BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF028D10

Length=665
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006482261.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    258   2e-80   Citrus sinensis [apfelsine]
ref|XP_006482260.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    258   2e-80   Citrus sinensis [apfelsine]
gb|KDO58994.1|  hypothetical protein CISIN_1g014118mg                   258   2e-80   Citrus sinensis [apfelsine]
gb|KDO58997.1|  hypothetical protein CISIN_1g014118mg                   258   2e-80   Citrus sinensis [apfelsine]
gb|KDO58996.1|  hypothetical protein CISIN_1g014118mg                   258   2e-80   Citrus sinensis [apfelsine]
ref|XP_006430788.1|  hypothetical protein CICLE_v10011886mg             256   6e-80   Citrus clementina [clementine]
ref|XP_006430787.1|  hypothetical protein CICLE_v10011886mg             256   6e-80   
ref|XP_006430789.1|  hypothetical protein CICLE_v10011886mg             256   7e-80   Citrus clementina [clementine]
ref|XP_002282352.1|  PREDICTED: ubiquitin receptor RAD23c isoform X2    254   3e-79   Vitis vinifera
ref|XP_010647738.1|  PREDICTED: ubiquitin receptor RAD23c isoform X1    254   3e-79   Vitis vinifera
ref|XP_009631150.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    254   5e-79   Nicotiana tomentosiformis
ref|XP_010044267.1|  PREDICTED: ubiquitin receptor RAD23d-like          254   5e-79   Eucalyptus grandis [rose gum]
ref|XP_002312393.1|  hypothetical protein POPTR_0008s11840g             252   5e-79   
gb|KDO58998.1|  hypothetical protein CISIN_1g014118mg                   254   6e-79   Citrus sinensis [apfelsine]
ref|XP_010103792.1|  Putative DNA repair protein RAD23-3                254   7e-79   Morus notabilis
ref|XP_009631151.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    252   1e-78   
ref|XP_011022044.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    252   2e-78   Populus euphratica
ref|XP_007046249.1|  Rad23 UV excision repair protein family isof...    252   2e-78   
emb|CDP19777.1|  unnamed protein product                                251   3e-78   Coffea canephora [robusta coffee]
ref|NP_001242098.1|  uncharacterized protein LOC100813881               251   8e-78   
ref|NP_001240201.1|  uncharacterized protein LOC100809066               250   1e-77   Glycine max [soybeans]
ref|XP_006584606.1|  PREDICTED: uncharacterized protein LOC100813...    250   1e-77   
ref|XP_006584608.1|  PREDICTED: uncharacterized protein LOC100813...    250   1e-77   
gb|ACU18529.1|  unknown                                                 249   1e-77   Glycine max [soybeans]
ref|XP_006584607.1|  PREDICTED: uncharacterized protein LOC100813...    249   1e-77   
gb|KHG17760.1|  Putative DNA repair RAD23-3 -like protein               243   5e-77   Gossypium arboreum [tree cotton]
ref|XP_003555895.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    249   5e-77   Glycine max [soybeans]
gb|KHN15504.1|  Putative DNA repair protein RAD23-3                     249   7e-77   Glycine soja [wild soybean]
ref|XP_002529115.1|  uv excision repair protein rad23, putative         249   7e-77   Ricinus communis
ref|XP_006584604.1|  PREDICTED: uncharacterized protein LOC100813...    250   8e-77   
ref|XP_006584605.1|  PREDICTED: uncharacterized protein LOC100813...    250   9e-77   Glycine max [soybeans]
gb|KJB80000.1|  hypothetical protein B456_013G076800                    247   1e-76   Gossypium raimondii
gb|KJB79998.1|  hypothetical protein B456_013G076800                    247   1e-76   Gossypium raimondii
ref|XP_009791274.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    248   1e-76   Nicotiana sylvestris
ref|XP_011070815.1|  PREDICTED: ubiquitin receptor RAD23c-like          248   2e-76   
gb|EPS71284.1|  hypothetical protein M569_03474                         247   2e-76   Genlisea aurea
gb|KJB79994.1|  hypothetical protein B456_013G076500                    247   2e-76   Gossypium raimondii
ref|XP_006367045.1|  PREDICTED: ubiquitin receptor RAD23c-like          247   2e-76   
ref|XP_009791275.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    246   2e-76   Nicotiana sylvestris
ref|XP_003536688.1|  PREDICTED: ubiquitin receptor RAD23c               247   2e-76   Glycine max [soybeans]
gb|KJB80004.1|  hypothetical protein B456_013G076900                    246   2e-76   Gossypium raimondii
gb|KDP32945.1|  hypothetical protein JCGZ_12976                         246   2e-76   Jatropha curcas
gb|KJB80005.1|  hypothetical protein B456_013G076900                    246   3e-76   Gossypium raimondii
gb|KHN05574.1|  Putative DNA repair protein RAD23-3                     247   3e-76   Glycine soja [wild soybean]
gb|KJB79996.1|  hypothetical protein B456_013G076600                    244   5e-76   Gossypium raimondii
ref|XP_004236965.1|  PREDICTED: ubiquitin receptor RAD23c               246   7e-76   Solanum lycopersicum
gb|AFK43607.1|  unknown                                                 239   1e-75   Lotus japonicus
gb|KJB79995.1|  hypothetical protein B456_013G076600                    245   1e-75   Gossypium raimondii
ref|XP_002516727.1|  uv excision repair protein rad23, putative         243   4e-75   Ricinus communis
ref|XP_004497101.1|  PREDICTED: putative DNA repair protein RAD23...    244   5e-75   Cicer arietinum [garbanzo]
ref|XP_006378490.1|  hypothetical protein POPTR_0010s13610g             242   5e-75   
ref|XP_011099561.1|  PREDICTED: ubiquitin receptor RAD23c-like          243   5e-75   Sesamum indicum [beniseed]
ref|XP_010525156.1|  PREDICTED: ubiquitin receptor RAD23c-like          244   5e-75   Tarenaya hassleriana [spider flower]
ref|XP_007033284.1|  Rad23 UV excision repair protein family isof...    246   5e-75   
gb|KDO58993.1|  hypothetical protein CISIN_1g014118mg                   243   5e-75   Citrus sinensis [apfelsine]
gb|ABD96960.1|  hypothetical protein                                    244   9e-75   Tarenaya spinosa
ref|XP_002315945.2|  hypothetical protein POPTR_0010s13610g             243   1e-74   
ref|XP_011007998.1|  PREDICTED: ubiquitin receptor RAD23d-like          242   1e-74   Populus euphratica
ref|XP_011035052.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    242   1e-74   Populus euphratica
ref|XP_008230399.1|  PREDICTED: ubiquitin receptor RAD23d               242   2e-74   Prunus mume [ume]
ref|XP_011035051.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    242   2e-74   Populus euphratica
ref|XP_011035054.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    240   2e-74   Populus euphratica
ref|XP_002305813.1|  ubiquitin family protein                           242   2e-74   Populus trichocarpa [western balsam poplar]
ref|XP_010263550.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    242   2e-74   Nelumbo nucifera [Indian lotus]
ref|XP_011035053.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    241   2e-74   Populus euphratica
emb|CDP02781.1|  unnamed protein product                                241   2e-74   Coffea canephora [robusta coffee]
ref|XP_010263555.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    241   2e-74   Nelumbo nucifera [Indian lotus]
ref|XP_011035049.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    241   2e-74   Populus euphratica
ref|XP_011035048.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    241   2e-74   Populus euphratica
ref|XP_007215515.1|  hypothetical protein PRUPE_ppa007020mg             241   3e-74   Prunus persica
gb|EYU34397.1|  hypothetical protein MIMGU_mgv1a008220mg                241   4e-74   Erythranthe guttata [common monkey flower]
ref|XP_011097188.1|  PREDICTED: ubiquitin receptor RAD23c-like          241   5e-74   Sesamum indicum [beniseed]
ref|XP_007142901.1|  hypothetical protein PHAVU_007G026400g             241   5e-74   Phaseolus vulgaris [French bean]
ref|XP_009357056.1|  PREDICTED: ubiquitin receptor RAD23d               241   5e-74   Pyrus x bretschneideri [bai li]
ref|XP_010498530.1|  PREDICTED: ubiquitin receptor RAD23c-like          242   5e-74   Camelina sativa [gold-of-pleasure]
ref|XP_007142903.1|  hypothetical protein PHAVU_007G026600g             241   5e-74   Phaseolus vulgaris [French bean]
ref|XP_002884326.1|  hypothetical protein ARALYDRAFT_477488             241   5e-74   
ref|XP_010485565.1|  PREDICTED: ubiquitin receptor RAD23c-like          241   6e-74   Camelina sativa [gold-of-pleasure]
gb|KDO58995.1|  hypothetical protein CISIN_1g014118mg                   241   7e-74   Citrus sinensis [apfelsine]
ref|XP_008379541.1|  PREDICTED: ubiquitin receptor RAD23d-like          240   8e-74   
ref|XP_006383465.1|  hypothetical protein POPTR_0005s15740g             240   1e-73   Populus trichocarpa [western balsam poplar]
ref|XP_011021231.1|  PREDICTED: ubiquitin receptor RAD23d isoform X1    240   1e-73   Populus euphratica
ref|XP_010463666.1|  PREDICTED: ubiquitin receptor RAD23c               241   1e-73   Camelina sativa [gold-of-pleasure]
ref|XP_011021232.1|  PREDICTED: ubiquitin receptor RAD23d isoform X2    240   1e-73   Populus euphratica
ref|XP_006383464.1|  ubiquitin family protein                           239   2e-73   
ref|XP_011021236.1|  PREDICTED: ubiquitin receptor RAD23c isoform X4    239   2e-73   Populus euphratica
ref|XP_011021233.1|  PREDICTED: ubiquitin receptor RAD23c isoform X3    239   2e-73   Populus euphratica
ref|XP_010549930.1|  PREDICTED: ubiquitin receptor RAD23c-like          239   2e-73   Tarenaya hassleriana [spider flower]
ref|XP_011021237.1|  PREDICTED: ubiquitin receptor RAD23c isoform X5    238   2e-73   Populus euphratica
ref|XP_010103794.1|  Putative DNA repair protein RAD23-4                243   3e-73   
ref|XP_006484457.1|  PREDICTED: ubiquitin receptor RAD23c-like          238   6e-73   Citrus sinensis [apfelsine]
ref|XP_006363121.1|  PREDICTED: ubiquitin receptor RAD23c-like          238   7e-73   Solanum tuberosum [potatoes]
gb|KEH44233.1|  RAD23 UV excision repair family protein                 238   8e-73   Medicago truncatula
gb|KDO69965.1|  hypothetical protein CISIN_1g0163871mg                  236   1e-72   Citrus sinensis [apfelsine]
ref|XP_009622421.1|  PREDICTED: ubiquitin receptor RAD23d-like          231   1e-72   Nicotiana tomentosiformis
ref|XP_004232367.1|  PREDICTED: ubiquitin receptor RAD23d               237   1e-72   
ref|XP_006437675.1|  hypothetical protein CICLE_v10031777mg             237   1e-72   Citrus clementina [clementine]
ref|XP_002283656.1|  PREDICTED: ubiquitin receptor RAD23c               237   2e-72   Vitis vinifera
ref|XP_006299986.1|  hypothetical protein CARUB_v10016200mg             238   2e-72   Capsella rubella
ref|XP_006408408.1|  hypothetical protein EUTSA_v10020817mg             236   2e-72   
ref|XP_006846642.1|  hypothetical protein AMTR_s00156p00078120          236   3e-72   Amborella trichopoda
ref|XP_011464118.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    236   4e-72   Fragaria vesca subsp. vesca
ref|XP_004299088.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    236   5e-72   Fragaria vesca subsp. vesca
ref|XP_006408409.1|  hypothetical protein EUTSA_v10020817mg             236   5e-72   Eutrema salsugineum [saltwater cress]
ref|XP_007223090.1|  hypothetical protein PRUPE_ppa007032mg             235   5e-72   Prunus persica
gb|EYU44643.1|  hypothetical protein MIMGU_mgv1a006427mg                237   5e-72   Erythranthe guttata [common monkey flower]
ref|XP_009784661.1|  PREDICTED: ubiquitin receptor RAD23d               235   7e-72   Nicotiana sylvestris
ref|XP_009399730.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    235   8e-72   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAC76393.1|  RAD23-like protein                                     233   9e-72   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007227719.1|  hypothetical protein PRUPE_ppa007047mg             234   1e-71   Prunus persica
ref|NP_186903.1|  UV excision repair protein RAD23C                     235   2e-71   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010552226.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    234   2e-71   Tarenaya hassleriana [spider flower]
ref|NP_001189793.1|  UV excision repair protein RAD23C                  235   2e-71   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008243218.1|  PREDICTED: ubiquitin receptor RAD23d-like          234   2e-71   
ref|XP_010552232.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    234   3e-71   Tarenaya hassleriana [spider flower]
ref|XP_009607597.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    233   6e-71   Nicotiana tomentosiformis
ref|XP_009781758.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    233   7e-71   Nicotiana sylvestris
ref|XP_008775144.1|  PREDICTED: ubiquitin receptor RAD23d-like          232   8e-71   Phoenix dactylifera
ref|XP_006283908.1|  hypothetical protein CARUB_v10005026mg             232   9e-71   Capsella rubella
ref|XP_006405766.1|  hypothetical protein EUTSA_v10027790mg             232   1e-70   Eutrema salsugineum [saltwater cress]
ref|XP_009607598.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    231   1e-70   Nicotiana tomentosiformis
ref|XP_009781759.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    231   2e-70   Nicotiana sylvestris
ref|XP_010440953.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    231   2e-70   Camelina sativa [gold-of-pleasure]
ref|NP_198663.1|  ubiquitin receptor RAD23d                             231   3e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008801156.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    230   3e-70   
gb|ABB02636.1|  RAD23-like                                              231   3e-70   Solanum tuberosum [potatoes]
ref|XP_009399729.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    231   3e-70   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010435749.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    230   4e-70   Camelina sativa [gold-of-pleasure]
ref|XP_002870839.1|  hypothetical protein ARALYDRAFT_494129             230   4e-70   
ref|XP_010435751.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    230   4e-70   Camelina sativa [gold-of-pleasure]
ref|XP_008801157.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    230   4e-70   
ref|XP_008801154.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    231   4e-70   Phoenix dactylifera
ref|XP_008801153.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    231   5e-70   Phoenix dactylifera
ref|XP_009391404.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    231   6e-70   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010265160.1|  PREDICTED: ubiquitin receptor RAD23c-like          230   6e-70   Nelumbo nucifera [Indian lotus]
ref|XP_008781237.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    232   6e-70   Phoenix dactylifera
ref|XP_008781229.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    232   6e-70   
ref|XP_009391405.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    231   6e-70   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010317192.1|  PREDICTED: ubiquitin receptor RAD23d isoform X2    230   6e-70   Solanum lycopersicum
ref|XP_008781252.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    232   6e-70   Phoenix dactylifera
ref|XP_008781245.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    232   7e-70   
ref|XP_004233495.1|  PREDICTED: ubiquitin receptor RAD23d isoform X1    230   8e-70   Solanum lycopersicum
ref|XP_004233496.1|  PREDICTED: ubiquitin receptor RAD23c isoform X3    229   1e-69   Solanum lycopersicum
gb|AII99835.1|  putative DNA repair protein RAD23-3-like protein        229   1e-69   Nicotiana tabacum [American tobacco]
ref|XP_009125074.1|  PREDICTED: ubiquitin receptor RAD23d               229   2e-69   Brassica rapa
gb|AAK59766.1|  unknown protein                                         229   2e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010926135.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    229   2e-69   Elaeis guineensis
emb|CDX67404.1|  BnaA07g14440D                                          229   2e-69   
gb|KFK37714.1|  hypothetical protein AALP_AA3G019400                    230   2e-69   Arabis alpina [alpine rockcress]
ref|XP_010926134.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    229   2e-69   Elaeis guineensis
gb|KFK37713.1|  hypothetical protein AALP_AA3G019400                    230   2e-69   Arabis alpina [alpine rockcress]
emb|CDY58121.1|  BnaCnng32650D                                          228   3e-69   Brassica napus [oilseed rape]
gb|EYU29968.1|  hypothetical protein MIMGU_mgv1a008352mg                228   3e-69   Erythranthe guttata [common monkey flower]
ref|NP_001274760.1|  uncharacterized protein LOC102577665               228   3e-69   Solanum tuberosum [potatoes]
gb|EYU29967.1|  hypothetical protein MIMGU_mgv1a008352mg                228   3e-69   Erythranthe guttata [common monkey flower]
ref|XP_010916168.1|  PREDICTED: ubiquitin receptor RAD23c-like          227   1e-68   Elaeis guineensis
ref|XP_010450906.1|  PREDICTED: ubiquitin receptor RAD23d isoform X2    226   1e-68   Camelina sativa [gold-of-pleasure]
ref|XP_010450905.1|  PREDICTED: ubiquitin receptor RAD23d isoform X1    226   1e-68   Camelina sativa [gold-of-pleasure]
emb|CDY01661.1|  BnaC04g30910D                                          226   2e-68   
ref|XP_009139789.1|  PREDICTED: ubiquitin receptor RAD23d               226   2e-68   Brassica rapa
emb|CDX74522.1|  BnaA04g08670D                                          226   2e-68   
ref|XP_010907325.1|  PREDICTED: ubiquitin receptor RAD23d-like          226   3e-68   Elaeis guineensis
gb|KFK33251.1|  hypothetical protein AALP_AA6G350300                    225   5e-68   Arabis alpina [alpine rockcress]
emb|CDX74251.1|  BnaA03g27960D                                          225   1e-67   
ref|XP_010553921.1|  PREDICTED: ubiquitin receptor RAD23d isoform X2    224   1e-67   Tarenaya hassleriana [spider flower]
ref|XP_009356279.1|  PREDICTED: ubiquitin receptor RAD23d-like          224   2e-67   Pyrus x bretschneideri [bai li]
ref|XP_010553920.1|  PREDICTED: ubiquitin receptor RAD23d isoform X1    224   2e-67   Tarenaya hassleriana [spider flower]
ref|XP_009134681.1|  PREDICTED: ubiquitin receptor RAD23c               224   2e-67   Brassica rapa
emb|CDX91998.1|  BnaC03g33000D                                          224   2e-67   
ref|XP_008446578.1|  PREDICTED: ubiquitin receptor RAD23c-like          225   2e-67   Cucumis melo [Oriental melon]
gb|KGN52072.1|  hypothetical protein Csa_5G608600                       224   2e-67   Cucumis sativus [cucumbers]
ref|XP_010692904.1|  PREDICTED: ubiquitin receptor RAD23d               224   3e-67   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008368214.1|  PREDICTED: ubiquitin receptor RAD23c-like          222   6e-67   
ref|XP_009356676.1|  PREDICTED: ubiquitin receptor RAD23c-like          222   6e-67   Pyrus x bretschneideri [bai li]
emb|CAA72741.1|  RAD23, isoform I                                       219   8e-66   Daucus carota [carrots]
ref|XP_008390012.1|  PREDICTED: ubiquitin receptor RAD23c-like          218   1e-65   
ref|XP_009417654.1|  PREDICTED: ubiquitin receptor RAD23d-like          219   2e-65   
ref|XP_010681568.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    215   1e-64   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010681567.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    215   2e-64   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010681566.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    215   2e-64   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010681564.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    216   3e-64   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010681565.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    215   3e-64   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008368492.1|  PREDICTED: ubiquitin receptor RAD23d-like          206   3e-64   
ref|XP_010681563.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    215   4e-64   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010926132.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    215   1e-63   Elaeis guineensis
ref|XP_010926133.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    215   1e-63   Elaeis guineensis
ref|XP_008341883.1|  PREDICTED: ubiquitin receptor RAD23d-like          213   5e-63   
gb|ACN40029.1|  unknown                                                 210   4e-62   Picea sitchensis
ref|XP_004489115.1|  PREDICTED: putative DNA repair protein RAD23...    209   4e-62   Cicer arietinum [garbanzo]
gb|KEH21499.1|  RAD23 UV excision repair family protein                 208   1e-61   Medicago truncatula
ref|XP_004304134.1|  PREDICTED: ubiquitin receptor RAD23d-like          207   3e-61   Fragaria vesca subsp. vesca
gb|KJB69954.1|  hypothetical protein B456_011G053200                    201   2e-59   Gossypium raimondii
gb|KHG09850.1|  Putative DNA repair RAD23-1 -like protein               201   3e-59   Gossypium arboreum [tree cotton]
ref|XP_006427690.1|  hypothetical protein CICLE_v100258682mg            199   6e-59   
ref|XP_010107189.1|  Putative DNA repair protein RAD23-1                202   6e-59   
gb|KJB69952.1|  hypothetical protein B456_011G053200                    201   8e-59   Gossypium raimondii
ref|XP_010034056.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    201   9e-59   Eucalyptus grandis [rose gum]
ref|XP_010034055.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    201   1e-58   Eucalyptus grandis [rose gum]
ref|XP_010034057.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    201   1e-58   Eucalyptus grandis [rose gum]
gb|KJB34920.1|  hypothetical protein B456_006G091100                    201   1e-58   Gossypium raimondii
ref|XP_010034058.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    200   1e-58   Eucalyptus grandis [rose gum]
ref|XP_006655985.1|  PREDICTED: ubiquitin receptor RAD23c-like          201   1e-58   Oryza brachyantha
gb|EAZ07072.1|  hypothetical protein OsI_29318                          201   2e-58   Oryza sativa Indica Group [Indian rice]
gb|ABK24371.1|  unknown                                                 199   4e-58   Picea sitchensis
gb|KJB34921.1|  hypothetical protein B456_006G091100                    197   5e-58   Gossypium raimondii
ref|XP_006845449.1|  hypothetical protein AMTR_s00019p00116110          199   6e-58   Amborella trichopoda
ref|XP_006493449.1|  PREDICTED: ubiquitin receptor RAD23b-like          199   7e-58   Citrus sinensis [apfelsine]
ref|NP_001061854.1|  Os08g0430200                                       199   7e-58   
ref|XP_004965183.1|  PREDICTED: putative DNA repair protein RAD23...    199   9e-58   Setaria italica
gb|EAZ00429.1|  hypothetical protein OsI_22453                          199   1e-57   Oryza sativa Indica Group [Indian rice]
gb|ACG32894.1|  DNA repair protein RAD23                                199   1e-57   Zea mays [maize]
ref|NP_001057334.1|  Os06g0264300                                       199   1e-57   
gb|KHG13236.1|  Putative DNA repair RAD23-1 -like protein               197   2e-57   Gossypium arboreum [tree cotton]
gb|ACH72675.1|  RAD23                                                   197   3e-57   Pinus sylvestris var. mongolica
dbj|BAJ98767.1|  predicted protein                                      197   4e-57   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007024818.1|  Rad23 UV excision repair protein family isof...    196   5e-57   
ref|XP_009797066.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    194   5e-57   Nicotiana sylvestris
gb|KDP41924.1|  hypothetical protein JCGZ_26942                         195   7e-57   Jatropha curcas
ref|XP_009598522.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    195   9e-57   Nicotiana tomentosiformis
ref|XP_009598520.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    195   9e-57   Nicotiana tomentosiformis
ref|NP_001149140.1|  LOC100282762                                       196   1e-56   Zea mays [maize]
ref|XP_010246571.1|  PREDICTED: ubiquitin receptor RAD23b-like          195   1e-56   Nelumbo nucifera [Indian lotus]
gb|AFK37577.1|  unknown                                                 195   1e-56   Lotus japonicus
ref|XP_011020549.1|  PREDICTED: ubiquitin receptor RAD23b-like          195   1e-56   Populus euphratica
gb|EMS61794.1|  putative DNA repair protein RAD23                       196   1e-56   Triticum urartu
gb|EMT27109.1|  Putative DNA repair protein RAD23                       196   2e-56   
ref|XP_002303970.1|  DNA repair protein RAD23                           194   2e-56   
ref|XP_006385947.1|  hypothetical protein POPTR_0003s18540g             194   2e-56   Populus trichocarpa [western balsam poplar]
ref|XP_003563980.1|  PREDICTED: ubiquitin receptor RAD23d-like          196   2e-56   Brachypodium distachyon [annual false brome]
ref|XP_009797065.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    194   3e-56   Nicotiana sylvestris
ref|NP_001266655.1|  DNA repair protein RAD23                           195   3e-56   
ref|XP_009797063.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    194   3e-56   Nicotiana sylvestris
ref|NP_001142065.1|  uncharacterized protein LOC100274222               195   3e-56   Zea mays [maize]
gb|AEA86337.1|  putative DNA repair protein                             187   4e-56   Solanum nigrum
emb|CBI25247.3|  unnamed protein product                                194   4e-56   Vitis vinifera
ref|XP_004303217.1|  PREDICTED: ubiquitin receptor RAD23b               194   4e-56   Fragaria vesca subsp. vesca
ref|XP_010655132.1|  PREDICTED: ubiquitin receptor RAD23b               195   5e-56   Vitis vinifera
ref|XP_010268452.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    194   6e-56   Nelumbo nucifera [Indian lotus]
ref|XP_006341431.1|  PREDICTED: ubiquitin receptor RAD23b-like          193   7e-56   Solanum tuberosum [potatoes]
ref|XP_002299163.1|  DNA repair protein RAD23                           192   1e-55   
ref|XP_006368664.1|  hypothetical protein POPTR_0001s07510g             193   1e-55   
ref|XP_004235877.1|  PREDICTED: ubiquitin receptor RAD23b               192   1e-55   
ref|XP_011034604.1|  PREDICTED: ubiquitin receptor RAD23b-like          192   1e-55   Populus euphratica
ref|XP_009615678.1|  PREDICTED: ubiquitin receptor RAD23b               192   2e-55   Nicotiana tomentosiformis
ref|XP_011082656.1|  PREDICTED: ubiquitin receptor RAD23b-like          192   2e-55   Sesamum indicum [beniseed]
ref|XP_003574508.1|  PREDICTED: probable ubiquitin receptor RAD23...    192   3e-55   Brachypodium distachyon [annual false brome]
ref|XP_010235145.1|  PREDICTED: probable ubiquitin receptor RAD23...    192   3e-55   Brachypodium distachyon [annual false brome]
ref|XP_009365249.1|  PREDICTED: ubiquitin receptor RAD23b-like          191   3e-55   Pyrus x bretschneideri [bai li]
ref|XP_008342756.1|  PREDICTED: ubiquitin receptor RAD23b-like          191   3e-55   
ref|XP_009759118.1|  PREDICTED: ubiquitin receptor RAD23b isoform X2    191   4e-55   Nicotiana sylvestris
ref|XP_009759117.1|  PREDICTED: ubiquitin receptor RAD23b isoform X1    191   4e-55   Nicotiana sylvestris
ref|XP_010695313.1|  PREDICTED: probable ubiquitin receptor RAD23a      191   4e-55   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009354240.1|  PREDICTED: ubiquitin receptor RAD23b-like          191   6e-55   Pyrus x bretschneideri [bai li]
ref|XP_008381164.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    189   8e-55   
ref|XP_007215553.1|  hypothetical protein PRUPE_ppa007284mg             190   1e-54   Prunus persica
ref|XP_008228865.1|  PREDICTED: ubiquitin receptor RAD23b-like          190   1e-54   Prunus mume [ume]
ref|XP_008381163.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    190   1e-54   
gb|KHG13156.1|  Putative DNA repair RAD23-1 -like protein               189   3e-54   Gossypium arboreum [tree cotton]
emb|CDO98260.1|  unnamed protein product                                188   8e-54   Coffea canephora [robusta coffee]
ref|XP_007135849.1|  hypothetical protein PHAVU_010G163300g             187   1e-53   Phaseolus vulgaris [French bean]
ref|XP_002890153.1|  hypothetical protein ARALYDRAFT_312599             187   2e-53   Arabidopsis lyrata subsp. lyrata
ref|NP_850982.1|  ubiquitin receptor RAD23b                             187   2e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003578094.1|  PREDICTED: probable ubiquitin receptor RAD23       187   2e-53   Brachypodium distachyon [annual false brome]
ref|NP_565216.2|  ubiquitin receptor RAD23b                             187   2e-53   Arabidopsis thaliana [mouse-ear cress]
gb|ABG89119.1|  Rad23-3Ai                                               186   3e-53   synthetic construct
ref|NP_001063134.1|  Os09g0407200                                       187   3e-53   
ref|NP_001185439.1|  ubiquitin receptor RAD23b                          186   5e-53   Arabidopsis thaliana [mouse-ear cress]
gb|ACU20959.1|  unknown                                                 186   5e-53   Glycine max [soybeans]
ref|NP_173070.1|  DNA repair protein RAD23A                             186   6e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004956778.1|  PREDICTED: probable DNA repair protein RAD23...    186   6e-53   Setaria italica
ref|NP_001240038.1|  uncharacterized protein LOC100819019               185   6e-53   Glycine max [soybeans]
ref|XP_006306209.1|  hypothetical protein CARUB_v10011879mg             185   7e-53   Capsella rubella
dbj|BAC76391.1|  RAD23-like protein                                     185   7e-53   Arabidopsis thaliana [mouse-ear cress]
gb|ACJ83410.1|  unknown                                                 178   1e-52   Medicago truncatula
ref|XP_003529480.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    185   1e-52   Glycine max [soybeans]
ref|XP_004147454.1|  PREDICTED: putative DNA repair protein RAD23...    185   1e-52   Cucumis sativus [cucumbers]
ref|XP_008443453.1|  PREDICTED: ubiquitin receptor RAD23b-like          185   1e-52   Cucumis melo [Oriental melon]
ref|XP_009117771.1|  PREDICTED: probable ubiquitin receptor RAD23a      184   1e-52   Brassica rapa
ref|XP_004164899.1|  PREDICTED: putative DNA repair protein RAD23...    185   2e-52   
ref|XP_007150827.1|  hypothetical protein PHAVU_005G184000g             184   2e-52   
ref|XP_001763027.1|  predicted protein                                  184   2e-52   
ref|XP_002889262.1|  hypothetical protein ARALYDRAFT_316857             184   2e-52   
ref|XP_006416841.1|  hypothetical protein EUTSA_v10007982mg             184   3e-52   
ref|XP_003637292.1|  RAD23 protein                                      179   3e-52   
emb|CDX81753.1|  BnaC08g38480D                                          184   3e-52   
ref|XP_010459157.1|  PREDICTED: probable ubiquitin receptor RAD23a      184   3e-52   
ref|XP_002961618.1|  hypothetical protein SELMODRAFT_77427              184   3e-52   
ref|XP_010476726.1|  PREDICTED: LOW QUALITY PROTEIN: probable ubi...    183   3e-52   
ref|XP_010497716.1|  PREDICTED: probable ubiquitin receptor RAD23a      184   3e-52   
ref|XP_006389863.1|  hypothetical protein EUTSA_v10018655mg             184   4e-52   
dbj|BAC76389.1|  RAD23-like protein                                     183   4e-52   
gb|AAB65841.1|  osRAD23                                                 184   4e-52   
ref|XP_010532056.1|  PREDICTED: ubiquitin receptor RAD23b               183   4e-52   
dbj|BAC76390.1|  RAD23-like protein                                     183   6e-52   
ref|XP_008462954.1|  PREDICTED: ubiquitin receptor RAD23b isoform X2    183   6e-52   
ref|XP_008462953.1|  PREDICTED: ubiquitin receptor RAD23b isoform X1    183   7e-52   
gb|AEA86336.1|  putative DNA repair protein                             177   8e-52   
gb|EMT30328.1|  Putative DNA repair protein RAD23                       184   1e-51   
ref|XP_003637291.1|  RAD23 protein                                      182   1e-51   
ref|XP_010417634.1|  PREDICTED: ubiquitin receptor RAD23b               182   1e-51   
gb|EYU24564.1|  hypothetical protein MIMGU_mgv1a008731mg                182   1e-51   
ref|XP_002964690.1|  hypothetical protein SELMODRAFT_82644              182   2e-51   
tpg|DAA40043.1|  TPA: hypothetical protein ZEAMMB73_722140              177   2e-51   
gb|KHN31866.1|  Putative DNA repair protein RAD23-1                     181   3e-51   
ref|XP_003543713.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    181   3e-51   
ref|XP_002512770.1|  uv excision repair protein rad23, putative         180   5e-51   
ref|XP_004161413.1|  PREDICTED: putative DNA repair protein RAD23...    181   5e-51   
gb|KGN58646.1|  hypothetical protein Csa_3G710740                       181   6e-51   
ref|XP_010429867.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    180   7e-51   
ref|XP_010429866.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    180   7e-51   
ref|XP_004137651.1|  PREDICTED: putative DNA repair protein RAD23...    180   7e-51   
gb|ACF79443.1|  unknown                                                 180   8e-51   
gb|EMS50196.1|  putative DNA repair protein RAD23                       184   8e-51   
gb|KFK42374.1|  hypothetical protein AALP_AA2G247700                    180   9e-51   
ref|XP_006302422.1|  hypothetical protein CARUB_v10020503mg             180   9e-51   
ref|NP_001149553.1|  LOC100283179                                       180   9e-51   
ref|XP_004486596.1|  PREDICTED: putative DNA repair protein RAD23...    180   1e-50   
ref|XP_004486595.1|  PREDICTED: putative DNA repair protein RAD23...    179   1e-50   
ref|XP_010472832.1|  PREDICTED: ubiquitin receptor RAD23b-like          179   1e-50   
ref|XP_008668010.1|  PREDICTED: LOC100283179 isoform X1                 180   2e-50   
ref|XP_008794386.1|  PREDICTED: ubiquitin receptor RAD23b-like          179   3e-50   
tpg|DAA61380.1|  TPA: hypothetical protein ZEAMMB73_350633              174   3e-50   
ref|XP_009398645.1|  PREDICTED: ubiquitin receptor RAD23b-like          178   7e-50   
ref|XP_010929196.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    177   9e-50   
ref|XP_010929195.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    177   1e-49   
emb|CDY33351.1|  BnaC05g12320D                                          177   1e-49   
ref|XP_008650775.1|  PREDICTED: uncharacterized protein LOC100191...    177   1e-49   
tpg|DAA61379.1|  TPA: hypothetical protein ZEAMMB73_350633              177   1e-49   
ref|XP_010929193.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    177   1e-49   
ref|XP_009149056.1|  PREDICTED: probable ubiquitin receptor RAD23a      176   3e-49   
emb|CDY35071.1|  BnaA06g10810D                                          176   4e-49   
gb|KHF97937.1|  Putative DNA repair RAD23-4 -like protein               166   6e-49   
gb|KDO59000.1|  hypothetical protein CISIN_1g014118mg                   174   1e-48   
ref|XP_009408042.1|  PREDICTED: ubiquitin receptor RAD23b-like          174   3e-48   
emb|CAA72742.1|  RAD23 protein, isoform II                              173   3e-48   
ref|XP_009104513.1|  PREDICTED: ubiquitin receptor RAD23b               172   7e-48   
ref|XP_006646966.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    172   8e-48   
ref|XP_006646967.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    172   8e-48   
ref|XP_004951696.1|  PREDICTED: putative DNA repair protein RAD23...    172   9e-48   
ref|XP_006646968.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    171   1e-47   
emb|CDX79333.1|  BnaC06g19700D                                          172   2e-47   
ref|XP_006646969.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    171   2e-47   
gb|KHN38092.1|  Putative DNA repair protein RAD23-1                     172   3e-47   
emb|CDX67983.1|  BnaA07g20230D                                          171   5e-47   
gb|EEC72612.1|  hypothetical protein OsI_06092                          169   9e-47   
ref|NP_001046083.1|  Os02g0179300                                       169   9e-47   
ref|XP_001780766.1|  predicted protein                                  170   1e-46   
dbj|BAK04690.1|  predicted protein                                      169   1e-46   
ref|XP_009418051.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    169   2e-46   
ref|XP_009418030.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    168   3e-46   
gb|AAD34676.1|AC006341_4  Similar to gb|Y12014 RAD23 protein isof...    159   6e-46   
ref|XP_002451657.1|  hypothetical protein SORBIDRAFT_04g005370          166   1e-45   
ref|XP_008649304.1|  PREDICTED: ubiquitin receptor RAD23d-like          157   4e-45   
ref|NP_001148810.1|  LOC100282427                                       165   5e-45   
ref|XP_008677244.1|  PREDICTED: LOC100282427 isoform X2                 165   5e-45   
ref|XP_003570619.1|  PREDICTED: ubiquitin receptor RAD23b-like          164   9e-45   
gb|AFW87603.1|  hypothetical protein ZEAMMB73_681598                    156   9e-45   
ref|XP_001752264.1|  predicted protein                                  152   3e-43   
dbj|BAC76395.1|  RAD23-like protein                                     158   1e-42   
ref|XP_006603061.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    158   1e-42   
ref|XP_003551850.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    158   2e-42   
ref|XP_006598286.1|  PREDICTED: ubiquitin receptor RAD23b-like          156   3e-42   
gb|AAF68123.1|AC010793_18  F20B17.8                                     155   1e-41   
ref|XP_004172134.1|  PREDICTED: putative DNA repair protein RAD23...    154   1e-40   
ref|XP_004135098.1|  PREDICTED: putative DNA repair protein RAD23...    154   1e-40   
ref|NP_974181.1|  ubiquitin receptor RAD23b                             143   6e-37   
gb|KJB69953.1|  hypothetical protein B456_011G053200                    141   2e-36   
ref|XP_011022053.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    130   2e-32   
dbj|BAJ97496.1|  predicted protein                                      132   2e-32   
ref|XP_007033285.1|  Rad23 UV excision repair protein family isof...    129   1e-31   
gb|ACG24239.1|  hypothetical protein                                    122   1e-31   
ref|XP_010210284.1|  PREDICTED: UV excision repair protein RAD23 ...    128   2e-31   
gb|EMT16092.1|  Putative DNA repair protein RAD23-1                     129   2e-31   
ref|XP_005708114.1|  nucleotide excision repair protein                 129   2e-31   
gb|KGL75456.1|  UV excision repair protein RAD23 B                      128   2e-31   
gb|AFW87601.1|  hypothetical protein ZEAMMB73_681598                    128   3e-31   
gb|KJB80001.1|  hypothetical protein B456_013G076800                    127   3e-31   
ref|XP_007884175.1|  PREDICTED: UV excision repair protein RAD23 ...    127   4e-31   
gb|EMT03590.1|  Putative DNA repair protein RAD23-1                     125   4e-31   
gb|EYU24565.1|  hypothetical protein MIMGU_mgv1a008731mg                127   5e-31   
emb|CAB65692.1|  Rad23 Protein                                          119   5e-31   
ref|XP_007046250.1|  Rad23 UV excision repair protein family isof...    127   5e-31   
ref|XP_006011153.1|  PREDICTED: UV excision repair protein RAD23 ...    126   1e-30   
ref|XP_010074164.1|  PREDICTED: UV excision repair protein RAD23 ...    125   2e-30   
emb|CDQ90828.1|  unnamed protein product                                125   2e-30   
gb|KFU98476.1|  UV excision repair protein RAD23 B                      125   2e-30   
emb|CDQ83149.1|  unnamed protein product                                125   3e-30   
ref|XP_010873253.1|  PREDICTED: UV excision repair protein RAD23 ...    125   3e-30   
ref|XP_010284737.1|  PREDICTED: UV excision repair protein RAD23 ...    120   5e-30   
ref|XP_009933661.1|  PREDICTED: UV excision repair protein RAD23 ...    123   7e-30   
ref|XP_001366912.1|  PREDICTED: UV excision repair protein RAD23 ...    124   8e-30   
ref|XP_009977358.1|  PREDICTED: UV excision repair protein RAD23 ...    120   9e-30   
ref|XP_010161922.1|  PREDICTED: UV excision repair protein RAD23 ...    120   1e-29   
ref|XP_009958718.1|  PREDICTED: UV excision repair protein RAD23 ...    119   1e-29   
gb|EPS72838.1|  hypothetical protein M569_01918                         122   1e-29   
ref|NP_001078680.1|  ubiquitin receptor RAD23d                          122   2e-29   
ref|XP_006627060.1|  PREDICTED: UV excision repair protein RAD23 ...    123   2e-29   
ref|XP_002432231.1|  uv excision repair protein rad23, putative         122   3e-29   
ref|XP_009819016.1|  PREDICTED: UV excision repair protein RAD23 ...    122   3e-29   
ref|XP_005428092.1|  PREDICTED: UV excision repair protein RAD23 ...    122   3e-29   
ref|XP_009096530.1|  PREDICTED: UV excision repair protein RAD23 ...    122   3e-29   
ref|XP_005062233.1|  PREDICTED: UV excision repair protein RAD23 ...    122   3e-29   
ref|XP_010208101.1|  PREDICTED: UV excision repair protein RAD23 ...    122   3e-29   
ref|XP_008639793.1|  PREDICTED: LOW QUALITY PROTEIN: UV excision ...    122   3e-29   
gb|EMS58233.1|  Putative DNA repair protein RAD23-1                     123   3e-29   
ref|XP_010125653.1|  PREDICTED: UV excision repair protein RAD23 ...    121   4e-29   
gb|KFP28504.1|  UV excision repair protein RAD23 B                      122   4e-29   
ref|XP_009873289.1|  PREDICTED: UV excision repair protein RAD23 ...    121   4e-29   
ref|XP_010306604.1|  PREDICTED: UV excision repair protein RAD23 ...    117   4e-29   
ref|XP_009475490.1|  PREDICTED: UV excision repair protein RAD23 ...    121   4e-29   
gb|KFV42406.1|  UV excision repair protein RAD23 B                      122   4e-29   
ref|XP_009284591.1|  PREDICTED: UV excision repair protein RAD23 ...    121   4e-29   
gb|KFV48041.1|  UV excision repair protein RAD23 B                      122   5e-29   
ref|XP_009996457.1|  PREDICTED: UV excision repair protein RAD23 ...    121   5e-29   
ref|XP_009501627.1|  PREDICTED: UV excision repair protein RAD23 ...    121   5e-29   
ref|XP_010403980.1|  PREDICTED: UV excision repair protein RAD23 ...    122   5e-29   
ref|XP_002188381.1|  PREDICTED: UV excision repair protein RAD23 ...    122   5e-29   
gb|KFP54135.1|  UV excision repair protein RAD23 B                      122   5e-29   
ref|XP_003081625.1|  Nucleotide excision repair factor NEF2, RAD2...    119   6e-29   
gb|KFP78669.1|  UV excision repair protein RAD23 B                      122   6e-29   
ref|XP_009643344.1|  PREDICTED: UV excision repair protein RAD23 ...    121   6e-29   
ref|XP_010403981.1|  PREDICTED: UV excision repair protein RAD23 ...    122   6e-29   
ref|XP_005491419.1|  PREDICTED: UV excision repair protein RAD23 ...    122   6e-29   
gb|KFP45297.1|  UV excision repair protein RAD23 B                      122   6e-29   
ref|XP_005491420.1|  PREDICTED: UV excision repair protein RAD23 ...    122   6e-29   
ref|XP_005532282.1|  PREDICTED: UV excision repair protein RAD23 ...    122   6e-29   
ref|XP_010143171.1|  PREDICTED: UV excision repair protein RAD23 ...    120   7e-29   
gb|KFM01514.1|  UV excision repair protein RAD23 B                      121   7e-29   
ref|XP_009886968.1|  PREDICTED: UV excision repair protein RAD23 ...    120   7e-29   
gb|KFQ93153.1|  UV excision repair protein RAD23 B                      121   7e-29   
ref|XP_008921937.1|  PREDICTED: UV excision repair protein RAD23 ...    120   7e-29   
ref|XP_008495758.1|  PREDICTED: UV excision repair protein RAD23 ...    120   7e-29   
ref|XP_005154948.1|  PREDICTED: UV excision repair protein RAD23 ...    122   8e-29   
gb|KFU90019.1|  UV excision repair protein RAD23 B                      121   8e-29   
ref|XP_009704807.1|  PREDICTED: UV excision repair protein RAD23 ...    120   8e-29   
ref|XP_009964886.1|  PREDICTED: UV excision repair protein RAD23 ...    123   9e-29   
gb|KFP09954.1|  UV excision repair protein RAD23 B                      121   9e-29   
gb|KFW73791.1|  UV excision repair protein RAD23 B                      121   9e-29   
ref|XP_007899245.1|  PREDICTED: UV excision repair protein RAD23 ...    121   9e-29   
ref|XP_010011187.1|  PREDICTED: UV excision repair protein RAD23 ...    120   9e-29   
ref|XP_010724307.1|  PREDICTED: UV excision repair protein RAD23 ...    119   1e-28   
ref|XP_005013373.1|  PREDICTED: LOW QUALITY PROTEIN: UV excision ...    122   1e-28   
dbj|BAM18172.1|  UV excision repair protein rad23                       119   1e-28   
gb|KFV93588.1|  UV excision repair protein RAD23 B                      118   1e-28   
gb|KFP03775.1|  UV excision repair protein RAD23 B                      121   1e-28   
ref|XP_009685841.1|  PREDICTED: UV excision repair protein RAD23 ...    120   1e-28   
gb|KFW80798.1|  UV excision repair protein RAD23 B                      121   1e-28   
gb|KGL96224.1|  UV excision repair protein RAD23 B                      121   1e-28   
ref|XP_009563003.1|  PREDICTED: UV excision repair protein RAD23 ...    120   1e-28   
ref|XP_009579770.1|  PREDICTED: UV excision repair protein RAD23 ...    120   1e-28   
gb|KFP68145.1|  UV excision repair protein RAD23 B                      120   1e-28   
ref|XP_010150954.1|  PREDICTED: UV excision repair protein RAD23 ...    118   1e-28   
ref|XP_005362254.1|  PREDICTED: UV excision repair protein RAD23 ...    121   1e-28   
gb|KFQ43918.1|  UV excision repair protein RAD23 B                      120   2e-28   
gb|KFO78985.1|  UV excision repair protein RAD23 B                      120   2e-28   
ref|XP_003739932.1|  PREDICTED: UV excision repair protein RAD23 ...    120   2e-28   
ref|XP_005240425.1|  PREDICTED: UV excision repair protein RAD23 ...    120   2e-28   
gb|KFW08178.1|  UV excision repair protein RAD23 B                      120   2e-28   
gb|AFM90454.1|  UV excision repair protein RAD23-like B isoform 5       120   2e-28   
gb|KFV87804.1|  UV excision repair protein RAD23 B                      120   2e-28   
gb|AFM90973.1|  UV excision repair protein RAD23-like protein B i...    120   2e-28   
gb|EIE84327.1|  UV excision repair protein Rad23                        120   2e-28   
ref|XP_003431168.1|  PREDICTED: UV excision repair protein RAD23 ...    116   2e-28   
emb|CEF99377.1|  UBA-like                                               120   2e-28   
ref|NP_001279327.1|  UV excision repair protein RAD23 homolog B-like    120   2e-28   
gb|AFK10816.1|  UV excision repair protein RAD23-like protein           120   2e-28   
ref|XP_008938608.1|  PREDICTED: UV excision repair protein RAD23 ...    119   2e-28   
ref|XP_005502851.1|  PREDICTED: UV excision repair protein RAD23 ...    119   3e-28   
ref|XP_005446959.1|  PREDICTED: UV excision repair protein RAD23 ...    120   3e-28   
ref|XP_005818125.1|  Rad23 nucleotide excision repair protein bin...    120   3e-28   
ref|XP_003964320.1|  PREDICTED: UV excision repair protein RAD23 ...    119   3e-28   
ref|XP_006631678.1|  PREDICTED: UV excision repair protein RAD23 ...    119   3e-28   
emb|CAF91196.1|  unnamed protein product                                119   3e-28   
ref|XP_009487270.1|  PREDICTED: UV excision repair protein RAD23 ...    119   3e-28   
gb|KFQ83380.1|  UV excision repair protein RAD23 B                      119   3e-28   
ref|XP_429175.3|  PREDICTED: UV excision repair protein RAD23 hom...    120   3e-28   
gb|KFQ29720.1|  UV excision repair protein RAD23 B                      119   4e-28   
gb|EMC77210.1|  UV excision repair protein RAD23 like protein B         119   4e-28   
ref|XP_007178312.1|  PREDICTED: UV excision repair protein RAD23 ...    119   4e-28   
dbj|BAE89144.1|  unnamed protein product                                116   4e-28   
ref|XP_007462497.1|  PREDICTED: UV excision repair protein RAD23 ...    119   4e-28   
ref|XP_004949424.1|  PREDICTED: UV excision repair protein RAD23 ...    120   4e-28   
ref|XP_007950132.1|  PREDICTED: UV excision repair protein RAD23 ...    119   4e-28   
emb|CAN62701.1|  hypothetical protein VITISV_007064                     119   5e-28   
gb|KFQ54436.1|  UV excision repair protein RAD23 B                      119   5e-28   
ref|XP_005968716.1|  PREDICTED: UV excision repair protein RAD23 ...    119   5e-28   
gb|AAP81008.1|  RAD23-like protein B                                    119   5e-28   
ref|NP_001231653.1|  UV excision repair protein RAD23 homolog B i...    119   5e-28   
ref|XP_009905224.1|  PREDICTED: UV excision repair protein RAD23 ...    118   5e-28   
ref|XP_006906142.1|  PREDICTED: UV excision repair protein RAD23 ...    118   5e-28   
ref|XP_009455312.1|  PREDICTED: UV excision repair protein RAD23 ...    118   6e-28   
ref|XP_004949423.1|  PREDICTED: UV excision repair protein RAD23 ...    119   6e-28   
ref|XP_008706147.1|  PREDICTED: LOW QUALITY PROTEIN: UV excision ...    118   6e-28   
ref|XP_005684333.1|  PREDICTED: UV excision repair protein RAD23 ...    118   6e-28   
ref|XP_008521535.1|  PREDICTED: UV excision repair protein RAD23 ...    118   6e-28   
ref|XP_005605740.1|  PREDICTED: UV excision repair protein RAD23 ...    118   6e-28   
ref|XP_004004079.1|  PREDICTED: UV excision repair protein RAD23 ...    118   7e-28   
ref|XP_006180843.1|  PREDICTED: UV excision repair protein RAD23 ...    118   7e-28   
ref|XP_007424104.1|  PREDICTED: UV excision repair protein RAD23 ...    119   7e-28   
ref|XP_003777470.1|  PREDICTED: UV excision repair protein RAD23 ...    118   7e-28   



