BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF028A05

Length=687
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP19148.1|  unnamed protein product                                233   2e-70   Coffea canephora [robusta coffee]
ref|XP_009615190.1|  PREDICTED: ankyrin repeat protein SKIP35           237   4e-70   
ref|XP_009760838.1|  PREDICTED: ankyrin repeat protein SKIP35-like      234   3e-69   Nicotiana sylvestris
ref|XP_010324730.1|  PREDICTED: ankyrin repeat protein SKIP35 iso...    232   3e-68   Solanum lycopersicum
ref|XP_004244785.1|  PREDICTED: ankyrin repeat protein SKIP35 iso...    232   3e-68   Solanum lycopersicum
ref|XP_006351081.1|  PREDICTED: F-box/ankyrin repeat protein SKIP...    230   2e-67   Solanum tuberosum [potatoes]
ref|XP_006351083.1|  PREDICTED: F-box/ankyrin repeat protein SKIP...    230   2e-67   Solanum tuberosum [potatoes]
ref|XP_006344946.1|  PREDICTED: F-box/ankyrin repeat protein SKIP...    226   7e-66   Solanum tuberosum [potatoes]
ref|XP_006344945.1|  PREDICTED: F-box/ankyrin repeat protein SKIP...    226   7e-66   Solanum tuberosum [potatoes]
ref|XP_009797824.1|  PREDICTED: ankyrin repeat protein SKIP35-lik...    223   4e-65   Nicotiana sylvestris
ref|XP_009797820.1|  PREDICTED: ankyrin repeat protein SKIP35-lik...    223   4e-65   Nicotiana sylvestris
gb|AFK48259.1|  unknown                                                 212   4e-65   Lotus japonicus
emb|CDP19146.1|  unnamed protein product                                222   1e-64   Coffea canephora [robusta coffee]
gb|KDP29537.1|  hypothetical protein JCGZ_19250                         222   2e-64   Jatropha curcas
ref|XP_002533338.1|  conserved hypothetical protein                     221   5e-64   Ricinus communis
ref|XP_009618034.1|  PREDICTED: ankyrin repeat protein SKIP35-lik...    218   3e-63   Nicotiana tomentosiformis
ref|XP_009618028.1|  PREDICTED: ankyrin repeat protein SKIP35-lik...    218   4e-63   
ref|XP_010313979.1|  PREDICTED: ankyrin repeat protein SKIP35-lik...    218   5e-63   
ref|XP_004251971.1|  PREDICTED: ankyrin repeat protein SKIP35-lik...    218   6e-63   Solanum lycopersicum
emb|CAN70678.1|  hypothetical protein VITISV_044152                     216   9e-63   Vitis vinifera
ref|XP_010650761.1|  PREDICTED: ankyrin repeat protein SKIP35-like      216   2e-62   
ref|XP_011005246.1|  PREDICTED: ankyrin repeat protein SKIP35-like      216   4e-62   Populus euphratica
ref|XP_002309709.2|  hypothetical protein POPTR_0007s00280g             216   5e-62   
ref|XP_008243090.1|  PREDICTED: ankyrin repeat protein SKIP35-like      214   2e-61   Prunus mume [ume]
ref|XP_006584140.1|  PREDICTED: F-box/ankyrin repeat protein SKIP...    213   3e-61   Glycine max [soybeans]
gb|KHN22618.1|  F-box/ankyrin repeat protein SKIP35                     213   3e-61   Glycine soja [wild soybean]
emb|CBI24769.3|  unnamed protein product                                216   5e-61   Vitis vinifera
ref|XP_006478490.1|  PREDICTED: F-box/ankyrin repeat protein SKIP...    213   5e-61   Citrus sinensis [apfelsine]
ref|XP_006441987.1|  hypothetical protein CICLE_v10019310mg             213   5e-61   
ref|XP_010251448.1|  PREDICTED: ankyrin repeat protein SKIP35-like      213   5e-61   Nelumbo nucifera [Indian lotus]
ref|XP_011074019.1|  PREDICTED: ankyrin repeat protein SKIP35-like      213   7e-61   
ref|XP_007026463.1|  Ankyrin repeat family protein isoform 1            212   7e-61   Theobroma cacao [chocolate]
gb|KEH32772.1|  F-box/ankyrin repeat SKIP35-like protein                212   8e-61   Medicago truncatula
gb|KJB11213.1|  hypothetical protein B456_001G247600                    211   2e-60   Gossypium raimondii
