDPVRHAERFPIPPNILSGKREKCIIEKENNFKQPGERYRSWAPDRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI+RWV +L +PRV  EI S  ISY  Q D+  G K+AS LN+RP +
Sbjct  446  FIHRWVDALSDPRVTHEIRSVWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_007209948.1| hypothetical protein PRUPE_ppa004776mg [Prunus persica]
 gb|EMJ11147.1| hypothetical protein PRUPE_ppa004776mg [Prunus persica]
Length=492

 Score =   127 bits (320),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 77/107 (72%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AERFP P  I++G+R+KC+IEKE  FKQ G+R RS APDRQ+R
Sbjct  386  RDEEVNYFPSRYDPVRHAERFPIPPNILSGKREKCIIEKENNFKQPGERYRSWAPDRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI+RWV +L +PRV  EI S  ISY  Q D+  G K+AS LN+RP +
Sbjct  446  FIHRWVDALSDPRVTHEIRSVWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_009600533.1| PREDICTED: catalase isozyme 3-like [Nicotiana tomentosiformis]
Length=492

 Score =   127 bits (320),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 77/107 (72%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AE++P P RI+TG+RD+C+IEKE  FKQ G+R RS +PDRQ+R
Sbjct  386  RDEEVNYFPSRFDPCRHAEQYPIPPRILTGKRDRCIIEKENNFKQPGERYRSWSPDRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RW+ +L +PRV  EI +  ISY  Q D+  G K+AS LN+RP M
Sbjct  446  FICRWINALSDPRVTHEIHTIWISYWSQADKSLGEKIASRLNVRPTM  492



>ref|XP_011041225.1| PREDICTED: catalase isozyme 1 [Populus euphratica]
Length=492

 Score =   127 bits (320),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 76/107 (71%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D +  AERFP P  + +GRR+KC+IEKE  FKQ G+R RS APDRQ+R
Sbjct  386  RDEEVNYFPSRHDPSRHAERFPIPSAVCSGRREKCIIEKENNFKQPGERYRSWAPDRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            F+ RWV +L EPRV  E+ S  ISY  Q D+  G K+AS LN+RP +
Sbjct  446  FVCRWVDALSEPRVTHEVRSIWISYWSQADKSLGQKLASHLNVRPSI  492



>ref|XP_002306976.2| catalase family protein [Populus trichocarpa]
 gb|EEE93972.2| catalase family protein [Populus trichocarpa]
Length=492

 Score =   127 bits (320),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 76/107 (71%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D +  AERFP P  + +GRR+KC+IEKE  FKQ G+R RS APDRQ+R
Sbjct  386  RDEEVNYFPSRHDPSRHAERFPIPSAVCSGRREKCIIEKENNFKQPGERYRSWAPDRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            F+ RWV +L EPRV  E+ S  ISY  Q D+  G K+AS LN+RP +
Sbjct  446  FVRRWVDALSEPRVTHEVRSIWISYWSQADKSLGQKLASHLNVRPSV  492



>ref|XP_007136018.1| hypothetical protein PHAVU_009G011100g [Phaseolus vulgaris]
 gb|ESW08012.1| hypothetical protein PHAVU_009G011100g [Phaseolus vulgaris]
Length=492

 Score =   127 bits (320),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 74/107 (69%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D+   AE FP P  I +GRR+KC IEKE  FKQ G+R RS APDRQDR
Sbjct  386  RDEEVNYFPSRYDSVRHAESFPIPPAICSGRREKCGIEKENNFKQAGERFRSWAPDRQDR  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RWV +L +PRV  EI S  ISY  Q DR  G K+AS LN+RP +
Sbjct  446  FIRRWVDALSDPRVTHEIRSVWISYWSQADRSLGQKIASHLNMRPNI  492



>gb|AGV54297.1| peroxisomal catalase [Phaseolus vulgaris]
Length=492

 Score =   127 bits (320),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 74/107 (69%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D+   AE FP P  I +GRR+KC IEKE  FKQ G+R RS APDRQDR
Sbjct  386  RDEEVNYFPSRYDSVRHAESFPIPPAICSGRREKCGIEKENNFKQAGERFRSWAPDRQDR  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RWV +L +PRV  EI S  ISY  Q DR  G K+AS LN+RP +
Sbjct  446  FIRRWVDALSDPRVTHEIRSVWISYWSQADRSLGQKIASHLNMRPNI  492



>ref|XP_010061172.1| PREDICTED: catalase isozyme 3-like [Eucalyptus grandis]
 gb|KCW68094.1| hypothetical protein EUGRSUZ_F01776 [Eucalyptus grandis]
Length=492

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 76/107 (71%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEE++ FP K D    AER+P P +IVTG+R+K +IEKE  FKQ G+R RS APDRQ+R
Sbjct  386  RDEEINYFPSKFDPVRHAERYPIPSQIVTGKREKVIIEKENNFKQPGERYRSWAPDRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FINRW+K+L EPRV  E  S  ISY  Q D+  G K+AS L+ RP M
Sbjct  446  FINRWIKALTEPRVTHEHRSIWISYWTQADKSLGQKLASRLSARPSM  492



>gb|AAR84578.1| catalase 1a [Lotus japonicus]
Length=492

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 74/107 (69%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AER+P P  I TG R++C IEKE  FKQ G+R RS APDRQDR
Sbjct  386  RDEEVNYFPSRYDPVRHAERYPIPPAICTGSRERCAIEKENNFKQPGERYRSFAPDRQDR  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            F+ RWV +L +PRV  EI ST ISY  Q DR  G K+AS LN+RP +
Sbjct  446  FVRRWVDALSDPRVTHEIRSTWISYWSQADRSLGQKIASHLNLRPSI  492



>ref|XP_008365915.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 74/107 (69%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AE FP P  I TG+R+KCVIEKE  FKQ G+R RS APDRQ+R
Sbjct  386  RDEEVNYFPSRYDPARHAETFPIPSNICTGKREKCVIEKENNFKQPGERYRSWAPDRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            F++RWV  L EPRV  EI S  ISY  Q DR  G K+AS LN+RP +
Sbjct  446  FLHRWVDVLSEPRVTHEIRSIWISYWSQADRSFGQKLASRLNVRPSI  492



>ref|XP_008348924.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 74/107 (69%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AE FP P  I TG+R+KCVIEKE  FKQ G+R RS APDRQ+R
Sbjct  386  RDEEVNYFPSRYDPARHAETFPIPSNICTGKREKCVIEKENNFKQPGERYRSWAPDRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            F++RWV  L EPRV  EI S  ISY  Q DR  G K+AS LN+RP +
Sbjct  446  FLHRWVDVLSEPRVTHEIRSIWISYWSQADRSFGQKLASRLNVRPSI  492



>gb|KJB57963.1| hypothetical protein B456_009G187600 [Gossypium raimondii]
Length=492

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 77/107 (72%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEE++ FP + D +  AERFP P  + TG+R+KC+IEKE  FKQ G+R RS APDRQ+R
Sbjct  386  RDEEINYFPSRYDPSRHAERFPIPPALCTGKREKCIIEKENNFKQPGERYRSWAPDRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FINRWV ++ +PRV  EI S  I+Y  Q D+  G K+AS LN+RP +
Sbjct  446  FINRWVDAMSDPRVTHEIRSIWITYWSQADKSLGQKLASRLNVRPSI  492



>gb|AIS20825.1| CAT [Pyrus x bretschneideri]
Length=492

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 75/107 (70%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AE FP P  I TG+R+KCVIEKE  FKQ G+R RS APDRQ+R
Sbjct  386  RDEEVNYFPSRYDPARHAETFPIPSNICTGKREKCVIEKENNFKQPGERYRSWAPDRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            F++RWV +L +PRV  EI S  ISY  Q DR  G K+AS LN+RP +
Sbjct  446  FLHRWVDALSDPRVTYEIRSIWISYWSQADRSFGQKLASRLNVRPSI  492



>ref|XP_010061174.1| PREDICTED: catalase isozyme 3-like isoform X2 [Eucalyptus grandis]
 gb|KCW68092.1| hypothetical protein EUGRSUZ_F01775 [Eucalyptus grandis]
Length=492

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 76/107 (71%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEE++ FP K D    AER+P P +IVTG+R++ +IEKE  FKQ G+R RS APDRQ+R
Sbjct  386  RDEEINYFPSKFDPVRHAERYPIPSQIVTGKRERVIIEKENNFKQAGERYRSWAPDRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FINRW+K+L EPRV  E  S  ISY  Q D+  G K+AS L+ RP M
Sbjct  446  FINRWIKALSEPRVTHEHRSIWISYWTQADKSIGQKLASSLSARPSM  492



>gb|KCW68095.1| hypothetical protein EUGRSUZ_F01777 [Eucalyptus grandis]
Length=584

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 77/107 (72%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D+   AE+FP P  ++ G+RD+C+IEKE  FKQ G+R RS APDRQ+R
Sbjct  478  RDEEVNYFPSRFDSVRHAEKFPIPPPVLNGKRDRCMIEKENNFKQPGERYRSWAPDRQER  537

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RWV++L +PRV  EI S  ISY  Q D+  G K+AS LN+RP M
Sbjct  538  FIGRWVEALSDPRVTQEIRSIWISYWTQADKSLGQKIASCLNVRPSM  584



>ref|XP_008373403.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   127 bits (318),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 75/107 (70%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AE FP P  I TG+R+KCVIEKE  FKQ G+R RS APDRQ+R
Sbjct  386  RDEEVNYFPSRYDPVRHAETFPIPSNICTGKREKCVIEKENNFKQPGERYRSWAPDRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            F++RWV +L +PRV  EI S  ISY  Q DR  G K+AS LN+RP +
Sbjct  446  FLHRWVDALSDPRVTYEIRSIWISYWSQADRSFGQKLASRLNVRPSI  492



>gb|AFK46618.1| unknown [Lotus japonicus]
Length=112

 Score =   119 bits (299),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 71/107 (66%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AER+P P  I TG R++C +EKE  FKQ G+R RS APDRQDR
Sbjct  6    RDEEVNYFPSRYDPVRHAERYPIPPAICTGSRERCAVEKENDFKQPGERYRSFAPDRQDR  65

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            F+ RWV +L +PRV  EI S  ISY  Q DR  G K+A  LN+ P +
Sbjct  66   FVRRWVDALSDPRVTHEIRSAWISYWSQADRSFGQKIAFHLNLGPSI  112



>sp|Q9AXH0.1|CATA_AVIMR RecName: Full=Catalase [Avicennia marina]
 gb|AAK06839.1|AF328861_1 catalase [Avicennia marina]
 gb|AAP13538.1| catalase [Avicennia marina]
Length=492

 Score =   126 bits (317),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 75/107 (70%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEVD FP K D T  AER P P  ++TGRRD+ VIEKE  FKQ GDR RS APDRQ+R
Sbjct  386  RDEEVDYFPSKYDPTRHAERHPIPNAVITGRRDRRVIEKEDNFKQAGDRYRSWAPDRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            F+ RWV +L +PR+  EI S  +SY  Q D+  G K+AS LN+RP M
Sbjct  446  FLRRWVDALSDPRLTLEIRSIWVSYWSQADKSFGQKLASRLNVRPTM  492



>ref|XP_010918244.1| PREDICTED: catalase isozyme 1 [Elaeis guineensis]
Length=492

 Score =   126 bits (317),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 76/107 (71%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AERFP P RI+TGRR+KCVI KE  FKQ G+R RS  P+RQ+R
Sbjct  386  RDEEVNYFPSRYDPVRHAERFPIPSRILTGRREKCVIHKENNFKQPGERYRSWDPNRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RWV++L +PRV  EI S  ISY  Q D+  G K+A+ LN++P M
Sbjct  446  FIRRWVEALSDPRVTHEIQSIWISYWSQCDKSLGQKIATRLNVKPCM  492



>dbj|BAH20283.1| AT1G20620 [Arabidopsis thaliana]
Length=145

 Score =   120 bits (301),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 70/107 (65%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEE++ +P K D    AE+ P P    TG R KCVI+KE  FKQ GDR RS APDRQDR
Sbjct  39   RDEEINYYPSKFDPVRCAEKVPTPTNSYTGIRTKCVIKKENNFKQAGDRYRSWAPDRQDR  98

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            F+ RWV+ L EPR+  EI    ISY  Q DR  G K+AS LN+RP +
Sbjct  99   FVKRWVEILSEPRLTHEIRGIWISYWSQADRSLGQKLASRLNVRPSI  145



>sp|Q9M5L6.1|CATA_CAPAN RecName: Full=Catalase; AltName: Full=CaCat1 [Capsicum annuum]
 gb|AAF34718.1|AF227952_1 catalase [Capsicum annuum]
Length=492

 Score =   126 bits (316),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 75/107 (70%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEVD  P + D    AE++P P  ++TGRR+KCVI KE  FKQ G+R RS APDRQDR
Sbjct  386  RDEEVDYLPSRFDPCRPAEQYPIPSCVLTGRREKCVIPKENNFKQAGERYRSWAPDRQDR  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            +IN+WV+SL +PR   EI S  ISYL Q D+  G KVAS L ++P M
Sbjct  446  YINKWVESLSDPRATHEIRSIWISYLSQADKSCGQKVASRLTVKPTM  492



>sp|P49317.1|CATA3_NICPL RecName: Full=Catalase isozyme 3 [Nicotiana plumbaginifolia]
 emb|CAA85426.1| catalase [Nicotiana plumbaginifolia]
Length=492

 Score =   126 bits (316),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 75/107 (70%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AE++P P  ++TG+RDKC+IEKE  FKQ G+R RS APDRQ+R
Sbjct  386  RDEEVNYFPSRFDPCRHAEQYPIPPCVLTGKRDKCIIEKENNFKQPGERYRSWAPDRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RWV +L +PRV  EI S   SY  Q D+  G K+AS LN+RP M
Sbjct  446  FICRWVDALSDPRVTHEIRSIWFSYWSQADKTLGQKIASRLNVRPTM  492



>ref|NP_001289779.1| catalase isozyme 1 [Nelumbo nucifera]
 gb|ADY11209.1| catalase [Nelumbo nucifera]
Length=492

 Score =   125 bits (315),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 76/107 (71%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            R+EEV+ FP + D    AER+P P +I TG+R+KCVIEKE  FKQ G+R RS APDRQ+R
Sbjct  386  REEEVNYFPSRYDPVRHAERYPIPPQICTGKREKCVIEKENNFKQPGERYRSWAPDRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RW+ +L +PRV  EI S  ISY  Q D+  G K+AS LN++P M
Sbjct  446  FIKRWIDALSDPRVTHEIRSIWISYWSQADKSLGQKLASRLNVKPSM  492



>ref|XP_008237987.1| PREDICTED: catalase isozyme 1 [Prunus mume]
Length=492

 Score =   125 bits (315),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 76/107 (71%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AERFP P  I++G+R+KC+IEKE  FKQ G+R RS APDRQ+R
Sbjct  386  RDEEVNYFPSRYDPVRNAERFPIPPNILSGKREKCIIEKENNFKQPGERYRSWAPDRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RWV +L +PRV  EI S  ISY  Q D+  G K+AS LN+RP +
Sbjct  446  FICRWVDALSDPRVTHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_009773579.1| PREDICTED: catalase isozyme 3-like [Nicotiana sylvestris]
Length=492

 Score =   125 bits (315),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 76/107 (71%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AE++P P RI+TG+RD+C+IEKE  FKQ G+R RS +PDRQ+R
Sbjct  386  RDEEVNYFPSRFDPCRHAEQYPIPPRILTGKRDRCIIEKENNFKQPGERYRSWSPDRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RW+ +L +PRV  EI    ISY  Q D+  G K+AS LN+RP M
Sbjct  446  FICRWINALSDPRVTHEIRIIWISYWSQADKSLGEKIASRLNVRPTM  492



>ref|XP_008802866.1| PREDICTED: catalase isozyme 1 [Phoenix dactylifera]
Length=492

 Score =   125 bits (314),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 74/107 (69%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AE FP P  ++TGRR+KCVI KE  FKQ G+R RS APDRQ R
Sbjct  386  RDEEVNYFPSRYDPVRHAETFPIPSCVLTGRREKCVIHKENNFKQPGERYRSWAPDRQGR  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RWV++L +PRV  EI S  ISY  Q DR  G K+A+ LN++P M
Sbjct  446  FICRWVEALSDPRVTYEIRSIWISYWSQCDRSLGQKIATRLNVKPSM  492



>ref|XP_010242894.1| PREDICTED: catalase isozyme 1-like isoform X1 [Nelumbo nucifera]
Length=492

 Score =   125 bits (314),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 74/107 (69%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AERFP P RI TG+R+KCVIEKE  FKQ G+R RS  PDRQ+R
Sbjct  386  RDEEVNYFPSRYDPVRHAERFPIPPRICTGKREKCVIEKENNFKQPGERYRSFDPDRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RW  +L +PRV  EI S  ISY  Q D+  G K+A+ LN++P M
Sbjct  446  FIKRWFDALSDPRVTHEIRSIWISYWSQADKSLGQKLATRLNVKPSM  492



>ref|XP_010663966.1| PREDICTED: catalase isozyme 1 [Vitis vinifera]
 emb|CBI40714.3| unnamed protein product [Vitis vinifera]
Length=492

 Score =   125 bits (314),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 75/107 (70%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AER+P P  I+TGRR+KC+I KE  FKQ G+R RS APDRQ+R
Sbjct  386  RDEEVNYFPSRYDPVRHAERYPIPPAILTGRREKCIIPKENNFKQPGERYRSFAPDRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RWV +L +PRV  EI S  ISY  Q D+  G K+AS LN+RP +
Sbjct  446  FIQRWVDALSDPRVTYEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>gb|AAA57551.1| catalase, partial [Nicotiana sylvestris]
Length=383

 Score =   124 bits (312),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 75/107 (70%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEVD  P + D    AE++P P R++TGRR+ CVIEKE  FKQ G+R RS  PDRQDR
Sbjct  277  RDEEVDYLPSRFDPCRHAEQYPIPSRVLTGRREMCVIEKENNFKQAGERYRSWEPDRQDR  336

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            ++++WV+ L +PRV  EI S  ISYL Q D+  G KVAS L ++P M
Sbjct  337  YVSKWVEHLSDPRVTYEIRSIWISYLSQADKSCGQKVASRLTLKPTM  383



>ref|XP_008237989.1| PREDICTED: catalase isozyme 1-like [Prunus mume]
Length=492

 Score =   125 bits (314),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 75/107 (70%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AER+P P  I+ G+R+KCVIEKE  FKQ G+R RS APDRQ+R
Sbjct  386  RDEEVNYFPSRYDPVRHAERYPIPSNILYGKREKCVIEKENNFKQPGERYRSWAPDRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RWV +L +PRV  EI S  ISY  Q D+  G K+AS LN+RP +
Sbjct  446  FIRRWVDALSDPRVTHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>gb|ACJ73905.1| CAT1 [Solanum nigrum]
Length=168