>ref|XP_006482261.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Citrus 
sinensis]
Length=396

 Score =   258 bits (658),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/130 (94%), Positives = 126/130 (97%), Gaps = 0/130 (0%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
            GA TL+FLRNSQQFQALR MVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEP
Sbjct  267  GAGTLDFLRNSQQFQALRTMVQANPQILQPMLQELGKQNPHLMRLIQEHQTDFLRLINEP  326

Query  481  VEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  302
            VEGGEGN+LGQLA++MPQAV VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY
Sbjct  327  VEGGEGNVLGQLASAMPQAVTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  386

Query  301  LLDHMHEFED  272
            LLDHMHEFED
Sbjct  387  LLDHMHEFED  396



>ref|XP_006482260.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X1 [Citrus 
sinensis]
Length=397

 Score =   258 bits (658),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/130 (94%), Positives = 126/130 (97%), Gaps = 0/130 (0%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
            GA TL+FLRNSQQFQALR MVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEP
Sbjct  268  GAGTLDFLRNSQQFQALRTMVQANPQILQPMLQELGKQNPHLMRLIQEHQTDFLRLINEP  327

Query  481  VEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  302
            VEGGEGN+LGQLA++MPQAV VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY
Sbjct  328  VEGGEGNVLGQLASAMPQAVTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  387

Query  301  LLDHMHEFED  272
            LLDHMHEFED
Sbjct  388  LLDHMHEFED  397



>gb|KDO58994.1| hypothetical protein CISIN_1g014118mg [Citrus sinensis]
Length=402

 Score =   258 bits (658),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/130 (94%), Positives = 126/130 (97%), Gaps = 0/130 (0%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
            GA TL+FLRNSQQFQALR MVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEP
Sbjct  273  GAGTLDFLRNSQQFQALRTMVQANPQILQPMLQELGKQNPHLMRLIQEHQTDFLRLINEP  332

Query  481  VEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  302
            VEGGEGN+LGQLA++MPQAV VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY
Sbjct  333  VEGGEGNVLGQLASAMPQAVTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  392

Query  301  LLDHMHEFED  272
            LLDHMHEFED
Sbjct  393  LLDHMHEFED  402



>gb|KDO58997.1| hypothetical protein CISIN_1g014118mg [Citrus sinensis]
Length=403

 Score =   258 bits (658),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/130 (94%), Positives = 126/130 (97%), Gaps = 0/130 (0%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
            GA TL+FLRNSQQFQALR MVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEP
Sbjct  274  GAGTLDFLRNSQQFQALRTMVQANPQILQPMLQELGKQNPHLMRLIQEHQTDFLRLINEP  333

Query  481  VEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  302
            VEGGEGN+LGQLA++MPQAV VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY
Sbjct  334  VEGGEGNVLGQLASAMPQAVTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  393

Query  301  LLDHMHEFED  272
            LLDHMHEFED
Sbjct  394  LLDHMHEFED  403



>gb|KDO58996.1| hypothetical protein CISIN_1g014118mg [Citrus sinensis]
Length=403

 Score =   258 bits (658),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/130 (94%), Positives = 126/130 (97%), Gaps = 0/130 (0%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
            GA TL+FLRNSQQFQALR MVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEP
Sbjct  274  GAGTLDFLRNSQQFQALRTMVQANPQILQPMLQELGKQNPHLMRLIQEHQTDFLRLINEP  333

Query  481  VEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  302
            VEGGEGN+LGQLA++MPQAV VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY
Sbjct  334  VEGGEGNVLGQLASAMPQAVTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  393

Query  301  LLDHMHEFED  272
            LLDHMHEFED
Sbjct  394  LLDHMHEFED  403



>ref|XP_006430788.1| hypothetical protein CICLE_v10011886mg [Citrus clementina]
 gb|ESR44028.1| hypothetical protein CICLE_v10011886mg [Citrus clementina]
Length=400

 Score =   256 bits (655),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 122/130 (94%), Positives = 126/130 (97%), Gaps = 0/130 (0%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
            GA TL+FLRNSQQFQALR MVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEP
Sbjct  271  GAGTLDFLRNSQQFQALRTMVQANPQILQPMLQELGKQNPHLMRLIQEHQTDFLRLINEP  330

Query  481  VEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  302
            VEGGEGN+LGQLA++MPQAV VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY
Sbjct  331  VEGGEGNVLGQLASAMPQAVTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  390

Query  301  LLDHMHEFED  272
            LLDHMHEFED
Sbjct  391  LLDHMHEFED  400



>ref|XP_006430787.1| hypothetical protein CICLE_v10011886mg [Citrus clementina]
 gb|ESR44027.1| hypothetical protein CICLE_v10011886mg [Citrus clementina]
Length=401

 Score =   256 bits (655),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 122/130 (94%), Positives = 126/130 (97%), Gaps = 0/130 (0%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
            GA TL+FLRNSQQFQALR MVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEP
Sbjct  272  GAGTLDFLRNSQQFQALRTMVQANPQILQPMLQELGKQNPHLMRLIQEHQTDFLRLINEP  331

Query  481  VEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  302
            VEGGEGN+LGQLA++MPQAV VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY
Sbjct  332  VEGGEGNVLGQLASAMPQAVTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  391

Query  301  LLDHMHEFED  272
            LLDHMHEFED
Sbjct  392  LLDHMHEFED  401



>ref|XP_006430789.1| hypothetical protein CICLE_v10011886mg [Citrus clementina]
 gb|ESR44029.1| hypothetical protein CICLE_v10011886mg [Citrus clementina]
Length=401

 Score =   256 bits (654),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 122/130 (94%), Positives = 126/130 (97%), Gaps = 0/130 (0%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
            GA TL+FLRNSQQFQALR MVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEP
Sbjct  272  GAGTLDFLRNSQQFQALRTMVQANPQILQPMLQELGKQNPHLMRLIQEHQTDFLRLINEP  331

Query  481  VEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  302
            VEGGEGN+LGQLA++MPQAV VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY
Sbjct  332  VEGGEGNVLGQLASAMPQAVTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  391

Query  301  LLDHMHEFED  272
            LLDHMHEFED
Sbjct  392  LLDHMHEFED  401



>ref|XP_002282352.1| PREDICTED: ubiquitin receptor RAD23c isoform X2 [Vitis vinifera]
 emb|CBI27030.3| unnamed protein product [Vitis vinifera]
Length=397

 Score =   254 bits (650),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 124/131 (95%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = -2

Query  664  GGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE  485
             GA TL+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP LMRLIQEHQADFLRLINE
Sbjct  267  AGAGTLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLMRLIQEHQADFLRLINE  326

Query  484  PVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  305
            PVEGGEGNILGQLAA+MPQAV VTPEEREAI RLEAMGFDRALVLEVFFACNKNEELAAN
Sbjct  327  PVEGGEGNILGQLAAAMPQAVTVTPEEREAIARLEAMGFDRALVLEVFFACNKNEELAAN  386

Query  304  YLLDHMHEFED  272
            YLLDHMHEFED
Sbjct  387  YLLDHMHEFED  397



>ref|XP_010647738.1| PREDICTED: ubiquitin receptor RAD23c isoform X1 [Vitis vinifera]
Length=398

 Score =   254 bits (650),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 124/131 (95%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = -2

Query  664  GGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE  485
             GA TL+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP LMRLIQEHQADFLRLINE
Sbjct  268  AGAGTLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLMRLIQEHQADFLRLINE  327

Query  484  PVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  305
            PVEGGEGNILGQLAA+MPQAV VTPEEREAI RLEAMGFDRALVLEVFFACNKNEELAAN
Sbjct  328  PVEGGEGNILGQLAAAMPQAVTVTPEEREAIARLEAMGFDRALVLEVFFACNKNEELAAN  387

Query  304  YLLDHMHEFED  272
            YLLDHMHEFED
Sbjct  388  YLLDHMHEFED  398



>ref|XP_009631150.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Nicotiana 
tomentosiformis]
Length=395

 Score =   254 bits (648),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 123/131 (94%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = -2

Query  664  GGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE  485
            GGANTL+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP LMRLIQEHQADFLRLINE
Sbjct  265  GGANTLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLMRLIQEHQADFLRLINE  324

Query  484  PVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  305
            PVEGGEGNILGQLAA+MPQA+QVTPEEREAIERLE MGFD  LVLEVFFACNKNEELAAN
Sbjct  325  PVEGGEGNILGQLAAAMPQAIQVTPEEREAIERLEQMGFDHDLVLEVFFACNKNEELAAN  384

Query  304  YLLDHMHEFED  272
            YLLDHMHEFE+
Sbjct  385  YLLDHMHEFEE  395



>ref|XP_010044267.1| PREDICTED: ubiquitin receptor RAD23d-like [Eucalyptus grandis]
 gb|KCW86329.1| hypothetical protein EUGRSUZ_B03019 [Eucalyptus grandis]
Length=401

 Score =   254 bits (649),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 121/130 (93%), Positives = 128/130 (98%), Gaps = 0/130 (0%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
            GA TL+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP
Sbjct  272  GAGTLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  331

Query  481  VEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  302
            +EGGEGNILGQLA+SMPQAV VTPEEREAIERLEAMGFDRA+VLEV+FACNKNEELAANY
Sbjct  332  LEGGEGNILGQLASSMPQAVTVTPEEREAIERLEAMGFDRAIVLEVYFACNKNEELAANY  391

Query  301  LLDHMHEFED  272
            LLDH+HE+ED
Sbjct  392  LLDHIHEYED  401



>ref|XP_002312393.1| hypothetical protein POPTR_0008s11840g [Populus trichocarpa]
 gb|EEE89760.1| hypothetical protein POPTR_0008s11840g [Populus trichocarpa]
Length=333

 Score =   252 bits (643),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 122/129 (95%), Positives = 125/129 (97%), Gaps = 0/129 (0%)
 Frame = -2

Query  664  GGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE  485
            GGA TL+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINE
Sbjct  205  GGAGTLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQDDFLRLINE  264

Query  484  PVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  305
            PVE GEGN+LGQLAA+MPQAV VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN
Sbjct  265  PVESGEGNVLGQLAAAMPQAVTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  324

Query  304  YLLDHMHEF  278
            YLLDHMHEF
Sbjct  325  YLLDHMHEF  333



>gb|KDO58998.1| hypothetical protein CISIN_1g014118mg [Citrus sinensis]
Length=397

 Score =   254 bits (648),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 122/131 (93%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = -2

Query  664  GGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE  485
             GA TL+FLRNSQQFQALR MVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINE
Sbjct  267  AGAGTLDFLRNSQQFQALRTMVQANPQILQPMLQELGKQNPHLMRLIQEHQTDFLRLINE  326

Query  484  PVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  305
            PVEGGEGN+LGQLA++MPQAV VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN
Sbjct  327  PVEGGEGNVLGQLASAMPQAVTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  386

Query  304  YLLDHMHEFED  272
            YLLDHMHEFED
Sbjct  387  YLLDHMHEFED  397



>ref|XP_010103792.1| Putative DNA repair protein RAD23-3 [Morus notabilis]
 gb|EXB97154.1| Putative DNA repair protein RAD23-3 [Morus notabilis]
Length=421

 Score =   254 bits (649),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 121/130 (93%), Positives = 127/130 (98%), Gaps = 0/130 (0%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
            GA TL+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP LMRLIQEHQADFLRLINEP
Sbjct  290  GAGTLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLMRLIQEHQADFLRLINEP  349

Query  481  VEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  302
            VEGGEGN+LGQL+A+MPQAV VTPEEREAIERLEAMGFDRALVLEV+FACNKNEELAANY
Sbjct  350  VEGGEGNLLGQLSAAMPQAVTVTPEEREAIERLEAMGFDRALVLEVYFACNKNEELAANY  409

Query  301  LLDHMHEFED  272
            LLDHMHEF+D
Sbjct  410  LLDHMHEFDD  419



>ref|XP_009631151.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Nicotiana 
tomentosiformis]
Length=377

 Score =   252 bits (644),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 123/131 (94%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = -2

Query  664  GGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE  485
            GGANTL+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP LMRLIQEHQADFLRLINE
Sbjct  247  GGANTLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLMRLIQEHQADFLRLINE  306

Query  484  PVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  305
            PVEGGEGNILGQLAA+MPQA+QVTPEEREAIERLE MGFD  LVLEVFFACNKNEELAAN
Sbjct  307  PVEGGEGNILGQLAAAMPQAIQVTPEEREAIERLEQMGFDHDLVLEVFFACNKNEELAAN  366

Query  304  YLLDHMHEFED  272
            YLLDHMHEFE+
Sbjct  367  YLLDHMHEFEE  377



>ref|XP_011022044.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Populus 
euphratica]
Length=378

 Score =   252 bits (643),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 121/129 (94%), Positives = 124/129 (96%), Gaps = 0/129 (0%)
 Frame = -2

Query  664  GGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE  485
            GGA TL+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMR IQEHQ DFLRLINE
Sbjct  250  GGAGTLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRFIQEHQDDFLRLINE  309

Query  484  PVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  305
            PVE GEGN+LGQLAA+MPQAV VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN
Sbjct  310  PVESGEGNVLGQLAAAMPQAVTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  369

Query  304  YLLDHMHEF  278
            YLLDHMHEF
Sbjct  370  YLLDHMHEF  378



>ref|XP_007046249.1| Rad23 UV excision repair protein family isoform 1 [Theobroma 
cacao]
 gb|EOY02081.1| Rad23 UV excision repair protein family isoform 1 [Theobroma 
cacao]
Length=385

 Score =   252 bits (643),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 121/127 (95%), Positives = 124/127 (98%), Gaps = 0/127 (0%)
 Frame = -2

Query  652  TLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEG  473
            TL+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP EG
Sbjct  259  TLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPAEG  318

Query  472  GEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLD  293
            GEGNILGQLA +MPQAVQVTPEEREAIERLEAMGFDRA VL+VFFACNKNEELAANYLLD
Sbjct  319  GEGNILGQLAEAMPQAVQVTPEEREAIERLEAMGFDRATVLQVFFACNKNEELAANYLLD  378

Query  292  HMHEFED  272
            HMHEFED
Sbjct  379  HMHEFED  385



>emb|CDP19777.1| unnamed protein product [Coffea canephora]
Length=390

 Score =   251 bits (642),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 120/130 (92%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
            GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP
Sbjct  261  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  320

Query  481  VEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  302
            +EGGEGNILGQLA +MPQ +QVT EEREAI RLE MGFDRA VLEVFFACNKNEELAANY
Sbjct  321  IEGGEGNILGQLAGAMPQTIQVTAEEREAIRRLEEMGFDRATVLEVFFACNKNEELAANY  380

Query  301  LLDHMHEFED  272
            LLDHMHEFE+
Sbjct  381  LLDHMHEFEE  390



>ref|NP_001242098.1| uncharacterized protein LOC100813881 [Glycine max]
 gb|ACU21107.1| unknown [Glycine max]
Length=400

 Score =   251 bits (640),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 118/130 (91%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
            GA +L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEP
Sbjct  271  GAGSLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQVDFLRLINEP  330

Query  481  VEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  302
            VEGGEGNILGQLA +MPQAV VTPEER+AIERLEAMGFDRA VLEV+FACNKNEELAANY
Sbjct  331  VEGGEGNILGQLAGTMPQAVTVTPEERQAIERLEAMGFDRATVLEVYFACNKNEELAANY  390

Query  301  LLDHMHEFED  272
            LLDHMHEF++
Sbjct  391  LLDHMHEFDE  400



>ref|NP_001240201.1| uncharacterized protein LOC100809066 [Glycine max]
 gb|ACU22776.1| unknown [Glycine max]
 gb|KHN47572.1| Putative DNA repair protein RAD23-3 [Glycine soja]
Length=392

 Score =   250 bits (639),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 118/130 (91%), Positives = 126/130 (97%), Gaps = 0/130 (0%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
            GA +L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEP
Sbjct  263  GAGSLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQVDFLRLINEP  322

Query  481  VEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  302
            VEGGEGNILGQLA++MPQAV VTPEER+AIERLEAMGFDRA VLEV+FACNKNEELAANY
Sbjct  323  VEGGEGNILGQLASAMPQAVTVTPEERQAIERLEAMGFDRATVLEVYFACNKNEELAANY  382

Query  301  LLDHMHEFED  272
            LLDHMHEF++
Sbjct  383  LLDHMHEFDE  392



>ref|XP_006584606.1| PREDICTED: uncharacterized protein LOC100813881 isoform X3 [Glycine 
max]
Length=401

 Score =   250 bits (639),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 118/130 (91%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
            GA +L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEP
Sbjct  272  GAGSLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQVDFLRLINEP  331

Query  481  VEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  302
            VEGGEGNILGQLA +MPQAV VTPEER+AIERLEAMGFDRA VLEV+FACNKNEELAANY
Sbjct  332  VEGGEGNILGQLAGAMPQAVTVTPEERQAIERLEAMGFDRATVLEVYFACNKNEELAANY  391

Query  301  LLDHMHEFED  272
            LLDHMHEF++
Sbjct  392  LLDHMHEFDE  401



>ref|XP_006584608.1| PREDICTED: uncharacterized protein LOC100813881 isoform X5 [Glycine 
max]
Length=382

 Score =   250 bits (638),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 118/130 (91%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
            GA +L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEP
Sbjct  253  GAGSLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQVDFLRLINEP  312

Query  481  VEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  302
            VEGGEGNILGQLA +MPQAV VTPEER+AIERLEAMGFDRA VLEV+FACNKNEELAANY
Sbjct  313  VEGGEGNILGQLAGAMPQAVTVTPEERQAIERLEAMGFDRATVLEVYFACNKNEELAANY  372

Query  301  LLDHMHEFED  272
            LLDHMHEF++
Sbjct  373  LLDHMHEFDE  382



>gb|ACU18529.1| unknown [Glycine max]
Length=382

 Score =   249 bits (637),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 118/130 (91%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
            GA +L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEP
Sbjct  253  GAGSLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQVDFLRLINEP  312

Query  481  VEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  302
            VEGGEGNILGQLA +MPQAV VTPEER+AIERLEAMGFDRA VLEV+FACNKNEELAANY
Sbjct  313  VEGGEGNILGQLAGAMPQAVTVTPEERQAIERLEAMGFDRATVLEVYFACNKNEELAANY  372

Query  301  LLDHMHEFED  272
            LLDHMHEF++
Sbjct  373  LLDHMHEFDE  382



>ref|XP_006584607.1| PREDICTED: uncharacterized protein LOC100813881 isoform X4 [Glycine 
max]
Length=383

 Score =   249 bits (637),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 118/130 (91%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
            GA +L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEP
Sbjct  254  GAGSLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQVDFLRLINEP  313

Query  481  VEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  302
            VEGGEGNILGQLA +MPQAV VTPEER+AIERLEAMGFDRA VLEV+FACNKNEELAANY
Sbjct  314  VEGGEGNILGQLAGAMPQAVTVTPEERQAIERLEAMGFDRATVLEVYFACNKNEELAANY  373