ref|XP_007203611.1|  hypothetical protein PRUPE_ppa002867mg             211   2e-60   Prunus persica
gb|AJF94393.1|  F-box/ankyrin repeat protein SKIP35                     210   4e-60   Gossypium hirsutum [American cotton]
ref|XP_004288739.1|  PREDICTED: ankyrin repeat protein SKIP35-like      209   1e-59   Fragaria vesca subsp. vesca
gb|KHN27707.1|  F-box/ankyrin repeat protein SKIP35                     209   1e-59   Glycine soja [wild soybean]
ref|XP_006600252.1|  PREDICTED: F-box/ankyrin repeat protein SKIP...    208   2e-59   Glycine max [soybeans]
ref|XP_010277855.1|  PREDICTED: ankyrin repeat protein SKIP35           209   2e-59   Nelumbo nucifera [Indian lotus]
ref|XP_007153901.1|  hypothetical protein PHAVU_003G074400g             208   2e-59   Phaseolus vulgaris [French bean]
ref|XP_010672531.1|  PREDICTED: ankyrin repeat protein SKIP35-like      206   1e-58   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010087440.1|  hypothetical protein L484_019643                   204   5e-58   
ref|XP_010067585.1|  PREDICTED: ankyrin repeat protein SKIP35-like      204   7e-58   Eucalyptus grandis [rose gum]
ref|XP_010930324.1|  PREDICTED: ankyrin repeat protein SKIP35           204   1e-57   Elaeis guineensis
ref|XP_008394247.1|  PREDICTED: ankyrin repeat protein SKIP35           203   1e-57   
ref|XP_008445478.1|  PREDICTED: ankyrin repeat protein SKIP35-like      203   2e-57   Cucumis melo [Oriental melon]
gb|KHG16914.1|  F-box/ankyrin repeat SKIP35 -like protein               202   3e-57   Gossypium arboreum [tree cotton]
ref|XP_011085079.1|  PREDICTED: ankyrin repeat protein SKIP35-like      202   4e-57   Sesamum indicum [beniseed]
ref|XP_004144185.1|  PREDICTED: F-box/ankyrin repeat protein SKIP...    201   1e-56   Cucumis sativus [cucumbers]
ref|XP_008801302.1|  PREDICTED: ankyrin repeat protein SKIP35           199   5e-56   Phoenix dactylifera
gb|EYU22360.1|  hypothetical protein MIMGU_mgv1a017835mg                199   1e-55   Erythranthe guttata [common monkey flower]
ref|XP_004499381.1|  PREDICTED: F-box/ankyrin repeat protein SKIP...    198   1e-55   Cicer arietinum [garbanzo]
ref|XP_008354473.1|  PREDICTED: ankyrin repeat protein SKIP35-like      191   6e-54   
ref|XP_008389252.1|  PREDICTED: ankyrin repeat protein SKIP35           191   6e-54   
ref|XP_011004557.1|  PREDICTED: ankyrin repeat protein SKIP35           194   6e-54   Populus euphratica
ref|XP_006397583.1|  hypothetical protein EUTSA_v10001361mg             193   7e-54   Eutrema salsugineum [saltwater cress]
gb|KDO49748.1|  hypothetical protein CISIN_1g006847mg                   192   2e-53   Citrus sinensis [apfelsine]
ref|XP_006372306.1|  hypothetical protein POPTR_0017s00410g             192   2e-53   
gb|EYU36630.1|  hypothetical protein MIMGU_mgv1a002704mg                192   2e-53   Erythranthe guttata [common monkey flower]
ref|XP_010912734.1|  PREDICTED: ankyrin repeat protein SKIP35-like      192   2e-53   Elaeis guineensis
ref|XP_009366266.1|  PREDICTED: ankyrin repeat protein SKIP35-like      192   2e-53   
ref|XP_009379908.1|  PREDICTED: ankyrin repeat protein SKIP35-like      191   4e-53   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009390785.1|  PREDICTED: ankyrin repeat protein SKIP35-like      191   9e-53   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008781953.1|  PREDICTED: ankyrin repeat protein SKIP35-like      189   2e-52   Phoenix dactylifera
ref|XP_009404918.1|  PREDICTED: ankyrin repeat protein SKIP35-like      188   7e-52   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAX96769.1|  expressed protein                                       187   9e-52   Oryza sativa Japonica Group [Japonica rice]