 Score =   120 bits (300),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 74/107 (69%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEE+D FP + D    AE +P P ++ +G+R+KC+I+KE  FKQ G+R R+  PDRQ+R
Sbjct  62   RDEEIDYFPSRYDQVRHAEIYPIPSKVCSGKREKCIIQKENNFKQAGERYRTFTPDRQER  121

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            F+ RWV+ L +PR+  EI S  ISY  Q D+  G K+AS LN+RP +
Sbjct  122  FVRRWVEPLSDPRITYEIRSIWISYWSQADKSLGQKLASRLNVRPSI  168



>gb|AIA61608.1| catalase [Gynostemma pentaphyllum]
Length=492

 Score =   125 bits (313),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 75/107 (70%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AER+P P  + TG+R++CVI+KE  FKQ G+R RS APDRQ+R
Sbjct  386  RDEEVNYFPSRYDPARHAERYPHPPAVCTGKRERCVIDKENNFKQPGERYRSWAPDRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RWV +L +PRV  EI S  ISY  Q DR  G K+AS LN+RP +
Sbjct  446  FIRRWVNALSDPRVTHEIRSIWISYWSQADRSVGQKLASHLNMRPSI  492



>emb|CAA10286.1| catalase [Cicer arietinum]
Length=125

 Score =   118 bits (296),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 73/107 (68%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AERFP P   ++G+R++C+  KE  FKQ G+R R+ APDRQDR
Sbjct  19   RDEEVNYFPSRHDPVRHAERFPTPPAALSGKRERCIRPKENNFKQPGERYRTWAPDRQDR  78

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            F  RW+++L +PRV  E+ S  ISY  Q DR  G K+AS LN+RP +
Sbjct  79   FARRWIEALSDPRVTHEVRSIWISYWSQADRSLGQKIASHLNMRPSI  125



>ref|XP_009590727.1| PREDICTED: catalase isozyme 1 [Nicotiana tomentosiformis]
Length=492

 Score =   125 bits (313),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 75/107 (70%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEVD  P + D    AE++P P R++TGRR+ CVIEKE  FKQ G+R RS  PDRQDR
Sbjct  386  RDEEVDYLPSRFDPCRHAEQYPIPSRVLTGRREMCVIEKENNFKQAGERYRSWEPDRQDR  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            ++++WV+ L +PRV  EI S  ISYL Q D+  G KVAS L ++P M
Sbjct  446  YVSKWVEHLSDPRVTYEIRSIWISYLSQADKSCGQKVASRLTVKPTM  492



>ref|XP_009794245.1| PREDICTED: catalase isozyme 1 [Nicotiana sylvestris]
Length=492

 Score =   125 bits (313),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 75/107 (70%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEE+D FP + D    AE++P P  + TG+R+KCVI+KE  FKQ GDR RS  PDRQ+R
Sbjct  386  RDEEIDYFPSRYDPVRHAEKYPIPSTMCTGKREKCVIQKENNFKQAGDRYRSFTPDRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RWV++L +PR+  EI S  ISY  Q D+  G K+AS LN+RP +
Sbjct  446  FIRRWVEALSDPRITYEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_009792372.1| PREDICTED: catalase isozyme 1 [Nicotiana sylvestris]
Length=492

 Score =   124 bits (312),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 75/107 (70%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEVD  P + D    AE++P P R++TGRR+ CVIEKE  FKQ G+R RS  PDRQDR
Sbjct  386  RDEEVDYLPSRFDPCRHAEQYPIPSRVLTGRREMCVIEKENNFKQAGERYRSWEPDRQDR  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            ++++WV+ L +PRV  EI S  ISYL Q D+  G KVAS L ++P M
Sbjct  446  YVSKWVEHLSDPRVTYEIRSIWISYLSQADKSCGQKVASRLTLKPTM  492



>sp|P49319.2|CATA1_TOBAC RecName: Full=Catalase isozyme 1; AltName: Full=Salicylic acid-binding 
protein; Short=SABP [Nicotiana tabacum]
 gb|AAA57552.1| catalase [Nicotiana tabacum]
Length=492

 Score =   124 bits (312),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 75/107 (70%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEVD  P + D    AE++P P R++TGRR+ CVIEKE  FKQ G+R RS  PDRQDR
Sbjct  386  RDEEVDYLPSRFDPCRHAEQYPIPSRVLTGRREMCVIEKENNFKQAGERYRSWEPDRQDR  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            ++++WV+ L +PRV  EI S  ISYL Q D+  G KVAS L ++P M
Sbjct  446  YVSKWVEHLSDPRVTYEIRSIWISYLSQADKSCGQKVASRLTLKPTM  492



>emb|CCP37650.1| catalase-1 [Nicotiana tabacum]
Length=492

 Score =   124 bits (312),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 75/107 (70%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEE+D FP + D    AE++P P  + TG+R+KCVI+KE  FKQ GDR RS  PDRQ+R
Sbjct  386  RDEEIDYFPSRYDPVRHAEKYPIPSTMCTGKREKCVIQKENNFKQPGDRYRSFTPDRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RWV++L +PR+  EI S  ISY  Q D+  G K+AS LN+RP +
Sbjct  446  FIRRWVEALSDPRITYEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>gb|AFU48609.1| catalase 1, partial [Nicotiana benthamiana]
Length=491

 Score =   124 bits (311),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 75/107 (70%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEE+D FP + D    AE++P P  + TG+R+KCVI+KE  FKQ GDR RS  PDRQ+R
Sbjct  385  RDEEIDYFPSRYDPVRHAEKYPIPSTMCTGKREKCVIQKENNFKQPGDRYRSFTPDRQER  444

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RWV++L +PR+  EI S  ISY  Q D+  G K+AS LN+RP +
Sbjct  445  FIRRWVEALSDPRITYEIRSIWISYWSQADKSLGQKLASRLNVRPSI  491



>gb|ACL27272.1| catalase [Nicotiana benthamiana]
Length=492

 Score =   124 bits (311),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 75/107 (70%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEE+D FP + D    AE++P P  + TG+R+KCVI+KE  FKQ GDR RS  PDRQ+R
Sbjct  386  RDEEIDYFPSRYDPVRHAEKYPIPSTMCTGKREKCVIQKENNFKQPGDRYRSFTPDRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RWV++L +PR+  EI S  ISY  Q D+  G K+AS LN+RP +
Sbjct  446  FIRRWVEALSDPRITYEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_008789355.1| PREDICTED: catalase isozyme 1-like [Phoenix dactylifera]
Length=492

 Score =   124 bits (311),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 75/107 (70%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AER P P RI+TGRR+KCVI+KE  FKQ G+R RS  PDRQ R
Sbjct  386  RDEEVNYFPSRYDPVRHAERCPIPSRILTGRREKCVIQKENNFKQPGERYRSWDPDRQGR  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RWV++L +PRV  EI S  ISY  Q D+  G K+A+ LN++P M
Sbjct  446  FIRRWVEALSDPRVTHEIQSIWISYWSQCDKSLGRKIATRLNVKPSM  492



>ref|XP_003631925.1| PREDICTED: catalase isozyme 1-like [Vitis vinifera]
Length=492

 Score =   124 bits (311),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 73/105 (70%), Gaps = 0/105 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEVD FP + D    AE FP P  I  G+R+K VIEKE  FKQ G+R RS APDRQ+R
Sbjct  386  RDEEVDYFPSRFDPVRHAETFPIPSTICHGKREKVVIEKENNFKQPGERYRSFAPDRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRP  148
            FINRWV++L +PRV  EI S  ISY  Q DR  G K+AS LN++P
Sbjct  446  FINRWVETLSDPRVTYEIRSIWISYWSQADRSLGQKLASRLNVKP  490



>ref|NP_001268098.1| catalase [Vitis vinifera]
 gb|AAL83720.1|AF236127_1 catalase [Vitis vinifera]
Length=492

 Score =   124 bits (311),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 73/105 (70%), Gaps = 0/105 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEVD FP + D    AE FP P  I  G+R+K VIEKE  FKQ G+R RS APDRQ+R
Sbjct  386  RDEEVDYFPSRFDPVRHAETFPIPSTICHGKREKVVIEKENNFKQPGERYRSFAPDRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRP  148
            FINRWV++L +PRV  EI S  ISY  Q DR  G K+AS LN++P
Sbjct  446  FINRWVETLSDPRVTYEIRSIWISYWSQADRSLGQKLASRLNVKP  490



>ref|XP_007210576.1| hypothetical protein PRUPE_ppa004763mg [Prunus persica]
 gb|EMJ11775.1| hypothetical protein PRUPE_ppa004763mg [Prunus persica]
Length=492

 Score =   124 bits (311),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 75/107 (70%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AER+P P  I++G+R+KCVIEKE  FKQ G+R RS APDRQ+R
Sbjct  386  RDEEVNYFPSRHDPVRHAERYPIPSNILSGKREKCVIEKENNFKQPGERYRSWAPDRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RWV +L +PRV  EI S  ISY  Q D+  G K+ S LN+RP +
Sbjct  446  FIRRWVDALSDPRVTHEIRSIWISYWSQADKSLGQKLLSRLNVRPSI  492



>emb|CAD42909.1| catalase [Prunus persica]
Length=492

 Score =   124 bits (310),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 75/107 (70%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AER+P P  I++G+R+KCVIEKE  FKQ G+R RS APDRQ+R
Sbjct  386  RDEEVNYFPSRHDPVRHAERYPIPSNILSGKREKCVIEKENNFKQPGERYRSWAPDRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RWV +L +PRV  EI S  ISY  Q D+  G K+ S LN+RP +
Sbjct  446  FIRRWVDALSDPRVTHEIRSIWISYWSQADKSLGQKLLSRLNVRPSI  492



>gb|AGE15298.2| catalase 1 [Eriobotrya japonica]
Length=492

 Score =   124 bits (310),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 73/107 (68%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP +      AE FP P  I+TG+RDKCVIEKE  FKQ G+R RS APDRQ+R
Sbjct  386  RDEEVNYFPSRYQPARHAETFPIPSSIITGKRDKCVIEKENNFKQPGERYRSWAPDRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            F++RWV  L E RV  EI S  ISY  Q DR  G K+A+ LN+RP +
Sbjct  446  FLHRWVDVLSESRVTYEIRSIWISYWSQADRSFGQKLATRLNVRPSI  492



>gb|AAM97542.1| catalase 3 [Capsicum annuum]
Length=492

 Score =   124 bits (310),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 76/107 (71%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AE++P P R++ G+RD+C+I+KE  FKQ G+R RS APDRQ+R
Sbjct  386  RDEEVNYFPSRFDPCRHAEQYPIPPRVLNGKRDRCIIQKENNFKQPGERYRSWAPDRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RWV +L EPRV  EI +  +SY  Q D+  G K+AS LN++P M
Sbjct  446  FICRWVDALSEPRVTHEIRTIWLSYWSQADKSLGQKLASRLNVKPTM  492



>sp|P32290.1|CATA_VIGRR RecName: Full=Catalase [Vigna radiata var. radiata]
 dbj|BAA02755.1| catalase [Vigna radiata var. radiata]
Length=492

 Score =   124 bits (310),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 73/107 (68%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AE+FP P  + +GRR+K  IEKE  FKQ G+R RS APDRQDR
Sbjct  386  RDEEVNYFPSRYDPVRHAEKFPIPPAVFSGRREKIAIEKENNFKQAGERFRSWAPDRQDR  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RWV +L +PRV  EI S  ISY  Q DR  G K+AS LN+RP +
Sbjct  446  FIRRWVDALSDPRVTHEIRSVWISYWSQADRSLGQKIASHLNMRPNI  492



>dbj|BAD94702.1| catalase [Arabidopsis thaliana]
Length=108

 Score =   116 bits (291),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 74/107 (69%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AE++P P  + +G+R++C+IEKE  FK+ G+R R+  P+RQ+R
Sbjct  2    RDEEVNYFPSRYDQVRHAEKYPTPPAVCSGKRERCIIEKENNFKEPGERYRTFTPERQER  61

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RW+ +L +PR+  EI S  ISY  Q D+  G K+AS LN+RP +
Sbjct  62   FIQRWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  108



>gb|AAB71764.1| catalase 1 [Nicotiana tabacum]
Length=492

 Score =   123 bits (309),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 75/107 (70%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEE+D FP + D    AE++P P  + TG+R+KCVI+KE  FKQ GDR RS  PDRQ+R
Sbjct  386  RDEEIDYFPSRYDPVRHAEKYPIPSTMCTGKREKCVIQKENNFKQPGDRYRSFTPDRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RWV++L +PR+  EI +  ISY  Q D+  G K+AS LN+RP +
Sbjct  446  FIRRWVEALSDPRITYEIRTIWISYWSQADKSLGQKLASRLNVRPSI  492



>sp|O24339.1|CATA_SOLAP RecName: Full=Catalase [Soldanella alpina]
 emb|CAB16749.1| catalase [Soldanella alpina]
Length=492

 Score =   123 bits (309),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 75/107 (70%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AER P P  ++TG+RD+C+IEKE  FKQ G+R R+ APDRQ+R
Sbjct  386  RDEEVNYFPSRFDPVRHAERHPIPPPVLTGKRDRCMIEKENNFKQPGERYRTFAPDRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            F+ RWV +L +PRV  EI S  ISY  Q D+  G K+AS LN+RP M
Sbjct  446  FVCRWVDALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  492



>sp|P55311.1|CATA_SOLME RecName: Full=Catalase [Solanum melongena]
 emb|CAA50644.1| catalase [Solanum melongena]
Length=492

 Score =   123 bits (308),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 75/107 (70%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEVD  P + D    AE++P P  ++TGRR+KCVI KE  FKQ G+R R+  PDRQDR
Sbjct  386  RDEEVDYLPSRFDPCRPAEQYPIPSCVLTGRREKCVIPKENNFKQAGERYRTWEPDRQDR  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            +IN+WV+SL +PRV  EI S  ISYL Q D+  G KVAS L ++P M
Sbjct  446  YINKWVESLSDPRVTHEIRSIWISYLSQADKSCGQKVASRLLVKPTM  492



>gb|KJB14249.1| hypothetical protein B456_002G115900 [Gossypium raimondii]
Length=344

 Score =   122 bits (305),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 73/107 (68%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEE++ FP + D    AE FP P  + TGRR+KC+IEKE  FKQ G+R RS A DRQ+R
Sbjct  238  RDEEINYFPSRYDPVRHAEMFPIPPAVCTGRREKCIIEKENNFKQPGERYRSWAADRQER  297

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RWV +L +PRV  EI S  ISY  Q D+  G K+AS LN+RP +
Sbjct  298  FICRWVDALSDPRVTHEIRSIWISYWSQADKSVGQKLASRLNVRPSI  344



>gb|ADC95629.1| catalase [Bruguiera gymnorhiza]
Length=492

 Score =   123 bits (308),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 75/107 (70%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+  P + D    AERFP P  + TGRR+KC+IEKE  FKQ G+R RS APDRQ+R
Sbjct  386  RDEEVNYLPSRFDPVRHAERFPIPPAVCTGRREKCIIEKENNFKQPGERYRSWAPDRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            F +RWV++L +PRV  EI S  ISY  Q D+  G K+A+ LN+RP +
Sbjct  446  FTHRWVEALSDPRVTHEICSIWISYWTQCDKFLGQKLATRLNVRPSI  492



>ref|NP_001237571.1| catalase-4 [Glycine max]
 sp|O48561.1|CATA4_SOYBN RecName: Full=Catalase-4 [Glycine max]
 gb|AAB88172.1| catalase [Glycine max]
 gb|KHN33801.1| Catalase-4 [Glycine soja]
Length=492

 Score =   123 bits (308),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 72/107 (67%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AERFP P  I +GRR+KC IEKE  FKQ G+R RS APDRQDR
Sbjct  386  RDEEVNYFPSRYDPVRHAERFPIPPAICSGRREKCGIEKENNFKQPGERYRSWAPDRQDR  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            F  RWV +L +PRV  EI S  ISY  Q DR  G K+AS L+ RP +
Sbjct  446  FARRWVDALSDPRVTHEIRSVWISYWSQADRSLGQKIASHLSTRPNI  492



>ref|XP_002301920.1| catalase family protein [Populus trichocarpa]
 gb|ABK96479.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE81193.1| catalase family protein [Populus trichocarpa]
Length=492

 Score =   122 bits (307),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 74/107 (69%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AE FP P  + +G+R+KC+IEKE  FKQ G+R RS APDRQ+R
Sbjct  386  RDEEVNYFPSRYDPVRHAESFPIPPAVCSGKREKCIIEKENNFKQPGERYRSWAPDRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RWV +L +PRV  EI S  ISY  Q D+  G K+AS LN+RP +
Sbjct  446  FICRWVDALSDPRVTHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_006828715.1| hypothetical protein AMTR_s00001p00024160 [Amborella trichopoda]
 gb|ERM96131.1| hypothetical protein AMTR_s00001p00024160 [Amborella trichopoda]
Length=492

 Score =   122 bits (307),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 75/107 (70%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEVD FP + D    AE+FP P +I +G+R+KC+IEKE  FKQ G+R RS A DRQ+R
Sbjct  386  RDEEVDYFPSRFDPVRHAEKFPMPPQICSGKREKCMIEKENNFKQPGERYRSFAIDRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RWV +L +PRV  EI S  ISY  Q D+  G K+A+ LN++P M
Sbjct  446  FIKRWVDALSDPRVTHEILSIWISYWSQCDKSLGQKLATHLNLKPNM  492



>emb|CAI43948.1| catalase [Populus deltoides]
 gb|ABK96317.1| unknown [Populus trichocarpa x Populus deltoides]
Length=492

 Score =   122 bits (307),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 74/107 (69%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AE FP P  + +G+R+KC+IEKE  FKQ G+R RS APDRQ+R
Sbjct  386  RDEEVNYFPSRYDPVRHAESFPIPPAVCSGKREKCIIEKENNFKQPGERYRSWAPDRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RWV +L +PRV  EI S  ISY  Q D+  G K+AS LN+RP +
Sbjct  446  FICRWVDALSDPRVTHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>sp|P49316.1|CATA2_NICPL RecName: Full=Catalase isozyme 2 [Nicotiana plumbaginifolia]
 emb|CAA85425.1| catalase [Nicotiana plumbaginifolia]
Length=492

 Score =   122 bits (307),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 74/107 (69%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEVD  P + D    AE++P P R++ GRR+ CVIEKE  FKQ G+R RS  PDRQDR
Sbjct  386  RDEEVDYLPSRFDPCRHAEQYPIPSRVLNGRREMCVIEKENNFKQAGERYRSWEPDRQDR  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            ++++WV+ L +PRV  EI S  ISYL Q D+  G KVAS L ++P M
Sbjct  446  YVSKWVEHLSDPRVTYEIRSIWISYLSQADKSCGQKVASRLTLKPTM  492



>sp|P49315.1|CATA1_NICPL RecName: Full=Catalase isozyme 1, partial [Nicotiana plumbaginifolia]
 emb|CAA85424.1| catalase [Nicotiana plumbaginifolia]
Length=485