Query  301  LLDHMHEFED  272
            LLDHMHEF++
Sbjct  374  LLDHMHEFDE  383



>gb|KHG17760.1| Putative DNA repair RAD23-3 -like protein [Gossypium arboreum]
Length=222

 Score =   243 bits (620),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 118/130 (91%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
            GA TL+FLRNS QFQALRAMVQANPQILQPMLQELGKQNP+LMRLIQEHQ DFLRLINEP
Sbjct  93   GAGTLDFLRNSPQFQALRAMVQANPQILQPMLQELGKQNPNLMRLIQEHQGDFLRLINEP  152

Query  481  VEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  302
             EGGEGNILGQLA +MPQAVQVTPEEREAIERLEAMGFDRA VL+VFFACNKNEELAANY
Sbjct  153  AEGGEGNILGQLAEAMPQAVQVTPEEREAIERLEAMGFDRATVLQVFFACNKNEELAANY  212

Query  301  LLDHMHEFED  272
            LLDHMH+F+D
Sbjct  213  LLDHMHDFQD  222



>ref|XP_003555895.1| PREDICTED: ubiquitin receptor RAD23c-like isoform 1 [Glycine 
max]
 gb|KHN11428.1| Putative DNA repair protein RAD23-3 [Glycine soja]
Length=402

 Score =   249 bits (635),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 116/130 (89%), Positives = 126/130 (97%), Gaps = 0/130 (0%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
            GA +L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLI++HQADFLRLINEP
Sbjct  272  GAGSLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIRDHQADFLRLINEP  331

Query  481  VEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  302
             EGGEGNILGQ+A+ MPQAV VTPEER+AIERLEAMGFDRA+VLEV+FACNKNEELAANY
Sbjct  332  AEGGEGNILGQMASGMPQAVTVTPEERQAIERLEAMGFDRAIVLEVYFACNKNEELAANY  391

Query  301  LLDHMHEFED  272
            LLDHMHEFE+
Sbjct  392  LLDHMHEFEE  401



>gb|KHN15504.1| Putative DNA repair protein RAD23-3 [Glycine soja]
Length=416

 Score =   249 bits (635),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 118/130 (91%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
            GA +L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEP
Sbjct  287  GAGSLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQVDFLRLINEP  346

Query  481  VEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  302
            VEGGEGNILGQLA +MPQAV VTPEER+AIERLEAMGFDRA VLEV+FACNKNEELAANY
Sbjct  347  VEGGEGNILGQLAGAMPQAVTVTPEERQAIERLEAMGFDRATVLEVYFACNKNEELAANY  406

Query  301  LLDHMHEFED  272
            LLDHMHEF++
Sbjct  407  LLDHMHEFDE  416



>ref|XP_002529115.1| uv excision repair protein rad23, putative [Ricinus communis]
 gb|EEF33228.1| uv excision repair protein rad23, putative [Ricinus communis]
Length=409

 Score =   249 bits (635),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 119/127 (94%), Positives = 124/127 (98%), Gaps = 0/127 (0%)
 Frame = -2

Query  652  TLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEG  473
            TL+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP+L+RLIQEHQ DFLRLINEPVEG
Sbjct  283  TLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPNLVRLIQEHQTDFLRLINEPVEG  342

Query  472  GEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLD  293
            GEGNI+GQLAA+MPQAV VTPEEREAIERLEAMGFDR LVLEVFFACNKNEELAANYLLD
Sbjct  343  GEGNIMGQLAAAMPQAVTVTPEEREAIERLEAMGFDRGLVLEVFFACNKNEELAANYLLD  402

Query  292  HMHEFED  272
            HMHEFED
Sbjct  403  HMHEFED  409



>ref|XP_006584604.1| PREDICTED: uncharacterized protein LOC100813881 isoform X1 [Glycine 
max]
Length=469

 Score =   250 bits (639),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 118/130 (91%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
            GA +L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEP
Sbjct  340  GAGSLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQVDFLRLINEP  399

Query  481  VEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  302
            VEGGEGNILGQLA +MPQAV VTPEER+AIERLEAMGFDRA VLEV+FACNKNEELAANY
Sbjct  400  VEGGEGNILGQLAGAMPQAVTVTPEERQAIERLEAMGFDRATVLEVYFACNKNEELAANY  459

Query  301  LLDHMHEFED  272
            LLDHMHEF++
Sbjct  460  LLDHMHEFDE  469



>ref|XP_006584605.1| PREDICTED: uncharacterized protein LOC100813881 isoform X2 [Glycine 
max]
Length=468

 Score =   250 bits (639),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 118/130 (91%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
            GA +L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEP
Sbjct  339  GAGSLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQVDFLRLINEP  398

Query  481  VEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  302
            VEGGEGNILGQLA +MPQAV VTPEER+AIERLEAMGFDRA VLEV+FACNKNEELAANY
Sbjct  399  VEGGEGNILGQLAGAMPQAVTVTPEERQAIERLEAMGFDRATVLEVYFACNKNEELAANY  458

Query  301  LLDHMHEFED  272
            LLDHMHEF++
Sbjct  459  LLDHMHEFDE  468



>gb|KJB80000.1| hypothetical protein B456_013G076800 [Gossypium raimondii]
Length=382

 Score =   247 bits (631),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 118/130 (91%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
            GA TL+FLRNS QFQALRAMVQANPQILQPMLQELGKQNP+LMRLIQEHQ DFLRLINEP
Sbjct  253  GAGTLDFLRNSPQFQALRAMVQANPQILQPMLQELGKQNPNLMRLIQEHQGDFLRLINEP  312

Query  481  VEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  302
             EGGEGNILGQLA +MPQAVQVTPEEREAIERLEAMGFDRA VL+VFFACNKNEELAANY
Sbjct  313  AEGGEGNILGQLAEAMPQAVQVTPEEREAIERLEAMGFDRATVLQVFFACNKNEELAANY  372

Query  301  LLDHMHEFED  272
            LLDHMH+F+D
Sbjct  373  LLDHMHDFQD  382



>gb|KJB79998.1| hypothetical protein B456_013G076800 [Gossypium raimondii]
 gb|KJB79999.1| hypothetical protein B456_013G076800 [Gossypium raimondii]
Length=384

 Score =   247 bits (631),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 118/130 (91%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
            GA TL+FLRNS QFQALRAMVQANPQILQPMLQELGKQNP+LMRLIQEHQ DFLRLINEP
Sbjct  255  GAGTLDFLRNSPQFQALRAMVQANPQILQPMLQELGKQNPNLMRLIQEHQGDFLRLINEP  314

Query  481  VEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  302
             EGGEGNILGQLA +MPQAVQVTPEEREAIERLEAMGFDRA VL+VFFACNKNEELAANY
Sbjct  315  AEGGEGNILGQLAEAMPQAVQVTPEEREAIERLEAMGFDRATVLQVFFACNKNEELAANY  374

Query  301  LLDHMHEFED  272
            LLDHMH+F+D
Sbjct  375  LLDHMHDFQD  384



>ref|XP_009791274.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X1 [Nicotiana 
sylvestris]
Length=395

 Score =   248 bits (632),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 122/132 (92%), Positives = 127/132 (96%), Gaps = 1/132 (1%)
 Frame = -2

Query  664  GGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE  485
            GGANTL+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP LMRLIQEHQADFLRLINE
Sbjct  264  GGANTLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLMRLIQEHQADFLRLINE  323

Query  484  PVE-GGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAA  308
            PVE GGEGNILGQLAA+MPQA+QVTPEEREAIERLE MGFD  LVLEVFFACNKNEELAA
Sbjct  324  PVEGGGEGNILGQLAAAMPQAIQVTPEEREAIERLEQMGFDHDLVLEVFFACNKNEELAA  383

Query  307  NYLLDHMHEFED  272
            NYLLDH+HEFE+
Sbjct  384  NYLLDHIHEFEE  395



>ref|XP_011070815.1| PREDICTED: ubiquitin receptor RAD23c-like [Sesamum indicum]
Length=433

 Score =   248 bits (634),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/131 (92%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = -2

Query  664  GGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE  485
            GGANTL+FLRNS QFQALRAMVQANPQILQPMLQELGKQNP L+RLIQEHQADFLRLINE
Sbjct  303  GGANTLDFLRNSPQFQALRAMVQANPQILQPMLQELGKQNPQLVRLIQEHQADFLRLINE  362

Query  484  PVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  305
            PVEGG GNIL QLA +MPQA+QVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN
Sbjct  363  PVEGGAGNILEQLAGAMPQAIQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  422

Query  304  YLLDHMHEFED  272
            YLLDH+HEFE+
Sbjct  423  YLLDHIHEFEE  433



>gb|EPS71284.1| hypothetical protein M569_03474, partial [Genlisea aurea]
Length=389

 Score =   247 bits (630),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 119/131 (91%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = -2

Query  664  GGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE  485
            GGANTLEFLRN+ QFQALRAMVQANPQILQPMLQELGKQNP L+RLIQ+HQADFLRLINE
Sbjct  259  GGANTLEFLRNTPQFQALRAMVQANPQILQPMLQELGKQNPQLVRLIQDHQADFLRLINE  318

Query  484  PVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  305
            PVEGGEG++LGQLA  MPQAV VTPEEREAIERLEAMGFDRALVLEV+FACNKNEELAAN
Sbjct  319  PVEGGEGDLLGQLAGGMPQAVTVTPEEREAIERLEAMGFDRALVLEVYFACNKNEELAAN  378

Query  304  YLLDHMHEFED  272
            YLLDH HEFED
Sbjct  379  YLLDHGHEFED  389



>gb|KJB79994.1| hypothetical protein B456_013G076500 [Gossypium raimondii]
Length=384

 Score =   247 bits (630),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 117/130 (90%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
            GA +L+FLRNS QFQALRAMVQANPQILQPMLQELGKQNP+LMRLIQEHQ DFLRLINEP
Sbjct  255  GAGSLDFLRNSPQFQALRAMVQANPQILQPMLQELGKQNPNLMRLIQEHQGDFLRLINEP  314

Query  481  VEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  302
             EGGEGNILGQLA +MPQAVQVTPEEREAIERLEAMGFDRA VL+VFFACNKNEELAANY
Sbjct  315  AEGGEGNILGQLAEAMPQAVQVTPEEREAIERLEAMGFDRATVLQVFFACNKNEELAANY  374

Query  301  LLDHMHEFED  272
            LLDHMH+F+D
Sbjct  375  LLDHMHDFQD  384



>ref|XP_006367045.1| PREDICTED: ubiquitin receptor RAD23c-like [Solanum tuberosum]
Length=398

 Score =   247 bits (631),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 121/131 (92%), Positives = 126/131 (96%), Gaps = 1/131 (1%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
            GANTL+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP
Sbjct  268  GANTLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  327

Query  481  VEGGEG-NILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  305
            VEGGEG N+LGQLAA+MPQA+ VTPEEREAIERLE MGFD  LVLEVFFACNKNEELAAN
Sbjct  328  VEGGEGNNVLGQLAAAMPQAISVTPEEREAIERLEQMGFDHDLVLEVFFACNKNEELAAN  387

Query  304  YLLDHMHEFED  272
            YLLDHMHEFE+
Sbjct  388  YLLDHMHEFEE  398



>ref|XP_009791275.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Nicotiana 
sylvestris]
Length=377

 Score =   246 bits (629),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 122/132 (92%), Positives = 127/132 (96%), Gaps = 1/132 (1%)
 Frame = -2

Query  664  GGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE  485
            GGANTL+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP LMRLIQEHQADFLRLINE
Sbjct  246  GGANTLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLMRLIQEHQADFLRLINE  305

Query  484  PVE-GGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAA  308
            PVE GGEGNILGQLAA+MPQA+QVTPEEREAIERLE MGFD  LVLEVFFACNKNEELAA
Sbjct  306  PVEGGGEGNILGQLAAAMPQAIQVTPEEREAIERLEQMGFDHDLVLEVFFACNKNEELAA  365

Query  307  NYLLDHMHEFED  272
            NYLLDH+HEFE+
Sbjct  366  NYLLDHIHEFEE  377



>ref|XP_003536688.1| PREDICTED: ubiquitin receptor RAD23c [Glycine max]
Length=408

 Score =   247 bits (631),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 126/130 (97%), Gaps = 0/130 (0%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
            GA +L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLI++HQADFLRLINEP
Sbjct  278  GAGSLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIRDHQADFLRLINEP  337

Query  481  VEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  302
             EG EGNILGQ+A++MPQAV VTPEER+AIERLEAMGFDRA+VLEV+FACNKNEELAANY
Sbjct  338  AEGAEGNILGQMASAMPQAVTVTPEERQAIERLEAMGFDRAIVLEVYFACNKNEELAANY  397

Query  301  LLDHMHEFED  272
            LLDHMHEFE+
Sbjct  398  LLDHMHEFEE  407



>gb|KJB80004.1| hypothetical protein B456_013G076900 [Gossypium raimondii]
Length=384

 Score =   246 bits (629),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 117/130 (90%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
            GA TL+FLRNS QFQAL+AMVQANPQILQPMLQELGKQNP+LMRLIQEHQ DFLRLINEP
Sbjct  255  GAGTLDFLRNSPQFQALQAMVQANPQILQPMLQELGKQNPNLMRLIQEHQGDFLRLINEP  314

Query  481  VEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  302
             EGGEGNILGQLA +MPQAVQVTPEEREAIERLEAMGFDRA VL+VFFACNKNEELAANY
Sbjct  315  AEGGEGNILGQLAEAMPQAVQVTPEEREAIERLEAMGFDRATVLQVFFACNKNEELAANY  374

Query  301  LLDHMHEFED  272
            LLDHMH+F+D
Sbjct  375  LLDHMHDFQD  384



>gb|KDP32945.1| hypothetical protein JCGZ_12976 [Jatropha curcas]
Length=382

 Score =   246 bits (629),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 119/131 (91%), Positives = 125/131 (95%), Gaps = 1/131 (1%)
 Frame = -2

Query  664  GGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE  485
              A TL+FLRNSQQFQALR MVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE
Sbjct  253  ASAGTLDFLRNSQQFQALRTMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE  312

Query  484  PVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  305
            PVEG EGN+LGQLA++MPQAV VTPEEREAIERLEAMGFDRA+VLEVFFACNKNEELAAN
Sbjct  313  PVEG-EGNVLGQLASAMPQAVTVTPEEREAIERLEAMGFDRAIVLEVFFACNKNEELAAN  371

Query  304  YLLDHMHEFED  272
            YLLDHMHEFE+
Sbjct  372  YLLDHMHEFEE  382



>gb|KJB80005.1| hypothetical protein B456_013G076900 [Gossypium raimondii]
Length=385

 Score =   246 bits (629),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 117/130 (90%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
            GA TL+FLRNS QFQAL+AMVQANPQILQPMLQELGKQNP+LMRLIQEHQ DFLRLINEP
Sbjct  256  GAGTLDFLRNSPQFQALQAMVQANPQILQPMLQELGKQNPNLMRLIQEHQGDFLRLINEP  315

Query  481  VEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  302
             EGGEGNILGQLA +MPQAVQVTPEEREAIERLEAMGFDRA VL+VFFACNKNEELAANY
Sbjct  316  AEGGEGNILGQLAEAMPQAVQVTPEEREAIERLEAMGFDRATVLQVFFACNKNEELAANY  375

Query  301  LLDHMHEFED  272
            LLDHMH+F+D
Sbjct  376  LLDHMHDFQD  385



>gb|KHN05574.1| Putative DNA repair protein RAD23-3 [Glycine soja]
Length=410

 Score =   247 bits (631),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 126/130 (97%), Gaps = 0/130 (0%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
            GA +L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLI++HQADFLRLINEP
Sbjct  280  GAGSLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIRDHQADFLRLINEP  339

Query  481  VEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  302
             EG EGNILGQ+A++MPQAV VTPEER+AIERLEAMGFDRA+VLEV+FACNKNEELAANY
Sbjct  340  AEGAEGNILGQMASAMPQAVTVTPEERQAIERLEAMGFDRAIVLEVYFACNKNEELAANY  399

Query  301  LLDHMHEFED  272
            LLDHMHEFE+
Sbjct  400  LLDHMHEFEE  409



>gb|KJB79996.1| hypothetical protein B456_013G076600 [Gossypium raimondii]
Length=340

 Score =   244 bits (624),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 116/130 (89%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
            GA +L+FLRNS QFQALRAMVQANPQILQPMLQELGKQNP+L+RLIQEHQ DFLRLINEP
Sbjct  211  GAGSLDFLRNSPQFQALRAMVQANPQILQPMLQELGKQNPNLVRLIQEHQGDFLRLINEP  270

Query  481  VEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  302
             EGGEGNILGQLA +MPQAVQVTPEEREAIERLEAMGFDRA VL+VFFACNKNEELAANY
Sbjct  271  AEGGEGNILGQLAEAMPQAVQVTPEEREAIERLEAMGFDRATVLQVFFACNKNEELAANY  330

Query  301  LLDHMHEFED  272
            LLDHMH+F+D
Sbjct  331  LLDHMHDFQD  340



>ref|XP_004236965.1| PREDICTED: ubiquitin receptor RAD23c [Solanum lycopersicum]
Length=409

 Score =   246 bits (628),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 120/131 (92%), Positives = 126/131 (96%), Gaps = 1/131 (1%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
            GANTL+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP
Sbjct  279  GANTLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  338

Query  481  VEGGEG-NILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  305
            VEGGEG N+LGQLAA+MPQA+ VTPEEREAIERLE MGFD  LVLEVFFACNKNEELAAN
Sbjct  339  VEGGEGNNVLGQLAAAMPQAISVTPEEREAIERLEQMGFDHDLVLEVFFACNKNEELAAN  398

Query  304  YLLDHMHEFED  272
            YLLDH+HEFE+
Sbjct  399  YLLDHIHEFEE  409



>gb|AFK43607.1| unknown [Lotus japonicus]
Length=228

 Score =   239 bits (611),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 118/131 (90%), Positives = 125/131 (95%), Gaps = 1/131 (1%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
            GA +L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQ+HQ DFLRLINEP
Sbjct  97   GAGSLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQDHQVDFLRLINEP  156

Query  481  VEGGEGNILGQLA-ASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  305
            VEGGEGNILGQ A A+MPQAV VTPEEREAIERLEAMGFDRA VLEV+FACNKNEELAAN
Sbjct  157  VEGGEGNILGQPAGAAMPQAVSVTPEEREAIERLEAMGFDRATVLEVYFACNKNEELAAN  216

Query  304  YLLDHMHEFED  272
            YLLDHMHEF++
Sbjct  217  YLLDHMHEFDE  227



>gb|KJB79995.1| hypothetical protein B456_013G076600 [Gossypium raimondii]
Length=384

 Score =   245 bits (625),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 116/130 (89%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
            GA +L+FLRNS QFQALRAMVQANPQILQPMLQELGKQNP+L+RLIQEHQ DFLRLINEP
Sbjct  255  GAGSLDFLRNSPQFQALRAMVQANPQILQPMLQELGKQNPNLVRLIQEHQGDFLRLINEP  314

Query  481  VEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  302
             EGGEGNILGQLA +MPQAVQVTPEEREAIERLEAMGFDRA VL+VFFACNKNEELAANY
Sbjct  315  AEGGEGNILGQLAEAMPQAVQVTPEEREAIERLEAMGFDRATVLQVFFACNKNEELAANY  374

Query  301  LLDHMHEFED  272
            LLDHMH+F+D
Sbjct  375  LLDHMHDFQD  384



>ref|XP_002516727.1| uv excision repair protein rad23, putative [Ricinus communis]
 gb|EEF45625.1| uv excision repair protein rad23, putative [Ricinus communis]
Length=381

 Score =   243 bits (621),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 116/130 (89%), Positives = 126/130 (97%), Gaps = 1/130 (1%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
             A TL+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP
Sbjct  253  SAGTLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  312

Query  481  VEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  302
            VEG +GN+LGQLA+++PQ+V VTPEEREAIERLEAMGFDRA+VLEVFFACNKNEELAANY
Sbjct  313  VEG-DGNLLGQLASAVPQSVSVTPEEREAIERLEAMGFDRAIVLEVFFACNKNEELAANY  371

Query  301  LLDHMHEFED  272
            LLDHMH+FE+
Sbjct  372  LLDHMHDFEE  381



>ref|XP_004497101.1| PREDICTED: putative DNA repair protein RAD23-3-like [Cicer arietinum]
Length=400

 Score =   244 bits (622),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 113/130 (87%), Positives = 126/130 (97%), Gaps = 0/130 (0%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
            GA +L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLI++HQADFLRLINEP
Sbjct  270  GAGSLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIRDHQADFLRLINEP  329

Query  481  VEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  302
            +EGGEGN+LGQ+A  MPQAV VTPEER+AIERLEAMGFDRA+VLEV+FACNKNEELAANY
Sbjct  330  MEGGEGNLLGQMAGGMPQAVTVTPEERQAIERLEAMGFDRAIVLEVYFACNKNEELAANY  389

Query  301  LLDHMHEFED  272
            LLDH+HEF++
Sbjct  390  LLDHIHEFDE  399



>ref|XP_006378490.1| hypothetical protein POPTR_0010s13610g [Populus trichocarpa]
 gb|ERP56287.1| hypothetical protein POPTR_0010s13610g [Populus trichocarpa]
Length=352

 Score =   242 bits (618),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 116/129 (90%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = -2

Query  658  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  479
            A TL+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPV
Sbjct  224  AGTLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQDDFLRLINEPV  283

Query  478  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  299
            EGGEGN+ G LAA+MPQ+V VTPEEREAIERL AMGFD ALVLEV+FACNKNEELAANYL
Sbjct  284  EGGEGNVSGPLAAAMPQSVTVTPEEREAIERLGAMGFDPALVLEVYFACNKNEELAANYL  343

Query  298  LDHMHEFED  272
            LDH+HEFED
Sbjct  344  LDHIHEFED  352



>ref|XP_011099561.1| PREDICTED: ubiquitin receptor RAD23c-like [Sesamum indicum]
Length=380

 Score =   243 bits (620),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 120/131 (92%), Positives = 124/131 (95%), Gaps = 1/131 (1%)
 Frame = -2

Query  664  GGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE  485
              A TL+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP L+RLIQEHQADFLRLINE
Sbjct  251  ASAGTLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLVRLIQEHQADFLRLINE  310

Query  484  PVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  305
            PVEG EGNILGQLA +MPQAV VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN
Sbjct  311  PVEG-EGNILGQLAEAMPQAVTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  369

Query  304  YLLDHMHEFED  272
            YLLDHMHEF+D
Sbjct  370  YLLDHMHEFDD  380



>ref|XP_010525156.1| PREDICTED: ubiquitin receptor RAD23c-like [Tarenaya hassleriana]
Length=407

 Score =   244 bits (622),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 119/131 (91%), Positives = 126/131 (96%), Gaps = 1/131 (1%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
            GA TL+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP
Sbjct  277  GAGTLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  336

Query  481  VEGGE-GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  305
            VEGGE GNI+ QLA  +PQA+QVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN
Sbjct  337  VEGGEGGNIINQLAGGVPQAIQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  396

Query  304  YLLDHMHEFED  272
            YLLDH+HEF++
Sbjct  397  YLLDHIHEFDE  407



>ref|XP_007033284.1| Rad23 UV excision repair protein family isoform 1 [Theobroma 
cacao]
 gb|EOY04210.1| Rad23 UV excision repair protein family isoform 1 [Theobroma 
cacao]
Length=487

 Score =   246 bits (628),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 121/131 (92%), Positives = 126/131 (96%), Gaps = 1/131 (1%)
 Frame = -2

Query  664  GGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE  485
             GA TL+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE
Sbjct  358  AGAGTLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE  417

Query  484  PVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  305
            PVEG EGN+LGQLAA+MPQAV VTPEEREAIERLEAMGFDR +VLEVFFACNKNEELAAN
Sbjct  418  PVEG-EGNLLGQLAAAMPQAVTVTPEEREAIERLEAMGFDRNIVLEVFFACNKNEELAAN  476

Query  304  YLLDHMHEFED  272
            YLLDHMHEFE+
Sbjct  477  YLLDHMHEFEE  487



>gb|KDO58993.1| hypothetical protein CISIN_1g014118mg [Citrus sinensis]
Length=398

 Score =   243 bits (621),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 118/130 (91%), Positives = 122/130 (94%), Gaps = 4/130 (3%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
            GA TL+FLRNSQQFQALR MVQANPQILQ    ELGKQNPHLMRLIQEHQ DFLRLINEP
Sbjct  273  GAGTLDFLRNSQQFQALRTMVQANPQILQ----ELGKQNPHLMRLIQEHQTDFLRLINEP  328

Query  481  VEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  302
            VEGGEGN+LGQLA++MPQAV VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY
Sbjct  329  VEGGEGNVLGQLASAMPQAVTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  388

Query  301  LLDHMHEFED  272
            LLDHMHEFED
Sbjct  389  LLDHMHEFED  398



>gb|ABD96960.1| hypothetical protein [Cleome spinosa]
Length=435

 Score =   244 bits (623),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 119/131 (91%), Positives = 126/131 (96%), Gaps = 1/131 (1%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
            GA TL+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP
Sbjct  305  GAGTLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  364

Query  481  VEGGE-GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  305
            VEGGE GNI+ QLA  +PQA+QVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN
Sbjct  365  VEGGEGGNIINQLAGGVPQAIQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  424

Query  304  YLLDHMHEFED  272
            YLLDH+HEF++
Sbjct  425  YLLDHIHEFDE  435



>ref|XP_002315945.2| hypothetical protein POPTR_0010s13610g [Populus trichocarpa]
 gb|EEF02116.2| hypothetical protein POPTR_0010s13610g [Populus trichocarpa]
Length=396

 Score =   243 bits (619),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 116/129 (90%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = -2

Query  658  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  479
            A TL+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPV
Sbjct  268  AGTLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQDDFLRLINEPV  327

Query  478  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  299
            EGGEGN+ G LAA+MPQ+V VTPEEREAIERL AMGFD ALVLEV+FACNKNEELAANYL
Sbjct  328  EGGEGNVSGPLAAAMPQSVTVTPEEREAIERLGAMGFDPALVLEVYFACNKNEELAANYL  387

Query  298  LDHMHEFED  272
            LDH+HEFED
Sbjct  388  LDHIHEFED  396



>ref|XP_011007998.1| PREDICTED: ubiquitin receptor RAD23d-like [Populus euphratica]
Length=388

 Score =   242 bits (618),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 116/127 (91%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = -2

Query  652  TLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEG  473
            TL+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEG
Sbjct  262  TLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQDDFLRLINEPVEG  321

Query  472  GEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLD  293
            GEGNI G LAA+MPQ+V VTPEEREAIERL AMGFD ALVLEV+FACNKNEELAANYLLD
Sbjct  322  GEGNISGPLAAAMPQSVTVTPEEREAIERLGAMGFDPALVLEVYFACNKNEELAANYLLD  381

Query  292  HMHEFED  272
            H+HEFED
Sbjct  382  HIHEFED  388



>ref|XP_011035052.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X4 [Populus 
euphratica]
Length=385

 Score =   242 bits (617),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 116/131 (89%), Positives = 125/131 (95%), Gaps = 1/131 (1%)
 Frame = -2

Query  664  GGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE  485
             G   L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP+LMRLIQEHQADFLRLINE
Sbjct  256  AGTGNLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPYLMRLIQEHQADFLRLINE  315

Query  484  PVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  305
            PVEG EGN+LGQLA++MPQAV VTPEEREAIERLEAMGFDRA+VLEV+FACNKNEELAAN
Sbjct  316  PVEG-EGNVLGQLASAMPQAVTVTPEEREAIERLEAMGFDRAIVLEVYFACNKNEELAAN  374

Query  304  YLLDHMHEFED  272
            YLLDHMHEF++
Sbjct  375  YLLDHMHEFDE  385



>ref|XP_008230399.1| PREDICTED: ubiquitin receptor RAD23d [Prunus mume]
Length=385

 Score =   242 bits (617),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/131 (89%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = -2

Query  664  GGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE  485
             GA  L+FLRNS QFQALRAMVQANPQILQPMLQELGKQNPHLM+LIQ HQADFLRLINE
Sbjct  255  AGAGNLDFLRNSPQFQALRAMVQANPQILQPMLQELGKQNPHLMQLIQAHQADFLRLINE  314

Query  484  PVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  305
            PVEGGEGN+L QL A++PQAV VTPEEREAIERLEAMGFDRALVLEV+FACNKNEELAAN
Sbjct  315  PVEGGEGNLLEQLGAAVPQAVTVTPEEREAIERLEAMGFDRALVLEVYFACNKNEELAAN  374

Query  304  YLLDHMHEFED  272
            YLLDHMHEFE+
Sbjct  375  YLLDHMHEFEE  385



>ref|XP_011035051.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X3 [Populus 
euphratica]
Length=386

 Score =   242 bits (617),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/131 (89%), Positives = 125/131 (95%), Gaps = 1/131 (1%)
 Frame = -2

Query  664  GGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE  485
             G   L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP+LMRLIQEHQADFLRLINE
Sbjct  257  AGTGNLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPYLMRLIQEHQADFLRLINE  316

Query  484  PVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  305
            PVEG EGN+LGQLA++MPQAV VTPEEREAIERLEAMGFDRA+VLEV+FACNKNEELAAN
Sbjct  317  PVEG-EGNVLGQLASAMPQAVTVTPEEREAIERLEAMGFDRAIVLEVYFACNKNEELAAN  375

Query  304  YLLDHMHEFED  272
            YLLDHMHEF++
Sbjct  376  YLLDHMHEFDE  386



>ref|XP_011035054.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X6 [Populus 
euphratica]
Length=337

 Score =   240 bits (613),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/131 (89%), Positives = 125/131 (95%), Gaps = 1/131 (1%)
 Frame = -2

Query  664  GGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE  485
             G   L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP+LMRLIQEHQADFLRLINE
Sbjct  208  AGTGNLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPYLMRLIQEHQADFLRLINE  267

Query  484  PVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  305
            PVEG EGN+LGQLA++MPQAV VTPEEREAIERLEAMGFDRA+VLEV+FACNKNEELAAN
Sbjct  268  PVEG-EGNVLGQLASAMPQAVTVTPEEREAIERLEAMGFDRAIVLEVYFACNKNEELAAN  326

Query  304  YLLDHMHEFED  272
            YLLDHMHEF++
Sbjct  327  YLLDHMHEFDE  337



>ref|XP_002305813.1| ubiquitin family protein [Populus trichocarpa]
 gb|EEE86324.1| ubiquitin family protein [Populus trichocarpa]
Length=385

 Score =   242 bits (617),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/131 (89%), Positives = 125/131 (95%), Gaps = 1/131 (1%)
 Frame = -2

Query  664  GGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE  485
             G   L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP+LMRLIQEHQADFLRLINE
Sbjct  256  AGTGNLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPYLMRLIQEHQADFLRLINE  315

Query  484  PVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  305
            PVEG EGN+LGQLA++MPQAV VTPEEREAIERLEAMGFDRA+VLEV+FACNKNEELAAN
Sbjct  316  PVEG-EGNVLGQLASAMPQAVTVTPEEREAIERLEAMGFDRAIVLEVYFACNKNEELAAN  374

Query  304  YLLDHMHEFED  272
            YLLDHMHEF++
Sbjct  375  YLLDHMHEFDE  385



>ref|XP_010263550.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X1 [Nelumbo 
nucifera]
Length=387

 Score =   242 bits (617),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 117/130 (90%), Positives = 121/130 (93%), Gaps = 3/130 (2%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
            GA TL+FLRNS QFQALR MVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP
Sbjct  261  GAGTLDFLRNSPQFQALRGMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  320

Query  481  VEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  302
            VEGGEGN+ GQ+A   P  VQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY
Sbjct  321  VEGGEGNLFGQMA---PATVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  377

Query  301  LLDHMHEFED  272
            LLDH+HEFED
Sbjct  378  LLDHIHEFED  387



>ref|XP_011035053.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X5 [Populus 
euphratica]
Length=373

 Score =   241 bits (615),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/131 (89%), Positives = 125/131 (95%), Gaps = 1/131 (1%)
 Frame = -2

Query  664  GGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE  485
             G   L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP+LMRLIQEHQADFLRLINE
Sbjct  244  AGTGNLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPYLMRLIQEHQADFLRLINE  303

Query  484  PVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  305
            PVEG EGN+LGQLA++MPQAV VTPEEREAIERLEAMGFDRA+VLEV+FACNKNEELAAN
Sbjct  304  PVEG-EGNVLGQLASAMPQAVTVTPEEREAIERLEAMGFDRAIVLEVYFACNKNEELAAN  362

Query  304  YLLDHMHEFED  272
            YLLDHMHEF++
Sbjct  363  YLLDHMHEFDE  373



>emb|CDP02781.1| unnamed protein product [Coffea canephora]
Length=387

 Score =   241 bits (616),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 119/131 (91%), Positives = 124/131 (95%), Gaps = 1/131 (1%)
 Frame = -2

Query  664  GGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE  485
              A +L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE
Sbjct  258  ASAGSLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE  317

Query  484  PVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  305
            PVEG EGNILGQLA +MPQAV VTPEEREAIERLEAMGFD ALVLEVFFACNKNEELAAN
Sbjct  318  PVEG-EGNILGQLAEAMPQAVTVTPEEREAIERLEAMGFDPALVLEVFFACNKNEELAAN  376

Query  304  YLLDHMHEFED  272
            YLLDHMHEF++
Sbjct  377  YLLDHMHEFDE  387



>ref|XP_010263555.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Nelumbo 
nucifera]
Length=386

 Score =   241 bits (616),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 117/130 (90%), Positives = 121/130 (93%), Gaps = 3/130 (2%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
            GA TL+FLRNS QFQALR MVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP
Sbjct  260  GAGTLDFLRNSPQFQALRGMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  319

Query  481  VEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  302
            VEGGEGN+ GQ+A   P  VQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY
Sbjct  320  VEGGEGNLFGQMA---PATVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  376

Query  301  LLDHMHEFED  272
            LLDH+HEFED
Sbjct  377  LLDHIHEFED  386



>ref|XP_011035049.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Populus 
euphratica]
Length=390

 Score =   241 bits (616),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/131 (89%), Positives = 125/131 (95%), Gaps = 1/131 (1%)
 Frame = -2

Query  664  GGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE  485
             G   L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP+LMRLIQEHQADFLRLINE
Sbjct  261  AGTGNLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPYLMRLIQEHQADFLRLINE  320

Query  484  PVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  305
            PVEG EGN+LGQLA++MPQAV VTPEEREAIERLEAMGFDRA+VLEV+FACNKNEELAAN
Sbjct  321  PVEG-EGNVLGQLASAMPQAVTVTPEEREAIERLEAMGFDRAIVLEVYFACNKNEELAAN  379