gb|EEC67953.1|  hypothetical protein OsI_35687                          187   1e-51   Oryza sativa Indica Group [Indian rice]
gb|ABA92347.2|  expressed protein                                       187   1e-51   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001067610.1|  Os11g0246900                                       186   1e-51   
gb|EEE51919.1|  hypothetical protein OsJ_33524                          187   2e-51   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007026464.1|  Ankyrin repeat family protein isoform 2            184   1e-50   
ref|XP_010524207.1|  PREDICTED: ankyrin repeat protein SKIP35           183   4e-50   Tarenaya hassleriana [spider flower]
ref|XP_006662854.1|  PREDICTED: F-box/ankyrin repeat protein SKIP...    183   5e-50   Oryza brachyantha
ref|XP_009404281.1|  PREDICTED: ankyrin repeat protein SKIP35-like      182   8e-50   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002881948.1|  hypothetical protein ARALYDRAFT_483529             181   1e-49   
ref|XP_010508343.1|  PREDICTED: ankyrin repeat protein SKIP35-lik...    180   2e-49   
ref|NP_566008.1|  Ankyrin repeat family protein                         181   2e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010237787.1|  PREDICTED: ankyrin repeat protein SKIP35-lik...    181   3e-49   Brachypodium distachyon [annual false brome]
ref|XP_003577645.1|  PREDICTED: ankyrin repeat protein SKIP35-lik...    181   3e-49   Brachypodium distachyon [annual false brome]
gb|AAK82517.1|  At2g44090/F6E13.22                                      180   4e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010508342.1|  PREDICTED: ankyrin repeat protein SKIP35-lik...    180   4e-49   Camelina sativa [gold-of-pleasure]
emb|CDX79783.1|  BnaA05g03730D                                          180   4e-49   
ref|XP_010517993.1|  PREDICTED: ankyrin repeat protein SKIP35-like      179   1e-48   Camelina sativa [gold-of-pleasure]
ref|XP_004978972.1|  PREDICTED: F-box/ankyrin repeat protein SKIP...    179   1e-48   Setaria italica
ref|XP_004978971.1|  PREDICTED: F-box/ankyrin repeat protein SKIP...    179   1e-48   Setaria italica
ref|XP_009142990.1|  PREDICTED: ankyrin repeat protein SKIP35           179   2e-48   Brassica rapa
ref|XP_004978970.1|  PREDICTED: F-box/ankyrin repeat protein SKIP...    179   2e-48   
emb|CDY23417.1|  BnaC04g49450D                                          176   4e-48   Brassica napus [oilseed rape]
ref|XP_009387780.1|  PREDICTED: ankyrin repeat protein SKIP35-like      177   8e-48   
emb|CDY17887.1|  BnaC04g03320D                                          175   3e-47   Brassica napus [oilseed rape]
dbj|BAJ86308.1|  predicted protein                                      174   7e-47   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KFK37227.1|  hypothetical protein AALP_AA4G230300                    174   8e-47   Arabis alpina [alpine rockcress]
ref|XP_008370850.1|  PREDICTED: ankyrin repeat protein SKIP35-like      172   2e-46   
gb|EYU29406.1|  hypothetical protein MIMGU_mgv1a003332mg                172   3e-46   Erythranthe guttata [common monkey flower]
emb|CDY30455.1|  BnaA04g25560D                                          171   1e-45   Brassica napus [oilseed rape]
gb|EPS60182.1|  hypothetical protein M569_14622                         169   4e-45   Genlisea aurea
ref|NP_001169323.1|  uncharacterized protein LOC100383189               169   4e-45   Zea mays [maize]
ref|XP_002450553.1|  hypothetical protein SORBIDRAFT_05g006915          167   3e-44   Sorghum bicolor [broomcorn]
ref|XP_010469258.1|  PREDICTED: ankyrin repeat protein SKIP35           166   6e-44   Camelina sativa [gold-of-pleasure]