 Score =   122 bits (307),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 75/107 (70%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEE+D FP + D    AE++P P  + TG+R+KCVI+KE  FKQ G+R RS  PDRQ+R
Sbjct  379  RDEEIDYFPSRYDPVRHAEKYPIPSTMCTGKREKCVIQKENNFKQPGERYRSFTPDRQER  438

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RWV++L +PR+  EI S  ISY  Q D+  G K+AS LN+RP +
Sbjct  439  FIRRWVETLSDPRITYEIRSIWISYWSQADKSLGQKLASRLNVRPSI  485



>gb|ACJ11733.1| catalase [Gossypium hirsutum]
Length=492

 Score =   122 bits (306),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 74/107 (69%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEE++ FP + D    AE FP P  + TGRR+KC+IEKE  FKQ G+R RS A DRQ+R
Sbjct  386  RDEEINYFPSRYDPVRHAEMFPIPPAVCTGRREKCIIEKENNFKQPGERYRSWAADRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RWV++L +PRV  EI S  ISY  Q D+  G K+AS LN+RP +
Sbjct  446  FICRWVEALSDPRVTHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_009413057.1| PREDICTED: catalase isozyme 2-like [Musa acuminata subsp. malaccensis]
Length=492

 Score =   122 bits (306),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 74/107 (69%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AERFP P  +VTGRR+K +I KE  FKQ G+R RS APDRQ+R
Sbjct  386  RDEEVNYFPSRYDPVRHAERFPIPSSVVTGRREKSIINKENNFKQPGERYRSWAPDRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            F++RWV +L +PRV  EI    ISY  Q D+  G K+A+ LN++P M
Sbjct  446  FVHRWVDALSDPRVTHEIRDIWISYWSQCDKSLGQKIATRLNVKPTM  492



>ref|XP_011034872.1| PREDICTED: catalase isozyme 1-like [Populus euphratica]
Length=492

 Score =   122 bits (306),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 74/107 (69%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AE FP P  + +G+R+KC+IEKE  FKQ G+R RS APDRQ+R
Sbjct  386  RDEEVNYFPSRYDPVRHAESFPIPPAVCSGKREKCIIEKENNFKQPGERYRSWAPDRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            F+ RWV +L +PRV  EI S  ISY  Q D+  G K+AS LN+RP +
Sbjct  446  FVCRWVDALSDPRVTHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>gb|ABY19573.1| catalase [Manihot esculenta]
Length=261

 Score =   119 bits (299),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 72/105 (69%), Gaps = 0/105 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEVD FP + D    AER P P  I++GRR+KCVIEKE  FKQ GDR RS  PDRQ+R
Sbjct  155  RDEEVDYFPSRYDPVRHAERTPLPHAIISGRREKCVIEKENNFKQPGDRYRSWTPDRQER  214

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRP  148
            F+ R V +L +PR+  EI S  +SY  Q D+  G K+AS LN+RP
Sbjct  215  FLCRLVNALSDPRITHEIRSIWVSYWSQCDKSLGQKLASRLNVRP  259



>gb|AAB88173.1| catalase, partial [Glycine max]
Length=308

 Score =   120 bits (301),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 72/107 (67%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AE FP P  I +GRR+KC IEKE  FKQ G+R RS APDRQDR
Sbjct  202  RDEEVNYFPSRYDPVRHAETFPIPPAICSGRREKCGIEKENNFKQPGERYRSWAPDRQDR  261

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            F  RWV +L +PRV  EI S  ISY  Q DR  G K+AS L++RP +
Sbjct  262  FNRRWVDALSDPRVTHEIRSVWISYWSQADRSLGQKIASRLSMRPNI  308



>sp|P17598.2|CATA1_GOSHI RecName: Full=Catalase isozyme 1 [Gossypium hirsutum]
 emb|CAA36380.1| unnamed protein product [Gossypium hirsutum]
Length=492

 Score =   122 bits (305),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 73/107 (68%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEE++ FP + D    AE FP P  + TGRR+KC+IEKE  FKQ G+R RS A DRQ+R
Sbjct  386  RDEEINYFPSRYDPVRHAEMFPIPPAVCTGRREKCIIEKENNFKQPGERYRSWAADRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RWV +L +PRV  EI S  ISY  Q D+  G K+AS LN+RP +
Sbjct  446  FICRWVDALSDPRVTHEIRSIWISYWSQADKSVGQKLASLLNVRPSI  492



>gb|AAO17721.1| catalase [Hypericum perforatum]
Length=492

 Score =   122 bits (305),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 75/107 (70%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AE++P P  ++ GRR+KC+I KE  FKQ G+R RS +PDRQ+R
Sbjct  386  RDEEVNYFPSRYDPVRHAEKYPIPPVVLNGRREKCMIAKENNFKQPGERYRSFSPDRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            F+NRW+ SL +PRV  EI +  ++Y  Q D+  G K+AS LN+RP M
Sbjct  446  FLNRWISSLSDPRVTHEIRAIWVTYWYQADKSLGQKLASRLNVRPNM  492



>ref|XP_009400996.1| PREDICTED: catalase isozyme 2 [Musa acuminata subsp. malaccensis]
Length=492

 Score =   122 bits (305),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 76/107 (71%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEVD FP + D    AERFP P R++TG+R+KC+I KE  FKQ G+R RS +PDRQ+R
Sbjct  386  RDEEVDYFPSRYDPVRHAERFPIPTRVLTGKREKCMISKENNFKQPGERYRSFSPDRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RWV++L +P+V  EI S  ISY  Q D+    K+A+ L+++P M
Sbjct  446  FIRRWVEALSDPKVTHEIRSIWISYWSQCDKSLSQKLATRLSVKPSM  492



>ref|XP_007160597.1| hypothetical protein PHAVU_001G001000g [Phaseolus vulgaris]
 gb|ESW32591.1| hypothetical protein PHAVU_001G001000g [Phaseolus vulgaris]
Length=492

 Score =   122 bits (305),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 74/107 (69%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AER P P RI+ G+R+KC+IEKE  FKQ G+R RS A DRQ+R
Sbjct  386  RDEEVNYFPSRYDPVRHAERIPVPPRILDGKREKCMIEKENNFKQPGERYRSWASDRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            F+ RWV +L EPRV  EI S  ISY  Q DR  G K+AS LN++P +
Sbjct  446  FLRRWVDALSEPRVTHEIRSIWISYWSQADRSLGQKIASHLNLKPSI  492



>gb|AAX84671.1| catalase CAT2, partial [Manihot esculenta]
Length=270

 Score =   119 bits (299),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 72/105 (69%), Gaps = 0/105 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEVD FP + D    AER P P  I++GRR+KCVIEKE  FKQ GDR RS  PDRQ+R
Sbjct  164  RDEEVDYFPSRYDPVRHAERTPLPHAIISGRREKCVIEKENNFKQPGDRYRSWTPDRQER  223

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRP  148
            F+ R V +L +PR+  EI S  +SY  Q D+  G K+AS LN+RP
Sbjct  224  FLCRLVNALSDPRITHEIRSIWVSYWSQCDKSLGQKLASRLNVRP  268



>ref|XP_006382992.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60789.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
Length=490

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 76/107 (71%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AER+P P  I TG+R+KC+IEKE  FKQ G+R RS +PDR++R
Sbjct  384  RDEEVNYFPSRFDPVRHAERYPNPSVIHTGKREKCIIEKENNFKQPGERYRSFSPDRKER  443

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            F+ RWV++L +PRV  EI S  ISY  Q D+  G K+AS LN+RP +
Sbjct  444  FVRRWVEALSDPRVTYEIRSIWISYWSQADKSLGQKLASHLNMRPSI  490



>ref|XP_002306427.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 ref|XP_006382993.1| catalase family protein [Populus trichocarpa]
 emb|CAI43950.1| catalase [Populus deltoides]
 gb|EEE93423.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60790.1| catalase family protein [Populus trichocarpa]
Length=492

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 76/107 (71%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AER+P P  I TG+R+KC+IEKE  FKQ G+R RS +PDR++R
Sbjct  386  RDEEVNYFPSRFDPVRHAERYPNPSVIHTGKREKCIIEKENNFKQPGERYRSFSPDRKER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            F+ RWV++L +PRV  EI S  ISY  Q D+  G K+AS LN+RP +
Sbjct  446  FVRRWVEALSDPRVTYEIRSIWISYWSQADKSLGQKLASHLNMRPSI  492



>gb|KJB14250.1| hypothetical protein B456_002G115900 [Gossypium raimondii]
Length=492

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 73/107 (68%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEE++ FP + D    AE FP P  + TGRR+KC+IEKE  FKQ G+R RS A DRQ+R
Sbjct  386  RDEEINYFPSRYDPVRHAEMFPIPPAVCTGRREKCIIEKENNFKQPGERYRSWAADRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RWV +L +PRV  EI S  ISY  Q D+  G K+AS LN+RP +
Sbjct  446  FICRWVDALSDPRVTHEIRSIWISYWSQADKSVGQKLASRLNVRPSI  492



>ref|XP_011022153.1| PREDICTED: catalase-2-like isoform X2 [Populus euphratica]
Length=492

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 76/107 (71%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AER+P P  I TG+R+KC+IEKE  FKQ G+R RS +PDR++R
Sbjct  386  RDEEVNYFPSRFDPVRHAERYPNPSVIHTGKREKCIIEKENNFKQPGERYRSFSPDRKER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            F+ RWV++L +PRV  EI S  ISY  Q D+  G K+AS LN+RP +
Sbjct  446  FVRRWVEALSDPRVTYEIRSIWISYWSQADKSLGQKLASHLNMRPGI  492



>ref|XP_008452956.1| PREDICTED: catalase isozyme 1 [Cucumis melo]
Length=492

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 74/107 (69%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AER+P P  + TG+R++CVI+KE  FK+ G+R RS  PDRQ+R
Sbjct  386  RDEEVNYFPSRFDPARHAERYPHPPAVCTGKRERCVIQKENNFKEPGERYRSWTPDRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RWV +L +PRV  EI S  ISY  Q DR  G K+AS LN+RP +
Sbjct  446  FIRRWVDALSDPRVTHEIRSIWISYWSQADRSVGQKLASHLNVRPSI  492



>emb|CDP07287.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 74/107 (69%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AER P P  +++G+RDKCVI+KE  FKQ G+R RS APDRQ+R
Sbjct  386  RDEEVNYFPSRYDPVRHAERHPIPPPVLSGKRDKCVIQKENNFKQPGERYRSWAPDRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RWV +L + RV  EI S  ISY  Q D+  G K+A+ LN+RP M
Sbjct  446  FICRWVDALSDARVTHEIRSIWISYWSQADKSLGQKIATRLNVRPTM  492



>ref|XP_011074092.1| PREDICTED: catalase isozyme 3 isoform X3 [Sesamum indicum]
Length=492

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 75/107 (70%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D +  AER+P P  +++G+R K  IEKE  FKQ GDR RS APDRQ+R
Sbjct  386  RDEEVNYFPSRYDPSRHAERYPIPPVVLSGKRGKICIEKENNFKQPGDRYRSWAPDRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RWV++L +PR+  EI S  +SY  Q D+  G K+AS LN+RP M
Sbjct  446  FIRRWVEALSDPRLTHEIRSIWVSYWSQADKSLGQKLASHLNVRPTM  492



>ref|XP_011022275.1| PREDICTED: catalase-like [Populus euphratica]
Length=476

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 76/107 (71%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AER+P P  I TG+R+KC+IEKE  FKQ G+R RS +PDR++R
Sbjct  370  RDEEVNYFPSRFDPVRHAERYPNPSVIHTGKREKCIIEKENNFKQPGERYRSFSPDRKER  429

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            F+ RWV++L +PRV  EI S  ISY  Q D+  G K+AS LN+RP +
Sbjct  430  FVRRWVEALSDPRVTYEIRSIWISYWSQADKSLGQKLASHLNMRPGI  476



>ref|XP_010536470.1| PREDICTED: catalase-2-like [Tarenaya hassleriana]
Length=492

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 73/107 (68%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AERFP P  I +GRR+KC+IEKE  FKQ G+R RS APDRQ+R
Sbjct  386  RDEEVNYFPSRFDPVRHAERFPSPPAICSGRREKCIIEKENNFKQPGERYRSWAPDRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            F+ RWV++L + R   EI S  ISY  Q D+  G K+AS LN+RP  
Sbjct  446  FLKRWVEALSDKRCTHEIRSIWISYWSQADKSLGQKLASRLNVRPSF  492



>gb|AAB62892.1| catalase-1 [Nicotiana glutinosa]
Length=492

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 74/107 (69%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEE+D FP + D    AE++P P  + TG+R+KCVI KE  FKQ G+R RS  PDRQ+R
Sbjct  386  RDEEIDYFPSRYDPVRHAEKYPIPSTMCTGKREKCVILKENNFKQPGERYRSFTPDRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RWV++L +PR+  EI S  ISY  Q D+  G K+AS LN+RP +
Sbjct  446  FIRRWVEALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_011022152.1| PREDICTED: catalase-2-like isoform X1 [Populus euphratica]
Length=511

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 76/107 (71%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AER+P P  I TG+R+KC+IEKE  FKQ G+R RS +PDR++R
Sbjct  405  RDEEVNYFPSRFDPVRHAERYPNPSVIHTGKREKCIIEKENNFKQPGERYRSFSPDRKER  464

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            F+ RWV++L +PRV  EI S  ISY  Q D+  G K+AS LN+RP +
Sbjct  465  FVRRWVEALSDPRVTYEIRSIWISYWSQADKSLGQKLASHLNMRPGI  511



>gb|AJE26131.1| catalase [Salix matsudana]
Length=492

 Score =   121 bits (303),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 73/107 (68%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AE FP P  + +G+R+KC+IEKE  FKQ G+R RS APDRQ+R
Sbjct  386  RDEEVNYFPSRYDPVRHAESFPIPPAVCSGKREKCIIEKENNFKQPGERYRSWAPDRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RWV +L +PR   EI S  ISY  Q D+  G K+AS LN+RP +
Sbjct  446  FICRWVDALSDPRATHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_010530333.1| PREDICTED: catalase-2 [Tarenaya hassleriana]
Length=492

 Score =   121 bits (303),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 75/107 (70%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AER+P P  I +GRR++C+IEKE  FKQ G+R RS  PDRQ+R
Sbjct  386  RDEEVNYFPSRYDPVRHAERYPIPPVICSGRRERCIIEKENNFKQPGERYRSFTPDRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RW+++L +PR+  EI S  ISY  Q D+  G K+AS LN+RP +
Sbjct  446  FIRRWIEALSDPRITHEIRSIWISYWSQADQSLGQKLASRLNVRPSI  492



>ref|NP_001234827.1| catalase isozyme 1 [Solanum lycopersicum]
 sp|P30264.1|CATA1_SOLLC RecName: Full=Catalase isozyme 1 [Solanum lycopersicum]
 gb|AAA34145.1| catalase [Solanum lycopersicum]
 prf||1909364A catalase
Length=492

 Score =   121 bits (303),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 72/107 (67%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEVD  P + D    AE++P P  ++ GRR  CVI KE  FKQ G+R RS  PDRQDR
Sbjct  386  RDEEVDYLPSRFDPCRPAEQYPIPSCVLNGRRTNCVIPKENNFKQAGERYRSWEPDRQDR  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            +IN+WV+SL +PRV  EI S  ISYL Q D+  G KVAS L ++P M
Sbjct  446  YINKWVESLSDPRVTHEIRSIWISYLSQADKSCGQKVASRLTVKPTM  492



>ref|XP_009597278.1| PREDICTED: catalase isozyme 1 [Nicotiana tomentosiformis]
 emb|CCP37651.1| catalase-1 [Nicotiana tabacum]
Length=492

 Score =   121 bits (303),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 74/107 (69%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEE+D FP + D    AE++P P  + TG+R+KCVI+KE  F Q G+R RS  PDRQ+R
Sbjct  386  RDEEIDYFPSRYDPVRHAEKYPIPSTMCTGKREKCVIQKENNFNQPGERYRSFTPDRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RWV++L +PR+  EI S  ISY  Q D+  G K+AS LN+RP +
Sbjct  446  FIRRWVEALSDPRITYEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>gb|KHG25152.1| Catalase isozyme 1 [Gossypium arboreum]
Length=492

 Score =   121 bits (303),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 73/107 (68%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEE++ FP + D    AE FP P  + TGRR+KC+IEKE  FKQ G+R RS A DRQ+R
Sbjct  386  RDEEINYFPSRYDPVRHAEMFPIPPAVCTGRREKCIIEKENNFKQPGERYRSWAADRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RWV++  +PRV  EI S  ISY  Q D+  G K+AS LN+RP +
Sbjct  446  FICRWVEAFSDPRVTHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_011074091.1| PREDICTED: catalase isozyme 3 isoform X2 [Sesamum indicum]
Length=492

 Score =   121 bits (303),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 75/107 (70%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D +  AER+P P  +++G+R K  IEKE  FKQ GDR RS APDRQ+R
Sbjct  386  RDEEVNYFPSRYDPSRHAERYPIPPVVLSGKRGKICIEKENNFKQPGDRYRSWAPDRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RWV++L +PR+  EI S  +SY  Q D+  G K+AS LN+RP M
Sbjct  446  FIRRWVEALSDPRLTHEIRSIWVSYWSQADKSLGQKLASRLNVRPAM  492



>gb|KGN55499.1| hypothetical protein Csa_4G658590 [Cucumis sativus]
Length=492

 Score =   120 bits (302),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 74/107 (69%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AER+P P  + TG+R++CVI+KE  FK+ G+R RS  PDRQ+R
Sbjct  386  RDEEVNYFPSRYDPARHAERYPHPPAVCTGKRERCVIQKENNFKEPGERYRSWTPDRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RWV +L +PRV  EI S  I+Y  Q DR  G K+AS LN+RP +
Sbjct  446  FIRRWVDALSDPRVTHEIRSIWITYWSQADRSVGQKLASHLNVRPSI  492



>gb|ACB11496.1| catalase [Pinus sylvestris]
Length=492

 Score =   120 bits (302),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 73/107 (68%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AERFP P    TG+R+KCVIEKE  FKQ G+R RS AP+RQ+R
Sbjct  386  RDEEVNYFPSRFDPVRHAERFPIPSHTHTGKREKCVIEKENNFKQPGERYRSFAPERQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            F+ RWV +L +PRV  EI S  ISY  Q D+  G K+A+ LN++  M
Sbjct  446  FVKRWVAALSDPRVTHEICSIWISYWSQCDKSLGQKIAARLNMKANM  492