Query  304  YLLDHMHEFED  272
            YLLDHMHEF++
Sbjct  380  YLLDHMHEFDE  390



>ref|XP_011035048.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Populus 
euphratica]
Length=391

 Score =   241 bits (616),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/131 (89%), Positives = 125/131 (95%), Gaps = 1/131 (1%)
 Frame = -2

Query  664  GGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE  485
             G   L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP+LMRLIQEHQADFLRLINE
Sbjct  262  AGTGNLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPYLMRLIQEHQADFLRLINE  321

Query  484  PVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  305
            PVEG EGN+LGQLA++MPQAV VTPEEREAIERLEAMGFDRA+VLEV+FACNKNEELAAN
Sbjct  322  PVEG-EGNVLGQLASAMPQAVTVTPEEREAIERLEAMGFDRAIVLEVYFACNKNEELAAN  380

Query  304  YLLDHMHEFED  272
            YLLDHMHEF++
Sbjct  381  YLLDHMHEFDE  391



>ref|XP_007215515.1| hypothetical protein PRUPE_ppa007020mg [Prunus persica]
 gb|EMJ16714.1| hypothetical protein PRUPE_ppa007020mg [Prunus persica]
Length=385

 Score =   241 bits (615),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 116/131 (89%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = -2

Query  664  GGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE  485
             GA  L+FLRNS QFQALRAMVQANPQILQPMLQELGKQNPHLM+LIQ HQADFLRLINE
Sbjct  255  AGAGNLDFLRNSPQFQALRAMVQANPQILQPMLQELGKQNPHLMQLIQAHQADFLRLINE  314

Query  484  PVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  305
            PVEGGEGN+L QL A++PQAV VTPEEREAIERLEAMGFDRALVLEV+FACNKNEELAAN
Sbjct  315  PVEGGEGNLLEQLGAAVPQAVTVTPEEREAIERLEAMGFDRALVLEVYFACNKNEELAAN  374

Query  304  YLLDHMHEFED  272
            YLLDHMHEFE+
Sbjct  375  YLLDHMHEFEE  385



>gb|EYU34397.1| hypothetical protein MIMGU_mgv1a008220mg [Erythranthe guttata]
Length=381

 Score =   241 bits (614),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 120/135 (89%), Positives = 126/135 (93%), Gaps = 5/135 (4%)
 Frame = -2

Query  664  GGAN----TLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLR  497
            GG+N    TL+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP L+RLIQ+HQADFLR
Sbjct  248  GGSNASAGTLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLVRLIQDHQADFLR  307

Query  496  LINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEE  317
            LINEPVEG EGNILGQLA +MPQ V VTPEEREAIERLEAMGFDRALVLEVFFACNKNEE
Sbjct  308  LINEPVEG-EGNILGQLAEAMPQTVNVTPEEREAIERLEAMGFDRALVLEVFFACNKNEE  366

Query  316  LAANYLLDHMHEFED  272
            LAANYLLDHMHEF+D
Sbjct  367  LAANYLLDHMHEFDD  381



>ref|XP_011097188.1| PREDICTED: ubiquitin receptor RAD23c-like [Sesamum indicum]
Length=380

 Score =   241 bits (614),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 119/131 (91%), Positives = 124/131 (95%), Gaps = 1/131 (1%)
 Frame = -2

Query  664  GGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE  485
              A TL+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP L+RLIQEHQADFLRLINE
Sbjct  251  ASAGTLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLVRLIQEHQADFLRLINE  310

Query  484  PVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  305
            PVEG EGNILGQLA +MPQAV VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN
Sbjct  311  PVEG-EGNILGQLAEAMPQAVTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  369

Query  304  YLLDHMHEFED  272
            YLLDHMHEF++
Sbjct  370  YLLDHMHEFDE  380



>ref|XP_007142901.1| hypothetical protein PHAVU_007G026400g [Phaseolus vulgaris]
 gb|ESW14895.1| hypothetical protein PHAVU_007G026400g [Phaseolus vulgaris]
Length=402

 Score =   241 bits (615),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 113/127 (89%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = -2

Query  652  TLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEG  473
            +L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLI++HQADFLRLINEPVEG
Sbjct  275  SLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIRDHQADFLRLINEPVEG  334

Query  472  GEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLD  293
            GEGNILGQLA  MPQAV VT EER+AIERLEAMGFDRA+VLEV+FACNKNEELAANYLLD
Sbjct  335  GEGNILGQLAGGMPQAVSVTAEERQAIERLEAMGFDRAIVLEVYFACNKNEELAANYLLD  394

Query  292  HMHEFED  272
            H+HEF++
Sbjct  395  HIHEFDE  401



>ref|XP_009357056.1| PREDICTED: ubiquitin receptor RAD23d [Pyrus x bretschneideri]
Length=391

 Score =   241 bits (614),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 116/130 (89%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
            GA  L+FLRNS QFQALRAMVQANPQILQPMLQELGKQNPHLM+LIQ HQADFLRLINEP
Sbjct  262  GAGNLDFLRNSPQFQALRAMVQANPQILQPMLQELGKQNPHLMQLIQAHQADFLRLINEP  321

Query  481  VEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  302
            VEGGEGN+L QL A++PQAV VTPEEREAIERLEAMGFDRALVLEV+FACNKNEELAANY
Sbjct  322  VEGGEGNLLEQLGAAVPQAVTVTPEEREAIERLEAMGFDRALVLEVYFACNKNEELAANY  381

Query  301  LLDHMHEFED  272
            LLDHMHEFE+
Sbjct  382  LLDHMHEFEE  391



>ref|XP_010498530.1| PREDICTED: ubiquitin receptor RAD23c-like [Camelina sativa]
Length=420

 Score =   242 bits (617),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 120/134 (90%), Positives = 127/134 (95%), Gaps = 4/134 (3%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
            GA TL+FLRNSQQFQALRAMVQANPQ+LQPMLQELGKQNP+LMRLIQ+HQADFLRLINEP
Sbjct  287  GAGTLDFLRNSQQFQALRAMVQANPQVLQPMLQELGKQNPNLMRLIQDHQADFLRLINEP  346

Query  481  VEGG--EGNILGQLAASM--PQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEEL  314
            VEGG   GNILGQLAA M  PQA+QVTPEEREAIERLEAMGF+RALVLEVFFACNKNEEL
Sbjct  347  VEGGGESGNILGQLAAEMPQPQAIQVTPEEREAIERLEAMGFERALVLEVFFACNKNEEL  406

Query  313  AANYLLDHMHEFED  272
            AANYLLDHMHEFE+
Sbjct  407  AANYLLDHMHEFEE  420



>ref|XP_007142903.1| hypothetical protein PHAVU_007G026600g [Phaseolus vulgaris]
 gb|ESW14897.1| hypothetical protein PHAVU_007G026600g [Phaseolus vulgaris]
Length=400

 Score =   241 bits (615),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 113/127 (89%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = -2

Query  652  TLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEG  473
            +L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLI++HQADFLRLINEPVEG
Sbjct  273  SLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIRDHQADFLRLINEPVEG  332

Query  472  GEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLD  293
            GEGNILGQLA  MPQAV VT EER+AIERLEAMGFDRA+VLEV+FACNKNEELAANYLLD
Sbjct  333  GEGNILGQLAGGMPQAVTVTAEERQAIERLEAMGFDRAIVLEVYFACNKNEELAANYLLD  392

Query  292  HMHEFED  272
            H+HEF++
Sbjct  393  HIHEFDE  399



>ref|XP_002884326.1| hypothetical protein ARALYDRAFT_477488 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60585.1| hypothetical protein ARALYDRAFT_477488 [Arabidopsis lyrata subsp. 
lyrata]
Length=417

 Score =   241 bits (616),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 119/134 (89%), Positives = 127/134 (95%), Gaps = 4/134 (3%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
            GA TL+FLRNSQQFQALRAMVQANPQ+LQPMLQELGKQNP+LMRLIQ+HQADFLRLINEP
Sbjct  284  GAGTLDFLRNSQQFQALRAMVQANPQVLQPMLQELGKQNPNLMRLIQDHQADFLRLINEP  343

Query  481  VEGG--EGNILGQLAASM--PQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEEL  314
            VEGG   GN+LGQ+AA M  PQA+QVTPEEREAIERLEAMGFDRALVLEVFFACNKNEEL
Sbjct  344  VEGGGESGNLLGQMAAGMPQPQAIQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEEL  403

Query  313  AANYLLDHMHEFED  272
            AANYLLDHMHEFE+
Sbjct  404  AANYLLDHMHEFEE  417



>ref|XP_010485565.1| PREDICTED: ubiquitin receptor RAD23c-like [Camelina sativa]
Length=419

 Score =   241 bits (616),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 120/134 (90%), Positives = 127/134 (95%), Gaps = 4/134 (3%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
            GA TL+FLRNSQQFQALRAMVQANPQ+LQPMLQELGKQNP+LMRLIQ+HQADFLRLINEP
Sbjct  286  GAGTLDFLRNSQQFQALRAMVQANPQVLQPMLQELGKQNPNLMRLIQDHQADFLRLINEP  345

Query  481  VEGG--EGNILGQLAASM--PQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEEL  314
            VEGG   GNILGQLAA M  PQA+QVTPEEREAIERLEAMGF+RALVLEVFFACNKNEEL
Sbjct  346  VEGGGESGNILGQLAAEMPQPQAIQVTPEEREAIERLEAMGFERALVLEVFFACNKNEEL  405

Query  313  AANYLLDHMHEFED  272
            AANYLLDHMHEFE+
Sbjct  406  AANYLLDHMHEFEE  419



>gb|KDO58995.1| hypothetical protein CISIN_1g014118mg [Citrus sinensis]
Length=430

 Score =   241 bits (616),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 126/159 (79%), Gaps = 28/159 (18%)
 Frame = -2

Query  664  GGANTLEFLRNSQQ----------------------------FQALRAMVQANPQILQPM  569
             GA TL+FLRNSQQ                            FQALR MVQANPQILQPM
Sbjct  272  AGAGTLDFLRNSQQVSMMFYLFASLLFICDVFWYSYFRLLFQFQALRTMVQANPQILQPM  331

Query  568  LQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIE  389
            LQELGKQNPHLMRLIQEHQ DFLRLINEPVEGGEGN+LGQLA++MPQAV VTPEEREAIE
Sbjct  332  LQELGKQNPHLMRLIQEHQTDFLRLINEPVEGGEGNVLGQLASAMPQAVTVTPEEREAIE  391

Query  388  RLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  272
            RLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  392  RLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  430



>ref|XP_008379541.1| PREDICTED: ubiquitin receptor RAD23d-like [Malus domestica]
Length=387

 Score =   240 bits (612),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 116/131 (89%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = -2

Query  664  GGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE  485
             GA  L+FLRNS QFQALRAMVQANPQILQPMLQELGKQNPHLM+LIQ HQADFLRLINE
Sbjct  257  AGAGNLDFLRNSPQFQALRAMVQANPQILQPMLQELGKQNPHLMQLIQAHQADFLRLINE  316

Query  484  PVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  305
            PVEGGEGN+L QL A++PQAV VTPEEREAIERLEAMGFDRALVLEV+FACNKNEELAAN
Sbjct  317  PVEGGEGNLLEQLGAAVPQAVTVTPEEREAIERLEAMGFDRALVLEVYFACNKNEELAAN  376

Query  304  YLLDHMHEFED  272
            YLLDHMHEFE+
Sbjct  377  YLLDHMHEFEE  387



>ref|XP_006383465.1| hypothetical protein POPTR_0005s15740g [Populus trichocarpa]
 gb|ERP61262.1| hypothetical protein POPTR_0005s15740g [Populus trichocarpa]
Length=399

 Score =   240 bits (613),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 123/130 (95%), Gaps = 1/130 (1%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
            GA  L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEP
Sbjct  271  GAGNLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQPDFLRLINEP  330

Query  481  VEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  302
            VEG EGN+LGQLA+++PQ V VTPEEREAI+RL AMGFDRALVLEVFFACNKNEELAANY
Sbjct  331  VEG-EGNVLGQLASAVPQTVTVTPEEREAIDRLVAMGFDRALVLEVFFACNKNEELAANY  389

Query  301  LLDHMHEFED  272
            LLDHMHEF++
Sbjct  390  LLDHMHEFDE  399



>ref|XP_011021231.1| PREDICTED: ubiquitin receptor RAD23d isoform X1 [Populus euphratica]
Length=399

 Score =   240 bits (612),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 123/130 (95%), Gaps = 1/130 (1%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
            GA  L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEP
Sbjct  271  GAGNLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQPDFLRLINEP  330

Query  481  VEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  302
            VEG EGN+LGQLA+++PQ V VTPEEREAI+RL AMGFDRALVLEVFFACNKNEELAANY
Sbjct  331  VEG-EGNVLGQLASAVPQTVTVTPEEREAIDRLVAMGFDRALVLEVFFACNKNEELAANY  389

Query  301  LLDHMHEFED  272
            LLDHMHEF++
Sbjct  390  LLDHMHEFDE  399



>ref|XP_010463666.1| PREDICTED: ubiquitin receptor RAD23c [Camelina sativa]
Length=422

 Score =   241 bits (614),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 120/134 (90%), Positives = 127/134 (95%), Gaps = 4/134 (3%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
            GA TL+FLRNSQQFQALRAMVQANPQ+LQPMLQELGKQNP+LMRLIQ+HQADFLRLINEP
Sbjct  289  GAGTLDFLRNSQQFQALRAMVQANPQVLQPMLQELGKQNPNLMRLIQDHQADFLRLINEP  348

Query  481  VEGG--EGNILGQLAASM--PQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEEL  314
            VEGG   GNILGQLAA M  PQA+QVTPEEREAIERLEAMGF+RALVLEVFFACNKNEEL
Sbjct  349  VEGGGESGNILGQLAAEMPQPQAIQVTPEEREAIERLEAMGFERALVLEVFFACNKNEEL  408

Query  313  AANYLLDHMHEFED  272
            AANYLLDHMHEFE+
Sbjct  409  AANYLLDHMHEFEE  422



>ref|XP_011021232.1| PREDICTED: ubiquitin receptor RAD23d isoform X2 [Populus euphratica]
Length=398

 Score =   240 bits (612),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 123/130 (95%), Gaps = 1/130 (1%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
            GA  L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEP
Sbjct  270  GAGNLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQPDFLRLINEP  329

Query  481  VEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  302
            VEG EGN+LGQLA+++PQ V VTPEEREAI+RL AMGFDRALVLEVFFACNKNEELAANY
Sbjct  330  VEG-EGNVLGQLASAVPQTVTVTPEEREAIDRLVAMGFDRALVLEVFFACNKNEELAANY  388

Query  301  LLDHMHEFED  272
            LLDHMHEF++
Sbjct  389  LLDHMHEFDE  398



>ref|XP_006383464.1| ubiquitin family protein [Populus trichocarpa]
 gb|ERP61261.1| ubiquitin family protein [Populus trichocarpa]
Length=384

 Score =   239 bits (610),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 123/130 (95%), Gaps = 1/130 (1%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
            GA  L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEP
Sbjct  256  GAGNLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQPDFLRLINEP  315

Query  481  VEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  302
            VEG EGN+LGQLA+++PQ V VTPEEREAI+RL AMGFDRALVLEVFFACNKNEELAANY
Sbjct  316  VEG-EGNVLGQLASAVPQTVTVTPEEREAIDRLVAMGFDRALVLEVFFACNKNEELAANY  374

Query  301  LLDHMHEFED  272
            LLDHMHEF++
Sbjct  375  LLDHMHEFDE  384



>ref|XP_011021236.1| PREDICTED: ubiquitin receptor RAD23c isoform X4 [Populus euphratica]
Length=381

 Score =   239 bits (610),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 123/130 (95%), Gaps = 1/130 (1%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
            GA  L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEP
Sbjct  253  GAGNLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQPDFLRLINEP  312

Query  481  VEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  302
            VEG EGN+LGQLA+++PQ V VTPEEREAI+RL AMGFDRALVLEVFFACNKNEELAANY
Sbjct  313  VEG-EGNVLGQLASAVPQTVTVTPEEREAIDRLVAMGFDRALVLEVFFACNKNEELAANY  371

Query  301  LLDHMHEFED  272
            LLDHMHEF++
Sbjct  372  LLDHMHEFDE  381



>ref|XP_011021233.1| PREDICTED: ubiquitin receptor RAD23c isoform X3 [Populus euphratica]
Length=382

 Score =   239 bits (610),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 123/130 (95%), Gaps = 1/130 (1%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
            GA  L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEP
Sbjct  254  GAGNLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQPDFLRLINEP  313

Query  481  VEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  302
            VEG EGN+LGQLA+++PQ V VTPEEREAI+RL AMGFDRALVLEVFFACNKNEELAANY
Sbjct  314  VEG-EGNVLGQLASAVPQTVTVTPEEREAIDRLVAMGFDRALVLEVFFACNKNEELAANY  372

Query  301  LLDHMHEFED  272
            LLDHMHEF++
Sbjct  373  LLDHMHEFDE  382



>ref|XP_010549930.1| PREDICTED: ubiquitin receptor RAD23c-like [Tarenaya hassleriana]
 gb|ABD96879.1| hypothetical protein [Cleome spinosa]
Length=383

 Score =   239 bits (610),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 117/131 (89%), Positives = 123/131 (94%), Gaps = 1/131 (1%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
            GA TL+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP LMRLIQEHQADFLRLINEP
Sbjct  253  GAGTLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLMRLIQEHQADFLRLINEP  312

Query  481  VEGGE-GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  305
            VEGGE GNI  QL  +MPQA+QVTPEEREAIERLEAMGF+R LVLEVFFACNKNEELAAN
Sbjct  313  VEGGEGGNISSQLGGAMPQAIQVTPEEREAIERLEAMGFERGLVLEVFFACNKNEELAAN  372

Query  304  YLLDHMHEFED  272
            YLLDHMHEF++
Sbjct  373  YLLDHMHEFDE  383



>ref|XP_011021237.1| PREDICTED: ubiquitin receptor RAD23c isoform X5 [Populus euphratica]
Length=364

 Score =   238 bits (608),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 123/131 (94%), Gaps = 1/131 (1%)
 Frame = -2

Query  664  GGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE  485
             GA  L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINE
Sbjct  235  AGAGNLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQPDFLRLINE  294

Query  484  PVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  305
            PVEG EGN+LGQLA+++PQ V VTPEEREAI+RL AMGFDRALVLEVFFACNKNEELAAN
Sbjct  295  PVEG-EGNVLGQLASAVPQTVTVTPEEREAIDRLVAMGFDRALVLEVFFACNKNEELAAN  353

Query  304  YLLDHMHEFED  272
            YLLDHMHEF++
Sbjct  354  YLLDHMHEFDE  364



>ref|XP_010103794.1| Putative DNA repair protein RAD23-4 [Morus notabilis]
 gb|EXB97156.1| Putative DNA repair protein RAD23-4 [Morus notabilis]
Length=550

 Score =   243 bits (621),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 119/130 (92%), Positives = 125/130 (96%), Gaps = 1/130 (1%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
            GA TL+FLRNS QFQALRAMVQANPQILQPMLQELGKQNP LMRLIQEHQADFLRLINEP
Sbjct  420  GAGTLDFLRNSPQFQALRAMVQANPQILQPMLQELGKQNPQLMRLIQEHQADFLRLINEP  479

Query  481  VEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  302
            VEG EGN+LGQL+A+MPQAV VTPEEREAIERLEAMGFDRALVLEV+FACNKNEELAANY
Sbjct  480  VEG-EGNLLGQLSAAMPQAVTVTPEEREAIERLEAMGFDRALVLEVYFACNKNEELAANY  538

Query  301  LLDHMHEFED  272
            LLDHMHEF+D
Sbjct  539  LLDHMHEFDD  548



>ref|XP_006484457.1| PREDICTED: ubiquitin receptor RAD23c-like [Citrus sinensis]
Length=390

 Score =   238 bits (607),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 113/130 (87%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
            GA +L+FLRNS QFQ LRAMVQANPQ+LQPMLQELGKQNP L+RLIQEHQADFLRLINEP
Sbjct  261  GAGSLDFLRNSPQFQVLRAMVQANPQLLQPMLQELGKQNPQLVRLIQEHQADFLRLINEP  320

Query  481  VEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  302
            V+GGEGN+  QLA  MPQ++QVTPEEREAIERLEAMGFDRA+VLEVFFACNKNEELAANY
Sbjct  321  VQGGEGNLGDQLAGLMPQSIQVTPEEREAIERLEAMGFDRAIVLEVFFACNKNEELAANY  380

Query  301  LLDHMHEFED  272
            LLDHMHEFED
Sbjct  381  LLDHMHEFED  390



>ref|XP_006363121.1| PREDICTED: ubiquitin receptor RAD23c-like [Solanum tuberosum]
Length=390

 Score =   238 bits (607),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 122/131 (93%), Gaps = 1/131 (1%)
 Frame = -2

Query  664  GGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE  485
             GA  L+FLRNS QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINE
Sbjct  261  AGAGNLDFLRNSPQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQPDFLRLINE  320

Query  484  PVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  305
            PVEG EGN+LGQ A ++PQAV VTPEEREAIERLEAMGFDRALVLEV+FACNKNEELAAN
Sbjct  321  PVEG-EGNVLGQTAGAIPQAVTVTPEEREAIERLEAMGFDRALVLEVYFACNKNEELAAN  379

Query  304  YLLDHMHEFED  272
            YLLDHMHEF++
Sbjct  380  YLLDHMHEFDE  390



>gb|KEH44233.1| RAD23 UV excision repair family protein [Medicago truncatula]
Length=397

 Score =   238 bits (607),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 113/128 (88%), Positives = 125/128 (98%), Gaps = 1/128 (1%)
 Frame = -2

Query  652  TLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEG  473
            +L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLI++HQADFLRLINEP+EG
Sbjct  269  SLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIRDHQADFLRLINEPMEG  328

Query  472  GEG-NILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLL  296
            GEG N+LGQ+AA MPQ+V VTPEER+AIERLEAMGFDRA+VLEVFFACNKNEELAANYLL
Sbjct  329  GEGNNLLGQMAAGMPQSVTVTPEERQAIERLEAMGFDRAIVLEVFFACNKNEELAANYLL  388

Query  295  DHMHEFED  272
            DHMHEF++
Sbjct  389  DHMHEFDE  396



>gb|KDO69965.1| hypothetical protein CISIN_1g0163871mg, partial [Citrus sinensis]
Length=367

 Score =   236 bits (603),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/130 (87%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
            GA +L+FLRNS QFQ LRAMVQANPQ+LQPMLQELGKQNP L+RLIQEHQADFLRLINEP
Sbjct  238  GAGSLDFLRNSPQFQVLRAMVQANPQLLQPMLQELGKQNPQLVRLIQEHQADFLRLINEP  297

Query  481  VEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  302
            V+GGEGN+  QLA  MPQ++QVTPEEREAIERLEAMGFDRA+VLEVFFACNKNEELAANY
Sbjct  298  VQGGEGNLGDQLAGLMPQSIQVTPEEREAIERLEAMGFDRAIVLEVFFACNKNEELAANY  357

Query  301  LLDHMHEFED  272
            LLDHMHEFED
Sbjct  358  LLDHMHEFED  367



>ref|XP_009622421.1| PREDICTED: ubiquitin receptor RAD23d-like [Nicotiana tomentosiformis]
Length=194

 Score =   231 bits (588),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 114/130 (88%), Positives = 122/130 (94%), Gaps = 1/130 (1%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
            G+  L+FLRNS QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEP
Sbjct  66   GSGNLDFLRNSPQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQPDFLRLINEP  125

Query  481  VEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  302
            VEG EGN LGQ+A ++PQAV VTPEEREAIERLEAMGFDRALVLEV+FACNKNEELAANY
Sbjct  126  VEG-EGNALGQMAGAIPQAVTVTPEEREAIERLEAMGFDRALVLEVYFACNKNEELAANY  184

Query  301  LLDHMHEFED  272
            LLDHMHEF++
Sbjct  185  LLDHMHEFDE  194



>ref|XP_004232367.1| PREDICTED: ubiquitin receptor RAD23d [Solanum lycopersicum]
 emb|CAB51544.1| RAD23 protein [Solanum lycopersicum var. cerasiforme]
Length=389

 Score =   237 bits (605),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 114/131 (87%), Positives = 122/131 (93%), Gaps = 1/131 (1%)
 Frame = -2

Query  664  GGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE  485
             GA  L+FLRNS QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINE
Sbjct  260  AGAGNLDFLRNSPQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQPDFLRLINE  319

Query  484  PVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  305
            PVEG EGN+LGQ A ++PQAV VTPEEREAIERLEAMGFDRALVLEV+FACNKNEELAAN
Sbjct  320  PVEG-EGNVLGQTAGAIPQAVTVTPEEREAIERLEAMGFDRALVLEVYFACNKNEELAAN  378

Query  304  YLLDHMHEFED  272
            YLLDH+HEF++
Sbjct  379  YLLDHLHEFDE  389



>ref|XP_006437675.1| hypothetical protein CICLE_v10031777mg [Citrus clementina]
 gb|ESR50915.1| hypothetical protein CICLE_v10031777mg [Citrus clementina]
Length=390

 Score =   237 bits (604),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/130 (87%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
            GA +L+FLRNS QFQ LRAMVQANPQ+LQPMLQELGKQNP L+RLIQEHQADFLRLINEP
Sbjct  261  GAGSLDFLRNSPQFQVLRAMVQANPQLLQPMLQELGKQNPQLVRLIQEHQADFLRLINEP  320

Query  481  VEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  302
            V+GGEGN+  QLA  MPQ++QVTPEEREAIERLEAMGFDRA+VLEVFFACNKNEELAANY
Sbjct  321  VQGGEGNLGDQLAGLMPQSIQVTPEEREAIERLEAMGFDRAIVLEVFFACNKNEELAANY  380

Query  301  LLDHMHEFED  272
            LLDHMHEFED
Sbjct  381  LLDHMHEFED  390



>ref|XP_002283656.1| PREDICTED: ubiquitin receptor RAD23c [Vitis vinifera]
 emb|CBI33660.3| unnamed protein product [Vitis vinifera]
Length=381

 Score =   237 bits (604),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 116/131 (89%), Positives = 123/131 (94%), Gaps = 2/131 (2%)
 Frame = -2

Query  664  GGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE  485
              A TL+FLRNS QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE
Sbjct  253  ASAGTLDFLRNSPQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE  312

Query  484  PVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  305
            PVE GEGN+LGQL  ++PQAV +TPEERE+IERLEAMGFDRALVLEVFFACNKNEELAAN
Sbjct  313  PVE-GEGNVLGQL-GTVPQAVTITPEERESIERLEAMGFDRALVLEVFFACNKNEELAAN  370

Query  304  YLLDHMHEFED  272
            YLLDHMHEFE+
Sbjct  371  YLLDHMHEFEE  381



>ref|XP_006299986.1| hypothetical protein CARUB_v10016200mg [Capsella rubella]
 gb|EOA32884.1| hypothetical protein CARUB_v10016200mg [Capsella rubella]
Length=427

 Score =   238 bits (607),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 116/134 (87%), Positives = 125/134 (93%), Gaps = 4/134 (3%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
            GA TL+FLRNSQQFQALRAMVQANPQ+LQPMLQELGKQNP+LMRLIQ+HQADFLRLINEP
Sbjct  294  GAGTLDFLRNSQQFQALRAMVQANPQVLQPMLQELGKQNPNLMRLIQDHQADFLRLINEP  353

Query  481  VEGG--EGNILGQLAASM--PQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEEL  314
            VEGG   GN+LG +AA +  PQA+QVTPEEREAIERLE MGFDRALVLEVFFACNKNEEL
Sbjct  354  VEGGGESGNLLGHMAAGIPQPQAIQVTPEEREAIERLEGMGFDRALVLEVFFACNKNEEL  413

Query  313  AANYLLDHMHEFED  272
            AANYLLDHMHEFE+
Sbjct  414  AANYLLDHMHEFEE  427



>ref|XP_006408408.1| hypothetical protein EUTSA_v10020817mg [Eutrema salsugineum]
 gb|ESQ49861.1| hypothetical protein EUTSA_v10020817mg [Eutrema salsugineum]
Length=372

 Score =   236 bits (602),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 117/134 (87%), Positives = 125/134 (93%), Gaps = 4/134 (3%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
            GA TL+FLRNSQQFQALRAMVQANPQ+LQPMLQELGKQNP+LMRLIQ+HQADFLRLINEP
Sbjct  239  GAGTLDFLRNSQQFQALRAMVQANPQVLQPMLQELGKQNPNLMRLIQDHQADFLRLINEP  298

Query  481  VEGG--EGNILGQLAASM--PQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEEL  314
            VEGG   GN+ GQL A M  PQA+QVTPEEREAIERLEAMGF+RALVLEVFFACNKNEEL
Sbjct  299  VEGGGESGNLFGQLEAGMPQPQAIQVTPEEREAIERLEAMGFERALVLEVFFACNKNEEL  358

Query  313  AANYLLDHMHEFED  272
            AANYLLDHMHEFE+
Sbjct  359  AANYLLDHMHEFEE  372



>ref|XP_006846642.1| hypothetical protein AMTR_s00156p00078120 [Amborella trichopoda]
 gb|ERN08317.1| hypothetical protein AMTR_s00156p00078120 [Amborella trichopoda]
Length=389

 Score =   236 bits (602),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 116/132 (88%), Positives = 123/132 (93%), Gaps = 1/132 (1%)
 Frame = -2

Query  664  GGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE  485
             GA TL+FLRNSQQFQALR M QANPQILQPMLQELGKQNP LMRLIQEHQADFLRLINE
Sbjct  258  AGAGTLDFLRNSQQFQALRDMFQANPQILQPMLQELGKQNPQLMRLIQEHQADFLRLINE  317

Query  484  -PVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAA  308
             P EG EGN+LGQLA++MPQAV VTPEEREAIERLEA+GFDRALVLEVFFACNKNEELAA
Sbjct  318  QPAEGAEGNLLGQLASAMPQAVTVTPEEREAIERLEALGFDRALVLEVFFACNKNEELAA  377

Query  307  NYLLDHMHEFED  272
            NYLLDHM+EFE+
Sbjct  378  NYLLDHMNEFEE  389



>ref|XP_011464118.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Fragaria 
vesca subsp. vesca]
Length=401

 Score =   236 bits (602),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 111/126 (88%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = -2

Query  649  LEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGG  470
            L+FLR+S QFQALRAMVQANP ILQPMLQELGKQNP L+RLIQ+HQADFLRLINEPVEGG
Sbjct  276  LDFLRDSPQFQALRAMVQANPHILQPMLQELGKQNPQLVRLIQQHQADFLRLINEPVEGG  335

Query  469  EGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDH  290
            EG++LGQL A+MPQA+ VTPEEREAIERLEAMGFDRALVLEVF ACN+NEELAANYLLDH
Sbjct  336  EGDVLGQLDAAMPQAITVTPEEREAIERLEAMGFDRALVLEVFVACNRNEELAANYLLDH  395

Query  289  MHEFED  272
            MHEFED
Sbjct  396  MHEFED  401



>ref|XP_004299088.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Fragaria 
vesca subsp. vesca]
Length=400

 Score =   236 bits (602),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 111/126 (88%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = -2

Query  649  LEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGG  470
            L+FLR+S QFQALRAMVQANP ILQPMLQELGKQNP L+RLIQ+HQADFLRLINEPVEGG
Sbjct  275  LDFLRDSPQFQALRAMVQANPHILQPMLQELGKQNPQLVRLIQQHQADFLRLINEPVEGG  334

Query  469  EGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDH  290
            EG++LGQL A+MPQA+ VTPEEREAIERLEAMGFDRALVLEVF ACN+NEELAANYLLDH
Sbjct  335  EGDVLGQLDAAMPQAITVTPEEREAIERLEAMGFDRALVLEVFVACNRNEELAANYLLDH  394

Query  289  MHEFED  272
            MHEFED
Sbjct  395  MHEFED  400



>ref|XP_006408409.1| hypothetical protein EUTSA_v10020817mg [Eutrema salsugineum]
 gb|ESQ49862.1| hypothetical protein EUTSA_v10020817mg [Eutrema salsugineum]
Length=416

 Score =   236 bits (603),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 117/134 (87%), Positives = 125/134 (93%), Gaps = 4/134 (3%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
            GA TL+FLRNSQQFQALRAMVQANPQ+LQPMLQELGKQNP+LMRLIQ+HQADFLRLINEP
Sbjct  283  GAGTLDFLRNSQQFQALRAMVQANPQVLQPMLQELGKQNPNLMRLIQDHQADFLRLINEP  342

Query  481  VEGG--EGNILGQLAASM--PQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEEL  314
            VEGG   GN+ GQL A M  PQA+QVTPEEREAIERLEAMGF+RALVLEVFFACNKNEEL
Sbjct  343  VEGGGESGNLFGQLEAGMPQPQAIQVTPEEREAIERLEAMGFERALVLEVFFACNKNEEL  402

Query  313  AANYLLDHMHEFED  272
            AANYLLDHMHEFE+
Sbjct  403  AANYLLDHMHEFEE  416



>ref|XP_007223090.1| hypothetical protein PRUPE_ppa007032mg [Prunus persica]
 gb|EMJ24289.1| hypothetical protein PRUPE_ppa007032mg [Prunus persica]
Length=385

 Score =   235 bits (600),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 112/126 (89%), Positives = 122/126 (97%), Gaps = 2/126 (2%)
 Frame = -2

Query  649  LEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGG  470
            L+FLR+SQQFQALRAMVQANPQILQPMLQELGKQNP+LMRLIQ+HQADFLRLINEPVEGG
Sbjct  262  LDFLRDSQQFQALRAMVQANPQILQPMLQELGKQNPNLMRLIQQHQADFLRLINEPVEGG  321

Query  469  EGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDH  290
            EGNILG   A++PQ++ VTPEEREAIERLEAMGFDRA+VLEVFFACNKNEELAANYLLDH
Sbjct  322  EGNILGD--AAVPQSISVTPEEREAIERLEAMGFDRAIVLEVFFACNKNEELAANYLLDH  379

Query  289  MHEFED  272
            MHEFE+
Sbjct  380  MHEFEE  385



>gb|EYU44643.1| hypothetical protein MIMGU_mgv1a006427mg [Erythranthe guttata]
Length=444

 Score =   237 bits (605),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 124/131 (95%), Gaps = 1/131 (1%)
 Frame = -2