ref|XP_010512283.1|  PREDICTED: ankyrin repeat protein SKIP35-like      166   7e-44   Camelina sativa [gold-of-pleasure]
gb|EMS56943.1|  hypothetical protein TRIUR3_08812                       166   7e-44   Triticum urartu
ref|XP_002878304.1|  hypothetical protein ARALYDRAFT_486455             164   2e-43   
ref|XP_010413621.1|  PREDICTED: ankyrin repeat protein SKIP35-like      164   2e-43   Camelina sativa [gold-of-pleasure]
ref|NP_191550.1|  Ankyrin repeat family protein                         164   2e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006402640.1|  hypothetical protein EUTSA_v10005846mg             164   3e-43   Eutrema salsugineum [saltwater cress]
ref|XP_008788289.1|  PREDICTED: ankyrin repeat protein SKIP35-lik...    160   5e-43   Phoenix dactylifera
gb|EMT24392.1|  hypothetical protein F775_29756                         162   1e-42   
ref|XP_009116666.1|  PREDICTED: ankyrin repeat protein SKIP35           162   2e-42   Brassica rapa
ref|XP_008788288.1|  PREDICTED: ankyrin repeat protein SKIP35-lik...    160   2e-42   Phoenix dactylifera
ref|XP_006290752.1|  hypothetical protein CARUB_v10016852mg             161   4e-42   
emb|CDX71861.1|  BnaC08g30130D                                          160   5e-42   
ref|XP_008788283.1|  PREDICTED: ankyrin repeat protein SKIP35-lik...    160   5e-42   Phoenix dactylifera
ref|XP_008788287.1|  PREDICTED: ankyrin repeat protein SKIP35-lik...    160   6e-42   
emb|CDY05963.1|  BnaA09g38170D                                          159   2e-41   
ref|XP_002985572.1|  hypothetical protein SELMODRAFT_122416             150   1e-38   
ref|XP_002987003.1|  hypothetical protein SELMODRAFT_125287             150   2e-38   
ref|XP_006848543.1|  hypothetical protein AMTR_s00169p00037240          150   3e-38   Amborella trichopoda
dbj|BAD15575.1|  unknown protein                                        142   2e-37   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006858696.1|  hypothetical protein AMTR_s00066p00097810          145   9e-37   Amborella trichopoda
ref|XP_001775776.1|  predicted protein                                  145   1e-36   
ref|XP_001771374.1|  predicted protein                                  144   3e-36   
ref|NP_001047152.1|  Os02g0562400                                       142   1e-35   
ref|XP_001760791.1|  predicted protein                                  142   2e-35   
ref|XP_006647390.1|  PREDICTED: F-box/ankyrin repeat protein SKIP...    141   2e-35   Oryza brachyantha
gb|EAZ23465.1|  hypothetical protein OsJ_07159                          141   3e-35   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001755132.1|  predicted protein                                  139   2e-34   
ref|XP_004952744.1|  PREDICTED: F-box/ankyrin repeat protein SKIP...    135   3e-33   
gb|ACN33692.1|  unknown                                                 134   6e-33   Zea mays [maize]
ref|XP_002962852.1|  hypothetical protein SELMODRAFT_62282              122   1e-28   
ref|XP_002989433.1|  hypothetical protein SELMODRAFT_42326              121   2e-28   
ref|XP_001765794.1|  predicted protein                                73.6    2e-11   
ref|XP_001770027.1|  predicted protein                                70.9    1e-10   
ref|XP_001757638.1|  predicted protein                                68.9    4e-10   
ref|XP_001759714.1|  predicted protein                                68.9    4e-10   
gb|EAY86310.1|  hypothetical protein OsI_07683                        58.5    1e-06   Oryza sativa Indica Group [Indian rice]
ref|XP_008344056.1|  PREDICTED: LOW QUALITY PROTEIN: ankyrin repe...  53.9    1e-05   