>gb|KDP43757.1| hypothetical protein JCGZ_22384 [Jatropha curcas]
Length=492

 Score =   120 bits (302),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 74/107 (69%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AE++P P  ++TGRR+K VI KE  FKQ G+R RS  PDR+DR
Sbjct  386  RDEEVNYFPSRYDPVRHAEKYPIPPPVLTGRREKTVIPKENNFKQPGERYRSFTPDRKDR  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RWV++L +PRV  EI S  ISY  Q D+  G K+AS LN+RP M
Sbjct  446  FIRRWVEALSDPRVTYEIRSIWISYWSQADKSLGQKIASHLNMRPTM  492



>ref|XP_009110221.1| PREDICTED: catalase-3 [Brassica rapa]
 gb|AFN81244.1| catalase 2 [Brassica rapa subsp. pekinensis]
 emb|CDX96630.1| BnaA08g21730D [Brassica napus]
Length=492

 Score =   120 bits (301),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 72/107 (67%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEE++ +P K D    AE+ P P +  TG R KC+I+KE  FKQ GDR RS APDRQDR
Sbjct  386  RDEEINYYPSKFDPVRCAEKVPIPTKSYTGIRTKCIIKKENNFKQPGDRYRSWAPDRQDR  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            F+ RWV+ L EPR+  EI S  ISY  Q DR  G K+AS LN+RP +
Sbjct  446  FVKRWVEILSEPRLTHEIRSIWISYWSQADRSLGQKLASRLNVRPSI  492



>ref|XP_010498496.1| PREDICTED: catalase-3 [Camelina sativa]
 ref|XP_010459748.1| PREDICTED: catalase-3 [Camelina sativa]
 ref|XP_010477307.1| PREDICTED: catalase-3 [Camelina sativa]
Length=492

 Score =   120 bits (301),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 72/107 (67%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEE++ +P K D    AE+ P P +  TG R KC+I+KE  FKQ GDR RS APDRQDR
Sbjct  386  RDEEINYYPSKFDPVRCAEKVPIPTKSYTGIRTKCIIKKENNFKQPGDRYRSWAPDRQDR  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            F+ RWV+ L EPR+  EI S  ISY  Q DR  G K+AS LN+RP +
Sbjct  446  FVKRWVEILSEPRLTHEIRSIWISYWSQADRSLGQKLASRLNVRPSI  492



>gb|AET97564.1| catalase [Ziziphus jujuba]
Length=492

 Score =   120 bits (301),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 73/107 (68%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AE+ P P  I  G+R+KC+IEKE  FKQ G+R RS APDRQ+R
Sbjct  386  RDEEVNYFPSRYDPVRHAEQHPIPSAIFNGKREKCIIEKENNFKQPGERYRSWAPDRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RW+ +L +PRV  EI S  ISY  Q D+  G K+AS LN+RP +
Sbjct  446  FIRRWIDALSDPRVTHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|NP_001031072.3| catalase 3 [Arabidopsis thaliana]
 gb|AEE29996.1| catalase 3 [Arabidopsis thaliana]
Length=377

 Score =   119 bits (299),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 70/107 (65%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEE++ +P K D    AE+ P P    TG R KCVI+KE  FKQ GDR RS APDRQDR
Sbjct  271  RDEEINYYPSKFDPVRCAEKVPTPTNSYTGIRTKCVIKKENNFKQAGDRYRSWAPDRQDR  330

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            F+ RWV+ L EPR+  EI    ISY  Q DR  G K+AS LN+RP +
Sbjct  331  FVKRWVEILSEPRLTHEIRGIWISYWSQADRSLGQKLASRLNVRPSI  377



>gb|ADZ45555.1| catalase [Vigna radiata]
Length=492

 Score =   120 bits (300),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 72/107 (67%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AE+FP P  I +GRR+K  IEKE  FKQ G+R RS APDRQDR
Sbjct  386  RDEEVNYFPSRYDPVRHAEKFPIPPAICSGRREKIAIEKENNFKQAGERFRSWAPDRQDR  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            F  RWV +L +PRV  EI S  ISY  Q DR  G K+AS L++RP +
Sbjct  446  FTRRWVDALSDPRVTHEIRSVWISYWSQADRSLGQKIASHLSMRPNI  492



>ref|NP_001240021.1| catalase [Glycine max]
 dbj|BAG09375.1| peroxisomal catalase [Glycine max]
 gb|KHN20113.1| Catalase-4 [Glycine soja]
Length=492

 Score =   120 bits (300),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 72/107 (67%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AE FP P  I +GRR+KC IEKE  FKQ G+R RS APDRQDR
Sbjct  386  RDEEVNYFPSRYDPVRHAETFPIPPAICSGRREKCGIEKENNFKQPGERYRSWAPDRQDR  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            F  RWV +L +PRV  EI S  ISY  Q DR  G K+AS L++RP +
Sbjct  446  FNRRWVDALSDPRVTHEIRSVWISYWSQADRSLGQKIASRLSMRPNI  492



>gb|AFR53082.1| CAT [Anthurium andraeanum]
Length=492

 Score =   120 bits (300),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 75/107 (70%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AER+P   RIVTGRR+KC+IEK+  FKQ GDR RS A DRQ+R
Sbjct  386  RDEEVNYFPSRHDPLRHAERYPINNRIVTGRREKCIIEKQNDFKQPGDRYRSWAHDRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            F+ RWV++L  P+V  E+ S  +SYL + D   G KVA+ LN++P M
Sbjct  446  FVRRWVEALAHPKVSHEVRSIWVSYLSKSDVSLGQKVANRLNMKPSM  492



>gb|ADZ45556.1| catalase [Vigna radiata]
Length=492

 Score =   120 bits (300),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 72/107 (67%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AE+FP P  I +GRR+K  IEKE  FKQ G+R RS APDRQDR
Sbjct  386  RDEEVNYFPSRYDPVRHAEKFPIPPAICSGRREKIAIEKENNFKQAGERFRSWAPDRQDR  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            F  RWV +L +PRV  EI S  ISY  Q DR  G K+AS L++RP +
Sbjct  446  FTRRWVDALSDPRVTHEIRSVWISYWSQADRSLGQKIASHLSMRPNI  492



>ref|XP_007018034.1| Catalase 2 [Theobroma cacao]
 gb|EOY15259.1| Catalase 2 [Theobroma cacao]
Length=492

 Score =   120 bits (300),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 74/107 (69%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEE++ FP + D    AERFP P  + +GRR+KC+IEKE  FKQ G+R RS APDRQ+R
Sbjct  386  RDEEINYFPSRYDPVRHAERFPIPPAVCSGRREKCIIEKENNFKQPGERYRSWAPDRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RWV +L +PRV  EI S  I+Y  Q  +  G K+AS LN++P +
Sbjct  446  FICRWVDALSDPRVTHEIRSIWITYWSQACKSLGQKLASRLNVKPNI  492



>gb|AAR14052.2| catalase [Solanum tuberosum]
Length=475

 Score =   120 bits (300),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 74/107 (69%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEE+D FP + D    AE +P P  + +G+R+KC+I+KE  FKQ G+R R+  PDRQ+R
Sbjct  369  RDEEIDYFPSRYDQVRHAEVYPIPSTVCSGKREKCIIQKENNFKQPGERYRTFTPDRQER  428

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RWV++L +PR+  EI S  ISY  Q D+  G K+AS LN+RP +
Sbjct  429  FIRRWVEALSDPRITYEIRSIWISYWSQADKSLGQKLASRLNVRPSI  475



>gb|AAG43363.1|AF151368_1 catalase [Hevea brasiliensis]
Length=492

 Score =   120 bits (300),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 73/107 (68%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    +ERFP P  I +GRRDKCVIEKE  F+Q G+R RS APDRQ+R
Sbjct  386  RDEEVNYFPSRCDPVRHSERFPIPSTICSGRRDKCVIEKENNFEQPGERYRSWAPDRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            F+NR V  L +PR+  E+ S  ISY  Q DR  G K+A  LN+RP +
Sbjct  446  FLNRMVGCLSDPRITHELRSIWISYWTQCDRSLGQKLAFRLNVRPSI  492



>ref|XP_010094556.1| Catalase isozyme 1 [Morus notabilis]
 gb|EXB56310.1| Catalase isozyme 1 [Morus notabilis]
Length=492

 Score =   120 bits (300),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 74/107 (69%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            R+EEV+ FP + D    AER+P P  I TGRR++ VI+KE  FKQ G+R RS +PDRQ+R
Sbjct  386  REEEVNYFPSRYDPVRHAERYPIPSAICTGRRERTVIDKENNFKQPGERYRSFSPDRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RWV +L +PRV  EI S  ISY  Q DR  G K+AS LN+RP +
Sbjct  446  FIKRWVNALSDPRVTHEIRSIWISYWSQADRSLGQKLASRLNVRPSI  492



>gb|ABR15776.1| catalase [Litchi chinensis]
Length=291

 Score =   117 bits (294),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 71/107 (66%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEVD FP K  N   AE+FP P RI +G+R+K  IEKE  FK  GDR RS APDRQ+R
Sbjct  185  RDEEVDYFPSKFTNVANAEKFPIPGRICSGKREKACIEKENNFKLPGDRYRSWAPDRQER  244

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI R V  L +PRV  EI S  +SY  Q D+  G K+AS LN+RP +
Sbjct  245  FIKRVVDGLSDPRVTFEIRSIWVSYWSQADKSLGQKIASRLNVRPNI  291



>gb|KFK44175.1| hypothetical protein AALP_AA1G224300 [Arabis alpina]
Length=492

 Score =   119 bits (299),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 71/107 (66%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEE++ +P K D    AE+ P P +  TG R KCVI+KE  FKQ GDR RS APDRQDR
Sbjct  386  RDEEINYYPSKFDPVRCAEKVPVPSKSYTGIRTKCVIKKENNFKQPGDRYRSWAPDRQDR  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RWV+ L EPR+  EI    ISY  Q DR  G K+AS LN+RP +
Sbjct  446  FIKRWVEILSEPRLTHEIRGIWISYWSQADRSLGQKLASRLNVRPSI  492



>ref|NP_001234186.1| catalase isozyme 2 [Solanum lycopersicum]
 sp|Q9XHH3.1|CATA2_SOLLC RecName: Full=Catalase isozyme 2 [Solanum lycopersicum]
 gb|AAD41256.1| catalase 2 [Solanum lycopersicum]
Length=492

 Score =   119 bits (299),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 74/107 (69%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEE+D FP + D    AE +P P  + +G+R+KC+I+KE  FKQ G+R RS  PDRQ+R
Sbjct  386  RDEEIDYFPSRYDQVRHAEVYPIPSTVCSGKREKCIIQKENNFKQPGERYRSFTPDRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RWV++L +PR+  EI S  I+Y  Q D+  G K+AS LN+RP +
Sbjct  446  FIRRWVEALSDPRITYEIRSIWITYWSQADKSLGQKLASRLNVRPSI  492



>dbj|BAH20307.1| AT1G20620 [Arabidopsis thaliana]
Length=458

 Score =   119 bits (299),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 70/107 (65%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEE++ +P K D    AE+ P P    TG R KCVI+KE  FKQ GDR RS APDRQDR
Sbjct  352  RDEEINYYPSKFDPVRCAEKVPTPTNSYTGIRTKCVIKKENNFKQAGDRYRSWAPDRQDR  411

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            F+ RWV+ L EPR+  EI    ISY  Q DR  G K+AS LN+RP +
Sbjct  412  FVKRWVEILSEPRLTHEIRGIWISYWSQADRSLGQKLASRLNVRPSI  458



>ref|XP_010536468.1| PREDICTED: catalase-3-like [Tarenaya hassleriana]
Length=492

 Score =   119 bits (299),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 72/107 (67%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D+   A ++P P  I +G R KCVIEKE  FKQ GDR RS APDRQ+R
Sbjct  386  RDEEVNYFPSRFDSVRHAAKYPIPSAICSGERVKCVIEKENNFKQPGDRYRSWAPDRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            + NRWV++L + RV  EI    ISYL Q D+  G KVA+ LN+RP  
Sbjct  446  YANRWVEALSDARVTDEIRGIWISYLSQSDKSLGMKVANRLNVRPSF  492



>emb|CDY31488.1| BnaC05g15970D [Brassica napus]
Length=500

 Score =   119 bits (299),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 72/107 (67%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEE++ +P K D    AE+ P P +  TG R KC+I+KE  FKQ GDR RS APDRQDR
Sbjct  394  RDEEINYYPSKFDPVRCAEKVPIPNKSYTGIRTKCIIKKENNFKQPGDRYRSWAPDRQDR  453

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            F+ RWV+ L EPR+  EI S  ISY  Q DR  G K+AS LN+RP +
Sbjct  454  FVKRWVEILSEPRLTHEIRSIWISYWSQADRSLGQKLASRLNVRPSI  500



>emb|CDY33636.1| BnaC08g19360D [Brassica napus]
Length=492

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 72/107 (67%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEE++ +P K D    AE+ P P +  TG R KC+I+KE  FKQ GDR RS APDRQDR
Sbjct  386  RDEEINYYPSKFDPVRCAEKVPIPNKSYTGIRTKCIIKKENNFKQPGDRYRSWAPDRQDR  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            F+ RWV+ L EPR+  EI S  ISY  Q DR  G K+AS LN+RP +
Sbjct  446  FVKRWVEILSEPRLTHEIRSIWISYWSQADRSLGQKLASRLNVRPSI  492



>ref|XP_009103334.1| PREDICTED: catalase-3-like [Brassica rapa]
 gb|AAB53101.2| catalase [Brassica napus]
 gb|AET08935.1| catalase [Brassica napus]
Length=492

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 72/107 (67%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEE++ +P K D    AE+ P P +  TG R KC+I+KE  FKQ GDR RS APDRQDR
Sbjct  386  RDEEINYYPSKFDPVRCAEKVPIPNKSYTGIRTKCIIKKENNFKQPGDRYRSWAPDRQDR  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            F+ RWV+ L EPR+  EI S  ISY  Q DR  G K+AS LN+RP +
Sbjct  446  FVKRWVEILSEPRLTHEIRSIWISYWSQADRSLGQKLASRLNVRPSI  492



>ref|NP_564120.1| catalase 3 [Arabidopsis thaliana]
 sp|Q42547.3|CATA3_ARATH RecName: Full=Catalase-3 [Arabidopsis thaliana]
 gb|AAL08303.1| At1g20620/F5M15_4 [Arabidopsis thaliana]
 gb|AAL24212.1| At1g20620/F5M15_4 [Arabidopsis thaliana]
 gb|AEE29995.1| catalase 3 [Arabidopsis thaliana]
Length=492

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 70/107 (65%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEE++ +P K D    AE+ P P    TG R KCVI+KE  FKQ GDR RS APDRQDR
Sbjct  386  RDEEINYYPSKFDPVRCAEKVPTPTNSYTGIRTKCVIKKENNFKQAGDRYRSWAPDRQDR  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            F+ RWV+ L EPR+  EI    ISY  Q DR  G K+AS LN+RP +
Sbjct  446  FVKRWVEILSEPRLTHEIRGIWISYWSQADRSLGQKLASRLNVRPSI  492



>emb|CDY29519.1| BnaA06g14510D [Brassica napus]
Length=492

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 72/107 (67%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEE++ +P K D    AE+ P P +  TG R KC+I+KE  FKQ GDR RS APDRQDR
Sbjct  386  RDEEINYYPSKFDPVRCAEKVPIPNKSYTGIRTKCIIKKENNFKQPGDRYRSWAPDRQDR  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            F+ RWV+ L EPR+  EI S  ISY  Q DR  G K+AS LN+RP +
Sbjct  446  FVKRWVEILSEPRLTHEIRSIWISYWSQADRSLGQKLASRLNVRPSI  492



>ref|XP_006306495.1| hypothetical protein CARUB_v10012481mg [Capsella rubella]
 gb|EOA39393.1| hypothetical protein CARUB_v10012481mg [Capsella rubella]
Length=492

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 70/107 (65%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEE++ +P K D    AE+ P P    TG R KCVI+KE  FKQ GDR RS APDRQDR
Sbjct  386  RDEEINYYPSKFDPVRCAEKVPIPTNSYTGIRTKCVIKKENNFKQAGDRYRSWAPDRQDR  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            F+ RWV+ L EPR+  EI    ISY  Q DR  G K+AS LN+RP +
Sbjct  446  FVKRWVEILSEPRLTHEIRGIWISYWSQADRSLGQKLASRLNVRPSI  492



>gb|AAM65021.1| unknown [Arabidopsis thaliana]
Length=492

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 70/107 (65%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEE++ +P K D    AE+ P P    TG R KCVI+KE  FKQ GDR RS APDRQDR
Sbjct  386  RDEEINYYPSKFDPVRCAEKVPTPTNSYTGIRTKCVIKKENNFKQAGDRYRSWAPDRQDR  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            F+ RWV+ L EPR+  EI    ISY  Q DR  G K+AS LN+RP +
Sbjct  446  FVKRWVEILSEPRLTHEIRGIWISYWSQADRSLGQKLASRLNVRPSI  492



>ref|XP_011074090.1| PREDICTED: catalase isoform X1 [Sesamum indicum]
Length=513

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 74/107 (69%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AE+FP P  +++G+R K VIEKE  FKQ GDR RS APDRQ+R
Sbjct  407  RDEEVNYFPSRYDPCRHAEKFPIPPVVLSGQRVKTVIEKENNFKQPGDRYRSWAPDRQER  466

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RW+ +L +PR+  EI S  +SY  Q D+  G K+AS LN+RP M
Sbjct  467  FIRRWIDALSDPRLTAEIRSIWVSYWTQADKSLGQKLASRLNVRPAM  513



>ref|XP_008791900.1| PREDICTED: catalase isozyme 2 [Phoenix dactylifera]
Length=492

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 74/107 (69%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            R+EEVD FP + D    AERFP P R+VTG+R+K VI K+  FKQ G+R RS APDRQ+R
Sbjct  386  RNEEVDYFPSRHDPLRHAERFPIPSRVVTGKREKTVIPKQNDFKQPGERYRSWAPDRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            F+ RW +SL  P+V  E+ S  I+YL Q D   G KVA+ LN++P M
Sbjct  446  FVRRWAESLGHPKVSHELRSIWITYLTQCDVSLGQKVANRLNVKPSM  492



>gb|AAC48918.1| salicylic acid binding catalase, partial [Nicotiana tabacum]
Length=489

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 73/107 (68%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEVD  P + D    AE++P P R++TGRR+ CVIEKE  FKQ G+R RS  PDRQDR
Sbjct  383  RDEEVDYLPSRFDPCRHAEQYPIPSRVLTGRREMCVIEKENNFKQAGERYRSWEPDRQDR  442

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            ++++WV+ L +PRV  EI S  I  L Q D+  G KVAS L ++P M
Sbjct  443  YVSKWVEHLSDPRVTYEIRSIWICSLSQADKSCGQKVASRLTLKPTM  489



>ref|XP_010934843.1| PREDICTED: catalase isozyme 2 [Elaeis guineensis]
 gb|AFS65099.1| catalase 2 [Elaeis guineensis]
Length=492