Query  664  GGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE  485
            GG N L+FLRNSQQFQALRA+VQANPQILQPMLQELGKQNP L+RLIQ+HQADFLRLINE
Sbjct  315  GGGNNLDFLRNSQQFQALRAVVQANPQILQPMLQELGKQNPQLVRLIQDHQADFLRLINE  374

Query  484  PVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  305
            PVEG +GN+LGQLA +MPQ+V VT EEREAIERLEAMGFDRALVLEVFFACNKNEELAAN
Sbjct  375  PVEG-DGNVLGQLAEAMPQSVAVTAEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  433

Query  304  YLLDHMHEFED  272
            YLLDHMHEF+D
Sbjct  434  YLLDHMHEFDD  444



>ref|XP_009784661.1| PREDICTED: ubiquitin receptor RAD23d [Nicotiana sylvestris]
Length=387

 Score =   235 bits (600),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 113/131 (86%), Positives = 121/131 (92%), Gaps = 1/131 (1%)
 Frame = -2

Query  664  GGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE  485
             G+  L+FLRNS QFQALR MVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINE
Sbjct  258  AGSGNLDFLRNSPQFQALRTMVQANPQILQPMLQELGKQNPHLMRLIQEHQPDFLRLINE  317

Query  484  PVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  305
            PVEG EGN LGQ+A ++PQAV VTPEEREAIERLEAMGFDRALVLEV+FACNKNEELAAN
Sbjct  318  PVEG-EGNALGQMAGAIPQAVTVTPEEREAIERLEAMGFDRALVLEVYFACNKNEELAAN  376

Query  304  YLLDHMHEFED  272
            YLLDHMHEF++
Sbjct  377  YLLDHMHEFDE  387



>ref|XP_009399730.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=391

 Score =   235 bits (600),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 111/130 (85%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
            G  +L+FLRNS QF+AL+A+VQANPQILQPMLQELGKQNP +MRLIQEHQ +FLRLINEP
Sbjct  262  GGGSLDFLRNSPQFRALQALVQANPQILQPMLQELGKQNPQIMRLIQEHQGEFLRLINEP  321

Query  481  VEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  302
             EG EGN+LGQLAA MPQA+ VTPEEREAIERLEAMGFDRALVL+VFFACNKNEELAANY
Sbjct  322  AEGTEGNVLGQLAAGMPQALTVTPEEREAIERLEAMGFDRALVLQVFFACNKNEELAANY  381

Query  301  LLDHMHEFED  272
            LLDHMHEFED
Sbjct  382  LLDHMHEFED  391



>dbj|BAC76393.1| RAD23-like protein [Arabidopsis thaliana]
Length=337

 Score =   233 bits (595),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 117/134 (87%), Positives = 126/134 (94%), Gaps = 4/134 (3%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
            GA TL+FLRNSQQFQALRAMVQANPQ+LQPMLQELGKQNP+LMRLIQ+HQADFLRLINEP
Sbjct  204  GAGTLDFLRNSQQFQALRAMVQANPQVLQPMLQELGKQNPNLMRLIQDHQADFLRLINEP  263

Query  481  VEGG--EGNILGQLAASM--PQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEEL  314
            VEGG   GN+LGQ+AA M  PQA+QVT EEREAIERLEAMGF+RALVLEVFFACNKNEEL
Sbjct  264  VEGGGESGNLLGQMAAGMPQPQAIQVTHEEREAIERLEAMGFERALVLEVFFACNKNEEL  323

Query  313  AANYLLDHMHEFED  272
            AANYLLDHMHEFE+
Sbjct  324  AANYLLDHMHEFEE  337



>ref|XP_007227719.1| hypothetical protein PRUPE_ppa007047mg [Prunus persica]
 ref|XP_008243219.1| PREDICTED: ubiquitin receptor RAD23c-like [Prunus mume]
 gb|EMJ28918.1| hypothetical protein PRUPE_ppa007047mg [Prunus persica]
Length=385

 Score =   234 bits (598),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/126 (89%), Positives = 122/126 (97%), Gaps = 2/126 (2%)
 Frame = -2

Query  649  LEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGG  470
            L+FLR+SQQFQALRAMVQANPQILQPMLQELGKQNP+LMRLIQ+HQADFLRLINEPVEGG
Sbjct  262  LDFLRDSQQFQALRAMVQANPQILQPMLQELGKQNPNLMRLIQQHQADFLRLINEPVEGG  321

Query  469  EGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDH  290
            EGNILG   A++PQ++ VTPEEREAIERLEAMGFDRA+VLEVFFACNKNEELAANYLLDH
Sbjct  322  EGNILGD--AAVPQSISVTPEEREAIERLEAMGFDRAIVLEVFFACNKNEELAANYLLDH  379

Query  289  MHEFED  272
            MHEFE+
Sbjct  380  MHEFEE  385



>ref|NP_186903.1| UV excision repair protein RAD23C [Arabidopsis thaliana]
 sp|Q84L31.2|RD23C_ARATH RecName: Full=Ubiquitin receptor RAD23c; Short=AtRAD23c; AltName: 
Full=Putative DNA repair protein RAD23-3; AltName: Full=RAD23-like 
protein 3; Short=AtRAD23-3 [Arabidopsis thaliana]
 gb|AAF32461.1| putative RAD23 [Arabidopsis thaliana]
 gb|AAK62617.1| AT3g02540/F16B3_17 [Arabidopsis thaliana]
 gb|AAM47342.1| AT3g02540/F16B3_17 [Arabidopsis thaliana]
 dbj|BAC76392.1| RAD23-like protein [Arabidopsis thaliana]
 gb|ABG89116.1| Rad23-1 [synthetic construct]
 gb|AEE73824.1| UV excision repair protein RAD23C [Arabidopsis thaliana]
Length=419

 Score =   235 bits (600),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 117/134 (87%), Positives = 126/134 (94%), Gaps = 4/134 (3%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
            GA TL+FLRNSQQFQALRAMVQANPQ+LQPMLQELGKQNP+LMRLIQ+HQADFLRLINEP
Sbjct  286  GAGTLDFLRNSQQFQALRAMVQANPQVLQPMLQELGKQNPNLMRLIQDHQADFLRLINEP  345

Query  481  VEGG--EGNILGQLAASM--PQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEEL  314
            VEGG   GN+LGQ+AA M  PQA+QVT EEREAIERLEAMGF+RALVLEVFFACNKNEEL
Sbjct  346  VEGGGESGNLLGQMAAGMPQPQAIQVTHEEREAIERLEAMGFERALVLEVFFACNKNEEL  405

Query  313  AANYLLDHMHEFED  272
            AANYLLDHMHEFE+
Sbjct  406  AANYLLDHMHEFEE  419



>ref|XP_010552226.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Tarenaya 
hassleriana]
Length=387

 Score =   234 bits (597),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 121/131 (92%), Gaps = 1/131 (1%)
 Frame = -2

Query  664  GGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE  485
             GA  L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP LMRLIQ+HQADFL LINE
Sbjct  257  AGAGNLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLMRLIQDHQADFLNLINE  316

Query  484  PVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  305
            P EG E N+LGQL ++MPQAV VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN
Sbjct  317  PAEGEE-NLLGQLGSAMPQAVTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  375

Query  304  YLLDHMHEFED  272
            YLLDH+HEFED
Sbjct  376  YLLDHIHEFED  386



>ref|NP_001189793.1| UV excision repair protein RAD23C [Arabidopsis thaliana]
 gb|AEE73826.1| UV excision repair protein RAD23C [Arabidopsis thaliana]
Length=418

 Score =   235 bits (599),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 117/134 (87%), Positives = 126/134 (94%), Gaps = 4/134 (3%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
            GA TL+FLRNSQQFQALRAMVQANPQ+LQPMLQELGKQNP+LMRLIQ+HQADFLRLINEP
Sbjct  285  GAGTLDFLRNSQQFQALRAMVQANPQVLQPMLQELGKQNPNLMRLIQDHQADFLRLINEP  344

Query  481  VEGG--EGNILGQLAASM--PQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEEL  314
            VEGG   GN+LGQ+AA M  PQA+QVT EEREAIERLEAMGF+RALVLEVFFACNKNEEL
Sbjct  345  VEGGGESGNLLGQMAAGMPQPQAIQVTHEEREAIERLEAMGFERALVLEVFFACNKNEEL  404

Query  313  AANYLLDHMHEFED  272
            AANYLLDHMHEFE+
Sbjct  405  AANYLLDHMHEFEE  418



>ref|XP_008243218.1| PREDICTED: ubiquitin receptor RAD23d-like [Prunus mume]
Length=384

 Score =   234 bits (596),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/126 (89%), Positives = 121/126 (96%), Gaps = 2/126 (2%)
 Frame = -2

Query  649  LEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGG  470
            L+FLR SQQFQALRAMVQANPQILQPMLQELGKQNP+LMRLIQ+HQADFLRLINEPVEGG
Sbjct  261  LDFLRGSQQFQALRAMVQANPQILQPMLQELGKQNPNLMRLIQQHQADFLRLINEPVEGG  320

Query  469  EGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDH  290
            EGNILG   A++PQ++ VTPEEREAIERLEAMGFDRA+VLEVFFACNKNEELAANYLLDH
Sbjct  321  EGNILGD--AAVPQSISVTPEEREAIERLEAMGFDRAIVLEVFFACNKNEELAANYLLDH  378

Query  289  MHEFED  272
            MHEFE+
Sbjct  379  MHEFEE  384



>ref|XP_010552232.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Tarenaya 
hassleriana]
Length=384

 Score =   234 bits (596),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 121/131 (92%), Gaps = 1/131 (1%)
 Frame = -2

Query  664  GGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE  485
             GA  L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP LMRLIQ+HQADFL LINE
Sbjct  254  AGAGNLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLMRLIQDHQADFLNLINE  313

Query  484  PVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  305
            P EG E N+LGQL ++MPQAV VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN
Sbjct  314  PAEGEE-NLLGQLGSAMPQAVTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  372

Query  304  YLLDHMHEFED  272
            YLLDH+HEFED
Sbjct  373  YLLDHIHEFED  383



>ref|XP_009607597.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Nicotiana 
tomentosiformis]
Length=383

 Score =   233 bits (593),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 113/131 (86%), Positives = 120/131 (92%), Gaps = 1/131 (1%)
 Frame = -2

Query  664  GGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE  485
             GA  L+FL NS QFQALRAMVQANPQILQPMLQELGKQNP LMRLIQEHQADFLRLINE
Sbjct  254  AGAGNLDFLSNSPQFQALRAMVQANPQILQPMLQELGKQNPQLMRLIQEHQADFLRLINE  313

Query  484  PVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  305
            PVEG EGN+ GQ A ++PQAV VTPEEREAIERLEAMGFDRALVL+VFFACNKNEELAAN
Sbjct  314  PVEG-EGNVPGQPAGAIPQAVTVTPEEREAIERLEAMGFDRALVLQVFFACNKNEELAAN  372

Query  304  YLLDHMHEFED  272
            YLLDHMHEF++
Sbjct  373  YLLDHMHEFDE  383



>ref|XP_009781758.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Nicotiana 
sylvestris]
Length=387

 Score =   233 bits (593),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 113/131 (86%), Positives = 120/131 (92%), Gaps = 1/131 (1%)
 Frame = -2

Query  664  GGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE  485
             GA  L+FL NS QFQALRAMVQANPQILQPMLQELGKQNP LMRLIQEHQADFLRLINE
Sbjct  258  AGAGNLDFLSNSPQFQALRAMVQANPQILQPMLQELGKQNPQLMRLIQEHQADFLRLINE  317

Query  484  PVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  305
            PVEG EGN+ GQ A ++PQAV VTPEEREAIERLEAMGFDRALVL+VFFACNKNEELAAN
Sbjct  318  PVEG-EGNVPGQPAGAIPQAVTVTPEEREAIERLEAMGFDRALVLQVFFACNKNEELAAN  376

Query  304  YLLDHMHEFED  272
            YLLDHMHEF++
Sbjct  377  YLLDHMHEFDE  387



>ref|XP_008775144.1| PREDICTED: ubiquitin receptor RAD23d-like [Phoenix dactylifera]
Length=384

 Score =   232 bits (592),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 109/131 (83%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = -2

Query  664  GGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE  485
             GA +L+FLRNS QF+AL+ +VQANPQILQPMLQELGKQNP +MRLIQEHQA+FLRL+NE
Sbjct  254  AGAGSLDFLRNSPQFRALQTLVQANPQILQPMLQELGKQNPQVMRLIQEHQAEFLRLLNE  313

Query  484  PVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  305
            P EG E ++LGQLA++MPQA+ VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN
Sbjct  314  PTEGAESDLLGQLASAMPQALTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  373

Query  304  YLLDHMHEFED  272
            YLLDHMHEFED
Sbjct  374  YLLDHMHEFED  384



>ref|XP_006283908.1| hypothetical protein CARUB_v10005026mg [Capsella rubella]
 gb|EOA16806.1| hypothetical protein CARUB_v10005026mg [Capsella rubella]
Length=385

 Score =   232 bits (592),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 114/126 (90%), Positives = 120/126 (95%), Gaps = 1/126 (1%)
 Frame = -2

Query  649  LEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGG  470
            L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP L+RLIQEHQADFLRLINEPVEG 
Sbjct  260  LDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLVRLIQEHQADFLRLINEPVEGE  319

Query  469  EGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDH  290
            E N++ QL A+MPQAV VTPEEREAIERLEAMGFDRA+VLEVFFACNKNEELAANYLLDH
Sbjct  320  E-NVMEQLEAAMPQAVTVTPEEREAIERLEAMGFDRAMVLEVFFACNKNEELAANYLLDH  378

Query  289  MHEFED  272
            MHEFED
Sbjct  379  MHEFED  384



>ref|XP_006405766.1| hypothetical protein EUTSA_v10027790mg [Eutrema salsugineum]
 gb|ESQ47219.1| hypothetical protein EUTSA_v10027790mg [Eutrema salsugineum]
Length=389

 Score =   232 bits (591),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 114/126 (90%), Positives = 120/126 (95%), Gaps = 1/126 (1%)
 Frame = -2

Query  649  LEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGG  470
            L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP L+RLIQEHQADFLRLINEPVEG 
Sbjct  264  LDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLVRLIQEHQADFLRLINEPVEGE  323

Query  469  EGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDH  290
            E N++ QL A+MPQAV VTPEEREAIERLEAMGFDRA+VLEVFFACNKNEELAANYLLDH
Sbjct  324  E-NVIEQLEAAMPQAVTVTPEEREAIERLEAMGFDRAMVLEVFFACNKNEELAANYLLDH  382

Query  289  MHEFED  272
            MHEFED
Sbjct  383  MHEFED  388



>ref|XP_009607598.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Nicotiana 
tomentosiformis]
Length=365

 Score =   231 bits (589),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 113/131 (86%), Positives = 120/131 (92%), Gaps = 1/131 (1%)
 Frame = -2

Query  664  GGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE  485
             GA  L+FL NS QFQALRAMVQANPQILQPMLQELGKQNP LMRLIQEHQADFLRLINE
Sbjct  236  AGAGNLDFLSNSPQFQALRAMVQANPQILQPMLQELGKQNPQLMRLIQEHQADFLRLINE  295

Query  484  PVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  305
            PVEG EGN+ GQ A ++PQAV VTPEEREAIERLEAMGFDRALVL+VFFACNKNEELAAN
Sbjct  296  PVEG-EGNVPGQPAGAIPQAVTVTPEEREAIERLEAMGFDRALVLQVFFACNKNEELAAN  354

Query  304  YLLDHMHEFED  272
            YLLDHMHEF++
Sbjct  355  YLLDHMHEFDE  365



>ref|XP_009781759.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Nicotiana 
sylvestris]
Length=369

 Score =   231 bits (589),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/131 (86%), Positives = 120/131 (92%), Gaps = 1/131 (1%)
 Frame = -2

Query  664  GGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE  485
             GA  L+FL NS QFQALRAMVQANPQILQPMLQELGKQNP LMRLIQEHQADFLRLINE
Sbjct  240  AGAGNLDFLSNSPQFQALRAMVQANPQILQPMLQELGKQNPQLMRLIQEHQADFLRLINE  299

Query  484  PVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  305
            PVEG EGN+ GQ A ++PQAV VTPEEREAIERLEAMGFDRALVL+VFFACNKNEELAAN
Sbjct  300  PVEG-EGNVPGQPAGAIPQAVTVTPEEREAIERLEAMGFDRALVLQVFFACNKNEELAAN  358

Query  304  YLLDHMHEFED  272
            YLLDHMHEF++
Sbjct  359  YLLDHMHEFDE  369



>ref|XP_010440953.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Camelina 
sativa]
 ref|XP_010440954.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Camelina 
sativa]
 ref|XP_010440955.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X3 [Camelina 
sativa]
 ref|XP_010440956.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X4 [Camelina 
sativa]
Length=377

 Score =   231 bits (590),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/126 (90%), Positives = 119/126 (94%), Gaps = 1/126 (1%)
 Frame = -2

Query  649  LEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGG  470
            L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP L+RLIQEHQ DFLRLINEPVEG 
Sbjct  252  LDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLVRLIQEHQTDFLRLINEPVEGE  311

Query  469  EGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDH  290
            E N++ QL A+MPQAV VTPEEREAIERLEAMGFDRA+VLEVFFACNKNEELAANYLLDH
Sbjct  312  E-NVMEQLEAAMPQAVTVTPEEREAIERLEAMGFDRAMVLEVFFACNKNEELAANYLLDH  370

Query  289  MHEFED  272
            MHEFED
Sbjct  371  MHEFED  376



>ref|NP_198663.1| ubiquitin receptor RAD23d [Arabidopsis thaliana]
 sp|Q84L30.2|RD23D_ARATH RecName: Full=Ubiquitin receptor RAD23d; Short=AtRAD23d; AltName: 
Full=Putative DNA repair protein RAD23-4; AltName: Full=RAD23-like 
protein 4; Short=AtRAD23-4 [Arabidopsis thaliana]
 dbj|BAB09359.1| DNA repair protein RAD23 homolog [Arabidopsis thaliana]
 gb|AAL25609.1| unknown protein [Arabidopsis thaliana]
 gb|AAL87405.1| At5g38470/At5g38470 [Arabidopsis thaliana]
 gb|AAM65106.1| DNA repair protein RAD23 homolog [Arabidopsis thaliana]
 dbj|BAC76394.1| RAD23-like protein [Arabidopsis thaliana]
 gb|ABG89117.1| Rad23-2 [synthetic construct]
 gb|AED94321.1| putative DNA repair protein RAD23-4 [Arabidopsis thaliana]
Length=378

 Score =   231 bits (588),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 113/126 (90%), Positives = 119/126 (94%), Gaps = 1/126 (1%)
 Frame = -2

Query  649  LEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGG  470
            L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP L+RLIQEHQADFLRLINEPVEG 
Sbjct  253  LDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLVRLIQEHQADFLRLINEPVEGE  312

Query  469  EGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDH  290
            E N++ QL A+MPQAV VTPEEREAIERLE MGFDRA+VLEVFFACNKNEELAANYLLDH
Sbjct  313  E-NVMEQLEAAMPQAVTVTPEEREAIERLEGMGFDRAMVLEVFFACNKNEELAANYLLDH  371

Query  289  MHEFED  272
            MHEFED
Sbjct  372  MHEFED  377



>ref|XP_008801156.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X3 [Phoenix 
dactylifera]
Length=370

 Score =   230 bits (587),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 112/131 (85%), Positives = 122/131 (93%), Gaps = 1/131 (1%)
 Frame = -2

Query  664  GGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE  485
             GA++L+FLRNS QFQA +A+VQANPQILQPMLQELGKQNP +MRLI+EHQA+FLRLINE
Sbjct  241  SGASSLDFLRNSPQFQAFKALVQANPQILQPMLQELGKQNPLVMRLIREHQAEFLRLINE  300

Query  484  PVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  305
            P EG E N+LGQLAA MPQA+ VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN
Sbjct  301  PAEG-ESNLLGQLAAEMPQALTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  359

Query  304  YLLDHMHEFED  272
            YLLDHMHEFED
Sbjct  360  YLLDHMHEFED  370



>gb|ABB02636.1| RAD23-like [Solanum tuberosum]
Length=384

 Score =   231 bits (588),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 112/130 (86%), Positives = 120/130 (92%), Gaps = 1/130 (1%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
            GA  L+FL NS QFQALRAMVQANPQILQPMLQELGKQNP LMRLIQEHQADFLRLINEP
Sbjct  256  GAGNLDFLSNSPQFQALRAMVQANPQILQPMLQELGKQNPQLMRLIQEHQADFLRLINEP  315

Query  481  VEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  302
            VEG EGN+ GQ A ++PQAV VTPEEREAIERLEAMGFDRALVL+VFFACNKNEE+AANY
Sbjct  316  VEG-EGNVPGQPAGAIPQAVTVTPEEREAIERLEAMGFDRALVLQVFFACNKNEEMAANY  374

Query  301  LLDHMHEFED  272
            LLDHMHEF++
Sbjct  375  LLDHMHEFDE  384



>ref|XP_009399729.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=392

 Score =   231 bits (589),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 111/131 (85%), Positives = 121/131 (92%), Gaps = 1/131 (1%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
            G  +L+FLRNS QF+AL+A+VQANPQILQPMLQELGKQNP +MRLIQEHQ +FLRLINEP
Sbjct  262  GGGSLDFLRNSPQFRALQALVQANPQILQPMLQELGKQNPQIMRLIQEHQGEFLRLINEP  321

Query  481  VEGGEG-NILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  305
             EG EG N+LGQLAA MPQA+ VTPEEREAIERLEAMGFDRALVL+VFFACNKNEELAAN
Sbjct  322  AEGTEGSNVLGQLAAGMPQALTVTPEEREAIERLEAMGFDRALVLQVFFACNKNEELAAN  381

Query  304  YLLDHMHEFED  272
            YLLDHMHEFED
Sbjct  382  YLLDHMHEFED  392



>ref|XP_010435749.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Camelina 
sativa]
Length=376

 Score =   230 bits (587),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 113/126 (90%), Positives = 119/126 (94%), Gaps = 1/126 (1%)
 Frame = -2

Query  649  LEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGG  470
            L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP L+RLIQEHQ DFLRLINEPVEG 
Sbjct  251  LDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLVRLIQEHQTDFLRLINEPVEGE  310

Query  469  EGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDH  290
            E N++ QL A+MPQAV VTPEEREAIERLEAMGFDRA+VLEVFFACNKNEELAANYLLDH
Sbjct  311  E-NVMEQLEAAMPQAVTVTPEEREAIERLEAMGFDRAMVLEVFFACNKNEELAANYLLDH  369

Query  289  MHEFED  272
            MHEFED
Sbjct  370  MHEFED  375



>ref|XP_002870839.1| hypothetical protein ARALYDRAFT_494129 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47098.1| hypothetical protein ARALYDRAFT_494129 [Arabidopsis lyrata subsp. 
lyrata]
Length=377

 Score =   230 bits (587),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 113/126 (90%), Positives = 120/126 (95%), Gaps = 1/126 (1%)
 Frame = -2

Query  649  LEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGG  470
            L+FLRNSQ+FQALRAMVQANPQILQPMLQELGKQNP L+RLIQEHQADFLRLINEPVEG 
Sbjct  252  LDFLRNSQKFQALRAMVQANPQILQPMLQELGKQNPQLVRLIQEHQADFLRLINEPVEGE  311

Query  469  EGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDH  290
            E N++ QL A+MPQAV VTPEEREAIERLEAMGFDRA+VLEVFFACNKNEELAANYLLDH
Sbjct  312  E-NVMEQLEAAMPQAVTVTPEEREAIERLEAMGFDRAMVLEVFFACNKNEELAANYLLDH  370

Query  289  MHEFED  272
            MHEFED
Sbjct  371  MHEFED  376



>ref|XP_010435751.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Camelina 
sativa]
Length=374

 Score =   230 bits (587),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 113/126 (90%), Positives = 119/126 (94%), Gaps = 1/126 (1%)
 Frame = -2

Query  649  LEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGG  470
            L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP L+RLIQEHQ DFLRLINEPVEG 
Sbjct  249  LDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLVRLIQEHQTDFLRLINEPVEGE  308

Query  469  EGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDH  290
            E N++ QL A+MPQAV VTPEEREAIERLEAMGFDRA+VLEVFFACNKNEELAANYLLDH
Sbjct  309  E-NVMEQLEAAMPQAVTVTPEEREAIERLEAMGFDRAMVLEVFFACNKNEELAANYLLDH  367

Query  289  MHEFED  272
            MHEFED
Sbjct  368  MHEFED  373



>ref|XP_008801157.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X4 [Phoenix 
dactylifera]
Length=367

 Score =   230 bits (586),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 112/131 (85%), Positives = 122/131 (93%), Gaps = 1/131 (1%)
 Frame = -2

Query  664  GGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE  485
             GA++L+FLRNS QFQA +A+VQANPQILQPMLQELGKQNP +MRLI+EHQA+FLRLINE
Sbjct  238  SGASSLDFLRNSPQFQAFKALVQANPQILQPMLQELGKQNPLVMRLIREHQAEFLRLINE  297

Query  484  PVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  305
            P EG E N+LGQLAA MPQA+ VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN
Sbjct  298  PAEG-ESNLLGQLAAEMPQALTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  356

Query  304  YLLDHMHEFED  272
            YLLDHMHEFED
Sbjct  357  YLLDHMHEFED  367



>ref|XP_008801154.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Phoenix 
dactylifera]
Length=388

 Score =   231 bits (588),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 112/131 (85%), Positives = 122/131 (93%), Gaps = 1/131 (1%)
 Frame = -2

Query  664  GGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE  485
             GA++L+FLRNS QFQA +A+VQANPQILQPMLQELGKQNP +MRLI+EHQA+FLRLINE
Sbjct  259  SGASSLDFLRNSPQFQAFKALVQANPQILQPMLQELGKQNPLVMRLIREHQAEFLRLINE  318

Query  484  PVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  305
            P EG E N+LGQLAA MPQA+ VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN
Sbjct  319  PAEG-ESNLLGQLAAEMPQALTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  377

Query  304  YLLDHMHEFED  272
            YLLDHMHEFED
Sbjct  378  YLLDHMHEFED  388



>ref|XP_008801153.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Phoenix 
dactylifera]
Length=391

 Score =   231 bits (588),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 112/131 (85%), Positives = 122/131 (93%), Gaps = 1/131 (1%)
 Frame = -2

Query  664  GGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE  485
             GA++L+FLRNS QFQA +A+VQANPQILQPMLQELGKQNP +MRLI+EHQA+FLRLINE
Sbjct  262  SGASSLDFLRNSPQFQAFKALVQANPQILQPMLQELGKQNPLVMRLIREHQAEFLRLINE  321

Query  484  PVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  305
            P EG E N+LGQLAA MPQA+ VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN
Sbjct  322  PAEG-ESNLLGQLAAEMPQALTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  380

Query  304  YLLDHMHEFED  272
            YLLDHMHEFED
Sbjct  381  YLLDHMHEFED  391



>ref|XP_009391404.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=409

 Score =   231 bits (589),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 109/130 (84%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
            G  +L+FLRNS QF+AL+A+VQANPQILQPMLQELGKQNP +MRLIQEHQ +FLRLINEP
Sbjct  280  GGGSLDFLRNSPQFRALQALVQANPQILQPMLQELGKQNPQIMRLIQEHQGEFLRLINEP  339

Query  481  VEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  302
             EG EGN LGQLA  MPQ + VTPEEREAIERLEAMGFDRALVL+VFFACNKNEELAANY
Sbjct  340  AEGTEGNPLGQLAGGMPQTLNVTPEEREAIERLEAMGFDRALVLQVFFACNKNEELAANY  399

Query  301  LLDHMHEFED  272
            LLDHMHEFED
Sbjct  400  LLDHMHEFED  409



>ref|XP_010265160.1| PREDICTED: ubiquitin receptor RAD23c-like [Nelumbo nucifera]
Length=383

 Score =   230 bits (587),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 114/130 (88%), Positives = 119/130 (92%), Gaps = 4/130 (3%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
            G  TL+FLRNS QFQALR MVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP
Sbjct  258  GTGTLDFLRNSPQFQALRGMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  317

Query  481  VEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  302
            VE GEGN+ GQ+A   P  VQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY
Sbjct  318  VE-GEGNLFGQMA---PATVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  373

Query  301  LLDHMHEFED  272
            LLDH+HEFE+
Sbjct  374  LLDHIHEFEE  383



>ref|XP_008781237.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Phoenix 
dactylifera]
Length=451

 Score =   232 bits (592),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 109/131 (83%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = -2

Query  664  GGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE  485
             GA +L+FLRNS QF+AL+ +VQANPQILQPMLQELGKQNP +MRLIQ+HQA+FLRL+NE
Sbjct  321  AGAGSLDFLRNSPQFRALQTLVQANPQILQPMLQELGKQNPQVMRLIQDHQAEFLRLLNE  380

Query  484  PVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  305
            P EG E N+LGQLA++MPQA+ VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN
Sbjct  381  PAEGAESNLLGQLASAMPQALTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  440

Query  304  YLLDHMHEFED  272
            YLLDHMHEFED
Sbjct  441  YLLDHMHEFED  451



>ref|XP_008781229.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Phoenix 
dactylifera]
Length=452

 Score =   232 bits (591),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 109/131 (83%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = -2

Query  664  GGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE  485
             GA +L+FLRNS QF+AL+ +VQANPQILQPMLQELGKQNP +MRLIQ+HQA+FLRL+NE
Sbjct  322  AGAGSLDFLRNSPQFRALQTLVQANPQILQPMLQELGKQNPQVMRLIQDHQAEFLRLLNE  381

Query  484  PVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  305
            P EG E N+LGQLA++MPQA+ VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN
Sbjct  382  PAEGAESNLLGQLASAMPQALTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  441

Query  304  YLLDHMHEFED  272
            YLLDHMHEFED
Sbjct  442  YLLDHMHEFED  452



>ref|XP_009391405.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=408

 Score =   231 bits (588),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 109/130 (84%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
            G  +L+FLRNS QF+AL+A+VQANPQILQPMLQELGKQNP +MRLIQEHQ +FLRLINEP
Sbjct  279  GGGSLDFLRNSPQFRALQALVQANPQILQPMLQELGKQNPQIMRLIQEHQGEFLRLINEP  338

Query  481  VEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  302
             EG EGN LGQLA  MPQ + VTPEEREAIERLEAMGFDRALVL+VFFACNKNEELAANY
Sbjct  339  AEGTEGNPLGQLAGGMPQTLNVTPEEREAIERLEAMGFDRALVLQVFFACNKNEELAANY  398

Query  301  LLDHMHEFED  272
            LLDHMHEFED
Sbjct  399  LLDHMHEFED  408



>ref|XP_010317192.1| PREDICTED: ubiquitin receptor RAD23d isoform X2 [Solanum lycopersicum]
Length=381

 Score =   230 bits (586),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 111/131 (85%), Positives = 120/131 (92%), Gaps = 1/131 (1%)
 Frame = -2

Query  664  GGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE  485
             GA  L+FL NS QFQALRAMVQANPQILQPMLQELGKQNP LMRLIQEHQADFLRLINE
Sbjct  252  AGAGNLDFLSNSPQFQALRAMVQANPQILQPMLQELGKQNPQLMRLIQEHQADFLRLINE  311

Query  484  PVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  305
            PVEG EGN+ GQ A ++PQAV VTPEEREAIERLEAMGFDRALVL+V+FACNKNEE+AAN
Sbjct  312  PVEG-EGNVPGQPAGAIPQAVTVTPEEREAIERLEAMGFDRALVLQVYFACNKNEEMAAN  370

Query  304  YLLDHMHEFED  272
            YLLDHMHEF++
Sbjct  371  YLLDHMHEFDE  381



>ref|XP_008781252.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X4 [Phoenix 
dactylifera]
Length=450

 Score =   232 bits (591),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 109/131 (83%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = -2

Query  664  GGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE  485
             GA +L+FLRNS QF+AL+ +VQANPQILQPMLQELGKQNP +MRLIQ+HQA+FLRL+NE
Sbjct  320  AGAGSLDFLRNSPQFRALQTLVQANPQILQPMLQELGKQNPQVMRLIQDHQAEFLRLLNE  379

Query  484  PVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  305
            P EG E N+LGQLA++MPQA+ VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN
Sbjct  380  PAEGAESNLLGQLASAMPQALTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  439

Query  304  YLLDHMHEFED  272
            YLLDHMHEFED
Sbjct  440  YLLDHMHEFED  450



>ref|XP_008781245.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X3 [Phoenix 
dactylifera]
Length=451

 Score =   232 bits (591),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 109/131 (83%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = -2

Query  664  GGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE  485
             GA +L+FLRNS QF+AL+ +VQANPQILQPMLQELGKQNP +MRLIQ+HQA+FLRL+NE
Sbjct  321  AGAGSLDFLRNSPQFRALQTLVQANPQILQPMLQELGKQNPQVMRLIQDHQAEFLRLLNE  380

Query  484  PVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  305
            P EG E N+LGQLA++MPQA+ VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN
Sbjct  381  PAEGAESNLLGQLASAMPQALTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  440

Query  304  YLLDHMHEFED  272
            YLLDHMHEFED
Sbjct  441  YLLDHMHEFED  451



>ref|XP_004233495.1| PREDICTED: ubiquitin receptor RAD23d isoform X1 [Solanum lycopersicum]
Length=383

 Score =   230 bits (586),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 111/131 (85%), Positives = 120/131 (92%), Gaps = 1/131 (1%)
 Frame = -2

Query  664  GGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE  485
             GA  L+FL NS QFQALRAMVQANPQILQPMLQELGKQNP LMRLIQEHQADFLRLINE
Sbjct  254  AGAGNLDFLSNSPQFQALRAMVQANPQILQPMLQELGKQNPQLMRLIQEHQADFLRLINE  313

Query  484  PVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  305
            PVEG EGN+ GQ A ++PQAV VTPEEREAIERLEAMGFDRALVL+V+FACNKNEE+AAN
Sbjct  314  PVEG-EGNVPGQPAGAIPQAVTVTPEEREAIERLEAMGFDRALVLQVYFACNKNEEMAAN  372

Query  304  YLLDHMHEFED  272
            YLLDHMHEF++
Sbjct  373  YLLDHMHEFDE  383



>ref|XP_004233496.1| PREDICTED: ubiquitin receptor RAD23c isoform X3 [Solanum lycopersicum]
Length=365

 Score =   229 bits (583),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/131 (85%), Positives = 120/131 (92%), Gaps = 1/131 (1%)
 Frame = -2