>emb|CDP19148.1| unnamed protein product [Coffea canephora]
Length=421

 Score =   233 bits (594),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 111/144 (77%), Positives = 129/144 (90%), Gaps = 1/144 (1%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL+Q+ F G+PAATYAVADSIARS DE+VAPELR+FL EHWSEAA ++G +QG+EHY+NL
Sbjct  277  FLLQSDFLGEPAATYAVADSIARSNDESVAPELRAFLKEHWSEAAFLDGLKQGQEHYMNL  336

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGVT  316
            VRI+  GESPICLRDLP PLR+AIAYLPLYREC KAGGCLLSQR RGQLVEAA+RL GV 
Sbjct  337  VRIVKWGESPICLRDLPGPLRVAIAYLPLYRECRKAGGCLLSQRRRGQLVEAARRLGGVE  396

Query  315  LEDARQGRELLGILEHNLPTFLLN  244
            LE+A QGR+LL +LEH+LP+FLLN
Sbjct  397  LEEASQGRQLLAVLEHHLPSFLLN  420



>ref|XP_009615190.1| PREDICTED: ankyrin repeat protein SKIP35 [Nicotiana tomentosiformis]
 ref|XP_009615191.1| PREDICTED: ankyrin repeat protein SKIP35 [Nicotiana tomentosiformis]
 ref|XP_009615192.1| PREDICTED: ankyrin repeat protein SKIP35 [Nicotiana tomentosiformis]
 emb|CAI84657.1| hypothetical protein [Nicotiana tabacum]
Length=621

 Score =   237 bits (605),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 113/145 (78%), Positives = 128/145 (88%), Gaps = 1/145 (1%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL+ + F GDPAATYAVADSIA+S+DEAVAPELRSFL EHWSEAA  +G RQG+EHYLN+
Sbjct  473  FLLSSDFLGDPAATYAVADSIAKSDDEAVAPELRSFLREHWSEAAFSDGLRQGQEHYLNI  532

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGVT  316
            VRI+  GESP+CL DLP PLR+AIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRL GV 
Sbjct  533  VRILKWGESPVCLADLPGPLRVAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLDGVV  592

Query  315  LEDARQGRELLGILEHNLPTFLLNA  241
            LE+  QGRELL +LEH++P FL+NA
Sbjct  593  LEEVNQGRELLAVLEHHIPPFLVNA  617



>ref|XP_009760838.1| PREDICTED: ankyrin repeat protein SKIP35-like [Nicotiana sylvestris]
 ref|XP_009760839.1| PREDICTED: ankyrin repeat protein SKIP35-like [Nicotiana sylvestris]
Length=621

 Score =   234 bits (598),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 112/145 (77%), Positives = 127/145 (88%), Gaps = 1/145 (1%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL+ + F GDPAATYAVADSIA+ +DEAVAPELRSFL EHWSEAA  +G RQG+EHYLN+
Sbjct  473  FLLSSDFLGDPAATYAVADSIAKLDDEAVAPELRSFLREHWSEAAFSDGLRQGQEHYLNI  532

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGVT  316
            VRI+  GESP+CL DLP PLR+AIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRL GV 
Sbjct  533  VRILKWGESPVCLGDLPGPLRVAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLDGVV  592