 Score =   119 bits (298),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 74/107 (69%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            R+EEVD FP + D    AERFP P R+VTG+R+K VI K+  FKQ G+R RS APDRQ+R
Sbjct  386  RNEEVDYFPSRHDPLRHAERFPIPSRVVTGKREKIVIPKQNDFKQPGERYRSWAPDRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            F+ RW +SL  P+V  E+ S  I+YL Q D   G KVA+ LN++P M
Sbjct  446  FVRRWAESLGHPKVSHELRSIWITYLTQCDVSLGQKVANRLNVKPSM  492



>ref|XP_009149539.1| PREDICTED: catalase-3 [Brassica rapa]
Length=543

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 72/107 (67%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEE++ +P K D    AE+ P P +  TG R KC+I+KE  FKQ GDR RS APDRQDR
Sbjct  437  RDEEINYYPSKFDPVRCAEKVPIPNKSYTGIRTKCIIKKENNFKQPGDRYRSWAPDRQDR  496

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            F+ RWV+ L EPR+  EI S  ISY  Q DR  G K+AS LN+RP +
Sbjct  497  FVKRWVEILSEPRLTHEIRSIWISYWSQADRSLGQKLASRLNVRPSI  543



>emb|CDY01364.1| BnaA07g11370D [Brassica napus]
Length=556

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 72/107 (67%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEE++ +P K D    AE+ P P +  TG R KC+I+KE  FKQ GDR RS APDRQDR
Sbjct  450  RDEEINYYPSKFDPVRCAEKVPIPNKSYTGIRTKCIIKKENNFKQPGDRYRSWAPDRQDR  509

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            F+ RWV+ L EPR+  EI S  ISY  Q DR  G K+AS LN+RP +
Sbjct  510  FVKRWVEILSEPRLTHEIRSIWISYWSQADRSLGQKLASRLNVRPSI  556



>gb|AAF19965.1|AF207906_1 catalase 1 [Zantedeschia aethiopica]
Length=492

 Score =   119 bits (298),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 74/107 (69%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AE+FP P RI+ G R+KC I+KE  FKQ G++ RS APDRQ+R
Sbjct  386  RDEEVNYFPSRYDPVRHAEQFPIPPRILNGGREKCCIQKENNFKQPGEKYRSWAPDRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RW+ +L +PRV  EI +  I+Y  Q D+  G K+AS LNI+P +
Sbjct  446  FIKRWIDALSDPRVTHEIRTIWITYWSQCDKFLGQKLASRLNIKPTL  492



>gb|AHF27428.1| catalase, partial [Cucurbita moschata]
 gb|AHF27431.1| catalase, partial [Cucurbita maxima]
Length=344

 Score =   118 bits (295),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 74/107 (69%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D +  AER+P P  + +G+R++C+IEKE  FK+ G+R RS  PDRQ+R
Sbjct  238  RDEEVNYFPSRFDPSRHAERYPHPPAVCSGKRERCIIEKENNFKEPGERYRSWTPDRQER  297

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            F+ RWV +L + RV  EI S  ISY  Q DR  G K+AS LN+RP +
Sbjct  298  FVRRWVDALSDTRVTHEIRSIWISYWSQADRSLGQKLASHLNVRPSI  344



>emb|CDP01803.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 72/107 (67%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEVD FP + D    AE  P P  ++TGRR+K +I KE  FKQ G+R RS APDRQ+R
Sbjct  386  RDEEVDYFPSRYDPVRHAEMHPIPSAVLTGRREKTIIPKENNFKQPGERYRSFAPDRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RWV +L +PRV  EI S  ISY  Q D+  G K+AS LNIRP +
Sbjct  446  FICRWVDALSDPRVTYEIRSIWISYWSQADKSLGQKLASRLNIRPSI  492



>gb|EYU30275.1| hypothetical protein MIMGU_mgv1a005250mg [Erythranthe guttata]
Length=492

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 74/107 (69%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AE+ P P  +++G+RD+C IEKE  FKQ G+R R+ +PDRQ+R
Sbjct  386  RDEEVNYFPSRYDPCRHAEKHPIPPVVLSGKRDRCCIEKENNFKQPGERYRTFSPDRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RWV +L +PR+  EI S  ISY  Q D+  G K+AS LN+RP M
Sbjct  446  FIRRWVDALSDPRLTHEIRSIWISYWSQADKSLGQKLASRLNVRPTM  492



>ref|XP_006340832.1| PREDICTED: catalase isozyme 2 [Solanum tuberosum]
Length=492

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 74/107 (69%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEE+D FP + D    AE +P P  + +G+R+KC+I+KE  FKQ G+R R+  PDRQ+R
Sbjct  386  RDEEIDYFPSRYDQVRHAEVYPIPSTVCSGKREKCIIQKENNFKQPGERYRTFTPDRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RWV++L +PR+  EI S  I+Y  Q D+  G K+AS LN+RP +
Sbjct  446  FIRRWVEALSDPRITYEIRSIWITYWSQADKSLGQKLASRLNVRPSI  492



>dbj|BAC79443.1| catalase [Acacia ampliceps]
Length=492

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 72/107 (67%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEVD FP + D    AE+FP P   + GRRD+ +IEKE  FKQ GD  R+ APDRQ+R
Sbjct  386  RDEEVDYFPSRYDTARHAEKFPIPPVNLIGRRDRRIIEKENNFKQPGDLYRTWAPDRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RW+  L +P+V  E+ S  ISYL Q DR  G KVAS LN+RP +
Sbjct  446  FIRRWIGVLSDPKVTHEVRSIWISYLSQADRSLGQKVASHLNMRPSI  492



>emb|CAC04509.1| catalase [Digitalis lanata]
Length=265

 Score =   116 bits (290),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 71/107 (66%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AERFP P   + G+RD+  IEKE  FKQ G++ RS  PDRQ+R
Sbjct  159  RDEEVNYFPSRYDPCRHAERFPHPPVALNGKRDRICIEKENNFKQPGEKYRSFPPDRQER  218

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RWV +L +PR+  EI S  +SY  Q D+  G K+AS LNIRP M
Sbjct  219  FIKRWVDALSDPRLTHEIRSIWVSYWTQADKSLGQKLASRLNIRPTM  265



>gb|ABC01913.1| catalase isozyme 1-like protein [Solanum tuberosum]
Length=492

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 71/107 (66%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEVD  P + D    AE++P P  ++ GRR  CVI KE  FKQ G+R RS   DRQDR
Sbjct  386  RDEEVDYLPSRFDPCRPAEQYPIPACVLNGRRTNCVIPKENNFKQAGERYRSWESDRQDR  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            +IN+WV+SL +PRV  EI S  ISYL Q D+  G KVAS L ++P M
Sbjct  446  YINKWVESLSDPRVTHEIRSIWISYLSQADKSCGQKVASRLTVKPTM  492



>sp|P30567.1|CATA2_GOSHI RecName: Full=Catalase isozyme 2 [Gossypium hirsutum]
 emb|CAA39998.1| subunit 2 of cotton catalase [Gossypium hirsutum]
Length=492

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 74/107 (69%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AE+ P P  +++G+R+KC+I KE  FKQ G+R RS + DRQ+R
Sbjct  386  RDEEVNYFPSRYDPVRHAEKHPIPSTVLSGKREKCIIGKENNFKQPGERYRSFSADRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FINRW+ +L +PRV  EI S  ISY  Q D+  G K+AS LN+RP +
Sbjct  446  FINRWIDALSDPRVTHEIRSIWISYWSQADKSLGQKIASRLNVRPSI  492



>gb|AFU90822.1| catalase, partial [Populus tomentosa]
Length=487

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 71/103 (69%), Gaps = 0/103 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AE FP P  + +G+R+KC+IEKE  FKQ G+R RS APDRQ+R
Sbjct  385  RDEEVNYFPSRYDPVRHAESFPIPPAVCSGKREKCIIEKENNFKQPGERYRSWAPDRQER  444

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNI  154
            FI RWV +L +PRV  EI S  ISY  Q D+  G K+AS LN+
Sbjct  445  FICRWVDALSDPRVTHEIRSIWISYWSQADKSLGQKLASRLNV  487



>gb|KHG12976.1| Catalase isozyme 2 [Gossypium arboreum]
Length=492

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 74/107 (69%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AE+ P P  +++G+R+KC+I KE  FKQ G+R RS + DRQ+R
Sbjct  386  RDEEVNYFPSRYDPVRHAEKHPIPSTVLSGKREKCIIGKENNFKQPGERYRSFSADRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FINRW+ +L +PRV  EI S  ISY  Q D+  G K+AS LN+RP +
Sbjct  446  FINRWIDALSDPRVTHEIRSIWISYWSQADKSLGQKIASRLNVRPSI  492



>ref|XP_010523643.1| PREDICTED: catalase-2-like [Tarenaya hassleriana]
Length=492

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 75/107 (70%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AER+P P  + +GRR++C+IEKE  FKQ G+R RS  PDR++R
Sbjct  386  RDEEVNYFPSRYDPVRHAERYPVPSVVCSGRRERCIIEKENNFKQPGERYRSFTPDRKER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RW+++L +PR+  EI S  ISY  Q D+  G K+AS +N+RP +
Sbjct  446  FIRRWIEALSDPRITHEIRSIWISYWSQADQSLGQKLASRMNVRPNI  492



>gb|AHF27430.1| catalase [Cucurbita moschata]
Length=492

 Score =   118 bits (296),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 76/108 (70%), Gaps = 1/108 (1%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXX-FKQXGDRXRSXAPDRQD  286
            RDEEV+ FP + D    AE+FP P  ++TG+R++CVI KE   FKQ GDR RS APDRQD
Sbjct  385  RDEEVNYFPSRYDPCRHAEKFPMPPNVLTGKRERCVIPKENNNFKQAGDRYRSWAPDRQD  444

Query  285  RFINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            RF+ R+V++L +PRV  E+ +  ISY  Q DR  G K+AS LN+RP +
Sbjct  445  RFVKRFVEALSDPRVTHEVRNIWISYWSQADRSLGQKIASRLNVRPNI  492



>ref|XP_004238430.1| PREDICTED: catalase isozyme 3 [Solanum lycopersicum]
Length=492

 Score =   118 bits (296),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 73/107 (68%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+  P + D    AE++P P R++TG+R+K +IEKE  FKQ G+  RS APDRQ+R
Sbjct  386  RDEEVNYLPSRLDPCRHAEQYPIPPRVLTGKREKVIIEKENNFKQPGEHYRSWAPDRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            F+ RWV +L +PR   EI S  ISY  Q D+  G K+AS LNIRP M
Sbjct  446  FLCRWVDALSDPRATHEIRSIWISYWSQADKSLGQKLASRLNIRPTM  492



>gb|AHF27433.1| catalase [Cucurbita maxima]
Length=492

 Score =   118 bits (296),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 76/108 (70%), Gaps = 1/108 (1%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXX-FKQXGDRXRSXAPDRQD  286
            RDEEV+ FP + D    AE+FP P  ++TG+R++CVI KE   FKQ GDR RS APDRQD
Sbjct  385  RDEEVNYFPSRYDPCRHAEKFPMPPNVLTGKRERCVIPKENNNFKQAGDRYRSWAPDRQD  444

Query  285  RFINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            RF+ R+V++L +PRV  E+ +  ISY  Q DR  G K+AS LN+RP +
Sbjct  445  RFVKRFVEALSDPRVTHEVRNIWISYWSQADRSLGQKIASRLNVRPNI  492



>dbj|BAJ33995.1| unnamed protein product [Thellungiella halophila]
Length=492

 Score =   118 bits (295),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 76/107 (71%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AE++P P  + +G+R++C+IEKE  FK+ G+R RS AP+RQ+R
Sbjct  386  RDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCIIEKENNFKEPGERYRSFAPERQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RW+++L +PR+  EI S  ISY  Q D+  G K+AS LN+RP +
Sbjct  446  FIRRWIEALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>gb|AIX10947.1| putative catalase [Gardenia jasminoides]
Length=492

 Score =   118 bits (295),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 73/107 (68%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEE+D FP + D    AER P P R++TGRR++ VIEKE  FKQ  +R RS APDRQ+R
Sbjct  386  RDEEIDYFPSRYDPVRHAERHPIPTRVLTGRRERRVIEKENNFKQPVERYRSWAPDRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            F+ RWV +L +PR+  EI S  ISY  Q D+  G K+A  LN+RP M
Sbjct  446  FVRRWVDALSDPRLTHEIRSIWISYWSQADKSLGQKIAFRLNVRPTM  492



>ref|XP_006412153.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
 gb|ESQ53606.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
Length=492

 Score =   118 bits (295),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 76/107 (71%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AE++P P  + +G+R++C+IEKE  FK+ G+R RS AP+RQ+R
Sbjct  386  RDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCIIEKENNFKEPGERYRSFAPERQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RW+++L +PR+  EI S  ISY  Q D+  G K+AS LN+RP +
Sbjct  446  FIRRWIEALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>gb|ABK24453.1| unknown [Picea sitchensis]
Length=492

 Score =   118 bits (295),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 71/107 (66%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AERFP P    +G R+KCVIEKE  FKQ G+R RS  PDRQ+R
Sbjct  386  RDEEVNYFPSRFDPVRHAERFPIPSHTHSGMREKCVIEKENNFKQPGERYRSFEPDRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            F+ RWV +L +PRV  EI S  ISY  Q D+  G K+A+ LN++  M
Sbjct  446  FVKRWVAALSDPRVTHEICSIWISYWSQSDKSLGQKIAARLNMKANM  492



>gb|AAD30292.1|AF139539_1 catalase 3 [Raphanus sativus]
Length=492

 Score =   118 bits (295),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 71/107 (66%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEE++ +P K D    AE+ P P +  TG R KC+I+KE  FKQ GDR RS APDRQDR
Sbjct  386  RDEEINYYPSKFDPVRCAEKVPIPNKSYTGIRTKCIIKKENNFKQAGDRYRSWAPDRQDR  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            F+ RWV+ L EPR+  EI S  ISY  Q D   G K+AS LN+RP +
Sbjct  446  FVKRWVEILSEPRLTHEIRSIWISYWSQADASLGQKLASRLNVRPSI  492



>gb|AEQ30070.1| catalase, partial [Litchi chinensis]
Length=487

 Score =   118 bits (295),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 71/107 (66%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEVD FP K  N   AE+FP P RI +G+R+K  IEKE  FK  GDR RS APDRQ+R
Sbjct  381  RDEEVDYFPSKFTNVANAEKFPIPGRICSGKREKACIEKENNFKLPGDRYRSWAPDRQER  440

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI R V  L +PRV  EI S  +SY  Q D+  G K+AS LN+RP +
Sbjct  441  FIKRVVDGLSDPRVTFEIRSIWVSYWSQADKSLGQKIASRLNVRPNI  487



>gb|AAD37788.1|AF149283_1 catalase 1 [Phaseolus vulgaris]
Length=428

 Score =   117 bits (294),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 70/102 (69%), Gaps = 0/102 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AER P P RI+ G+R+KC+IEKE  FKQ G+R RS A DRQ+R
Sbjct  327  RDEEVNYFPSRYDPVRHAERIPVPPRILDGKREKCMIEKENNFKQPGERYRSWASDRQER  386

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLN  157
            F+ RWV +L EPRV  EI S  ISY  Q DR  G K+AS LN
Sbjct  387  FLRRWVDALSEPRVTHEIRSIWISYWSQADRSLGQKIASHLN  428



>emb|CDY17510.1| BnaC03g65530D [Brassica napus]
Length=477

 Score =   117 bits (294),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 75/107 (70%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AE++P P  + +G+R++CVIEKE  FK+ G+R RS  P+RQ+R
Sbjct  371  RDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCVIEKENNFKEPGERYRSFTPERQER  430

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RW+++L +PR+  EI S  ISY  Q D+  G K+AS LN+RP +
Sbjct  431  FIRRWIEALSDPRITHEIRSIWISYWSQADKTLGQKLASHLNVRPSI  477



>gb|ACV30589.1| catalase [Carica papaya]
Length=170

 Score =   113 bits (282),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 73/108 (68%), Gaps = 1/108 (1%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTG-RRDKCVIEKEXXFKQXGDRXRSXAPDRQD  286
            RDEEV+  P K D    AER+P P ++ +  +R+KC+IEK+  FKQ G+R R+  PDRQ+
Sbjct  63   RDEEVNYHPSKFDPVTNAERYPIPTKVYSACKREKCIIEKQNDFKQPGERYRTFEPDRQE  122

Query  285  RFINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            RFINRWVK+L EPR+  EI S  I +L + D   G KVA  LNIRP +
Sbjct  123  RFINRWVKALSEPRITHEIRSIWIDWLSRADESLGRKVAMRLNIRPSI  170



>sp|P48350.1|CATA1_CUCPE RecName: Full=Catalase isozyme 1 [Cucurbita pepo]
 dbj|BAA09506.1| catalase [Cucurbita pepo]
Length=492

 Score =   117 bits (294),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 74/107 (69%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D +  AER+P P  + +G+R++C+IEKE  FK+ G+R RS  PDRQ+R
Sbjct  386  RDEEVNYFPSRFDPSRHAERYPHPPAVCSGKRERCIIEKENNFKEPGERYRSWTPDRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            F+ RWV +L + RV  EI S  ISY  Q DR  G K+AS LN+RP +
Sbjct  446  FVRRWVDALSDTRVTHEIRSIWISYWSQADRSLGQKLASHLNVRPSI  492



>pir||S40265 catalase (EC 1.11.1.6) - eggplant
Length=502

 Score =   118 bits (295),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 71/101 (70%), Gaps = 0/101 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEVD  P + D    AE++P P  ++TGRR+KCVI KE  FKQ G+R R+  PDRQDR
Sbjct  386  RDEEVDYLPSRFDPCRPAEQYPIPSCVLTGRREKCVIPKENNFKQAGERYRTWEPDRQDR  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXL  160
            +IN+WV+SL +PRV  EI S  ISYL Q D+  G KVAS L
Sbjct  446  YINKWVESLSDPRVTHEIRSIWISYLSQADKSCGQKVASRL  486



>sp|P48352.1|CATA3_CUCPE RecName: Full=Catalase isozyme 3 [Cucurbita pepo]
 dbj|BAA09508.1| catalase [Cucurbita pepo]
Length=492

 Score =   117 bits (294),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 76/108 (70%), Gaps = 1/108 (1%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXX-FKQXGDRXRSXAPDRQD  286
            RDEEV+ FP + D    AE+FP P  ++TG+R++CVI KE   FKQ GDR RS APDRQD
Sbjct  385  RDEEVNYFPSRYDPCRHAEKFPMPPNVLTGKRERCVIPKENNNFKQAGDRYRSWAPDRQD  444

Query  285  RFINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            RF+ R+V++L +PRV  E+ +  ISY  Q DR  G K+AS LN+RP +
Sbjct  445  RFVKRFVEALSDPRVTDEVRNIWISYWSQADRSLGQKIASRLNVRPNI  492