Query  664  GGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE  485
             GA  L+FL NS QFQALRAMVQANPQILQPMLQELGKQNP LMRLIQEHQADFLRLINE
Sbjct  236  AGAGNLDFLSNSPQFQALRAMVQANPQILQPMLQELGKQNPQLMRLIQEHQADFLRLINE  295

Query  484  PVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  305
            PVEG EGN+ GQ A ++PQAV VTPEEREAIERLEAMGFDRALVL+V+FACNKNEE+AAN
Sbjct  296  PVEG-EGNVPGQPAGAIPQAVTVTPEEREAIERLEAMGFDRALVLQVYFACNKNEEMAAN  354

Query  304  YLLDHMHEFED  272
            YLLDHMHEF++
Sbjct  355  YLLDHMHEFDE  365



>gb|AII99835.1| putative DNA repair protein RAD23-3-like protein [Nicotiana tabacum]
Length=387

 Score =   229 bits (584),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 112/131 (85%), Positives = 119/131 (91%), Gaps = 1/131 (1%)
 Frame = -2

Query  664  GGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE  485
             GA  L+FL NS QFQALRAMVQANPQILQPMLQELGKQNP LMRLIQEHQADFLRLINE
Sbjct  258  AGAGNLDFLSNSPQFQALRAMVQANPQILQPMLQELGKQNPQLMRLIQEHQADFLRLINE  317

Query  484  PVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  305
            PVE  EGN+ GQ A ++PQAV VTPEEREAIERLEAMGFDRALVL+VFFACNKNEELAAN
Sbjct  318  PVES-EGNVPGQPAGAIPQAVTVTPEEREAIERLEAMGFDRALVLQVFFACNKNEELAAN  376

Query  304  YLLDHMHEFED  272
            YLLDHMHEF++
Sbjct  377  YLLDHMHEFDE  387



>ref|XP_009125074.1| PREDICTED: ubiquitin receptor RAD23d [Brassica rapa]
Length=382

 Score =   229 bits (583),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 113/126 (90%), Positives = 120/126 (95%), Gaps = 1/126 (1%)
 Frame = -2

Query  649  LEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGG  470
            L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP L+RLIQEHQADFLRLINEPVEG 
Sbjct  257  LDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLVRLIQEHQADFLRLINEPVEGE  316

Query  469  EGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDH  290
            E N++ QL A+MPQAV VTPEEREAIERLEAMGFDRA+VLEVFFACNKNEELAANYLLDH
Sbjct  317  E-NVMEQLEAAMPQAVTVTPEEREAIERLEAMGFDRAMVLEVFFACNKNEELAANYLLDH  375

Query  289  MHEFED  272
            MHEFE+
Sbjct  376  MHEFEE  381



>gb|AAK59766.1| unknown protein [Arabidopsis thaliana]
Length=378

 Score =   229 bits (583),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 112/126 (89%), Positives = 118/126 (94%), Gaps = 1/126 (1%)
 Frame = -2

Query  649  LEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGG  470
            L+FLRNS QFQALRAMVQANPQILQPMLQELGKQNP L+RLIQEHQADFLRLINEPVEG 
Sbjct  253  LDFLRNSHQFQALRAMVQANPQILQPMLQELGKQNPQLVRLIQEHQADFLRLINEPVEGE  312

Query  469  EGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDH  290
            E N++ QL A+MPQAV VTPEEREAIERLE MGFDRA+VLEVFFACNKNEELAANYLLDH
Sbjct  313  E-NVMEQLEAAMPQAVTVTPEEREAIERLEGMGFDRAMVLEVFFACNKNEELAANYLLDH  371

Query  289  MHEFED  272
            MHEFED
Sbjct  372  MHEFED  377



>ref|XP_010926135.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X4 [Elaeis 
guineensis]
Length=395

 Score =   229 bits (584),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/131 (83%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = -2

Query  664  GGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE  485
              A +L+FLRNS QF+AL+ +VQANPQILQPMLQELGKQNP +MRLIQEHQA+FLRL+NE
Sbjct  265  ASAGSLDFLRNSPQFRALQTLVQANPQILQPMLQELGKQNPQVMRLIQEHQAEFLRLLNE  324

Query  484  PVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  305
            P EG E N+LGQLA +MPQA+ VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN
Sbjct  325  PAEGAESNLLGQLAGAMPQALTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  384

Query  304  YLLDHMHEFED  272
            YLLDHMHEFED
Sbjct  385  YLLDHMHEFED  395



>emb|CDX67404.1| BnaA07g14440D [Brassica napus]
Length=382

 Score =   229 bits (583),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 113/126 (90%), Positives = 120/126 (95%), Gaps = 1/126 (1%)
 Frame = -2

Query  649  LEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGG  470
            L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP L+RLIQEHQADFLRLINEPVEG 
Sbjct  257  LDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLVRLIQEHQADFLRLINEPVEGE  316

Query  469  EGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDH  290
            E N++ QL A+MPQAV VTPEEREAIERLEAMGFDRA+VLEVFFACNKNEELAANYLLDH
Sbjct  317  E-NVMEQLEAAMPQAVTVTPEEREAIERLEAMGFDRAMVLEVFFACNKNEELAANYLLDH  375

Query  289  MHEFED  272
            MHEFE+
Sbjct  376  MHEFEE  381



>gb|KFK37714.1| hypothetical protein AALP_AA3G019400 [Arabis alpina]
Length=435

 Score =   230 bits (586),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 113/134 (84%), Positives = 124/134 (93%), Gaps = 4/134 (3%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
             A TL+FLRNSQQFQ LRAMVQANPQ+LQPMLQELGKQNP+LMRLIQ+HQADFLRLINEP
Sbjct  302  SAGTLDFLRNSQQFQTLRAMVQANPQVLQPMLQELGKQNPNLMRLIQDHQADFLRLINEP  361

Query  481  VEGG--EGNILGQLAASM--PQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEEL  314
            VEGG   GN+LGQLAA M  PQA+QVTPEER+AIERLE MGF+RALVLEVFFACNK+EEL
Sbjct  362  VEGGAETGNLLGQLAAGMQQPQAIQVTPEERDAIERLEGMGFERALVLEVFFACNKDEEL  421

Query  313  AANYLLDHMHEFED  272
            AANYLLDH+HEFE+
Sbjct  422  AANYLLDHIHEFEE  435



>ref|XP_010926134.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X3 [Elaeis 
guineensis]
Length=396

 Score =   229 bits (584),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/131 (83%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = -2

Query  664  GGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE  485
              A +L+FLRNS QF+AL+ +VQANPQILQPMLQELGKQNP +MRLIQEHQA+FLRL+NE
Sbjct  266  ASAGSLDFLRNSPQFRALQTLVQANPQILQPMLQELGKQNPQVMRLIQEHQAEFLRLLNE  325

Query  484  PVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  305
            P EG E N+LGQLA +MPQA+ VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN
Sbjct  326  PAEGAESNLLGQLAGAMPQALTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  385

Query  304  YLLDHMHEFED  272
            YLLDHMHEFED
Sbjct  386  YLLDHMHEFED  396



>gb|KFK37713.1| hypothetical protein AALP_AA3G019400 [Arabis alpina]
Length=425

 Score =   230 bits (586),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 124/133 (93%), Gaps = 4/133 (3%)
 Frame = -2

Query  658  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  479
            A TL+FLRNSQQFQ LRAMVQANPQ+LQPMLQELGKQNP+LMRLIQ+HQADFLRLINEPV
Sbjct  293  AGTLDFLRNSQQFQTLRAMVQANPQVLQPMLQELGKQNPNLMRLIQDHQADFLRLINEPV  352

Query  478  EGG--EGNILGQLAASM--PQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELA  311
            EGG   GN+LGQLAA M  PQA+QVTPEER+AIERLE MGF+RALVLEVFFACNK+EELA
Sbjct  353  EGGAETGNLLGQLAAGMQQPQAIQVTPEERDAIERLEGMGFERALVLEVFFACNKDEELA  412

Query  310  ANYLLDHMHEFED  272
            ANYLLDH+HEFE+
Sbjct  413  ANYLLDHIHEFEE  425



>emb|CDY58121.1| BnaCnng32650D [Brassica napus]
Length=384

 Score =   228 bits (582),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 113/126 (90%), Positives = 120/126 (95%), Gaps = 1/126 (1%)
 Frame = -2

Query  649  LEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGG  470
            L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP L+RLIQEHQADFLRLINEPVEG 
Sbjct  259  LDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLVRLIQEHQADFLRLINEPVEGE  318

Query  469  EGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDH  290
            E N++ QL A+MPQAV VTPEEREAIERLEAMGFDRA+VLEVFFACNKNEELAANYLLDH
Sbjct  319  E-NVMEQLEAAMPQAVTVTPEEREAIERLEAMGFDRAMVLEVFFACNKNEELAANYLLDH  377

Query  289  MHEFED  272
            MHEFE+
Sbjct  378  MHEFEE  383



>gb|EYU29968.1| hypothetical protein MIMGU_mgv1a008352mg [Erythranthe guttata]
Length=375

 Score =   228 bits (581),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 110/132 (83%), Positives = 122/132 (92%), Gaps = 1/132 (1%)
 Frame = -2

Query  664  GGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE  485
            GGAN L+FLRN+ QFQALRAMVQANPQILQPMLQELGKQNP L+RLIQEHQADF+RLINE
Sbjct  244  GGANALDFLRNNPQFQALRAMVQANPQILQPMLQELGKQNPQLVRLIQEHQADFVRLINE  303

Query  484  PVEGGEGNILGQLA-ASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAA  308
            P+EG EG++LGQL    M  A++VTPEERE+IERLEAMGFD+ALVLEVFFACNKNEELAA
Sbjct  304  PIEGAEGDLLGQLGEGGMQHAIEVTPEERESIERLEAMGFDQALVLEVFFACNKNEELAA  363

Query  307  NYLLDHMHEFED  272
            NYLLDHMHEFE+
Sbjct  364  NYLLDHMHEFEE  375



>ref|NP_001274760.1| uncharacterized protein LOC102577665 [Solanum tuberosum]
 gb|ABB16981.1| unknown [Solanum tuberosum]
Length=382

 Score =   228 bits (582),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 111/130 (85%), Positives = 119/130 (92%), Gaps = 1/130 (1%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
            GA  L+FL NS QFQALRAMVQANPQILQPMLQELGKQNP LMRLIQEHQADFLRLINEP
Sbjct  254  GAGNLDFLSNSPQFQALRAMVQANPQILQPMLQELGKQNPQLMRLIQEHQADFLRLINEP  313

Query  481  VEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  302
            VEG EGN+ GQ A ++PQAV VTPEEREAIERLEAMGFDRALVL+VFFAC KNEE+AANY
Sbjct  314  VEG-EGNVPGQPAGAIPQAVTVTPEEREAIERLEAMGFDRALVLQVFFACXKNEEMAANY  372

Query  301  LLDHMHEFED  272
            LLDHMHEF++
Sbjct  373  LLDHMHEFDE  382



>gb|EYU29967.1| hypothetical protein MIMGU_mgv1a008352mg [Erythranthe guttata]
Length=376

 Score =   228 bits (581),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 110/132 (83%), Positives = 122/132 (92%), Gaps = 1/132 (1%)
 Frame = -2

Query  664  GGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE  485
            GGAN L+FLRN+ QFQALRAMVQANPQILQPMLQELGKQNP L+RLIQEHQADF+RLINE
Sbjct  245  GGANALDFLRNNPQFQALRAMVQANPQILQPMLQELGKQNPQLVRLIQEHQADFVRLINE  304

Query  484  PVEGGEGNILGQLA-ASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAA  308
            P+EG EG++LGQL    M  A++VTPEERE+IERLEAMGFD+ALVLEVFFACNKNEELAA
Sbjct  305  PIEGAEGDLLGQLGEGGMQHAIEVTPEERESIERLEAMGFDQALVLEVFFACNKNEELAA  364

Query  307  NYLLDHMHEFED  272
            NYLLDHMHEFE+
Sbjct  365  NYLLDHMHEFEE  376



>ref|XP_010916168.1| PREDICTED: ubiquitin receptor RAD23c-like [Elaeis guineensis]
Length=384

 Score =   227 bits (578),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 107/129 (83%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = -2

Query  658  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  479
            A +L+FLRNS QF+AL+ +VQANPQILQPMLQELGKQNP +MRLIQEHQA+FLRL+NEP 
Sbjct  256  AGSLDFLRNSPQFRALQTLVQANPQILQPMLQELGKQNPQVMRLIQEHQAEFLRLLNEPA  315

Query  478  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  299
            EG E ++LGQ A+ MPQA+ VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL
Sbjct  316  EGAESDLLGQFASPMPQALTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  375

Query  298  LDHMHEFED  272
            LDHMHEFED
Sbjct  376  LDHMHEFED  384



>ref|XP_010450906.1| PREDICTED: ubiquitin receptor RAD23d isoform X2 [Camelina sativa]
Length=379

 Score =   226 bits (577),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 111/126 (88%), Positives = 118/126 (94%), Gaps = 1/126 (1%)
 Frame = -2

Query  649  LEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGG  470
            L+FLRNSQQF+ALR MVQANPQILQPMLQELGKQNP L+RLIQEHQ DFLRLINEPVEG 
Sbjct  254  LDFLRNSQQFRALRGMVQANPQILQPMLQELGKQNPQLVRLIQEHQTDFLRLINEPVEGE  313

Query  469  EGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDH  290
            E N++ QL A+MPQAV VTPEEREAIERLEAMGFDRA+VLEVFFACNKNEELAANYLLDH
Sbjct  314  E-NVMEQLEAAMPQAVTVTPEEREAIERLEAMGFDRAMVLEVFFACNKNEELAANYLLDH  372

Query  289  MHEFED  272
            MHEFED
Sbjct  373  MHEFED  378



>ref|XP_010450905.1| PREDICTED: ubiquitin receptor RAD23d isoform X1 [Camelina sativa]
Length=381

 Score =   226 bits (577),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 111/126 (88%), Positives = 118/126 (94%), Gaps = 1/126 (1%)
 Frame = -2

Query  649  LEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGG  470
            L+FLRNSQQF+ALR MVQANPQILQPMLQELGKQNP L+RLIQEHQ DFLRLINEPVEG 
Sbjct  256  LDFLRNSQQFRALRGMVQANPQILQPMLQELGKQNPQLVRLIQEHQTDFLRLINEPVEGE  315

Query  469  EGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDH  290
            E N++ QL A+MPQAV VTPEEREAIERLEAMGFDRA+VLEVFFACNKNEELAANYLLDH
Sbjct  316  E-NVMEQLEAAMPQAVTVTPEEREAIERLEAMGFDRAMVLEVFFACNKNEELAANYLLDH  374

Query  289  MHEFED  272
            MHEFED
Sbjct  375  MHEFED  380



>emb|CDY01661.1| BnaC04g30910D [Brassica napus]
Length=378

 Score =   226 bits (577),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 113/126 (90%), Positives = 119/126 (94%), Gaps = 1/126 (1%)
 Frame = -2

Query  649  LEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGG  470
            L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP L+RLIQEHQADFLRLINEPVEG 
Sbjct  253  LDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLVRLIQEHQADFLRLINEPVEGE  312

Query  469  EGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDH  290
            E N + QL A+MPQAV VTPEEREAIERLEAMGFDRA+VLEVFFACNKNEELAANYLLDH
Sbjct  313  E-NAMEQLEAAMPQAVTVTPEEREAIERLEAMGFDRAMVLEVFFACNKNEELAANYLLDH  371

Query  289  MHEFED  272
            MHEFE+
Sbjct  372  MHEFEE  377



>ref|XP_009139789.1| PREDICTED: ubiquitin receptor RAD23d [Brassica rapa]
Length=378

 Score =   226 bits (576),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 113/126 (90%), Positives = 119/126 (94%), Gaps = 1/126 (1%)
 Frame = -2

Query  649  LEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGG  470
            L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP L+RLIQEHQADFLRLINEPVEG 
Sbjct  253  LDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLVRLIQEHQADFLRLINEPVEGE  312

Query  469  EGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDH  290
            E N + QL A+MPQAV VTPEEREAIERLEAMGFDRA+VLEVFFACNKNEELAANYLLDH
Sbjct  313  E-NAMEQLEAAMPQAVTVTPEEREAIERLEAMGFDRAMVLEVFFACNKNEELAANYLLDH  371

Query  289  MHEFED  272
            MHEFE+
Sbjct  372  MHEFEE  377



>emb|CDX74522.1| BnaA04g08670D [Brassica napus]
Length=380

 Score =   226 bits (576),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 113/126 (90%), Positives = 119/126 (94%), Gaps = 1/126 (1%)
 Frame = -2

Query  649  LEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGG  470
            L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP L+RLIQEHQADFLRLINEPVEG 
Sbjct  255  LDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLVRLIQEHQADFLRLINEPVEGE  314

Query  469  EGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDH  290
            E N + QL A+MPQAV VTPEEREAIERLEAMGFDRA+VLEVFFACNKNEELAANYLLDH
Sbjct  315  E-NAMEQLEAAMPQAVTVTPEEREAIERLEAMGFDRAMVLEVFFACNKNEELAANYLLDH  373

Query  289  MHEFED  272
            MHEFE+
Sbjct  374  MHEFEE  379



>ref|XP_010907325.1| PREDICTED: ubiquitin receptor RAD23d-like [Elaeis guineensis]
Length=391

 Score =   226 bits (575),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 109/131 (83%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = -2

Query  664  GGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE  485
             G  +L+FLRNS QFQA +A+VQANPQIL+PMLQELGKQNP +MRLIQEHQ +FL LINE
Sbjct  261  AGGGSLDFLRNSPQFQAFKALVQANPQILRPMLQELGKQNPLVMRLIQEHQDEFLCLINE  320

Query  484  PVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  305
            P EGGE N+LGQLAA+MPQA+ VTPEE EAIERLEAMGFDRALVLEVFFACNKNEELAAN
Sbjct  321  PAEGGESNLLGQLAAAMPQALTVTPEECEAIERLEAMGFDRALVLEVFFACNKNEELAAN  380

Query  304  YLLDHMHEFED  272
            YLLDHMHEFED
Sbjct  381  YLLDHMHEFED  391



>gb|KFK33251.1| hypothetical protein AALP_AA6G350300 [Arabis alpina]
Length=392

 Score =   225 bits (574),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 111/126 (88%), Positives = 120/126 (95%), Gaps = 1/126 (1%)
 Frame = -2

Query  649  LEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGG  470
            L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP L+RLIQEHQADFLRLINEPVE G
Sbjct  267  LDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLVRLIQEHQADFLRLINEPVE-G  325

Query  469  EGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDH  290
            E N++ QL A+MPQAV VTPEEREAIERLEAMGF+RA+VLEVFFACNKNEELAANYLLDH
Sbjct  326  EENVIEQLEAAMPQAVTVTPEEREAIERLEAMGFERAMVLEVFFACNKNEELAANYLLDH  385

Query  289  MHEFED  272
            MHEF++
Sbjct  386  MHEFDE  391



>emb|CDX74251.1| BnaA03g27960D [Brassica napus]
Length=401

 Score =   225 bits (573),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 113/132 (86%), Positives = 122/132 (92%), Gaps = 3/132 (2%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
            G  TL+FLRNSQQFQALRAMVQANPQ+LQPMLQELGKQNP+LMRLIQEHQADFLRLINEP
Sbjct  271  GGGTLDFLRNSQQFQALRAMVQANPQVLQPMLQELGKQNPNLMRLIQEHQADFLRLINEP  330

Query  481  VEGG-EG-NILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAA  308
            VEGG EG N+ G+     PQA+QVTPEER+AIERLEAMGF+RALVLEVFFACNKNEELAA
Sbjct  331  VEGGAEGANLFGE-GMPQPQAIQVTPEERDAIERLEAMGFERALVLEVFFACNKNEELAA  389

Query  307  NYLLDHMHEFED  272
            NYLLDHMHEFE+
Sbjct  390  NYLLDHMHEFEE  401



>ref|XP_010553921.1| PREDICTED: ubiquitin receptor RAD23d isoform X2 [Tarenaya hassleriana]
Length=378

 Score =   224 bits (570),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 111/130 (85%), Positives = 119/130 (92%), Gaps = 1/130 (1%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
            GA  L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP LMRLIQ+HQADFLRLINE 
Sbjct  249  GAGNLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLMRLIQDHQADFLRLINEQ  308

Query  481  VEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  302
             EG E N+LGQLA++MPQAV VTPEEREAIERLEAMGF+R + LEVF ACNKNEELAANY
Sbjct  309  GEGEE-NLLGQLASAMPQAVTVTPEEREAIERLEAMGFNRDIALEVFIACNKNEELAANY  367

Query  301  LLDHMHEFED  272
            LLDH+HEFED
Sbjct  368  LLDHIHEFED  377



>ref|XP_009356279.1| PREDICTED: ubiquitin receptor RAD23d-like [Pyrus x bretschneideri]
Length=385

 Score =   224 bits (570),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 120/131 (92%), Gaps = 2/131 (2%)
 Frame = -2

Query  664  GGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE  485
            G A  L+FLR++QQFQALR+MVQANPQILQPMLQELGKQNP+L+RLI EHQADFLRLINE
Sbjct  257  GAAGNLDFLRDNQQFQALRSMVQANPQILQPMLQELGKQNPNLVRLIGEHQADFLRLINE  316

Query  484  PVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  305
            P EGGEGN+LG   A++PQA+ ++PEEREAIERLEAMGF RA+VL+VFFACNKNEEL AN
Sbjct  317  PAEGGEGNVLGD--AAVPQAIAISPEEREAIERLEAMGFARAIVLQVFFACNKNEELTAN  374

Query  304  YLLDHMHEFED  272
            YLLDHMHEFED
Sbjct  375  YLLDHMHEFED  385



>ref|XP_010553920.1| PREDICTED: ubiquitin receptor RAD23d isoform X1 [Tarenaya hassleriana]
Length=379

 Score =   224 bits (570),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 111/130 (85%), Positives = 119/130 (92%), Gaps = 1/130 (1%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
            GA  L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP LMRLIQ+HQADFLRLINE 
Sbjct  250  GAGNLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLMRLIQDHQADFLRLINEQ  309

Query  481  VEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  302
             EG E N+LGQLA++MPQAV VTPEEREAIERLEAMGF+R + LEVF ACNKNEELAANY
Sbjct  310  GEGEE-NLLGQLASAMPQAVTVTPEEREAIERLEAMGFNRDIALEVFIACNKNEELAANY  368

Query  301  LLDHMHEFED  272
            LLDH+HEFED
Sbjct  369  LLDHIHEFED  378



>ref|XP_009134681.1| PREDICTED: ubiquitin receptor RAD23c [Brassica rapa]
Length=401

 Score =   224 bits (571),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 113/132 (86%), Positives = 122/132 (92%), Gaps = 3/132 (2%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
            G  TL+FLRNSQQFQALRAMVQANPQ+LQPMLQELGKQNP+LMRLIQEHQADFLRLINEP
Sbjct  271  GGGTLDFLRNSQQFQALRAMVQANPQVLQPMLQELGKQNPNLMRLIQEHQADFLRLINEP  330

Query  481  VEGG-EG-NILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAA  308
            VEGG EG N+ G+     PQA+QVTPEER+AIERLEAMGF+RALVLEVFFACNKNEELAA
Sbjct  331  VEGGAEGANLFGE-GMPQPQAIQVTPEERDAIERLEAMGFERALVLEVFFACNKNEELAA  389

Query  307  NYLLDHMHEFED  272
            NYLLDHMHEFE+
Sbjct  390  NYLLDHMHEFEE  401



>emb|CDX91998.1| BnaC03g33000D [Brassica napus]
Length=403

 Score =   224 bits (571),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 113/132 (86%), Positives = 122/132 (92%), Gaps = 3/132 (2%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
            G  TL+FLRNSQQFQALRAMVQANPQ+LQPMLQELGKQNP+LMRLIQEHQADFLRLINEP
Sbjct  273  GGGTLDFLRNSQQFQALRAMVQANPQVLQPMLQELGKQNPNLMRLIQEHQADFLRLINEP  332

Query  481  VEGG-EG-NILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAA  308
            VEGG EG N+ G+     PQA+QVTPEER+AIERLEAMGF+RALVLEVFFACNKNEELAA
Sbjct  333  VEGGAEGANLFGE-GMPQPQAIQVTPEERDAIERLEAMGFERALVLEVFFACNKNEELAA  391

Query  307  NYLLDHMHEFED  272
            NYLLDHMHEFE+
Sbjct  392  NYLLDHMHEFEE  403



>ref|XP_008446578.1| PREDICTED: ubiquitin receptor RAD23c-like [Cucumis melo]
Length=422

 Score =   225 bits (573),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 107/129 (83%), Positives = 120/129 (93%), Gaps = 1/129 (1%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
            G+ +L+FLRNS QFQALRAMV+ANPQILQPMLQELGKQNP L+RLIQ+HQ DFLRLINEP
Sbjct  291  GSGSLDFLRNSPQFQALRAMVRANPQILQPMLQELGKQNPQLIRLIQDHQPDFLRLINEP  350

Query  481  VEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  302
            +EG EGNILGQLA +MPQA+ VTPEEREAI+RLE MGFDR LV+EVFFACNKNEE+AANY
Sbjct  351  LEG-EGNILGQLAEAMPQAITVTPEEREAIQRLEDMGFDRGLVVEVFFACNKNEEMAANY  409

Query  301  LLDHMHEFE  275
            LLDH+HEFE
Sbjct  410  LLDHIHEFE  418



>gb|KGN52072.1| hypothetical protein Csa_5G608600 [Cucumis sativus]
Length=420

 Score =   224 bits (572),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 107/129 (83%), Positives = 120/129 (93%), Gaps = 1/129 (1%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
            G+ +L+FLRNS QFQALRAMV+ANPQILQPMLQELGKQNP L+RLIQ+HQ DFLRLINEP
Sbjct  289  GSGSLDFLRNSPQFQALRAMVRANPQILQPMLQELGKQNPQLIRLIQDHQPDFLRLINEP  348

Query  481  VEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  302
            +EG EGNILGQLA +MPQA+ VTPEEREAI+RLE MGFDR LV+EVFFACNKNEE+AANY
Sbjct  349  LEG-EGNILGQLAEAMPQAITVTPEEREAIQRLEDMGFDRGLVVEVFFACNKNEEMAANY  407

Query  301  LLDHMHEFE  275
            LLDH+HEFE
Sbjct  408  LLDHIHEFE  416



>ref|XP_010692904.1| PREDICTED: ubiquitin receptor RAD23d [Beta vulgaris subsp. vulgaris]
Length=409

 Score =   224 bits (571),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 109/130 (84%), Positives = 119/130 (92%), Gaps = 1/130 (1%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
            GA +L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP LMRLIQ+HQADFLRLINEP
Sbjct  274  GAGSLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLMRLIQDHQADFLRLINEP  333

Query  481  VEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  302
            VE GEGN+L QL ++MP +V VTPEEREAIERLE MGF RA VL+V+FACNKNEELAANY
Sbjct  334  VE-GEGNLLSQLTSAMPASVSVTPEEREAIERLEGMGFRRATVLQVYFACNKNEELAANY  392

Query  301  LLDHMHEFED  272
            LLDHM EFE+
Sbjct  393  LLDHMDEFEN  402



>ref|XP_008368214.1| PREDICTED: ubiquitin receptor RAD23c-like [Malus domestica]
Length=378

 Score =   222 bits (566),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 107/131 (82%), Positives = 120/131 (92%), Gaps = 2/131 (2%)
 Frame = -2

Query  664  GGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE  485
            GGA  L+FLR++QQFQALR+MVQANPQILQPMLQELGKQNP+L+RLI  HQADFLRLINE
Sbjct  250  GGAGNLDFLRDNQQFQALRSMVQANPQILQPMLQELGKQNPNLVRLIGTHQADFLRLINE  309

Query  484  PVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  305
            P EGGEGN+LG   A++PQA+ +T EEREAIERLEAMGF RA+VL+VFFACNKNEELAAN
Sbjct  310  PAEGGEGNVLGD--AAVPQAITITREEREAIERLEAMGFARAIVLQVFFACNKNEELAAN  367

Query  304  YLLDHMHEFED  272
            YLLDHMHEFED
Sbjct  368  YLLDHMHEFED  378



>ref|XP_009356676.1| PREDICTED: ubiquitin receptor RAD23c-like [Pyrus x bretschneideri]
Length=384

 Score =   222 bits (566),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 107/131 (82%), Positives = 120/131 (92%), Gaps = 2/131 (2%)
 Frame = -2

Query  664  GGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE  485
            GGA  L+FLR++QQFQALR+MVQANPQILQPMLQELGKQNP+L+RLI  HQADFLRLINE
Sbjct  256  GGAGNLDFLRDNQQFQALRSMVQANPQILQPMLQELGKQNPNLVRLIGAHQADFLRLINE  315

Query  484  PVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  305
            P EGGEGN+LG   A++PQA+ +T EEREAIERLEAMGF RA+VL+VFFACNKNEELAAN
Sbjct  316  PAEGGEGNVLGD--AAVPQAITITREEREAIERLEAMGFARAIVLQVFFACNKNEELAAN  373

Query  304  YLLDHMHEFED  272
            YLLDHMHEFED
Sbjct  374  YLLDHMHEFED  384



>emb|CAA72741.1| RAD23, isoform I [Daucus carota]
Length=382

 Score =   219 bits (559),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 109/129 (84%), Positives = 117/129 (91%), Gaps = 5/129 (4%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
            GA  L+FLR +QQFQALRAMVQ+NPQILQPMLQELGKQNPHLMRLIQEHQADFL+LINEP
Sbjct  259  GAGNLDFLRTNQQFQALRAMVQSNPQILQPMLQELGKQNPHLMRLIQEHQADFLQLINEP  318

Query  481  VEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  302
            +EGGE N+LG      PQA+ VTPEER+AIERLEAMGFDR LVLEVFFACNKNEELAANY
Sbjct  319  MEGGE-NLLGH----GPQAISVTPEERDAIERLEAMGFDRELVLEVFFACNKNEELAANY  373

Query  301  LLDHMHEFE  275
            LLDHMHEFE
Sbjct  374  LLDHMHEFE  382



>ref|XP_008390012.1| PREDICTED: ubiquitin receptor RAD23c-like [Malus domestica]
Length=359

 Score =   218 bits (556),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 117/126 (93%), Gaps = 2/126 (2%)
 Frame = -2

Query  649  LEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGG  470
            L+FLR++QQFQALR+MVQANPQILQPMLQELGKQNP+L+RLI EHQADFLRLINEP EGG
Sbjct  236  LDFLRDNQQFQALRSMVQANPQILQPMLQELGKQNPNLVRLIGEHQADFLRLINEPAEGG  295

Query  469  EGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDH  290
            EGN LG   A++PQA+ +TPEEREAIERLEAMGF RA+VL+VFFACNKNEEL ANYLLDH
Sbjct  296  EGNALGD--AAVPQAIAITPEEREAIERLEAMGFARAIVLQVFFACNKNEELTANYLLDH  353

Query  289  MHEFED  272
            MHEFED
Sbjct  354  MHEFED  359



>ref|XP_009417654.1| PREDICTED: ubiquitin receptor RAD23d-like [Musa acuminata subsp. 
malaccensis]
Length=391

 Score =   219 bits (557),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 117/131 (89%), Gaps = 1/131 (1%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
            G  +L+FL+NS QF+AL+A+VQANPQ LQPMLQELGKQNP ++RLIQEHQ +FLRLINEP
Sbjct  261  GGGSLDFLQNSPQFRALQALVQANPQFLQPMLQELGKQNPQILRLIQEHQGEFLRLINEP  320

Query  481  VEGGEG-NILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  305
             EG EG NILGQL   MPQA+ VTPEE EAIERLEAMGFDRALVL+VFFACNKNEELAAN
Sbjct  321  AEGTEGGNILGQLPTGMPQALSVTPEEHEAIERLEAMGFDRALVLQVFFACNKNEELAAN  380

Query  304  YLLDHMHEFED  272
            YLLDHMHEFED
Sbjct  381  YLLDHMHEFED  391



>ref|XP_010681568.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X6 [Beta vulgaris 
subsp. vulgaris]
Length=354

 Score =   215 bits (548),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 100/127 (79%), Positives = 116/127 (91%), Gaps = 0/127 (0%)
 Frame = -2

Query  658  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  479
            +  L+FLRNS+QFQALRAMVQANPQ+LQPMLQELGKQNP+L+RLIQEHQ +F +L+NEPV
Sbjct  228  SGALDFLRNSEQFQALRAMVQANPQVLQPMLQELGKQNPNLVRLIQEHQTEFDQLLNEPV  287

Query  478  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  299
            EG EGN+LGQLA +MPQA+QVTPEE   IERLEAMGF+R+ VLE++FACNKNEEL ANYL
Sbjct  288  EGKEGNLLGQLAGAMPQAIQVTPEEHATIERLEAMGFERSTVLELYFACNKNEELTANYL  347

Query  298  LDHMHEF  278
            LDHMHEF
Sbjct  348  LDHMHEF  354



>ref|XP_010681567.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X5 [Beta vulgaris 
subsp. vulgaris]
Length=357

 Score =   215 bits (547),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 100/127 (79%), Positives = 116/127 (91%), Gaps = 0/127 (0%)
 Frame = -2

Query  658  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  479
            +  L+FLRNS+QFQALRAMVQANPQ+LQPMLQELGKQNP+L+RLIQEHQ +F +L+NEPV
Sbjct  231  SGALDFLRNSEQFQALRAMVQANPQVLQPMLQELGKQNPNLVRLIQEHQTEFDQLLNEPV  290

Query  478  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  299
            EG EGN+LGQLA +MPQA+QVTPEE   IERLEAMGF+R+ VLE++FACNKNEEL ANYL
Sbjct  291  EGKEGNLLGQLAGAMPQAIQVTPEEHATIERLEAMGFERSTVLELYFACNKNEELTANYL  350

Query  298  LDHMHEF  278
            LDHMHEF
Sbjct  351  LDHMHEF  357



>ref|XP_010681566.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X4 [Beta vulgaris 
subsp. vulgaris]
Length=373

 Score =   215 bits (548),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 100/127 (79%), Positives = 116/127 (91%), Gaps = 0/127 (0%)
 Frame = -2

Query  658  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  479
            +  L+FLRNS+QFQALRAMVQANPQ+LQPMLQELGKQNP+L+RLIQEHQ +F +L+NEPV
Sbjct  247  SGALDFLRNSEQFQALRAMVQANPQVLQPMLQELGKQNPNLVRLIQEHQTEFDQLLNEPV  306

Query  478  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  299
            EG EGN+LGQLA +MPQA+QVTPEE   IERLEAMGF+R+ VLE++FACNKNEEL ANYL
Sbjct  307  EGKEGNLLGQLAGAMPQAIQVTPEEHATIERLEAMGFERSTVLELYFACNKNEELTANYL  366