Query  315  LEDARQGRELLGILEHNLPTFLLNA  241
            LE+  QGRELL +LEH++P FL+NA
Sbjct  593  LEEVNQGRELLAVLEHHIPPFLVNA  617



>ref|XP_010324730.1| PREDICTED: ankyrin repeat protein SKIP35 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010324731.1| PREDICTED: ankyrin repeat protein SKIP35 isoform X1 [Solanum 
lycopersicum]
Length=636

 Score =   232 bits (592),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 111/144 (77%), Positives = 125/144 (87%), Gaps = 1/144 (1%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL+ + F GDP ATYAVADSIA+S+DEAVAP LRSFL EHWSEAA  +G RQG+EHY NL
Sbjct  487  FLLSSDFLGDPIATYAVADSIAKSDDEAVAPALRSFLREHWSEAAFSDGLRQGQEHYCNL  546

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGVT  316
            +RIM  GESP+CLRD+P PLRIAIAYLPLYRECVKAGGCLLSQRL+GQLVEAAKRL GV 
Sbjct  547  LRIMKWGESPVCLRDIPGPLRIAIAYLPLYRECVKAGGCLLSQRLKGQLVEAAKRLDGVV  606

Query  315  LEDARQGRELLGILEHNLPTFLLN  244
            LE+ +QGRELL +LEH+LP FL N
Sbjct  607  LEEVKQGRELLAVLEHHLPPFLHN  630



>ref|XP_004244785.1| PREDICTED: ankyrin repeat protein SKIP35 isoform X2 [Solanum 
lycopersicum]
Length=635

 Score =   232 bits (592),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 111/144 (77%), Positives = 125/144 (87%), Gaps = 1/144 (1%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL+ + F GDP ATYAVADSIA+S+DEAVAP LRSFL EHWSEAA  +G RQG+EHY NL
Sbjct  486  FLLSSDFLGDPIATYAVADSIAKSDDEAVAPALRSFLREHWSEAAFSDGLRQGQEHYCNL  545

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGVT  316
            +RIM  GESP+CLRD+P PLRIAIAYLPLYRECVKAGGCLLSQRL+GQLVEAAKRL GV 
Sbjct  546  LRIMKWGESPVCLRDIPGPLRIAIAYLPLYRECVKAGGCLLSQRLKGQLVEAAKRLDGVV  605

Query  315  LEDARQGRELLGILEHNLPTFLLN  244
            LE+ +QGRELL +LEH+LP FL N
Sbjct  606  LEEVKQGRELLAVLEHHLPPFLHN  629



>ref|XP_006351081.1| PREDICTED: F-box/ankyrin repeat protein SKIP35-like isoform X1 
[Solanum tuberosum]
 ref|XP_006351082.1| PREDICTED: F-box/ankyrin repeat protein SKIP35-like isoform X2 
[Solanum tuberosum]
Length=636

 Score =   230 bits (587),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 124/142 (87%), Gaps = 1/142 (1%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL+ + F GDP ATYAVADSIA+S+DEAVAP LRSFL EHWSEAA  +G RQG+EHY NL
Sbjct  487  FLLSSDFLGDPIATYAVADSIAKSDDEAVAPALRSFLREHWSEAAFSDGLRQGQEHYCNL  546

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGVT  316
            VRI+  GESP+CLRD+P PLRIAIAYLPLYRECVKAGGCLLSQRL+GQLVEAAKRL GV 
Sbjct  547  VRIIKWGESPVCLRDIPGPLRIAIAYLPLYRECVKAGGCLLSQRLKGQLVEAAKRLDGVV  606

Query  315  LEDARQGRELLGILEHNLPTFL  250
            LE+ +QGRELL +LEH+LP FL
Sbjct  607  LEEVKQGRELLAVLEHHLPPFL  628



>ref|XP_006351083.1| PREDICTED: F-box/ankyrin repeat protein SKIP35-like isoform X3 
[Solanum tuberosum]
Length=635