>gb|ACJ73906.1| CAT2 [Solanum nigrum]
Length=315

 Score =   116 bits (290),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 70/107 (65%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEVD  P + D    AE++P P  ++ G R  CV  KE  FKQ G+R RS  PDRQDR
Sbjct  209  RDEEVDYLPSRFDPCRPAEQYPIPSCVLNGPRTMCVTPKENNFKQAGERYRSWEPDRQDR  268

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            +IN+WV+SL +PRV  EI S  ISYL Q D+  G KVAS L ++P M
Sbjct  269  YINKWVESLSDPRVTHEIPSIWISYLSQADKSCGQKVASRLTVKPPM  315



>ref|XP_006828714.1| hypothetical protein AMTR_s00001p00022550 [Amborella trichopoda]
 gb|ERM96130.1| hypothetical protein AMTR_s00001p00022550 [Amborella trichopoda]
Length=492

 Score =   117 bits (294),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 74/107 (69%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEVD FP + D    AER P P ++V+G+R++CVIEKE  FKQ GDR RS APDRQ+R
Sbjct  386  RDEEVDYFPSRFDPVRHAERCPLPPQLVSGKRERCVIEKENNFKQPGDRYRSFAPDRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            F+ R V +L + RV  EI S  ISY  Q D+  G K+A+ LNI+P M
Sbjct  446  FVKRIVDALSDTRVTHEIRSIWISYWSQCDKSLGQKIATRLNIKPHM  492



>ref|XP_007046520.1| Catalase 2 [Theobroma cacao]
 gb|EOX90677.1| Catalase 2 [Theobroma cacao]
Length=492

 Score =   117 bits (294),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 75/107 (70%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AE++P P  I +G+R+KC+I+KE  F+Q G+R RS APDRQ+R
Sbjct  386  RDEEVNYFPSRFDPVRHAEKYPIPTAICSGKREKCIIDKENNFQQPGERYRSFAPDRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RWV +L +PRV  EI S  ISY  + D+  G K+AS L++RP +
Sbjct  446  FIYRWVDALSDPRVTYEIRSIWISYWSKADKSLGQKLASRLSVRPSI  492



>ref|XP_010941422.1| PREDICTED: catalase isozyme B [Elaeis guineensis]
Length=492

 Score =   117 bits (294),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 74/107 (69%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AERFP P R++TG+R+KCVI KE  FKQ G+R RS  P RQ+R
Sbjct  386  RDEEVNYFPSRYDPVRHAERFPLPPRVLTGKREKCVIGKENNFKQPGERYRSFDPARQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            F++RWV++L + RV  EI    I+Y  Q D+  G K+A+ LN+RP M
Sbjct  446  FVHRWVEALSDTRVTHEIRGIWITYWSQCDKSLGQKLATRLNMRPSM  492



>ref|NP_001237556.1| catalase-1/2 [Glycine max]
 sp|P29756.1|CATA1_SOYBN RecName: Full=Catalase-1/2 [Glycine max]
 emb|CAA78056.1| catalase [Glycine max]
 gb|AAB88169.1| catalase [Glycine max]
 gb|AAB88170.1| catalase [Glycine max]
 gb|KHN48523.1| Catalase-1/2 [Glycine soja]
Length=492

 Score =   117 bits (294),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 73/107 (68%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AE+ P P RI+ G+R+KC+IEKE  FKQ G+R RS   DRQ+R
Sbjct  386  RDEEVNYFPSRYDPVRHAEKVPVPPRILGGKREKCMIEKENNFKQPGERYRSWPSDRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            F+ RWV +L +PRV  EI S  ISY  Q DR  G K+AS LN++P +
Sbjct  446  FVRRWVDALSDPRVTHEIRSIWISYWSQADRSLGQKIASHLNLKPSI  492



>emb|CDY31878.1| BnaC07g15280D [Brassica napus]
Length=492

 Score =   117 bits (294),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 71/107 (66%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEE++ +P K D    AE+ P P +  TG R KC+I+KE  FKQ GDR RS APDRQDR
Sbjct  386  RDEEINYYPSKFDPVRCAEKAPIPNKSYTGIRTKCIIKKENNFKQPGDRYRSWAPDRQDR  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            F+ RWV+ L EPR+  EI    ISY  Q DR  G K+AS LN+RP +
Sbjct  446  FVKRWVEILSEPRLTHEIRGIWISYWSQADRSLGQKLASRLNVRPSI  492



>gb|AAM97541.1| catalase 2, partial [Capsicum annuum]
Length=484

 Score =   117 bits (293),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 74/107 (69%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEE+D FP + D    AE +P P  + +G+R+KC+I+KE  F+Q G+R RS + DRQ+R
Sbjct  378  RDEEIDYFPSRYDPVRHAENYPIPTTVCSGKREKCIIQKENNFQQPGERYRSFSADRQER  437

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RWV++L +PR+  EI S  ISY  Q D+  G K+AS LN+RP +
Sbjct  438  FIRRWVEALSDPRITYEIRSIWISYWSQADKSLGQKLASRLNVRPSI  484



>ref|XP_004500876.1| PREDICTED: catalase-4-like isoform X1 [Cicer arietinum]
Length=493

 Score =   117 bits (293),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 73/107 (68%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AERFP P   ++G+R++C+  KE  FKQ G+R R+ APDRQDR
Sbjct  387  RDEEVNYFPSRHDPVRHAERFPTPPAALSGKRERCIRPKENNFKQPGERYRTWAPDRQDR  446

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            F  RW+++L +PRV  E+ S  ISY  Q DR  G K+AS LN+RP +
Sbjct  447  FARRWIEALSDPRVTHEVRSIWISYWSQADRSLGQKIASHLNMRPSI  493



>gb|KFK30147.1| catalase [Arabis alpina]
Length=492

 Score =   117 bits (293),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 75/107 (70%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AE++P P  + +G+R++CVIEKE  FK+ G+R RS  P+RQ+R
Sbjct  386  RDEEVNYFPSRYDTVRHAEKYPAPPAVCSGKRERCVIEKENNFKEPGERYRSFPPERQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RW+++L +PR+  EI S  ISY  Q D+  G K+AS LN+RP +
Sbjct  446  FIRRWIEALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_004500877.1| PREDICTED: catalase-4-like isoform X2 [Cicer arietinum]
Length=492

 Score =   117 bits (293),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 73/107 (68%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AERFP P   ++G+R++C+  KE  FKQ G+R R+ APDRQDR
Sbjct  386  RDEEVNYFPSRHDPVRHAERFPTPPAALSGKRERCIRPKENNFKQPGERYRTWAPDRQDR  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            F  RW+++L +PRV  E+ S  ISY  Q DR  G K+AS LN+RP +
Sbjct  446  FARRWIEALSDPRVTHEVRSIWISYWSQADRSLGQKIASHLNMRPSI  492



>emb|CDX76313.1| BnaA08g10870D [Brassica napus]
Length=477

 Score =   117 bits (293),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 75/107 (70%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AE++P P  + +G+R++CVIEKE  FK+ G+R RS  P+RQ+R
Sbjct  371  RDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCVIEKENNFKEPGERYRSFTPERQER  430

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RW+++L +PR+  EI S  ISY  Q D+  G K+AS LN+RP +
Sbjct  431  FIRRWIEALSDPRITHEIRSIWISYWSQADKTLGQKLASRLNVRPSI  477



>gb|AAD30291.2|AF139538_1 catalase 2 [Raphanus sativus]
Length=492

 Score =   117 bits (293),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 71/107 (66%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEE++ +P K D    AE+ P P +  TG R KCVI+KE  FKQ GDR RS APDRQDR
Sbjct  386  RDEEINYYPSKFDPVRCAEKVPIPSKSYTGIRTKCVIKKENNFKQAGDRYRSWAPDRQDR  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            F+ RWV+ L E R+  EI S  ISY  Q DR  G K+AS LN+RP +
Sbjct  446  FVKRWVEILSELRLTHEIRSIWISYWSQADRSLGQKLASRLNVRPSI  492



>ref|NP_001274863.1| catalase isozyme 1 [Solanum tuberosum]
 gb|ABY21246.1| catalase isozyme [Solanum tuberosum]
Length=492

 Score =   117 bits (293),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 71/107 (66%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEVD FP + D    AE++P P  ++ GRR  CVI KE   KQ G+R RS   DRQDR
Sbjct  386  RDEEVDYFPSRFDPCRPAEQYPIPACVLNGRRTNCVIPKENNSKQAGERYRSWESDRQDR  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            +IN+WV+SL +PRV  EI S  ISYL Q D+  G KVAS L ++P M
Sbjct  446  YINKWVESLSDPRVTHEIRSIWISYLSQADKSCGQKVASRLTVKPTM  492



>gb|AFU90823.1| catalase, partial [Populus x beijingensis]
Length=446

 Score =   117 bits (292),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 71/103 (69%), Gaps = 0/103 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AE FP P  + +G+R++C+IEKE  FKQ G+R RS APDRQ+R
Sbjct  344  RDEEVNYFPSRYDPVRHAESFPIPPAVCSGKRERCIIEKENNFKQPGERYRSWAPDRQER  403

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNI  154
            FI RWV +L +PRV  EI S  ISY  Q D+  G K+AS LN+
Sbjct  404  FICRWVDALSDPRVTHEIRSIWISYWSQADKSLGQKLASRLNV  446



>sp|P49284.1|CATA1_SOLTU RecName: Full=Catalase isozyme 1 [Solanum tuberosum]
 gb|AAA80650.1| catalase [Solanum tuberosum]
Length=492

 Score =   117 bits (293),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 71/107 (66%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEVD FP + D    AE++P P  ++ GRR  CVI KE   KQ G+R RS   DRQDR
Sbjct  386  RDEEVDYFPSRFDPCRPAEQYPIPACVLNGRRTNCVIPKENNSKQAGERYRSWESDRQDR  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            +IN+WV+SL +PRV  EI S  ISYL Q D+  G KVAS L ++P M
Sbjct  446  YINKWVESLSDPRVTHEIRSIWISYLSQADKSCGQKVASRLTVKPTM  492



>gb|ACJ76836.3| catalase [Dimocarpus longan]
Length=492

 Score =   117 bits (293),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 71/107 (66%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEVD FP K  N   AE+FP P RI +G+R+K  IEKE  FK  GDR RS APDRQ+R
Sbjct  386  RDEEVDYFPSKFTNVANAEKFPIPSRICSGKREKACIEKENNFKLPGDRYRSWAPDRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI R V  L +PRV  E+ S  +SY  Q D+  G K+AS LN+RP +
Sbjct  446  FIKRVVDGLSDPRVTFELRSIWVSYWSQADKSLGQKIASRLNVRPNI  492



>ref|NP_001291326.1| catalase isozyme 1 [Sesamum indicum]
 gb|AFJ42575.1| catalase [Sesamum indicum]
Length=492

 Score =   117 bits (293),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 75/107 (70%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D T  +E +P P  +++G+R+K  IEKE  FKQ G+R RS APDRQ+R
Sbjct  386  RDEEVNYFPSRYDPTRHSEMYPIPPVVLSGKREKRCIEKENNFKQPGERYRSWAPDRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RWV++L +PR+  EI S  ISY  Q D+  G K+AS LN+RP M
Sbjct  446  FIRRWVEALSDPRLTHEIRSIWISYWSQADKSLGQKLASRLNVRPTM  492



>ref|XP_002437631.1| hypothetical protein SORBIDRAFT_10g030840 [Sorghum bicolor]
 gb|EER88998.1| hypothetical protein SORBIDRAFT_10g030840 [Sorghum bicolor]
Length=492

 Score =   117 bits (293),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 72/107 (67%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D T  AE+ P P R++TG R+KC+IEKE  FKQ G+R RS  P RQDR
Sbjct  386  RDEEVNYFPSRFDPTRHAEKVPIPSRVLTGCREKCIIEKENNFKQAGERFRSFDPARQDR  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RWV +L +PRV  E  +  I+Y  Q D   G K+AS LN++P M
Sbjct  446  FIQRWVDALSDPRVTHEHHTIWINYWSQCDASLGQKLASRLNLKPNM  492



>emb|CDX72514.1| BnaC07g45360D [Brassica napus]
Length=480

 Score =   117 bits (292),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 74/107 (69%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AE++P P  + +G+R++CVIEKE  FK+ G+R RS  P+RQ+R
Sbjct  374  RDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCVIEKENNFKEPGERYRSFTPERQER  433

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RW+ +L +PR+  EI S  ISY  Q D+  G K+AS LN+RP +
Sbjct  434  FIGRWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  480



>gb|AAD17935.1| catalase [Brassica juncea]
Length=492

 Score =   117 bits (293),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 75/107 (70%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AE++P P  + +G+R++CVIEKE  FK+ G+R RS  P+RQ+R
Sbjct  386  RDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCVIEKENNFKEPGERYRSFTPERQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RW+++L +PR+  EI S  ISY  Q D+  G K+AS LN+RP +
Sbjct  446  FIRRWIEALSDPRITHEIRSIWISYWSQADKTLGQKLASRLNVRPSI  492



>ref|XP_002521709.1| catalase, putative [Ricinus communis]
 gb|EEF40696.1| catalase, putative [Ricinus communis]
Length=492

 Score =   117 bits (293),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 74/107 (69%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AE+ P P RI++G+R+KC+I KE  FKQ G+R RS  PDR++R
Sbjct  386  RDEEVNYFPSRYDPARHAEQHPIPPRILSGKREKCIILKENNFKQPGERYRSFTPDRKER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RWV++L + R+  EI S  ISY  Q D+  G K+AS LN+RP M
Sbjct  446  FIRRWVEALTDTRITYEIRSIWISYWSQADKSLGQKLASHLNMRPTM  492



>gb|ACV92695.1| catalase [Brassica oleracea]
Length=492

 Score =   117 bits (292),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 74/107 (69%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AE++P P  + +G+R++CVIEKE  FK+ G+R RS  P+RQ+R
Sbjct  386  RDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCVIEKENNFKEPGERYRSFTPERQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RW+ +L +PR+  EI S  ISY  Q D+  G K+AS LN+RP +
Sbjct  446  FIGRWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_009106100.1| PREDICTED: catalase-2 [Brassica rapa]
Length=492

 Score =   117 bits (292),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 74/107 (69%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AE++P P  + +G+R++CVIEKE  FK+ G+R RS  P+RQ+R
Sbjct  386  RDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCVIEKENNFKEPGERYRSFTPERQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RW+ +L +PR+  EI S  ISY  Q D+  G K+AS LN+RP +
Sbjct  446  FIGRWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPNI  492



>ref|XP_002867092.1| hypothetical protein ARALYDRAFT_491144 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43351.1| hypothetical protein ARALYDRAFT_491144 [Arabidopsis lyrata subsp. 
lyrata]
Length=492

 Score =   117 bits (292),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 75/107 (70%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AE++P P  + +G+R++C+IEKE  FK+ G+R RS  P+RQ+R
Sbjct  386  RDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCIIEKENNFKEPGERYRSFTPERQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RW+++L +PR+  EI S  ISY  Q D+  G K+AS LN+RP +
Sbjct  446  FIQRWIEALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>prf||2104177A catalase
Length=492

 Score =   117 bits (292),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/105 (53%), Positives = 73/105 (70%), Gaps = 0/105 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEE+D FP + D    AE++P P   ++G+RDKCVIEKE  FKQ G+R RS +PDRQ+R
Sbjct  386  RDEEIDYFPSRYDPARHAEQYPIPPVRLSGKRDKCVIEKENNFKQPGERYRSFSPDRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRP  148
            FINR V  L +PRV  E+ S  +SY  Q D+  G K+AS LN++P
Sbjct  446  FINRVVGGLSDPRVTHEVRSIWVSYWSQADKSLGQKIASRLNVKP  490



>gb|AAB86582.2| catalase [Raphanus sativus]
Length=491

 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 74/107 (69%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AE++P P  + +G+R++C+IEKE  FK+ G+R RS  P+RQ+R
Sbjct  385  RDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCIIEKENNFKEPGERYRSFTPERQER  444

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RW+ +L +PR+  EI S  ISY  Q D+  G K+AS LN+RP +
Sbjct  445  FIGRWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  491



>gb|AAF79625.1|AC027665_26 F5M15.5 [Arabidopsis thaliana]
 gb|AAF80611.1|AC069251_4 F2D10.11 [Arabidopsis thaliana]
Length=1013

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 69/105 (66%), Gaps = 0/105 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEE++ +P K D    AE+ P P    TG R KCVI+KE  FKQ GDR RS APDRQDR
Sbjct  425  RDEEINYYPSKFDPVRCAEKVPTPTNSYTGIRTKCVIKKENNFKQAGDRYRSWAPDRQDR  484

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRP  148
            F+ RWV+ L EPR+  EI    ISY  Q DR  G K+AS LN+RP
Sbjct  485  FVKRWVEILSEPRLTHEIRGIWISYWSQADRSLGQKLASRLNVRP  529


 Score =   105 bits (262),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 69/105 (66%), Gaps = 0/105 (0%)
 Frame = -1

Query  462   RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
             RDEEV+ FP + D    AE++P    + +G R+KC I KE  FKQ G+R RS   DRQ+R
Sbjct  907   RDEEVNYFPSRLDPVRHAEKYPTTPIVCSGNREKCFIGKENNFKQPGERYRSWDSDRQER  966

Query  282   FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRP  148
             F+ R+V++L EPRV  EI S  ISY  Q D+  G K+A+ LN+RP
Sbjct  967   FVKRFVEALSEPRVTHEIRSIWISYWSQADKSLGQKLATRLNVRP  1011



>gb|AAF71742.1|AF248491_1 catalase [Raphanus sativus]
Length=492

 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 74/107 (69%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AE++P P  + +G+R++C+IEKE  FK+ G+R RS  P+RQ+R
Sbjct  386  RDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCIIEKENNFKEPGERYRSFTPERQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RW+ +L +PR+  EI S  ISY  Q D+  G K+AS LN+RP +
Sbjct  446  FIGRWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>sp|P45739.1|CATA_HELAN RecName: Full=Catalase [Helianthus annuus]
 gb|AAA69866.1| catalase [Helianthus annuus]
Length=492

 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/105 (53%), Positives = 73/105 (70%), Gaps = 0/105 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEE+D FP + D    AE++P P   ++G+RDKCVIEKE  FKQ G+R RS +PDRQ+R
Sbjct  386  RDEEIDYFPSRYDPARHAEQYPIPPVRLSGKRDKCVIEKENNFKQPGERYRSFSPDRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRP  148
            FINR V  L +PRV  E+ S  +SY  Q D+  G K+AS LN++P
Sbjct  446  FINRVVGGLSDPRVTHEVRSIWVSYWSQADKSLGQKIASRLNVKP  490



>emb|CAA64220.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 74/107 (69%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AE++P P  + +G+R++CVIEKE  FK+ G+R R+  P+RQ+R
Sbjct  386  RDEEVNYFPSRYDQVRHAEKYPTPPAVCSGKRERCVIEKENNFKEPGERYRTFTPERQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RW+ +L +PR+  EI S  ISY  Q D+  G K+AS LN+RP +
Sbjct  446  FIQRWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>dbj|BAJ87148.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=302