Query  298  LDHMHEF  278
            LDHMHEF
Sbjct  367  LDHMHEF  373



>ref|XP_010681564.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=392

 Score =   216 bits (549),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 100/127 (79%), Positives = 116/127 (91%), Gaps = 0/127 (0%)
 Frame = -2

Query  658  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  479
            +  L+FLRNS+QFQALRAMVQANPQ+LQPMLQELGKQNP+L+RLIQEHQ +F +L+NEPV
Sbjct  266  SGALDFLRNSEQFQALRAMVQANPQVLQPMLQELGKQNPNLVRLIQEHQTEFDQLLNEPV  325

Query  478  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  299
            EG EGN+LGQLA +MPQA+QVTPEE   IERLEAMGF+R+ VLE++FACNKNEEL ANYL
Sbjct  326  EGKEGNLLGQLAGAMPQAIQVTPEEHATIERLEAMGFERSTVLELYFACNKNEELTANYL  385

Query  298  LDHMHEF  278
            LDHMHEF
Sbjct  386  LDHMHEF  392



>ref|XP_010681565.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X3 [Beta vulgaris 
subsp. vulgaris]
Length=376

 Score =   215 bits (548),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 100/127 (79%), Positives = 116/127 (91%), Gaps = 0/127 (0%)
 Frame = -2

Query  658  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  479
            +  L+FLRNS+QFQALRAMVQANPQ+LQPMLQELGKQNP+L+RLIQEHQ +F +L+NEPV
Sbjct  250  SGALDFLRNSEQFQALRAMVQANPQVLQPMLQELGKQNPNLVRLIQEHQTEFDQLLNEPV  309

Query  478  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  299
            EG EGN+LGQLA +MPQA+QVTPEE   IERLEAMGF+R+ VLE++FACNKNEEL ANYL
Sbjct  310  EGKEGNLLGQLAGAMPQAIQVTPEEHATIERLEAMGFERSTVLELYFACNKNEELTANYL  369

Query  298  LDHMHEF  278
            LDHMHEF
Sbjct  370  LDHMHEF  376



>ref|XP_008368492.1| PREDICTED: ubiquitin receptor RAD23d-like [Malus domestica]
Length=111

 Score =   206 bits (524),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 101/111 (91%), Positives = 107/111 (96%), Gaps = 0/111 (0%)
 Frame = -2

Query  604  MVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQA  425
            MVQANPQILQPMLQELGKQNPHLM+LIQ HQADFLRLINEPVEGGEGN+L QL A++PQA
Sbjct  1    MVQANPQILQPMLQELGKQNPHLMQLIQAHQADFLRLINEPVEGGEGNLLEQLGAAVPQA  60

Query  424  VQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  272
            V VTPEEREAIERLEAMGFDRALVLEV+FACNKNEELAANYLLDHMHEFE+
Sbjct  61   VTVTPEEREAIERLEAMGFDRALVLEVYFACNKNEELAANYLLDHMHEFEE  111



>ref|XP_010681563.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=395

 Score =   215 bits (548),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 100/127 (79%), Positives = 116/127 (91%), Gaps = 0/127 (0%)
 Frame = -2

Query  658  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  479
            +  L+FLRNS+QFQALRAMVQANPQ+LQPMLQELGKQNP+L+RLIQEHQ +F +L+NEPV
Sbjct  269  SGALDFLRNSEQFQALRAMVQANPQVLQPMLQELGKQNPNLVRLIQEHQTEFDQLLNEPV  328

Query  478  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  299
            EG EGN+LGQLA +MPQA+QVTPEE   IERLEAMGF+R+ VLE++FACNKNEEL ANYL
Sbjct  329  EGKEGNLLGQLAGAMPQAIQVTPEEHATIERLEAMGFERSTVLELYFACNKNEELTANYL  388

Query  298  LDHMHEF  278
            LDHMHEF
Sbjct  389  LDHMHEF  395



>ref|XP_010926132.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Elaeis 
guineensis]
Length=422

 Score =   215 bits (547),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 109/157 (69%), Positives = 120/157 (76%), Gaps = 26/157 (17%)
 Frame = -2

Query  664  GGANTLEFLRNSQQFQALRAMVQANPQILQ--------------------------PMLQ  563
              A +L+FLRNS QF+AL+ +VQANPQILQ                          PMLQ
Sbjct  266  ASAGSLDFLRNSPQFRALQTLVQANPQILQVASHSLPHKMFLLYFSLTLFSIFFSQPMLQ  325

Query  562  ELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERL  383
            ELGKQNP +MRLIQEHQA+FLRL+NEP EG E N+LGQLA +MPQA+ VTPEEREAIERL
Sbjct  326  ELGKQNPQVMRLIQEHQAEFLRLLNEPAEGAESNLLGQLAGAMPQALTVTPEEREAIERL  385

Query  382  EAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  272
            EAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  386  EAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  422



>ref|XP_010926133.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Elaeis 
guineensis]
Length=421

 Score =   215 bits (547),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 109/157 (69%), Positives = 120/157 (76%), Gaps = 26/157 (17%)
 Frame = -2

Query  664  GGANTLEFLRNSQQFQALRAMVQANPQILQ--------------------------PMLQ  563
              A +L+FLRNS QF+AL+ +VQANPQILQ                          PMLQ
Sbjct  265  ASAGSLDFLRNSPQFRALQTLVQANPQILQVASHSLPHKMFLLYFSLTLFSIFFSQPMLQ  324

Query  562  ELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERL  383
            ELGKQNP +MRLIQEHQA+FLRL+NEP EG E N+LGQLA +MPQA+ VTPEEREAIERL
Sbjct  325  ELGKQNPQVMRLIQEHQAEFLRLLNEPAEGAESNLLGQLAGAMPQALTVTPEEREAIERL  384

Query  382  EAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  272
            EAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  385  EAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  421



>ref|XP_008341883.1| PREDICTED: ubiquitin receptor RAD23d-like [Malus domestica]
Length=408

 Score =   213 bits (542),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 106/130 (82%), Positives = 115/130 (88%), Gaps = 1/130 (1%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
            GA  L+FLRNS QFQALRAMVQANPQILQPMLQELGKQNPHLM+LIQ HQADFLRLINEP
Sbjct  260  GAGNLDFLRNSPQFQALRAMVQANPQILQPMLQELGKQNPHLMQLIQAHQADFLRLINEP  319

Query  481  VEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAA-N  305
            VEGGEGN+L QL A++PQAV VTPEEREAIERLEAMGFDRALV EV+FACNKNEELA+  
Sbjct  320  VEGGEGNLLEQLGAAVPQAVTVTPEEREAIERLEAMGFDRALVPEVYFACNKNEELASIP  379

Query  304  YLLDHMHEFE  275
            +L    H+F 
Sbjct  380  FLCLGWHKFS  389



>gb|ACN40029.1| unknown [Picea sitchensis]
Length=403

 Score =   210 bits (535),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -2

Query  646  EFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  467
            +FLRN+ QFQALR MVQANPQILQPMLQEL KQNP LMRLIQ+HQADFLRL+NEPVEG E
Sbjct  279  DFLRNNPQFQALRTMVQANPQILQPMLQELSKQNPQLMRLIQDHQADFLRLVNEPVEGAE  338

Query  466  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  287
            G+   QLA +MPQA+ VTPEEREAIERLEAMGFDRALV+E F AC+KNE+LAANYLL+H 
Sbjct  339  GDFFNQLAGAMPQAINVTPEEREAIERLEAMGFDRALVIEAFLACDKNEQLAANYLLEHA  398

Query  286  HEFED  272
             ++ED
Sbjct  399  GDYED  403



>ref|XP_004489115.1| PREDICTED: putative DNA repair protein RAD23-4-like [Cicer arietinum]
Length=377

 Score =   209 bits (533),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 103/129 (80%), Positives = 112/129 (87%), Gaps = 2/129 (2%)
 Frame = -2

Query  658  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  479
            A  LEFLRNS QFQALR MVQANPQILQPMLQELGKQNPHLM LIQEHQADFLRLINEP 
Sbjct  251  AGDLEFLRNSPQFQALRTMVQANPQILQPMLQELGKQNPHLMELIQEHQADFLRLINEP-  309

Query  478  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  299
             GGE N+  QL A++PQ + +TPEE EAI+RLE MGFDR LVLEVFFACNKNE+LAANYL
Sbjct  310  -GGEENLESQLGAAVPQTITITPEEHEAIQRLEDMGFDRDLVLEVFFACNKNEDLAANYL  368

Query  298  LDHMHEFED  272
            LDH +EF+D
Sbjct  369  LDHQNEFDD  377



>gb|KEH21499.1| RAD23 UV excision repair family protein [Medicago truncatula]
Length=370

 Score =   208 bits (530),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 104/129 (81%), Positives = 112/129 (87%), Gaps = 2/129 (2%)
 Frame = -2

Query  658  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  479
            A  LEFLRNSQQFQALR MVQANPQILQPMLQELGKQNP+LM LIQEHQADFLRLINEP 
Sbjct  244  AGDLEFLRNSQQFQALRTMVQANPQILQPMLQELGKQNPNLMELIQEHQADFLRLINEP-  302

Query  478  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  299
             GGE N+ GQL A  PQ + +TPEE EAI+RLE MGFDR LVLEVFFACNKNE+LAANYL
Sbjct  303  -GGEENLEGQLGALAPQTITITPEENEAIQRLEDMGFDRDLVLEVFFACNKNEDLAANYL  361

Query  298  LDHMHEFED  272
            LDH +EF+D
Sbjct  362  LDHQNEFDD  370



>ref|XP_004304134.1| PREDICTED: ubiquitin receptor RAD23d-like [Fragaria vesca subsp. 
vesca]
Length=390

 Score =   207 bits (528),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 106/133 (80%), Positives = 114/133 (86%), Gaps = 2/133 (2%)
 Frame = -2

Query  664  GGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE  485
             GA  L+FLRNS QFQALR MVQANPQILQPML ELGKQNPHLM+LIQ HQADFLRLINE
Sbjct  258  AGAGNLDFLRNSPQFQALRTMVQANPQILQPMLLELGKQNPHLMQLIQAHQADFLRLINE  317

Query  484  PV--EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELA  311
            PV   G    +    +A+MPQAV VTPEEREAIERLEAMGF+RALVLEV+FACNKNEELA
Sbjct  318  PVEGGGEGNLLGQLGSAAMPQAVTVTPEEREAIERLEAMGFERALVLEVYFACNKNEELA  377

Query  310  ANYLLDHMHEFED  272
            ANYLLDHMHEFE+
Sbjct  378  ANYLLDHMHEFEE  390



>gb|KJB69954.1| hypothetical protein B456_011G053200 [Gossypium raimondii]
Length=317

 Score =   201 bits (510),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 112/131 (85%), Gaps = 0/131 (0%)
 Frame = -2

Query  664  GGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE  485
            GG  +L+FLRN+QQFQALR MVQ+NPQILQPMLQELGKQNP L+RLIQEH A+FL+LINE
Sbjct  187  GGDGSLDFLRNNQQFQALRTMVQSNPQILQPMLQELGKQNPQLLRLIQEHHAEFLQLINE  246

Query  484  PVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  305
            P+EG EG+I  Q    MP A+ VTP E+EAIERLEAMGFDRALV+E F AC++NEELAAN
Sbjct  247  PLEGSEGDIFDQAEQEMPHAINVTPAEQEAIERLEAMGFDRALVIEAFLACDRNEELAAN  306

Query  304  YLLDHMHEFED  272
            YLL++  +FED
Sbjct  307  YLLENGGDFED  317



>gb|KHG09850.1| Putative DNA repair RAD23-1 -like protein [Gossypium arboreum]
Length=362

 Score =   201 bits (512),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 96/131 (73%), Positives = 113/131 (86%), Gaps = 0/131 (0%)
 Frame = -2

Query  664  GGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE  485
            GG  +L+FLRN+QQFQALR+MVQ+NPQILQPMLQELGKQNP L+RLIQEH A+FL+LINE
Sbjct  232  GGDGSLDFLRNNQQFQALRSMVQSNPQILQPMLQELGKQNPQLLRLIQEHHAEFLQLINE  291

Query  484  PVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  305
            P+EG EG+I  Q    MP AV VTP E+EAIERLEAMGFDRALV+E F AC++NEELAAN
Sbjct  292  PLEGSEGDIFDQAEQEMPHAVNVTPAEQEAIERLEAMGFDRALVIEAFLACDRNEELAAN  351

Query  304  YLLDHMHEFED  272
            YLL++  +FED
Sbjct  352  YLLENGGDFED  362



>ref|XP_006427690.1| hypothetical protein CICLE_v100258682mg, partial [Citrus clementina]
 gb|ESR40930.1| hypothetical protein CICLE_v100258682mg, partial [Citrus clementina]
Length=301

 Score =   199 bits (506),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 93/131 (71%), Positives = 113/131 (86%), Gaps = 0/131 (0%)
 Frame = -2

Query  664  GGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE  485
            GG  +L+FLRN+QQFQALR+MVQ+NPQILQPMLQELGKQNP L+RLIQEHQ +FL+LINE
Sbjct  171  GGLGSLDFLRNNQQFQALRSMVQSNPQILQPMLQELGKQNPQLLRLIQEHQTEFLQLINE  230

Query  484  PVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  305
            PV+G EG++  Q    MP A+ VTP E+EAI+RLEAMGFDRALV+E F AC++NEELAAN
Sbjct  231  PVDGSEGDMFDQPEQDMPHAINVTPAEQEAIQRLEAMGFDRALVIEAFLACDRNEELAAN  290

Query  304  YLLDHMHEFED  272
            YLL++  +FED
Sbjct  291  YLLENAGDFED  301



>ref|XP_010107189.1| Putative DNA repair protein RAD23-1 [Morus notabilis]
 gb|EXC14085.1| Putative DNA repair protein RAD23-1 [Morus notabilis]
Length=421

 Score =   202 bits (515),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 95/127 (75%), Positives = 112/127 (88%), Gaps = 0/127 (0%)
 Frame = -2

Query  652  TLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEG  473
            +L+FLRN+QQFQ LR+MVQANPQILQPMLQELGKQNP L+RLIQEHQA+FL+LINEP+EG
Sbjct  295  SLDFLRNNQQFQTLRSMVQANPQILQPMLQELGKQNPQLLRLIQEHQAEFLQLINEPLEG  354

Query  472  GEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLD  293
             EG+I  Q    MP A+ VTPEE+EAIERLEAMGFDRALV+E + AC++NEELAANYLL+
Sbjct  355  SEGDIFDQPEQDMPHAINVTPEEQEAIERLEAMGFDRALVIEAYLACDRNEELAANYLLE  414

Query  292  HMHEFED  272
            H  +FED
Sbjct  415  HAGDFED  421



>gb|KJB69952.1| hypothetical protein B456_011G053200 [Gossypium raimondii]
 gb|KJB69955.1| hypothetical protein B456_011G053200 [Gossypium raimondii]
Length=362

 Score =   201 bits (510),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 112/131 (85%), Gaps = 0/131 (0%)
 Frame = -2

Query  664  GGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE  485
            GG  +L+FLRN+QQFQALR MVQ+NPQILQPMLQELGKQNP L+RLIQEH A+FL+LINE
Sbjct  232  GGDGSLDFLRNNQQFQALRTMVQSNPQILQPMLQELGKQNPQLLRLIQEHHAEFLQLINE  291

Query  484  PVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  305
            P+EG EG+I  Q    MP A+ VTP E+EAIERLEAMGFDRALV+E F AC++NEELAAN
Sbjct  292  PLEGSEGDIFDQAEQEMPHAINVTPAEQEAIERLEAMGFDRALVIEAFLACDRNEELAAN  351

Query  304  YLLDHMHEFED  272
            YLL++  +FED
Sbjct  352  YLLENGGDFED  362



>ref|XP_010034056.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X2 [Eucalyptus 
grandis]
 gb|KCW53927.1| hypothetical protein EUGRSUZ_J03137 [Eucalyptus grandis]
Length=387

 Score =   201 bits (511),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 95/127 (75%), Positives = 111/127 (87%), Gaps = 0/127 (0%)
 Frame = -2

Query  652  TLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEG  473
            TL+FLRN+QQFQALR+MVQANPQILQPMLQELGKQNP L+RLIQEH A+FL+LINEP++G
Sbjct  261  TLDFLRNNQQFQALRSMVQANPQILQPMLQELGKQNPQLLRLIQEHHAEFLQLINEPLDG  320

Query  472  GEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLD  293
             EG+I  Q    MP A+ VTP E+EAIERLEAMGFDRALV+E F AC++NEELAANYLL+
Sbjct  321  SEGDIFDQPDQDMPHAINVTPAEQEAIERLEAMGFDRALVIEAFLACDRNEELAANYLLE  380

Query  292  HMHEFED  272
            H  +FED
Sbjct  381  HAGDFED  387



>ref|XP_010034055.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW53928.1| hypothetical protein EUGRSUZ_J03137 [Eucalyptus grandis]
Length=388

 Score =   201 bits (511),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/127 (75%), Positives = 111/127 (87%), Gaps = 0/127 (0%)
 Frame = -2

Query  652  TLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEG  473
            TL+FLRN+QQFQALR+MVQANPQILQPMLQELGKQNP L+RLIQEH A+FL+LINEP++G
Sbjct  262  TLDFLRNNQQFQALRSMVQANPQILQPMLQELGKQNPQLLRLIQEHHAEFLQLINEPLDG  321

Query  472  GEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLD  293
             EG+I  Q    MP A+ VTP E+EAIERLEAMGFDRALV+E F AC++NEELAANYLL+
Sbjct  322  SEGDIFDQPDQDMPHAINVTPAEQEAIERLEAMGFDRALVIEAFLACDRNEELAANYLLE  381

Query  292  HMHEFED  272
            H  +FED
Sbjct  382  HAGDFED  388



>ref|XP_010034057.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X3 [Eucalyptus 
grandis]
Length=374

 Score =   201 bits (510),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/127 (75%), Positives = 111/127 (87%), Gaps = 0/127 (0%)
 Frame = -2

Query  652  TLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEG  473
            TL+FLRN+QQFQALR+MVQANPQILQPMLQELGKQNP L+RLIQEH A+FL+LINEP++G
Sbjct  248  TLDFLRNNQQFQALRSMVQANPQILQPMLQELGKQNPQLLRLIQEHHAEFLQLINEPLDG  307

Query  472  GEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLD  293
             EG+I  Q    MP A+ VTP E+EAIERLEAMGFDRALV+E F AC++NEELAANYLL+
Sbjct  308  SEGDIFDQPDQDMPHAINVTPAEQEAIERLEAMGFDRALVIEAFLACDRNEELAANYLLE  367

Query  292  HMHEFED  272
            H  +FED
Sbjct  368  HAGDFED  374



>gb|KJB34920.1| hypothetical protein B456_006G091100 [Gossypium raimondii]
Length=373

 Score =   201 bits (510),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 94/131 (72%), Positives = 113/131 (86%), Gaps = 0/131 (0%)
 Frame = -2

Query  664  GGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE  485
            GG  +L+FLRN+QQFQALR+MVQ+NPQILQPMLQELGKQNP L+RLIQEH A+FL+LINE
Sbjct  243  GGLGSLDFLRNNQQFQALRSMVQSNPQILQPMLQELGKQNPQLLRLIQEHHAEFLQLINE  302

Query  484  PVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  305
            P++G EG+I  Q    MP A+ VTP E+EAIERLEAMGFDRALV+E F AC++NEELAAN
Sbjct  303  PLQGSEGDIFDQAEQEMPHAINVTPAEQEAIERLEAMGFDRALVIEAFLACDRNEELAAN  362

Query  304  YLLDHMHEFED  272
            YLL++  +FED
Sbjct  363  YLLENSGDFED  373



>ref|XP_010034058.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X4 [Eucalyptus 
grandis]
 gb|KCW53926.1| hypothetical protein EUGRSUZ_J03137 [Eucalyptus grandis]
Length=373

 Score =   200 bits (509),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/127 (75%), Positives = 111/127 (87%), Gaps = 0/127 (0%)
 Frame = -2

Query  652  TLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEG  473
            TL+FLRN+QQFQALR+MVQANPQILQPMLQELGKQNP L+RLIQEH A+FL+LINEP++G
Sbjct  247  TLDFLRNNQQFQALRSMVQANPQILQPMLQELGKQNPQLLRLIQEHHAEFLQLINEPLDG  306

Query  472  GEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLD  293
             EG+I  Q    MP A+ VTP E+EAIERLEAMGFDRALV+E F AC++NEELAANYLL+
Sbjct  307  SEGDIFDQPDQDMPHAINVTPAEQEAIERLEAMGFDRALVIEAFLACDRNEELAANYLLE  366

Query  292  HMHEFED  272
            H  +FED
Sbjct  367  HAGDFED  373



>ref|XP_006655985.1| PREDICTED: ubiquitin receptor RAD23c-like [Oryza brachyantha]
Length=409

 Score =   201 bits (512),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 101/127 (80%), Positives = 113/127 (89%), Gaps = 1/127 (1%)
 Frame = -2

Query  649  LEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE-PVEG  473
            L+ LR   QFQAL A+VQANPQILQPMLQELGKQNP ++RLIQE+QA+FLRL+NE P  G
Sbjct  281  LDALRQLPQFQALLALVQANPQILQPMLQELGKQNPQILRLIQENQAEFLRLVNESPDSG  340

Query  472  GEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLD  293
              GNILGQLAA+MPQA+ VTPEEREAI+RLEAMGF+R LVLEVFFACNK+EELAANYLLD
Sbjct  341  TGGNILGQLAAAMPQALTVTPEEREAIQRLEAMGFNRELVLEVFFACNKDEELAANYLLD  400

Query  292  HMHEFED  272
            H HEFED
Sbjct  401  HGHEFED  407



>gb|EAZ07072.1| hypothetical protein OsI_29318 [Oryza sativa Indica Group]
Length=406

 Score =   201 bits (511),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 114/131 (87%), Gaps = 1/131 (1%)
 Frame = -2

Query  664  GGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE  485
            GG N L+ LRN+ QF+ L ++VQANPQILQP+LQELGKQNP +++LIQE+QA+FLRLINE
Sbjct  270  GGGN-LDVLRNNSQFRGLLSLVQANPQILQPLLQELGKQNPQILQLIQENQAEFLRLINE  328

Query  484  PVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  305
            P EG EGN+L Q AA MPQ V VTPEE EAI+RLE MGFDR LVLEVFFACNK+E+LAAN
Sbjct  329  PAEGAEGNLLDQFAAGMPQTVAVTPEENEAIQRLEQMGFDRDLVLEVFFACNKDEQLAAN  388

Query  304  YLLDHMHEFED  272
            YLLDHM+EF+D
Sbjct  389  YLLDHMNEFDD  399



>gb|ABK24371.1| unknown [Picea sitchensis]
Length=390

 Score =   199 bits (507),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 110/131 (84%), Gaps = 3/131 (2%)
 Frame = -2

Query  664  GGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE  485
             G   L+FLRN+ QFQALR MVQANPQILQPMLQEL KQNP LMRLIQ+HQA+FL LINE
Sbjct  263  AGGGALDFLRNNPQFQALRTMVQANPQILQPMLQELSKQNPQLMRLIQDHQAEFLHLINE  322

Query  484  PVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  305
              EG   ++LGQ AA MPQ++ VTPEEREAIERLEAMGFDRALV+E F AC+KNEELAAN
Sbjct  323  ETEG---DLLGQFAAEMPQSINVTPEEREAIERLEAMGFDRALVIEAFLACDKNEELAAN  379

Query  304  YLLDHMHEFED  272
            YLL+H  ++ED
Sbjct  380  YLLEHAADYED  390



>gb|KJB34921.1| hypothetical protein B456_006G091100 [Gossypium raimondii]
Length=305

 Score =   197 bits (500),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 94/131 (72%), Positives = 113/131 (86%), Gaps = 0/131 (0%)
 Frame = -2

Query  664  GGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE  485
            GG  +L+FLRN+QQFQALR+MVQ+NPQILQPMLQELGKQNP L+RLIQEH A+FL+LINE
Sbjct  175  GGLGSLDFLRNNQQFQALRSMVQSNPQILQPMLQELGKQNPQLLRLIQEHHAEFLQLINE  234

Query  484  PVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  305
            P++G EG+I  Q    MP A+ VTP E+EAIERLEAMGFDRALV+E F AC++NEELAAN
Sbjct  235  PLQGSEGDIFDQAEQEMPHAINVTPAEQEAIERLEAMGFDRALVIEAFLACDRNEELAAN  294

Query  304  YLLDHMHEFED  272
            YLL++  +FED
Sbjct  295  YLLENSGDFED  305



>ref|XP_006845449.1| hypothetical protein AMTR_s00019p00116110 [Amborella trichopoda]
 gb|ERN07124.1| hypothetical protein AMTR_s00019p00116110 [Amborella trichopoda]
Length=370

 Score =   199 bits (505),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 93/130 (72%), Positives = 111/130 (85%), Gaps = 0/130 (0%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
            G  +L+FLRN++QFQ LR MVQANPQILQPMLQEL KQNP L+RLIQEHQA+FL+LINEP
Sbjct  241  GGGSLDFLRNNEQFQTLRHMVQANPQILQPMLQELSKQNPQLLRLIQEHQAEFLQLINEP  300

Query  481  VEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  302
             EG EG++ GQ    MPQ++ VTPEEREAIERLEAMGFDRALV+E F AC++NEELA NY
Sbjct  301  AEGAEGDLFGQAEQDMPQSITVTPEEREAIERLEAMGFDRALVIEAFLACDRNEELAINY  360

Query  301  LLDHMHEFED  272
            LL++  ++ED
Sbjct  361  LLENPGDYED  370



>ref|XP_006493449.1| PREDICTED: ubiquitin receptor RAD23b-like [Citrus sinensis]
Length=377

 Score =   199 bits (505),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 93/131 (71%), Positives = 113/131 (86%), Gaps = 0/131 (0%)
 Frame = -2

Query  664  GGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE  485
             G  +L+FLRN+QQFQALR+MVQ+NPQILQPMLQELGKQNP L+RLIQEHQA+FL+LINE
Sbjct  247  SGLGSLDFLRNNQQFQALRSMVQSNPQILQPMLQELGKQNPQLLRLIQEHQAEFLQLINE  306

Query  484  PVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  305
            PV+G EG++  Q    MP A+ VTP E+EAI+RLEAMGFDRALV+E F AC++NEELAAN
Sbjct  307  PVDGSEGDMFDQPEQDMPHAINVTPAEQEAIQRLEAMGFDRALVIEAFLACDRNEELAAN  366

Query  304  YLLDHMHEFED  272
            YLL++  +FED
Sbjct  367  YLLENAGDFED  377



>ref|NP_001061854.1| Os08g0430200 [Oryza sativa Japonica Group]
 dbj|BAD01169.1| putative osRAD23 [Oryza sativa Japonica Group]
 dbj|BAF23768.1| Os08g0430200 [Oryza sativa Japonica Group]
 gb|EAZ42817.1| hypothetical protein OsJ_27402 [Oryza sativa Japonica Group]
 dbj|BAG89255.1| unnamed protein product [Oryza sativa Japonica Group]
Length=406

 Score =   199 bits (507),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 113/131 (86%), Gaps = 1/131 (1%)
 Frame = -2

Query  664  GGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE  485
            GG N L+ LRN+ QF+ L ++VQANPQILQP+LQELGKQNP +++LIQE+QA+FLRLINE
Sbjct  270  GGGN-LDVLRNNSQFRGLLSLVQANPQILQPLLQELGKQNPQILQLIQENQAEFLRLINE  328

Query  484  PVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  305
            P EG EGN+L Q AA MPQ V VTPEE EAI+RLE MGFDR LVLEVFFACNK+E LAAN
Sbjct  329  PAEGAEGNLLDQFAAGMPQTVAVTPEENEAIQRLEQMGFDRDLVLEVFFACNKDELLAAN  388

Query  304  YLLDHMHEFED  272
            YLLDHM+EF+D
Sbjct  389  YLLDHMNEFDD  399



>ref|XP_004965183.1| PREDICTED: putative DNA repair protein RAD23-3-like [Setaria 
italica]
Length=410

 Score =   199 bits (506),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 100/127 (79%), Positives = 113/127 (89%), Gaps = 1/127 (1%)
 Frame = -2

Query  649  LEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGG  470
            L+ LR   QFQAL  +VQANPQILQPMLQELGKQNP ++RLIQE+QA+FLRL+NE  EGG
Sbjct  281  LDALRQLPQFQALLQLVQANPQILQPMLQELGKQNPQILRLIQENQAEFLRLVNESPEGG  340

Query  469  EG-NILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLD  293
             G NILGQLAA+MPQAVQVTPEEREAI+RLE MGF+R LVLEVFFACNK+EELAANYLLD
Sbjct  341  AGGNILGQLAAAMPQAVQVTPEEREAIQRLEGMGFNRELVLEVFFACNKDEELAANYLLD  400

Query  292  HMHEFED  272
            H HEF++
Sbjct  401  HGHEFDE  407



>gb|EAZ00429.1| hypothetical protein OsI_22453 [Oryza sativa Indica Group]
Length=413

 Score =   199 bits (506),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 100/128 (78%), Positives = 113/128 (88%), Gaps = 2/128 (2%)
 Frame = -2

Query  649  LEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGG  470
            L+ LR   QFQAL A+VQANPQILQPMLQELGKQNP ++RLIQE+QA+FLRL+NE  + G
Sbjct  284  LDALRQLPQFQALLALVQANPQILQPMLQELGKQNPQILRLIQENQAEFLRLVNESPDSG  343

Query  469  E--GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLL  296
               GNILGQLAA+MPQA+ VTPEEREAI+RLEAMGF+R LVLEVFFACNK+EELAANYLL
Sbjct  344  TAGGNILGQLAAAMPQALTVTPEEREAIQRLEAMGFNRELVLEVFFACNKDEELAANYLL  403

Query  295  DHMHEFED  272
            DH HEFED
Sbjct  404  DHGHEFED  411



>gb|ACG32894.1| DNA repair protein RAD23 [Zea mays]
Length=402

 Score =   199 bits (505),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 114/131 (87%), Gaps = 1/131 (1%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
            G+  L+ LR   QFQAL  +VQANPQILQPMLQELGKQNP ++RLIQE+QA+F+RL+NE 
Sbjct  269  GSGALDALRQLPQFQALLQLVQANPQILQPMLQELGKQNPQILRLIQENQAEFVRLVNET  328

Query  481  VEGGEG-NILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  305
             EGG G NILGQLAA+MPQ+V VTPEEREAI+RLE MGF+R LVLEVFFACNK+EELAAN
Sbjct  329  PEGGPGGNILGQLAAAMPQSVTVTPEEREAIQRLEGMGFNRELVLEVFFACNKDEELAAN  388

Query  304  YLLDHMHEFED  272
            YLLDH HEF++
Sbjct  389  YLLDHGHEFDE  399



>ref|NP_001057334.1| Os06g0264300 [Oryza sativa Japonica Group]
 dbj|BAD54365.1| putative RAD23 protein [Oryza sativa Japonica Group]
 dbj|BAD54370.1| putative RAD23 protein [Oryza sativa Japonica Group]
 dbj|BAF19248.1| Os06g0264300 [Oryza sativa Japonica Group]
 gb|EAZ36555.1| hypothetical protein OsJ_20893 [Oryza sativa Japonica Group]
 dbj|BAG88004.1| unnamed protein product [Oryza sativa Japonica Group]
Length=413

 Score =   199 bits (505),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 100/128 (78%), Positives = 113/128 (88%), Gaps = 2/128 (2%)
 Frame = -2

Query  649  LEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGG  470
            L+ LR   QFQAL A+VQANPQILQPMLQELGKQNP ++RLIQE+QA+FLRL+NE  + G
Sbjct  284  LDALRQLPQFQALLALVQANPQILQPMLQELGKQNPQILRLIQENQAEFLRLVNESPDSG  343

Query  469  E--GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLL  296
               GNILGQLAA+MPQA+ VTPEEREAI+RLEAMGF+R LVLEVFFACNK+EELAANYLL
Sbjct  344  AAGGNILGQLAAAMPQALTVTPEEREAIQRLEAMGFNRELVLEVFFACNKDEELAANYLL  403

Query  295  DHMHEFED  272
            DH HEFED
Sbjct  404  DHGHEFED  411



>gb|KHG13236.1| Putative DNA repair RAD23-1 -like protein [Gossypium arboreum]
Length=373

 Score =   197 bits (501),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/131 (71%), Positives = 112/131 (85%), Gaps = 0/131 (0%)
 Frame = -2

Query  664  GGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE  485
            GG  +L+FLRN+QQFQALR+MVQ+NPQILQPML ELGKQNP L+RLIQEH A+FL+LINE
Sbjct  243  GGLGSLDFLRNNQQFQALRSMVQSNPQILQPMLLELGKQNPQLLRLIQEHHAEFLQLINE  302

Query  484  PVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  305
            P++G EG+I  Q    MP A+ VTP E+EAIERLEAMGFDRALV+E F AC++NEELAAN
Sbjct  303  PLQGSEGDIFDQAEQEMPHAINVTPAEQEAIERLEAMGFDRALVIEAFLACDRNEELAAN  362

Query  304  YLLDHMHEFED  272
            YLL++  +FED
Sbjct  363  YLLENSGDFED  373



>gb|ACH72675.1| RAD23 [Pinus sylvestris var. mongolica]
Length=390

 Score =   197 bits (502),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 109/126 (87%), Gaps = 3/126 (2%)
 Frame = -2

Query  649  LEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGG  470
            L+FLRN+ QFQALR MVQANPQILQPMLQEL KQNP LMRLIQ+HQA+FL LINE  +G 
Sbjct  268  LDFLRNNPQFQALRTMVQANPQILQPMLQELSKQNPQLMRLIQDHQAEFLHLINEETDG-  326

Query  469  EGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDH  290
              ++LGQ AA MPQ++ VTPEEREAIERLEAMGFDRALV+E F AC+KNEELAANYLL+H
Sbjct  327  --DLLGQFAAEMPQSINVTPEEREAIERLEAMGFDRALVIEAFLACDKNEELAANYLLEH  384

Query  289  MHEFED  272
              ++ED
Sbjct  385  AADYED  390



>dbj|BAJ98767.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=414

 Score =   197 bits (502),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 98/124 (79%), Positives = 110/124 (89%), Gaps = 1/124 (1%)
 Frame = -2