 Score =   230 bits (586),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 124/142 (87%), Gaps = 1/142 (1%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL+ + F GDP ATYAVADSIA+S+DEAVAP LRSFL EHWSEAA  +G RQG+EHY NL
Sbjct  486  FLLSSDFLGDPIATYAVADSIAKSDDEAVAPALRSFLREHWSEAAFSDGLRQGQEHYCNL  545

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGVT  316
            VRI+  GESP+CLRD+P PLRIAIAYLPLYRECVKAGGCLLSQRL+GQLVEAAKRL GV 
Sbjct  546  VRIIKWGESPVCLRDIPGPLRIAIAYLPLYRECVKAGGCLLSQRLKGQLVEAAKRLDGVV  605

Query  315  LEDARQGRELLGILEHNLPTFL  250
            LE+ +QGRELL +LEH+LP FL
Sbjct  606  LEEVKQGRELLAVLEHHLPPFL  627



>ref|XP_006344946.1| PREDICTED: F-box/ankyrin repeat protein SKIP35-like isoform X2 
[Solanum tuberosum]
Length=628

 Score =   226 bits (576),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 110/146 (75%), Positives = 126/146 (86%), Gaps = 2/146 (1%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL+ + F GDP ATYAVADSIA+S+D+AVAP LRSFL EHWSEAA  +G +QG+EHYLN 
Sbjct  478  FLLHSDFLGDPVATYAVADSIAKSDDDAVAPGLRSFLREHWSEAAFSDGLQQGKEHYLNF  537

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGG-CLLSQRLRGQLVEAAKRLSGV  319
            VRI+N GESPICL+DLP PLR+AIAYLPLYRE VK GG CLLSQRLRGQLVEAAKRL GV
Sbjct  538  VRIVNCGESPICLKDLPGPLRVAIAYLPLYRESVKVGGCCLLSQRLRGQLVEAAKRLGGV  597

Query  318  TLEDARQGRELLGILEHNLPTFLLNA  241
             LE+A QG+EL+ +LEH+LP FLLNA
Sbjct  598  VLEEANQGKELVAVLEHHLPPFLLNA  623



>ref|XP_006344945.1| PREDICTED: F-box/ankyrin repeat protein SKIP35-like isoform X1 
[Solanum tuberosum]
Length=629

 Score =   226 bits (575),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 110/146 (75%), Positives = 126/146 (86%), Gaps = 2/146 (1%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL+ + F GDP ATYAVADSIA+S+D+AVAP LRSFL EHWSEAA  +G +QG+EHYLN 
Sbjct  479  FLLHSDFLGDPVATYAVADSIAKSDDDAVAPGLRSFLREHWSEAAFSDGLQQGKEHYLNF  538

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGG-CLLSQRLRGQLVEAAKRLSGV  319
            VRI+N GESPICL+DLP PLR+AIAYLPLYRE VK GG CLLSQRLRGQLVEAAKRL GV
Sbjct  539  VRIVNCGESPICLKDLPGPLRVAIAYLPLYRESVKVGGCCLLSQRLRGQLVEAAKRLGGV  598

Query  318  TLEDARQGRELLGILEHNLPTFLLNA  241
             LE+A QG+EL+ +LEH+LP FLLNA
Sbjct  599  VLEEANQGKELVAVLEHHLPPFLLNA  624



>ref|XP_009797824.1| PREDICTED: ankyrin repeat protein SKIP35-like isoform X2 [Nicotiana 
sylvestris]
Length=602

 Score =   223 bits (569),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 108/146 (74%), Positives = 124/146 (85%), Gaps = 2/146 (1%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDE-AVAPELRSFLHEHWSEAAAIEGKRQGEEHYLN  499
            FL+ + F GDP ATYAVADSIA+S+D+ AV P L+SFL EHWSEAA  +G RQG+EHYLN
Sbjct  451  FLLHSDFLGDPVATYAVADSIAKSDDDDAVTPNLKSFLQEHWSEAAFFDGLRQGQEHYLN  510