 Score =   115 bits (287),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 72/107 (67%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D T  AE++P P R+++G R+KC+I+KE  FKQ G+R RS  P RQDR
Sbjct  196  RDEEVNYFPSRFDPTRHAEKYPMPPRVLSGCREKCIIDKENNFKQAGERYRSFDPARQDR  255

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            F+ RWV +L + RV  EI S  +SY  Q D   G K+AS L I+P M
Sbjct  256  FLQRWVDALTDARVTHEIQSIWVSYWSQCDASLGQKLASRLKIKPNM  302



>ref|XP_004300681.1| PREDICTED: catalase isozyme 1 [Fragaria vesca subsp. vesca]
Length=492

 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/105 (54%), Positives = 70/105 (67%), Gaps = 0/105 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AE  P P  + TGRR+K +IEKE  FKQ G+R RS APDRQ+R
Sbjct  386  RDEEVNYFPSRFDPVRHAESHPIPSAVYTGRREKSIIEKENNFKQAGERYRSFAPDRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRP  148
            +I RWV +L +PR   EI S  ISY  Q D+  G K+AS LN+RP
Sbjct  446  YIRRWVDALSDPRCTHEIRSIWISYWSQADKSLGQKLASHLNVRP  490



>ref|NP_001235974.1| catalase-3 [Glycine max]
 sp|O48560.1|CATA3_SOYBN RecName: Full=Catalase-3 [Glycine max]
 gb|AAB88171.1| catalase [Glycine max]
 gb|KHN12602.1| Catalase-3 [Glycine soja]
Length=492

 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 72/107 (67%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AER P P R + G+R+KC+IEKE  FKQ G+R RS   DRQ+R
Sbjct  386  RDEEVNYFPSRYDPVRHAERVPVPPRTLGGKREKCMIEKENNFKQPGERYRSWPSDRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            F+ RWV +L +PRV  EI S  ISY  Q DR  G K+AS LN++P +
Sbjct  446  FVRRWVDALSDPRVTHEIRSIWISYWSQADRSLGQKIASHLNLKPSI  492



>ref|XP_006283612.1| hypothetical protein CARUB_v10004668mg [Capsella rubella]
 gb|EOA16510.1| hypothetical protein CARUB_v10004668mg [Capsella rubella]
Length=492

 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 75/107 (70%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AE++P P  + +G+R++CVIEKE  FK+ G+R RS  P+RQ+R
Sbjct  386  RDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCVIEKENNFKEPGERYRSFPPERQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RW+++L +PR+  EI S  ISY  Q D+  G K+AS LN+RP +
Sbjct  446  FIRRWIEALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>emb|CDY40645.1| BnaA03g53180D [Brassica napus]
Length=485

 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 74/107 (69%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AE++P P  + +G+R++C+IEKE  FK+ G+R RS  P+RQ+R
Sbjct  379  RDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCIIEKENNFKEPGERYRSFTPERQER  438

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RW+ +L +PR+  EI S  ISY  Q D+  G K+AS LN+RP +
Sbjct  439  FIGRWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPNI  485



>gb|AIU99481.1| catalase [Saccharum spontaneum]
Length=492

 Score =   116 bits (291),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 56/107 (52%), Positives = 71/107 (66%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AE+ P P R++TG R+KC+I+KE  FKQ G+R RS  P RQDR
Sbjct  386  RDEEVNYFPSRFDPARHAEKVPIPTRVLTGCREKCIIQKENNFKQAGERYRSFDPARQDR  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RWV +L +PRV  E  +  ISY  Q D   G K+AS LN++P M
Sbjct  446  FIQRWVDALSDPRVTHEHHTIWISYWSQCDASLGQKLASRLNLKPNM  492



>ref|XP_009138342.1| PREDICTED: catalase-2 [Brassica rapa]
 gb|AAD17934.1| catalase [Brassica juncea]
Length=492

 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 74/107 (69%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AE++P P  + +G+R++C+IEKE  FK+ G+R RS  P+RQ+R
Sbjct  386  RDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCIIEKENNFKEPGERYRSFTPERQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RW+ +L +PR+  EI S  ISY  Q D+  G K+AS LN+RP +
Sbjct  446  FIGRWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPNI  492



>gb|AIU99480.1| catalase [Saccharum spontaneum]
Length=492

 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 71/107 (66%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AE+ P P R++TG R+KC+I+KE  FKQ G+R RS  P RQDR
Sbjct  386  RDEEVNYFPSRFDPARHAEKVPIPTRVLTGCREKCIIQKENNFKQAGERYRSFDPARQDR  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RWV +L +PRV  E  +  ISY  Q D   G K+AS LN++P M
Sbjct  446  FIQRWVDALSDPRVTHEHHTIWISYWSQCDASLGQKLASRLNLKPNM  492



>emb|CDP07288.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 70/107 (65%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEVD FP + D    A R P P  ++ G+RD+CVI KE  FKQ G+R RS APDRQ+R
Sbjct  386  RDEEVDYFPSRFDPVRHAARHPIPSTVLRGKRDRCVIPKENNFKQAGERYRSWAPDRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RWV  L + RV  EI S  ISY  Q D+  G K+A+ LN+RP M
Sbjct  446  FICRWVDILSDARVTHEIRSIWISYWSQADKSLGQKMATRLNVRPTM  492



>sp|P55312.1|CATA2_SOLTU RecName: Full=Catalase isozyme 2 [Solanum tuberosum]
Length=492

 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 70/107 (65%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEVD  P + D    AE++P P  ++ GRR  CVI KE  FKQ G+R RS   DRQDR
Sbjct  386  RDEEVDYLPSRFDPCRPAEQYPIPACVLNGRRTNCVIPKENNFKQAGERYRSWESDRQDR  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            +I +WV+SL +PRV  EI S  ISYL Q D+  G KVAS L ++P M
Sbjct  446  YITKWVESLSDPRVTHEIRSIWISYLSQADKSCGQKVASRLTVKPTM  492



>emb|CAA45564.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 74/107 (69%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AE++P P  + +G+R++C+IEKE  FK+ G+R R+  P+RQ+R
Sbjct  386  RDEEVNYFPSRYDQVRHAEKYPTPPAVCSGKRERCIIEKENNFKEPGERYRTFTPERQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RW+ +L +PR+  EI S  ISY  Q D+  G K+AS LN+RP +
Sbjct  446  FIQRWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>emb|CAA85470.1| catalase [Solanum tuberosum]
Length=491

 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 70/107 (65%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEVD  P + D    AE++P P  ++ GRR  CVI KE  FKQ G+R RS   DRQDR
Sbjct  385  RDEEVDYLPSRFDPCRPAEQYPIPACVLNGRRTNCVIPKENNFKQAGERYRSWESDRQDR  444

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            +I +WV+SL +PRV  EI S  ISYL Q D+  G KVAS L ++P M
Sbjct  445  YITKWVESLSDPRVTHEIRSIWISYLSQADKSCGQKVASRLTVKPTM  491



>gb|AAR97905.1| catalase [Solanum tuberosum]
Length=492

 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 70/107 (65%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEVD  P + D    AE++P P  ++ GRR  CVI KE  FKQ G+R RS   DRQDR
Sbjct  386  RDEEVDYLPSRFDPCRPAEQYPIPACVLNGRRTNCVIPKENNFKQAGERYRSWESDRQDR  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            +I +WV+SL +PRV  EI S  ISYL Q D+  G KVAS L ++P M
Sbjct  446  YITKWVESLSDPRVTHEIRSIWISYLSQADKSCGQKVASRLTVKPTM  492



>gb|AIM43584.1| catalase [Saccharum hybrid cultivar Yacheng05-179]
Length=492

 Score =   116 bits (290),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 56/107 (52%), Positives = 71/107 (66%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AE+ P P R++TG R+KC+I+KE  FKQ G+R RS  P RQDR
Sbjct  386  RDEEVNYFPSRFDPARHAEKVPIPTRVLTGCREKCIIQKENNFKQAGERYRSFDPARQDR  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RWV +L +PRV  E  +  ISY  Q D   G K+AS LN++P M
Sbjct  446  FIQRWVDALSDPRVTHEHHTIWISYWSQCDASLGQKLASRLNLKPNM  492



>gb|AIU99485.1| catalase [Saccharum spontaneum]
Length=492

 Score =   116 bits (290),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 56/107 (52%), Positives = 71/107 (66%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AE+ P P R++TG R+KC+I+KE  FKQ G+R RS  P RQDR
Sbjct  386  RDEEVNYFPSRFDPARHAEKVPIPTRVLTGCREKCIIQKENNFKQAGERYRSFDPARQDR  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RWV +L +PRV  E  +  ISY  Q D   G K+AS LN++P M
Sbjct  446  FIQRWVDALSDPRVTHEHHTIWISYWSQCDASLGQKLASRLNLKPNM  492



>ref|XP_010534184.1| PREDICTED: catalase isozyme 3-like [Tarenaya hassleriana]
Length=492

 Score =   116 bits (290),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 55/105 (52%), Positives = 71/105 (68%), Gaps = 0/105 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D+   A ++P P  + +G R KCVIEKE  FKQ G+R RS APDRQ+R
Sbjct  386  RDEEVNYFPSRFDSVRHAAKYPIPSAVCSGERIKCVIEKENNFKQPGERYRSWAPDRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRP  148
            +  RWV++L + RV  EI    ISYL Q D+  G KVA+ LN+RP
Sbjct  446  YAKRWVEALSDARVTDEIRGVWISYLSQSDKSLGMKVANRLNVRP  490



>gb|AAK96854.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 74/107 (69%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AE++P P  + +G+R++C+IEKE  FK+ G+R R+  P+RQ+R
Sbjct  386  RDEEVNYFPSRYDQVRHAEKYPTPPAVCSGKRERCIIEKENNFKEPGERYRTFTPERQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RW+ +L +PR+  EI S  ISY  Q D+  G K+AS LN+RP +
Sbjct  446  FIQRWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>gb|AIU99484.1| catalase [Saccharum arundinaceum]
Length=492

 Score =   116 bits (290),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 56/107 (52%), Positives = 71/107 (66%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AE+ P P R++TG R+KC+I+KE  FKQ G+R RS  P RQDR
Sbjct  386  RDEEVNYFPSRFDPARHAEKVPIPTRVLTGCREKCIIQKENNFKQAGERYRSFDPARQDR  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RWV +L +PRV  E  +  ISY  Q D   G K+AS LN++P M
Sbjct  446  FIQRWVDALSDPRVTHEHHTIWISYWSQCDASLGQKLASRLNLKPNM  492



>prf||1906388A catalase
Length=492

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 74/107 (69%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AE++P P  + +G+R++C+IEKE  FK+ G+R R+  P+RQ+R
Sbjct  386  RDEEVNYFPSRYDQVRHAEKYPTPPAVCSGKRERCIIEKENNFKEPGERYRTFTPERQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RW+ +L +PR+  EI S  ISY  Q D+  G K+AS LN+RP +
Sbjct  446  FIQRWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>gb|AIU99488.1| catalase [Saccharum hybrid cultivar ROC22]
Length=492

 Score =   116 bits (290),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 56/107 (52%), Positives = 71/107 (66%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AE+ P P R++TG R+KC+I+KE  FKQ G+R RS  P RQDR
Sbjct  386  RDEEVNYFPSRFDPARHAEKVPIPTRVLTGCREKCIIQKENNFKQAGERYRSFDPARQDR  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RWV +L +PRV  E  +  ISY  Q D   G K+AS LN++P M
Sbjct  446  FIQRWVGALSDPRVTHEHHTIWISYWSQCDASLGQKLASRLNLKPNM  492



>ref|XP_010692544.1| PREDICTED: catalase-like [Beta vulgaris subsp. vulgaris]
Length=492

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 72/107 (67%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEE+D FP + D    AERFP P  I+ GRR+K +I KE  FK+ G R RS  P RQDR
Sbjct  386  RDEEIDYFPSRFDPLREAERFPIPTAIIHGRREKQIIPKENNFKEPGVRYRSWDPARQDR  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            F+ R+VK+L +PR+  EI S  +SYL Q D+  G KVAS LNIRP M
Sbjct  446  FVGRFVKALSDPRLTYEIRSIWVSYLTQADKSLGMKVASRLNIRPTM  492



>ref|NP_195235.1| catalase 2 [Arabidopsis thaliana]
 sp|P25819.3|CATA2_ARATH RecName: Full=Catalase-2 [Arabidopsis thaliana]
 emb|CAA17773.1| catalase [Arabidopsis thaliana]
 emb|CAB80226.1| catalase [Arabidopsis thaliana]
 gb|AAL66998.1| putative catalase [Arabidopsis thaliana]
 gb|AAM44902.1| putative catalase [Arabidopsis thaliana]
 gb|AEE86462.1| catalase 2 [Arabidopsis thaliana]
Length=492

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 74/107 (69%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AE++P P  + +G+R++C+IEKE  FK+ G+R R+  P+RQ+R
Sbjct  386  RDEEVNYFPSRYDQVRHAEKYPTPPAVCSGKRERCIIEKENNFKEPGERYRTFTPERQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RW+ +L +PR+  EI S  ISY  Q D+  G K+AS LN+RP +
Sbjct  446  FIQRWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_006656514.1| PREDICTED: catalase isozyme B-like [Oryza brachyantha]
Length=492

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 70/107 (65%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AE+ P P R++TG R+KCVI KE  FKQ G+R RS  P RQDR
Sbjct  386  RDEEVNYFPSRFDAARHAEKVPVPPRVLTGCREKCVINKENNFKQAGERYRSFDPARQDR  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RWV +L +PR+  E+    ISY  Q D   G K+AS LN++P M
Sbjct  446  FIQRWVDALSDPRITHELRGIWISYWSQCDASLGQKLASRLNLKPNM  492



>gb|AFW69584.1| catalase1 [Zea mays]
Length=353

 Score =   115 bits (287),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 71/107 (66%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AE+ P P R++TG R+KC+I+KE  FKQ G+R RS  P RQDR
Sbjct  247  RDEEVNYFPSRFDPARHAEKVPIPPRVLTGCREKCIIQKENNFKQAGERYRSFDPARQDR  306

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RWV +L +PRV  E  +  ISY  Q D   G K+AS LN++P M
Sbjct  307  FIQRWVDALTDPRVTHEHRTIWISYWSQCDAALGQKLASRLNLKPSM  353



>gb|AAD17936.1| catalase [Brassica juncea]
Length=492

 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 74/107 (69%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AE++P P  I +G+R++C+IEKE  FK+ G+R RS  P+RQ+R
Sbjct  386  RDEEVNYFPSRYDPVRHAEKYPTPPAICSGKRERCIIEKENNFKEPGERYRSFTPERQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RW+ +L +PR+  EI S  ISY  Q D+  G K+A+ LN+RP +
Sbjct  446  FIGRWIDALSDPRITHEIRSIWISYWSQADKSLGQKLANRLNVRPSI  492



>sp|Q01297.2|CATA1_RICCO RecName: Full=Catalase isozyme 1 [Ricinus communis]
 gb|AAB31537.1| catalase 1 [Ricinus communis=castor beans, hypocotyls, Peptide, 
492 aa]
 dbj|BAA04697.1| catalase CAT1 [Ricinus communis]
Length=492

 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 73/107 (68%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AE FP P  I +G+R+KCVIEKE  FKQ G+R RS APDRQ+R
Sbjct  386  RDEEVNYFPSRCDPARNAESFPVPSAICSGKREKCVIEKENNFKQPGERYRSWAPDRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            F+NR V  L +PR+  E+ +  ISY  Q D+  G K+A+ LN++P +
Sbjct  446  FLNRLVGGLSDPRITHELRTIWISYWIQCDKSLGQKLATRLNVKPSI  492



>gb|AAC49807.1| catalase 3 [Arabidopsis thaliana]
 gb|AAC17732.1| catalase 3 [Arabidopsis thaliana]
Length=492

 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 69/107 (64%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEE++ +P K D    AE+ P P    TG R KCVI+KE  FKQ GDR RS APDRQDR
Sbjct  386  RDEEINYYPSKFDPVRCAEKVPTPTNSYTGIRTKCVIKKENNFKQAGDRYRSWAPDRQDR  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            F+ RWV+ L EPR+  EI     SY  + DR  G K+AS LN+RP +
Sbjct  446  FVKRWVEILSEPRLTHEIRGIWTSYWLKADRSLGQKLASRLNVRPSI  492



>gb|ACL35349.1| catalase [Picea glauca]
Length=492

 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 70/107 (65%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AERFP P    +G R+KCVIEKE  FKQ G+R RS  PDRQ+R
Sbjct  386  RDEEVNYFPSRFDPVRHAERFPIPSHTHSGMREKCVIEKENNFKQPGERYRSFEPDRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            F+ RWV +L +PRV  EI S  I Y  Q D+  G K+A+ LN++  M
Sbjct  446  FVKRWVAALSDPRVTHEICSIWIFYWSQSDKSLGQKIAARLNMKANM  492



>gb|AIU99479.1| catalase [Saccharum arundinaceum]
Length=492

 Score =   115 bits (289),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 56/107 (52%), Positives = 71/107 (66%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AE+ P P R++TG R+KC+I+KE  FKQ G+R RS  P RQDR
Sbjct  386  RDEEVNYFPSRFDPARHAEKVPIPSRVLTGCREKCIIQKENNFKQAGERYRSFDPARQDR  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RWV +L +PRV  E  +  ISY  Q D   G K+AS LN++P M
Sbjct  446  FIQRWVDALSDPRVTHEHHTIWISYWSQCDASLGQKLASRLNLKPNM  492



>gb|ADU56198.1| catalase [Musa acuminata AAA Group]
Length=492

 Score =   115 bits (289),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 57/104 (55%), Positives = 68/104 (65%), Gaps = 0/104 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEVD FP +      AERFP P R VTGRR+K  I K+  FKQ G+R RS  PDRQDR
Sbjct  386  RDEEVDYFPSRQTPLRHAERFPIPTRPVTGRREKITIHKQNDFKQPGERYRSWTPDRQDR  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIR  151
            F+ RW ++L  P+V  E+ S  ISYL Q D   G KVA+ LN+R
Sbjct  446  FVRRWAEALGHPKVSHELRSIWISYLSQCDTSLGMKVANRLNMR  489



>gb|ABM47415.1| catalase [Prunus avium]
Length=492

 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 74/107 (69%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AERFP P  I+TG+R++ VIEKE  FKQ G+R RS APDRQ+R
Sbjct  386  RDEEVNYFPSRYDPVRHAERFPIPSNILTGKRERRVIEKENNFKQPGERYRSWAPDRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI R V +L +PRV  EI S  ISY  Q D+  G K+A+ LN+RP +
Sbjct  446  FIRRCVDALSDPRVSHEIRSIWISYWSQADKSLGQKIATRLNVRPSI  492