Query  640  LRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE-PVEGGEG  464
            LR   QFQAL A+VQANPQILQPMLQELGKQNP ++RLIQE+QA+FLRL+NE P  G  G
Sbjct  289  LRQLPQFQALLALVQANPQILQPMLQELGKQNPQILRLIQENQAEFLRLVNETPESGAGG  348

Query  463  NILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMH  284
            NILG LAA MPQAVQVTPEEREAI+RLE+MGF+R LVLEVFFACN++EELAANYLLDH H
Sbjct  349  NILGALAAQMPQAVQVTPEEREAIQRLESMGFNRELVLEVFFACNRDEELAANYLLDHGH  408

Query  283  EFED  272
            EFE+
Sbjct  409  EFEE  412



>ref|XP_007024818.1| Rad23 UV excision repair protein family isoform 1 [Theobroma 
cacao]
 gb|EOY27440.1| Rad23 UV excision repair protein family isoform 1 [Theobroma 
cacao]
Length=373

 Score =   196 bits (499),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 109/125 (87%), Gaps = 0/125 (0%)
 Frame = -2

Query  646  EFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  467
            +FLRN+QQFQALR+MVQ+NPQILQPMLQELGKQNP L+RLIQEH A+FL+LINEP+EG E
Sbjct  249  DFLRNNQQFQALRSMVQSNPQILQPMLQELGKQNPQLLRLIQEHHAEFLQLINEPLEGSE  308

Query  466  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  287
            G+I  Q    MP A+ VTP E+EAIERLEAMGFDRALV+E F AC++NEELAANYLL++ 
Sbjct  309  GDIFDQAEQDMPHAINVTPAEQEAIERLEAMGFDRALVIEAFLACDRNEELAANYLLENA  368

Query  286  HEFED  272
             +FED
Sbjct  369  GDFED  373



>ref|XP_009797066.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X3 [Nicotiana 
sylvestris]
Length=296

 Score =   194 bits (493),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 89/127 (70%), Positives = 110/127 (87%), Gaps = 0/127 (0%)
 Frame = -2

Query  652  TLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEG  473
            +L+FLRN+QQFQALR+MVQ+NPQILQPMLQELGKQNP L+R+IQEH  +FL+LINEPV+G
Sbjct  170  SLDFLRNNQQFQALRSMVQSNPQILQPMLQELGKQNPQLLRMIQEHHQEFLQLINEPVDG  229

Query  472  GEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLD  293
             +G++  Q    MP  V VTP+E+EAIERLEAMGFDRALV+E F AC++NEELAANYLL+
Sbjct  230  SDGDLFDQPEQDMPHTVSVTPQEQEAIERLEAMGFDRALVIEAFLACDRNEELAANYLLE  289

Query  292  HMHEFED  272
            H  ++ED
Sbjct  290  HAGDYED  296



>gb|KDP41924.1| hypothetical protein JCGZ_26942 [Jatropha curcas]
Length=352

 Score =   195 bits (496),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = -2

Query  646  EFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  467
            +FLRN+QQFQALR+MVQANPQILQPMLQELGKQNP L+R+IQEH A+FL+LINEP+EG E
Sbjct  228  DFLRNNQQFQALRSMVQANPQILQPMLQELGKQNPQLLRMIQEHNAEFLQLINEPLEGSE  287

Query  466  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  287
            G+I  Q+   MP A+ VTP E+EAIERLEAMGFDRALV+E F AC++NEELAANYLL++ 
Sbjct  288  GDIFDQVDQDMPHAINVTPAEQEAIERLEAMGFDRALVIEAFLACDRNEELAANYLLENA  347

Query  286  HEFED  272
             +FED
Sbjct  348  GDFED  352



>ref|XP_009598522.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X2 [Nicotiana 
tomentosiformis]
Length=366

 Score =   195 bits (496),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 90/127 (71%), Positives = 110/127 (87%), Gaps = 0/127 (0%)
 Frame = -2

Query  652  TLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEG  473
            +L+FLRN+QQFQALR+MVQ+NPQILQPMLQELGKQNP L+R+IQEH  +FL+LINEPV+G
Sbjct  240  SLDFLRNNQQFQALRSMVQSNPQILQPMLQELGKQNPQLLRMIQEHHQEFLQLINEPVDG  299

Query  472  GEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLD  293
             +G+I  Q    MP  V VTP+E+EAIERLEAMGFDRALV+E F AC++NEELAANYLL+
Sbjct  300  SDGDIFDQPEQDMPHTVSVTPQEQEAIERLEAMGFDRALVIEAFLACDRNEELAANYLLE  359

Query  292  HMHEFED  272
            H  ++ED
Sbjct  360  HAGDYED  366



>ref|XP_009598520.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009598521.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X1 [Nicotiana 
tomentosiformis]
Length=367

 Score =   195 bits (496),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 90/127 (71%), Positives = 110/127 (87%), Gaps = 0/127 (0%)
 Frame = -2

Query  652  TLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEG  473
            +L+FLRN+QQFQALR+MVQ+NPQILQPMLQELGKQNP L+R+IQEH  +FL+LINEPV+G
Sbjct  241  SLDFLRNNQQFQALRSMVQSNPQILQPMLQELGKQNPQLLRMIQEHHQEFLQLINEPVDG  300

Query  472  GEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLD  293
             +G+I  Q    MP  V VTP+E+EAIERLEAMGFDRALV+E F AC++NEELAANYLL+
Sbjct  301  SDGDIFDQPEQDMPHTVSVTPQEQEAIERLEAMGFDRALVIEAFLACDRNEELAANYLLE  360

Query  292  HMHEFED  272
            H  ++ED
Sbjct  361  HAGDYED  367



>ref|NP_001149140.1| LOC100282762 [Zea mays]
 gb|ACG34344.1| DNA repair protein RAD23 [Zea mays]
Length=402

 Score =   196 bits (498),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 113/131 (86%), Gaps = 1/131 (1%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
            G+  L+ LR   QFQAL  +VQANPQILQPMLQELGKQNP ++RLIQE+QA+F+RL+NE 
Sbjct  269  GSGALDALRQLPQFQALLQLVQANPQILQPMLQELGKQNPQILRLIQENQAEFVRLVNET  328

Query  481  VEGGEG-NILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  305
             EGG G NILGQLAA+MPQ+V VTPEEREAI+RLE MGF+  LVLEVFFACNK+EELAAN
Sbjct  329  PEGGPGGNILGQLAAAMPQSVTVTPEEREAIQRLEGMGFNHELVLEVFFACNKDEELAAN  388

Query  304  YLLDHMHEFED  272
            YLLDH HEF++
Sbjct  389  YLLDHGHEFDE  399



>ref|XP_010246571.1| PREDICTED: ubiquitin receptor RAD23b-like [Nelumbo nucifera]
Length=378

 Score =   195 bits (496),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 92/127 (72%), Positives = 109/127 (86%), Gaps = 0/127 (0%)
 Frame = -2

Query  652  TLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEG  473
            +L+FLRNSQQFQALR+MVQANPQILQPMLQEL KQNP L+RLIQEH A+FL+LINEP+EG
Sbjct  252  SLDFLRNSQQFQALRSMVQANPQILQPMLQELSKQNPQLLRLIQEHHAEFLQLINEPLEG  311

Query  472  GEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLD  293
             EG++  Q    MP A+ VTP E+EAIERLEAMGFDRALV+E F AC++NEELA NYLL+
Sbjct  312  SEGDLFDQPEQDMPHAISVTPAEQEAIERLEAMGFDRALVIEAFLACDRNEELAVNYLLE  371

Query  292  HMHEFED  272
            +  +FED
Sbjct  372  NAGDFED  378



>gb|AFK37577.1| unknown [Lotus japonicus]
Length=376

 Score =   195 bits (496),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 100/129 (78%), Positives = 110/129 (85%), Gaps = 5/129 (4%)
 Frame = -2

Query  658  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  479
            A  L+FLRN+QQFQALRAMVQANPQILQPMLQELGKQNPHLM+LIQEHQ+DFL LINEP 
Sbjct  253  AGDLDFLRNNQQFQALRAMVQANPQILQPMLQELGKQNPHLMQLIQEHQSDFLNLINEP-  311

Query  478  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  299
            EG E      LAA M QA+ VTPEE EAI+RLE MGFDR LVLEVF ACN+NE+LAANYL
Sbjct  312  EGEE----NPLAAGMTQAITVTPEEDEAIQRLEDMGFDRDLVLEVFIACNRNEDLAANYL  367

Query  298  LDHMHEFED  272
            LDH +EF+D
Sbjct  368  LDHQNEFDD  376



>ref|XP_011020549.1| PREDICTED: ubiquitin receptor RAD23b-like [Populus euphratica]
Length=372

 Score =   195 bits (496),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 91/127 (72%), Positives = 111/127 (87%), Gaps = 0/127 (0%)
 Frame = -2

Query  652  TLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEG  473
            +L+FLRN+QQFQALR+MVQANPQILQPMLQELGKQNP L+R+IQEH A+FL+LINEP++G
Sbjct  246  SLDFLRNNQQFQALRSMVQANPQILQPMLQELGKQNPQLLRIIQEHHAEFLQLINEPLDG  305

Query  472  GEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLD  293
             EG+I  Q    MP A+ VTP E+EAIERLEAMGFDRALV+E F AC++NE+LAANYLL+
Sbjct  306  SEGDIFDQPDQDMPHAINVTPAEQEAIERLEAMGFDRALVIEAFLACDRNEQLAANYLLE  365

Query  292  HMHEFED  272
            +  +FED
Sbjct  366  NAGDFED  372



>gb|EMS61794.1| putative DNA repair protein RAD23 [Triticum urartu]
Length=424

 Score =   196 bits (499),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 98/124 (79%), Positives = 109/124 (88%), Gaps = 1/124 (1%)
 Frame = -2

Query  640  LRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE-PVEGGEG  464
            LR   QFQAL A+VQANPQILQPMLQELGKQNP ++RLIQE+QA+FLRL+NE P  G  G
Sbjct  299  LRQLPQFQALLALVQANPQILQPMLQELGKQNPQILRLIQENQAEFLRLVNETPESGAGG  358

Query  463  NILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMH  284
            NILG LAA MPQAVQVTPEEREAI+RLE MGF+R LVLEVFFACN++EELAANYLLDH H
Sbjct  359  NILGALAAQMPQAVQVTPEEREAIQRLEGMGFNRELVLEVFFACNRDEELAANYLLDHGH  418

Query  283  EFED  272
            EFE+
Sbjct  419  EFEE  422



>gb|EMT27109.1| Putative DNA repair protein RAD23 [Aegilops tauschii]
Length=423

 Score =   196 bits (499),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 98/124 (79%), Positives = 109/124 (88%), Gaps = 1/124 (1%)
 Frame = -2

Query  640  LRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE-PVEGGEG  464
            LR   QFQAL A+VQANPQILQPMLQELGKQNP ++RLIQE+QA+FLRL+NE P  G  G
Sbjct  298  LRQLPQFQALLALVQANPQILQPMLQELGKQNPQILRLIQENQAEFLRLVNETPESGAGG  357

Query  463  NILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMH  284
            NILG LAA MPQAVQVTPEEREAI+RLE MGF+R LVLEVFFACN++EELAANYLLDH H
Sbjct  358  NILGALAAQMPQAVQVTPEEREAIQRLEGMGFNRELVLEVFFACNRDEELAANYLLDHGH  417

Query  283  EFED  272
            EFE+
Sbjct  418  EFEE  421



>ref|XP_002303970.1| DNA repair protein RAD23 [Populus trichocarpa]
 gb|EEE78949.1| DNA repair protein RAD23 [Populus trichocarpa]
Length=358

 Score =   194 bits (494),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/127 (72%), Positives = 111/127 (87%), Gaps = 0/127 (0%)
 Frame = -2

Query  652  TLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEG  473
            +L+FLRN+QQFQALR+MVQANPQILQPMLQELGKQNP L+R+IQEH A+FL+LINEP++G
Sbjct  232  SLDFLRNNQQFQALRSMVQANPQILQPMLQELGKQNPQLLRIIQEHHAEFLQLINEPLDG  291

Query  472  GEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLD  293
             EG+I  Q    MP A+ VTP E+EAIERLEAMGFDRALV+E F AC++NE+LAANYLL+
Sbjct  292  SEGDIFDQPDQDMPHAINVTPAEQEAIERLEAMGFDRALVIEAFLACDRNEQLAANYLLE  351

Query  292  HMHEFED  272
            +  +FED
Sbjct  352  NAGDFED  358



>ref|XP_006385947.1| hypothetical protein POPTR_0003s18540g [Populus trichocarpa]
 gb|ERP63744.1| hypothetical protein POPTR_0003s18540g [Populus trichocarpa]
Length=372

 Score =   194 bits (494),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/127 (72%), Positives = 111/127 (87%), Gaps = 0/127 (0%)
 Frame = -2

Query  652  TLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEG  473
            +L+FLRN+QQFQALR+MVQANPQILQPMLQELGKQNP L+R+IQEH A+FL+LINEP++G
Sbjct  246  SLDFLRNNQQFQALRSMVQANPQILQPMLQELGKQNPQLLRIIQEHHAEFLQLINEPLDG  305

Query  472  GEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLD  293
             EG+I  Q    MP A+ VTP E+EAIERLEAMGFDRALV+E F AC++NE+LAANYLL+
Sbjct  306  SEGDIFDQPDQDMPHAINVTPAEQEAIERLEAMGFDRALVIEAFLACDRNEQLAANYLLE  365

Query  292  HMHEFED  272
            +  +FED
Sbjct  366  NAGDFED  372



>ref|XP_003563980.1| PREDICTED: ubiquitin receptor RAD23d-like [Brachypodium distachyon]
Length=413

 Score =   196 bits (497),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 111/125 (89%), Gaps = 2/125 (2%)
 Frame = -2

Query  640  LRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE-PVEGGEG  464
            LR   QFQAL A+VQANPQILQPMLQELGKQNP ++RLIQE+QA+FLRL+NE P  G  G
Sbjct  287  LRALPQFQALLALVQANPQILQPMLQELGKQNPQILRLIQENQAEFLRLVNETPESGAAG  346

Query  463  NILGQLAASMPQ-AVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  287
            NILGQLAA+MPQ AV VTPEERE+I+RLEAMGF+R LVLEVFFACN++EELAANYLLDH 
Sbjct  347  NILGQLAAAMPQAAVTVTPEERESIQRLEAMGFNRELVLEVFFACNRDEELAANYLLDHG  406

Query  286  HEFED  272
            HE+ED
Sbjct  407  HEYED  411



>ref|XP_009797065.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X2 [Nicotiana 
sylvestris]
Length=367

 Score =   194 bits (493),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 89/127 (70%), Positives = 110/127 (87%), Gaps = 0/127 (0%)
 Frame = -2

Query  652  TLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEG  473
            +L+FLRN+QQFQALR+MVQ+NPQILQPMLQELGKQNP L+R+IQEH  +FL+LINEPV+G
Sbjct  241  SLDFLRNNQQFQALRSMVQSNPQILQPMLQELGKQNPQLLRMIQEHHQEFLQLINEPVDG  300

Query  472  GEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLD  293
             +G++  Q    MP  V VTP+E+EAIERLEAMGFDRALV+E F AC++NEELAANYLL+
Sbjct  301  SDGDLFDQPEQDMPHTVSVTPQEQEAIERLEAMGFDRALVIEAFLACDRNEELAANYLLE  360

Query  292  HMHEFED  272
            H  ++ED
Sbjct  361  HAGDYED  367



>ref|NP_001266655.1| DNA repair protein RAD23 [Zea mays]
 gb|ACG37645.1| DNA repair protein RAD23 [Zea mays]
Length=405

 Score =   195 bits (495),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 96/131 (73%), Positives = 112/131 (85%), Gaps = 1/131 (1%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
            G+  L+ LR   QFQAL  +VQANPQILQPMLQELGKQNP ++RLIQE+QA+FLRL+NE 
Sbjct  272  GSGALDALRQLPQFQALLQLVQANPQILQPMLQELGKQNPQILRLIQENQAEFLRLVNES  331

Query  481  VEGGEG-NILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  305
             EGG G NILGQLAA++PQ + VTPEEREAI+RLE MGF+R LVLEVFFACNK+EEL AN
Sbjct  332  PEGGPGGNILGQLAAAVPQTLTVTPEEREAIQRLEGMGFNRELVLEVFFACNKDEELTAN  391

Query  304  YLLDHMHEFED  272
            YLLDH HEF++
Sbjct  392  YLLDHGHEFDE  402



>ref|XP_009797063.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009797064.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X1 [Nicotiana 
sylvestris]
Length=368

 Score =   194 bits (493),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 89/127 (70%), Positives = 110/127 (87%), Gaps = 0/127 (0%)
 Frame = -2

Query  652  TLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEG  473
            +L+FLRN+QQFQALR+MVQ+NPQILQPMLQELGKQNP L+R+IQEH  +FL+LINEPV+G
Sbjct  242  SLDFLRNNQQFQALRSMVQSNPQILQPMLQELGKQNPQLLRMIQEHHQEFLQLINEPVDG  301

Query  472  GEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLD  293
             +G++  Q    MP  V VTP+E+EAIERLEAMGFDRALV+E F AC++NEELAANYLL+
Sbjct  302  SDGDLFDQPEQDMPHTVSVTPQEQEAIERLEAMGFDRALVIEAFLACDRNEELAANYLLE  361

Query  292  HMHEFED  272
            H  ++ED
Sbjct  362  HAGDYED  368



>ref|NP_001142065.1| uncharacterized protein LOC100274222 [Zea mays]
 gb|ACF87572.1| unknown [Zea mays]
 gb|AFW87602.1| DNA repair protein RAD23 [Zea mays]
Length=405

 Score =   195 bits (495),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 96/131 (73%), Positives = 112/131 (85%), Gaps = 1/131 (1%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
            G+  L+ LR   QFQAL  +VQANPQILQPMLQELGKQNP ++RLIQE+QA+FLRL+NE 
Sbjct  272  GSGALDALRQLPQFQALLQLVQANPQILQPMLQELGKQNPQILRLIQENQAEFLRLVNES  331

Query  481  VEGGEG-NILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  305
             EGG G NILGQLAA++PQ + VTPEEREAI+RLE MGF+R LVLEVFFACNK+EEL AN
Sbjct  332  PEGGPGGNILGQLAAAVPQTLTVTPEEREAIQRLEGMGFNRELVLEVFFACNKDEELTAN  391

Query  304  YLLDHMHEFED  272
            YLLDH HEF++
Sbjct  392  YLLDHGHEFDE  402



>gb|AEA86337.1| putative DNA repair protein [Solanum nigrum]
Length=166

 Score =   187 bits (476),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 95/104 (91%), Positives = 99/104 (95%), Gaps = 1/104 (1%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
            GANTL+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP
Sbjct  63   GANTLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  122

Query  481  VEGGEG-NILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  353
            VEGGEG N+LGQLAA+MPQA+ VTPEEREAIERLE MGFD  LV
Sbjct  123  VEGGEGTNVLGQLAAAMPQAISVTPEEREAIERLEQMGFDHDLV  166



>emb|CBI25247.3| unnamed protein product [Vitis vinifera]
Length=399

 Score =   194 bits (494),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = -2

Query  646  EFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  467
            EFLRN+ QFQALRAMVQANPQILQPMLQELGKQNPHL+RLIQEH A+FL+LINEP+EG E
Sbjct  275  EFLRNNHQFQALRAMVQANPQILQPMLQELGKQNPHLLRLIQEHHAEFLQLINEPLEGSE  334

Query  466  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  287
            G+I  Q    +P A+ VTP E+EAIERLEAMGFDRALV+E F AC++NEELA NYLL++ 
Sbjct  335  GDIFDQPEQELPHAINVTPAEQEAIERLEAMGFDRALVIEAFLACDRNEELAVNYLLENA  394

Query  286  HEFED  272
             ++ED
Sbjct  395  GDYED  399



>ref|XP_004303217.1| PREDICTED: ubiquitin receptor RAD23b [Fragaria vesca subsp. vesca]
Length=371

 Score =   194 bits (492),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 92/131 (70%), Positives = 110/131 (84%), Gaps = 0/131 (0%)
 Frame = -2

Query  664  GGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE  485
            G   +L+FLRN+ QFQ LR+MVQANPQILQPMLQELGKQNP L+RLIQEH A+FL+LINE
Sbjct  241  GALGSLDFLRNNHQFQTLRSMVQANPQILQPMLQELGKQNPQLLRLIQEHHAEFLQLINE  300

Query  484  PVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  305
            P+EG EG++  Q    MP A+ VTP E+EAIERLEAMGFDRALV+E F AC++NEELAAN
Sbjct  301  PLEGSEGDMFDQPDQEMPHAINVTPAEQEAIERLEAMGFDRALVIEAFLACDRNEELAAN  360

Query  304  YLLDHMHEFED  272
            YLL++  +FED
Sbjct  361  YLLENAGDFED  371



>ref|XP_010655132.1| PREDICTED: ubiquitin receptor RAD23b [Vitis vinifera]
Length=411

 Score =   195 bits (495),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = -2

Query  646  EFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  467
            EFLRN+ QFQALRAMVQANPQILQPMLQELGKQNPHL+RLIQEH A+FL+LINEP+EG E
Sbjct  287  EFLRNNHQFQALRAMVQANPQILQPMLQELGKQNPHLLRLIQEHHAEFLQLINEPLEGSE  346

Query  466  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  287
            G+I  Q    +P A+ VTP E+EAIERLEAMGFDRALV+E F AC++NEELA NYLL++ 
Sbjct  347  GDIFDQPEQELPHAINVTPAEQEAIERLEAMGFDRALVIEAFLACDRNEELAVNYLLENA  406

Query  286  HEFED  272
             ++ED
Sbjct  407  GDYED  411



>ref|XP_010268452.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X1 [Nelumbo 
nucifera]
 ref|XP_010268453.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X1 [Nelumbo 
nucifera]
Length=387

 Score =   194 bits (492),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 92/130 (71%), Positives = 110/130 (85%), Gaps = 0/130 (0%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
            G  +L+FLRN+QQFQALR+MVQANPQILQPMLQEL KQNP L+RLIQEH A+FL+LINEP
Sbjct  258  GDGSLDFLRNNQQFQALRSMVQANPQILQPMLQELSKQNPQLLRLIQEHHAEFLQLINEP  317

Query  481  VEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  302
            +EG EG++  Q    MP A+ VTP E+EAIERLEAMGFDRALV+E F AC++NEELA NY
Sbjct  318  LEGSEGDLFDQPEQDMPHAISVTPAEQEAIERLEAMGFDRALVIEAFLACDRNEELAVNY  377

Query  301  LLDHMHEFED  272
            LL++  +FED
Sbjct  378  LLENAGDFED  387



>ref|XP_006341431.1| PREDICTED: ubiquitin receptor RAD23b-like [Solanum tuberosum]
Length=367

 Score =   193 bits (491),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
            G  +L+FLRN+QQFQALR+MVQANPQILQPMLQELGKQNP L+R IQEH  +FL+LINEP
Sbjct  238  GLGSLDFLRNNQQFQALRSMVQANPQILQPMLQELGKQNPQLLRSIQEHDQEFLQLINEP  297

Query  481  VEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  302
            V+G +G++  Q    +P  V VTPEE+E IERLEAMGFDRALV+E F AC++NEELAANY
Sbjct  298  VDGSDGDMFDQAEQEIPHTVSVTPEEQEVIERLEAMGFDRALVIEAFLACDRNEELAANY  357

Query  301  LLDHMHEFED  272
            LL+H  ++ED
Sbjct  358  LLEHAGDYED  367



>ref|XP_002299163.1| DNA repair protein RAD23 [Populus trichocarpa]
 gb|EEE83968.1| DNA repair protein RAD23 [Populus trichocarpa]
Length=349

 Score =   192 bits (488),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/127 (72%), Positives = 110/127 (87%), Gaps = 0/127 (0%)
 Frame = -2

Query  652  TLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEG  473
            +L+FLRN+QQFQALR+MVQANPQILQPMLQELGKQNP L+R+IQEH A+FL+LINEP++G
Sbjct  223  SLDFLRNNQQFQALRSMVQANPQILQPMLQELGKQNPQLLRMIQEHNAEFLQLINEPLDG  282

Query  472  GEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLD  293
             EG+I  Q    MP A+ VTP E+EAIERL AMGFDRALV+E F AC++NEELAANYLL+
Sbjct  283  SEGDIFDQPDQDMPHAINVTPAEQEAIERLVAMGFDRALVIEAFLACDRNEELAANYLLE  342

Query  292  HMHEFED  272
            +  +FED
Sbjct  343  NGADFED  349



>ref|XP_006368664.1| hypothetical protein POPTR_0001s07510g [Populus trichocarpa]
 gb|ABK95041.1| unknown [Populus trichocarpa]
 gb|ERP65233.1| hypothetical protein POPTR_0001s07510g [Populus trichocarpa]
Length=375

 Score =   193 bits (490),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/127 (72%), Positives = 110/127 (87%), Gaps = 0/127 (0%)
 Frame = -2

Query  652  TLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEG  473
            +L+FLRN+QQFQALR+MVQANPQILQPMLQELGKQNP L+R+IQEH A+FL+LINEP++G
Sbjct  249  SLDFLRNNQQFQALRSMVQANPQILQPMLQELGKQNPQLLRMIQEHNAEFLQLINEPLDG  308

Query  472  GEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLD  293
             EG+I  Q    MP A+ VTP E+EAIERL AMGFDRALV+E F AC++NEELAANYLL+
Sbjct  309  SEGDIFDQPDQDMPHAINVTPAEQEAIERLVAMGFDRALVIEAFLACDRNEELAANYLLE  368

Query  292  HMHEFED  272
            +  +FED
Sbjct  369  NGADFED  375



>ref|XP_004235877.1| PREDICTED: ubiquitin receptor RAD23b [Solanum lycopersicum]
Length=366

 Score =   192 bits (488),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/127 (70%), Positives = 108/127 (85%), Gaps = 0/127 (0%)
 Frame = -2

Query  652  TLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEG  473
            +L+FLRN+QQFQALR+MVQANPQILQPMLQELGKQNP L+R IQEH  +FL+LINEPV+G
Sbjct  240  SLDFLRNNQQFQALRSMVQANPQILQPMLQELGKQNPQLLRSIQEHDQEFLQLINEPVDG  299

Query  472  GEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLD  293
             +G++  Q    +P  V VTPEE+E IERLEAMGFDRALV+E F AC++NEELAANYLL+
Sbjct  300  SDGDMFDQAEQEIPHTVSVTPEEQEVIERLEAMGFDRALVIEAFLACDRNEELAANYLLE  359

Query  292  HMHEFED  272
            H  ++ED
Sbjct  360  HAGDYED  366



>ref|XP_011034604.1| PREDICTED: ubiquitin receptor RAD23b-like [Populus euphratica]
Length=375

 Score =   192 bits (489),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/127 (72%), Positives = 110/127 (87%), Gaps = 0/127 (0%)
 Frame = -2

Query  652  TLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEG  473
            +L+FLRN+QQFQALR+MVQANPQILQPMLQELGKQNP L+R+IQEH A+FL+LINEP++G
Sbjct  249  SLDFLRNNQQFQALRSMVQANPQILQPMLQELGKQNPQLLRMIQEHNAEFLQLINEPLDG  308

Query  472  GEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLD  293
             EG+I  Q    MP A+ VTP E+EAIERL AMGFDRALV+E F AC++NEELAANYLL+
Sbjct  309  SEGDIFDQPDQDMPHAINVTPAEQEAIERLVAMGFDRALVIEAFLACDRNEELAANYLLE  368

Query  292  HMHEFED  272
            +  +FED
Sbjct  369  NGADFED  375



>ref|XP_009615678.1| PREDICTED: ubiquitin receptor RAD23b [Nicotiana tomentosiformis]
Length=367

 Score =   192 bits (488),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 108/130 (83%), Gaps = 0/130 (0%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
            G  +L+FLRN+QQFQALR+MVQANPQILQPMLQELGKQNP L+R IQEH  +FL+LINEP
Sbjct  238  GLGSLDFLRNNQQFQALRSMVQANPQILQPMLQELGKQNPQLLRSIQEHHQEFLQLINEP  297

Query  481  VEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  302
            V+G +G+I  Q    +P  V VTPEE+  IERLEAMGFDRALV+E F AC++NEELAANY
Sbjct  298  VDGSDGDIFDQAEQEIPHTVSVTPEEQAVIERLEAMGFDRALVIEAFLACDRNEELAANY  357

Query  301  LLDHMHEFED  272
            LL+H  ++ED
Sbjct  358  LLEHAGDYED  367



>ref|XP_011082656.1| PREDICTED: ubiquitin receptor RAD23b-like [Sesamum indicum]
Length=361

 Score =   192 bits (487),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/131 (69%), Positives = 110/131 (84%), Gaps = 0/131 (0%)
 Frame = -2

Query  664  GGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE  485
             G  +L+FLRN+QQFQALR++VQANPQILQPMLQELGKQNP L+RLIQE+  +FL+LINE
Sbjct  231  AGLGSLDFLRNNQQFQALRSLVQANPQILQPMLQELGKQNPSLLRLIQENHQEFLQLINE  290

Query  484  PVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  305
            PV+G EG+I  Q    MP AV VTP E+EAIER+EAMGFDRALV+E F AC++NEELA N
Sbjct  291  PVDGSEGDIFDQAEQEMPHAVSVTPAEQEAIERMEAMGFDRALVIEAFLACDRNEELAVN  350

Query  304  YLLDHMHEFED  272
            YLL++  +FED
Sbjct  351  YLLENAGDFED  361



>ref|XP_003574508.1| PREDICTED: probable ubiquitin receptor RAD23 isoform X2 [Brachypodium 
distachyon]
Length=394

 Score =   192 bits (488),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 93/130 (72%), Positives = 111/130 (85%), Gaps = 1/130 (1%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
            G N L+ LRN+ QF+ L ++VQANPQILQP+LQELGKQNP +++LIQE+QA+FLRLINEP
Sbjct  259  GGN-LDVLRNNSQFRGLLSLVQANPQILQPLLQELGKQNPQILQLIQENQAEFLRLINEP  317

Query  481  VEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  302
             EG EGN+L Q  A +PQ V VTP E EAI+RLE MGFDR LVLEVFFACNK+E+LAANY
Sbjct  318  AEGAEGNLLEQFGAGVPQTVAVTPAENEAIQRLEHMGFDRDLVLEVFFACNKDEQLAANY  377

Query  301  LLDHMHEFED  272
            LLDHM+EF+D
Sbjct  378  LLDHMNEFDD  387



>ref|XP_010235145.1| PREDICTED: probable ubiquitin receptor RAD23 isoform X1 [Brachypodium 
distachyon]
Length=395

 Score =   192 bits (488),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 93/130 (72%), Positives = 111/130 (85%), Gaps = 1/130 (1%)
 Frame = -2

Query  661  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  482
            G N L+ LRN+ QF+ L ++VQANPQILQP+LQELGKQNP +++LIQE+QA+FLRLINEP
Sbjct  260  GGN-LDVLRNNSQFRGLLSLVQANPQILQPLLQELGKQNPQILQLIQENQAEFLRLINEP  318

Query  481  VEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  302
             EG EGN+L Q  A +PQ V VTP E EAI+RLE MGFDR LVLEVFFACNK+E+LAANY
Sbjct  319  AEGAEGNLLEQFGAGVPQTVAVTPAENEAIQRLEHMGFDRDLVLEVFFACNKDEQLAANY  378

Query  301  LLDHMHEFED  272
            LLDHM+EF+D
Sbjct  379  LLDHMNEFDD  388



>ref|XP_009365249.1| PREDICTED: ubiquitin receptor RAD23b-like [Pyrus x bretschneideri]
Length=374

 Score =   191 bits (486),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 92/134 (69%), Positives = 111/134 (83%), Gaps = 3/134 (2%)
 Frame = -2

Query  664  GGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE  485
            G   +L+FLRN++QFQALR+MVQANPQILQPMLQELGKQNP L+RLIQEH  +FL+LINE
Sbjct  241  GALGSLDFLRNNRQFQALRSMVQANPQILQPMLQELGKQNPQLLRLIQEHHTEFLQLINE  300

Query  484  PVEGGEGNILGQLAA---SMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEEL  314
            P+EG EG+I  Q       MP A+ VTP E+EAIERLEAMGFDRALV+E F AC++NEEL
Sbjct  301  PLEGSEGDIFDQPDGPDQDMPHAINVTPAEQEAIERLEAMGFDRALVIEAFLACDRNEEL  360

Query  313  AANYLLDHMHEFED  272
            AANYLL++  ++ED
Sbjct  361  AANYLLENAGDYED  374



>ref|XP_008342756.1| PREDICTED: ubiquitin receptor RAD23b-like [Malus domestica]
Length=369

 Score =   191 bits (486),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 92/134 (69%), Positives = 111/134 (83%), Gaps = 3/134 (2%)
 Frame = -2

Query  664  GGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE  485
            G   +L+FLRN++QFQALR+MVQ+NPQILQPMLQELGKQNP L+RLIQEH  +FL+LINE
Sbjct  236  GALGSLDFLRNNRQFQALRSMVQSNPQILQPMLQELGKQNPQLLRLIQEHHTEFLQLINE  295

Query  484  PVEGGEGNILGQLAA---SMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEEL  314
            PVEG EG+I  Q       +P A+ VTP E+EAIERLEAMGFDRALV+E F AC++NEEL
Sbjct  296  PVEGSEGDIFDQADGPDQDLPHAINVTPAEQEAIERLEAMGFDRALVIEAFLACDRNEEL  355

Query  313  AANYLLDHMHEFED  272
            AANYLL++  +FED
Sbjct  356  AANYLLENAGDFED  369



>ref|XP_009759118.1| PREDICTED: ubiquitin receptor RAD23b isoform X2 [Nicotiana sylvestris]
Length=366

 Score =   191 bits (485),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 89/127 (70%), Positives = 107/127 (84%), Gaps = 0/127 (0%)
 Frame = -2

Query  652  TLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEG  473
            +L+FLRN+QQFQALR+MVQANPQILQPMLQELGKQNP L+R IQEH  +FL+LINEPV+G
Sbjct  240  SLDFLRNNQQFQALRSMVQANPQILQPMLQELGKQNPQLLRSIQEHHQEFLQLINEPVDG  299

Query  472  GEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLD  293
             +G+I  Q    +P  V VTPEE+  IERLEAMGFDRALV+E F AC++NEELAANYLL+
Sbjct  300  SDGDIFDQAEQEIPHTVSVTPEEQAVIERLEAMGFDRALVIEAFLACDRNEELAANYLLE  359

Query  292  HMHEFED  272
            H  ++ED
Sbjct  360  HAGDYED  366



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1037156799140