>gb|AAD50974.1|AF170272_1 catalase CAT1 [Manihot esculenta]
Length=492

 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 72/107 (67%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEVD FP + D    AER P P  I +GRR+KCVIEKE  FKQ G+R RS APDRQ+R
Sbjct  386  RDEEVDYFPSRYDPVRHAERSPIPNAICSGRREKCVIEKENNFKQPGERYRSWAPDRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            F+ R V +L EPR+  EI S  +SY  + D   G K+AS LN+RP +
Sbjct  446  FLCRLVNALSEPRITFEIRSIWVSYWSKCDASLGQKLASRLNVRPNI  492



>ref|XP_002890395.1| F5M15.5 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66654.1| F5M15.5 [Arabidopsis lyrata subsp. lyrata]
Length=981

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 69/105 (66%), Gaps = 0/105 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEE++ +P K D    AE+ P P    TG R KCVI+KE  FKQ GDR RS APDRQDR
Sbjct  393  RDEEINYYPSKFDPVRCAEKAPIPTNSYTGIRTKCVIKKENNFKQAGDRYRSWAPDRQDR  452

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRP  148
            F+ RWV+ L EPR+  EI    ISY  Q DR  G K+AS LN+RP
Sbjct  453  FVKRWVEILSEPRLTHEIRGIWISYWSQADRSLGQKLASRLNVRP  497


 Score =   105 bits (261),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 69/105 (66%), Gaps = 0/105 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AE++P    + TG R+KC I KE  F+Q G+R RS   DRQ+R
Sbjct  875  RDEEVNYFPSRLDPVRHAEKYPTTPIVCTGNREKCFIGKENNFQQPGERYRSWDSDRQER  934

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRP  148
            F+ R+V++L EPRV  EI S  ISY  Q D+  G K+A+ LN+RP
Sbjct  935  FVKRFVEALSEPRVTHEIRSIWISYWSQADKSLGQKLATRLNVRP  979



>gb|AHF21552.1| catalase [Hylocereus undatus]
Length=492

 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 71/107 (66%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEE+D FP K D    AE++P   ++ TG+R+K VI KE  FKQ GDR RS  P RQ+R
Sbjct  386  RDEEIDYFPSKFDPARQAEKYPILTKVYTGKREKTVIPKENNFKQPGDRYRSWDPARQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            F+ RWV  L +PRV  E+ S  +SYL Q DR  G KVA+ LN+RP M
Sbjct  446  FVKRWVDVLSDPRVTLELRSIWVSYLSQCDRSLGMKVATRLNMRPTM  492



>sp|A2YH64.2|CATA2_ORYSI RecName: Full=Catalase isozyme B; Short=CAT-B [Oryza sativa Indica 
Group]
 gb|EEC81340.1| hypothetical protein OsI_24526 [Oryza sativa Indica Group]
Length=492

 Score =   115 bits (288),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 71/107 (66%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AE+ P P R++TG R+KCVI+KE  FKQ G+R RS  P RQDR
Sbjct  386  RDEEVNYFPSRFDAARHAEKVPIPPRVLTGCREKCVIDKENNFKQAGERYRSFDPARQDR  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            F+ RWV +L +PR+  E+    ISY  Q D   G K+AS LN++P M
Sbjct  446  FLQRWVDALSDPRITHELRGIWISYWSQCDASLGQKLASRLNLKPNM  492



>gb|AAY59707.1| catalase [Oryza sativa Indica Group]
Length=492

 Score =   115 bits (288),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 71/107 (66%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AE+ P P R++TG R+KCVI+KE  FKQ G+R RS  P RQDR
Sbjct  386  RDEEVNYFPSRFDAARHAEKVPIPPRVLTGCREKCVIDKENNFKQAGERYRSFDPARQDR  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            F+ RWV +L +PR+  E+    ISY  Q D   G K+AS LN++P M
Sbjct  446  FLQRWVDALSDPRITHELRGIWISYWSQCDASLGQKLASRLNLKPNM  492



>gb|AAC17729.1| catalase 1, partial [Hordeum vulgare subsp. vulgare]
Length=398

 Score =   114 bits (286),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 72/107 (67%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D T  AE++P P R+++G R+KC+I+KE  FKQ G+R RS  P RQDR
Sbjct  292  RDEEVNYFPSRFDPTRHAEKYPMPPRVLSGCREKCIIDKENNFKQAGERYRSFDPARQDR  351

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            F+ RWV +L + RV  EI S  +SY  Q D   G K+AS L I+P M
Sbjct  352  FLQRWVDALTDARVTHEIQSIWVSYWSQCDASLGQKLASRLKIKPNM  398



>sp|P55307.1|CATA1_HORVU RecName: Full=Catalase isozyme 1 [Hordeum vulgare]
 gb|AAA96947.1| catalase [Hordeum vulgare subsp. vulgare]
 dbj|BAJ84783.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK08157.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97380.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=492

 Score =   115 bits (288),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 55/107 (51%), Positives = 72/107 (67%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D T  AE++P P R+++G R+KC+I+KE  FKQ G+R RS  P RQDR
Sbjct  386  RDEEVNYFPSRFDPTRHAEKYPMPPRVLSGCREKCIIDKENNFKQAGERYRSFDPARQDR  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            F+ RWV +L + RV  EI S  +SY  Q D   G K+AS L I+P M
Sbjct  446  FLQRWVDALTDARVTHEIQSIWVSYWSQCDASLGQKLASRLKIKPNM  492



>gb|ADU56199.1| catalase [Hevea brasiliensis]
Length=492

 Score =   115 bits (288),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 73/107 (68%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AE++P P  I++G  +KCVI KE  FKQ G+R RS + DR++R
Sbjct  386  RDEEVNYFPSRYDPVRHAEKYPIPSAILSGNCEKCVIPKENNFKQPGERYRSFSSDRKER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RWV+++ +PRV  EI S  ISY  Q D+  G K+AS LN+RP M
Sbjct  446  FIRRWVEAMSDPRVTYEIRSIWISYWYQADKSLGQKIASHLNMRPTM  492



>ref|NP_001241808.1| catalase isozyme B [Zea mays]
 gb|ACG48924.1| catalase isozyme B [Zea mays]
 gb|ACN25578.1| unknown [Zea mays]
 gb|AFW69583.1| catalase1 [Zea mays]
Length=492

 Score =   115 bits (287),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 71/107 (66%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AE+ P P R++TG R+KC+I+KE  FKQ G+R RS  P RQDR
Sbjct  386  RDEEVNYFPSRFDPARHAEKVPIPPRVLTGCREKCIIQKENNFKQAGERYRSFDPARQDR  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RWV +L +PRV  E  +  ISY  Q D   G K+AS LN++P M
Sbjct  446  FIQRWVDALTDPRVTHEHRTIWISYWSQCDAALGQKLASRLNLKPSM  492



>emb|CDY52649.1| BnaAnng11640D [Brassica napus]
Length=449

 Score =   114 bits (286),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 73/107 (68%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AE++P P  + +G+R++CVIEKE  FK+ G+R RS  P+R +R
Sbjct  343  RDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCVIEKENNFKEPGERYRSFTPERLER  402

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RW+ +L +PR+  EI S  ISY  Q D+  G K+AS LN+RP +
Sbjct  403  FIGRWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPNI  449



>emb|CAA42720.1| catalase-1 [Zea mays]
Length=492

 Score =   115 bits (287),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 71/107 (66%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AE+ P P R++TG R+KC+I+KE  FKQ G+R RS  P RQDR
Sbjct  386  RDEEVNYFPSRFDPARHAEKVPIPPRVLTGCREKCIIQKENNFKQAGERYRSFDPARQDR  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RWV +L +PRV  E  +  ISY  Q D   G K+AS LN++P M
Sbjct  446  FIQRWVDALTDPRVTHEHRTIWISYWSQCDAALGQKLASRLNLKPSM  492



>gb|KGN55500.1| hypothetical protein Csa_4G658600 [Cucumis sativus]
Length=405

 Score =   114 bits (286),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 53/104 (51%), Positives = 71/104 (68%), Gaps = 0/104 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEE++ FP + D T  AER+P P  + TG+R++CVIEKE  FKQ G+R RS   DRQ+R
Sbjct  299  RDEEINYFPSRIDPTRHAERYPQPSAVYTGKRERCVIEKENNFKQPGERYRSWPSDRQER  358

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIR  151
            F+ RWV +L +PRV  EI +  ISY  Q D+  G K+AS  N++
Sbjct  359  FVGRWVDALSDPRVTHEIRNIWISYWSQADKSLGHKLASHFNLK  402



>ref|XP_006342134.1| PREDICTED: catalase isozyme 3-like [Solanum tuberosum]
Length=492

 Score =   115 bits (287),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 72/107 (67%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AE++P P R++TG+R+K +IEKE  FKQ G+  RS AP RQ+R
Sbjct  386  RDEEVNYFPSRLDPCRHAEQYPIPPRVLTGKREKVIIEKENNFKQPGEHYRSWAPGRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            F+ RWV +L + R   EI S  ISY  Q D+  G K+AS LNIRP M
Sbjct  446  FVCRWVDALSDLRATHEIRSIWISYWSQADKSLGQKLASRLNIRPTM  492



>gb|AIU99482.1| catalase [Saccharum hybrid cultivar ROC22]
Length=492

 Score =   115 bits (287),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 70/107 (65%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AE+ P P R+ TG R+KC+I+KE  FKQ G+R RS  P RQDR
Sbjct  386  RDEEVNYFPSRFDPARHAEKVPIPTRVQTGCREKCIIQKENNFKQAGERYRSFDPARQDR  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RWV +L +PRV  E  +  ISY  Q D   G K+AS LN++P M
Sbjct  446  FIQRWVDALSDPRVTHEHHTIWISYWSQCDASLGQKLASRLNLKPNM  492



>gb|KJB17473.1| hypothetical protein B456_003G002800 [Gossypium raimondii]
Length=492

 Score =   115 bits (287),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 72/107 (67%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AE+ P P  + +G+R+KC+I KE  FKQ G+R RS + DRQ+R
Sbjct  386  RDEEVNYFPSRYDPVRHAEKHPIPSTVYSGKREKCIIGKENNFKQPGERYRSFSADRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FINRW+ +L + RV  EI S  ISY  Q D+  G K+AS LN+RP +
Sbjct  446  FINRWIDALSDSRVTHEIRSIWISYWSQADKSLGQKIASRLNVRPSI  492



>ref|XP_006473794.1| PREDICTED: catalase isozyme 1-like isoform X4 [Citrus sinensis]
Length=492

 Score =   115 bits (287),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 69/107 (64%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEE+D FP + D    AE  P P  I  GRR+KC+I KE  FKQ G+R RS APDRQ+R
Sbjct  386  RDEEIDYFPSRYDPVRHAEMHPTPPEICGGRREKCIIPKENNFKQPGERYRSWAPDRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RWV +L +PRV  EI    ISY  Q  +  G K+AS LN+RP +
Sbjct  446  FICRWVDALSDPRVTHEIRHIWISYWSQACKSLGQKLASRLNVRPNI  492



>ref|XP_009392261.1| PREDICTED: catalase isozyme A-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=492

 Score =   115 bits (287),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 71/107 (66%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEVD FP +      AE+FP P R+VTGRR+K VI K+  FKQ G+R RS   DRQ+R
Sbjct  386  RDEEVDYFPSRHSTLRHAEKFPIPNRVVTGRREKTVIPKQNDFKQPGERYRSWESDRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RW ++L  P+V  E+ S  ISYL Q D   G +VA+ LN+RP M
Sbjct  446  FIRRWAEALGHPKVSYELRSIWISYLSQCDATLGQRVANHLNMRPNM  492



>ref|XP_006435363.1| hypothetical protein CICLE_v10000951mg [Citrus clementina]
 gb|ESR48603.1| hypothetical protein CICLE_v10000951mg [Citrus clementina]
 gb|KDO85096.1| hypothetical protein CISIN_1g042356mg [Citrus sinensis]
Length=492

 Score =   115 bits (287),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 69/107 (64%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEE+D FP + D    AE  P P  I  GRR+KC+I KE  FKQ G+R RS APDRQ+R
Sbjct  386  RDEEIDYFPSRYDPVRHAEMHPTPPEICGGRREKCIIPKENNFKQPGERYRSWAPDRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RWV +L +PRV  EI    ISY  Q  +  G K+AS LN+RP +
Sbjct  446  FICRWVDALSDPRVTHEIRHIWISYWSQACKSLGQKLASRLNVRPNI  492



>emb|CAG23920.1| catalase [Festuca arundinacea]
Length=492

 Score =   115 bits (287),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 71/107 (66%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEVD FP + D    A R+P P R + GRR+K VIEKE  FKQ G+R RS  P RQ+R
Sbjct  386  RDEEVDYFPSRFDPATDAPRYPIPSRTLNGRREKMVIEKENNFKQPGERYRSMDPARQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FINRW+ +L +PR+  EI +  +SY  Q DR  G K+A  L+++P M
Sbjct  446  FINRWIDALSDPRLTHEIKAIWLSYWSQADRSLGQKLAGRLSVKPSM  492



>ref|XP_008452957.1| PREDICTED: catalase isozyme 1-like [Cucumis melo]
Length=492

 Score =   114 bits (286),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 54/104 (52%), Positives = 71/104 (68%), Gaps = 0/104 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AER+P P  + TG+R++CVIEKE  FKQ G+R RS   DRQ+R
Sbjct  386  RDEEVNYFPSRIDPAHHAERYPQPPAVYTGKRERCVIEKENNFKQPGERYRSWPADRQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIR  151
            F+ RWV +L +PRV  EI +  ISY  Q D+  G K+AS LN++
Sbjct  446  FVGRWVDALSDPRVTHEIRNIWISYWSQADKSLGQKLASRLNVK  489



>ref|XP_008464839.1| PREDICTED: catalase isozyme 3 [Cucumis melo]
 gb|ADN33988.1| catalase [Cucumis melo subsp. melo]
Length=492

 Score =   114 bits (286),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 55/108 (51%), Positives = 76/108 (70%), Gaps = 1/108 (1%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXX-FKQXGDRXRSXAPDRQD  286
            RDEEV+ FP + D    AE+FP P  +++G+R++CVI KE   FKQ GDR RS APDRQ+
Sbjct  385  RDEEVNYFPSRYDPCRHAEKFPMPPNVLSGKRERCVIPKENHNFKQAGDRYRSWAPDRQE  444

Query  285  RFINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            RF+ R+V++L +PRV  E+ +  ISY  Q DR  G K+AS +N+RP +
Sbjct  445  RFVRRFVEALSDPRVTHEVRNIWISYWSQADRSLGQKIASRMNVRPSI  492



>ref|XP_006473791.1| PREDICTED: catalase isozyme 1-like isoform X1 [Citrus sinensis]
 ref|XP_006473792.1| PREDICTED: catalase isozyme 1-like isoform X2 [Citrus sinensis]
 ref|XP_006473793.1| PREDICTED: catalase isozyme 1-like isoform X3 [Citrus sinensis]
Length=512

 Score =   114 bits (286),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 69/107 (64%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEE+D FP + D    AE  P P  I  GRR+KC+I KE  FKQ G+R RS APDRQ+R
Sbjct  406  RDEEIDYFPSRYDPVRHAEMHPTPPEICGGRREKCIIPKENNFKQPGERYRSWAPDRQER  465

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RWV +L +PRV  EI    ISY  Q  +  G K+AS LN+RP +
Sbjct  466  FICRWVDALSDPRVTHEIRHIWISYWSQACKSLGQKLASRLNVRPNI  512



>ref|XP_010437527.1| PREDICTED: catalase-2 [Camelina sativa]
Length=492

 Score =   114 bits (286),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 73/107 (68%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AE++P P  + +G+R++CVI KE  FK+ G+R RS  P+RQ+R
Sbjct  386  RDEEVNYFPSRYDQVRHAEKYPAPPAVCSGKRERCVIAKENNFKEPGERYRSFPPERQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RW+ +L +PR+  EI S  ISY  Q D+  G K+AS LN+RP +
Sbjct  446  FICRWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>gb|AFN81243.1| catalase 1 [Brassica rapa subsp. pekinensis]
Length=492

 Score =   114 bits (286),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 74/107 (69%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AE++P P  + +G+R++CVIEKE  FK+ G+R RS  P+RQ+R
Sbjct  386  RDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCVIEKENNFKEPGERYRSFTPERQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RW+++L +PR+  EI S  I Y  Q D+  G K+AS LN+RP +
Sbjct  446  FIRRWIEALFDPRITHEIRSIWIFYWSQADKTFGQKLASRLNVRPSI  492



>ref|XP_010432341.1| PREDICTED: catalase-2-like [Camelina sativa]
Length=492

 Score =   114 bits (286),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 73/107 (68%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AE++P P  + +G+R++CVI KE  FK+ G+R RS  P+RQ+R
Sbjct  386  RDEEVNYFPSRYDQVRHAEKYPAPPAVCSGKRERCVIAKENNFKEPGERYRSFPPERQER  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            FI RW+ +L +PR+  EI S  ISY  Q D+  G K+AS LN+RP +
Sbjct  446  FICRWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_004144240.1| PREDICTED: catalase isozyme 3-like [Cucumis sativus]
Length=483

 Score =   114 bits (285),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 55/108 (51%), Positives = 76/108 (70%), Gaps = 1/108 (1%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXX-FKQXGDRXRSXAPDRQD  286
            RDEEV+ FP + D    AE+FP P  +++G+R++CVI KE   FKQ GDR RS APDRQ+
Sbjct  376  RDEEVNYFPSRYDPCRHAEKFPMPPNVLSGKRERCVIPKENHNFKQAGDRYRSWAPDRQE  435

Query  285  RFINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            RF+ R+V++L +PRV  E+ +  ISY  Q DR  G K+AS +N+RP +
Sbjct  436  RFVRRFVEALSDPRVTHEVRNIWISYWSQADRSLGQKIASRMNVRPNI  483



>dbj|BAA34204.1| catalase [Oryza sativa Japonica Group]
Length=492

 Score =   114 bits (285),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 71/107 (66%), Gaps = 0/107 (0%)
 Frame = -1

Query  462  RDEEVDXFPXKXDNTXXAERFPXPLRIVTGRRDKCVIEKEXXFKQXGDRXRSXAPDRQDR  283
            RDEEV+ FP + D    AE+ P P R++TG R+KCVI+KE  F+Q G+R RS  P RQDR
Sbjct  386  RDEEVNYFPSRFDAARHAEKVPIPPRVLTGCREKCVIDKENNFQQAGERYRSFDPARQDR  445

Query  282  FINRWVKSLXEPRVXXEIXSTXISYLXQXDRXXGXKVASXLNIRPXM  142
            F+ RWV +L +PR+  E+    ISY  Q D   G K+AS LN++P M
Sbjct  446  FLQRWVDALSDPRITHELRGIWISYWSQCDASLGQKLASRLNLKPNM  492



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 559272306750