Query  498  LVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGV  319
            LVRI+   E PICL+DLP PLR+AIAYLPLYRE +KAGGCLLSQRLRGQLVEAAKRL GV
Sbjct  511  LVRIVKWSECPICLKDLPGPLRVAIAYLPLYRESIKAGGCLLSQRLRGQLVEAAKRLGGV  570

Query  318  TLEDARQGRELLGILEHNLPTFLLNA  241
             LE+A QG+ELL +LEH+LP FLLNA
Sbjct  571  ILEEANQGKELLAVLEHHLPPFLLNA  596



>ref|XP_009797820.1| PREDICTED: ankyrin repeat protein SKIP35-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009797821.1| PREDICTED: ankyrin repeat protein SKIP35-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009797822.1| PREDICTED: ankyrin repeat protein SKIP35-like isoform X1 [Nicotiana 
sylvestris]
Length=603

 Score =   223 bits (569),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 108/146 (74%), Positives = 124/146 (85%), Gaps = 2/146 (1%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDE-AVAPELRSFLHEHWSEAAAIEGKRQGEEHYLN  499
            FL+ + F GDP ATYAVADSIA+S+D+ AV P L+SFL EHWSEAA  +G RQG+EHYLN
Sbjct  452  FLLHSDFLGDPVATYAVADSIAKSDDDDAVTPNLKSFLQEHWSEAAFFDGLRQGQEHYLN  511

Query  498  LVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGV  319
            LVRI+   E PICL+DLP PLR+AIAYLPLYRE +KAGGCLLSQRLRGQLVEAAKRL GV
Sbjct  512  LVRIVKWSECPICLKDLPGPLRVAIAYLPLYRESIKAGGCLLSQRLRGQLVEAAKRLGGV  571

Query  318  TLEDARQGRELLGILEHNLPTFLLNA  241
             LE+A QG+ELL +LEH+LP FLLNA
Sbjct  572  ILEEANQGKELLAVLEHHLPPFLLNA  597



>gb|AFK48259.1| unknown [Lotus japonicus]
Length=203

 Score =   212 bits (540),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 102/144 (71%), Positives = 121/144 (84%), Gaps = 1/144 (1%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL+Q+ F GDPAATYAVAD IA+SEDEAVAPEL++FL +HWSE A +EG R G+EHY+NL
Sbjct  55   FLLQSDFLGDPAATYAVADIIAKSEDEAVAPELKTFLRDHWSEGAYMEGLRLGQEHYMNL  114

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGVT  316
            VRI+  GESPICLRDLP+PL +AIAYLPLYRECVKAGGCL SQRLRGQLVEAA+RL    
Sbjct  115  VRIIKWGESPICLRDLPAPLTVAIAYLPLYRECVKAGGCLFSQRLRGQLVEAARRLGDRV  174

Query  315  LEDARQGRELLGILEHNLPTFLLN  244
             ++   GREL+  LE++LP FLL+
Sbjct  175  FDEVTHGRELVVFLENHLPNFLLH  198



>emb|CDP19146.1| unnamed protein product [Coffea canephora]
Length=603

 Score =   222 bits (565),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 106/145 (73%), Positives = 124/145 (86%), Gaps = 1/145 (1%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL+++ F GDP ATY VAD+IA S DE+VAPELR+FL EHWSEAA + G RQG EH++NL
Sbjct  455  FLLRSDFLGDPTATYTVADTIANSNDESVAPELRAFLQEHWSEAAFLGGLRQGREHHMNL  514

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGVT  316
            VRI+  GESPICLRDLP PLR+AIAYLPLYREC+KAGG LLSQRLRGQLVEA +RL GV 
Sbjct  515  VRIIKWGESPICLRDLPGPLRVAIAYLPLYRECLKAGGSLLSQRLRGQLVEAVRRLGGVE  574

Query  315  LEDARQGRELLGILEHNLPTFLLNA  241
            LE+ARQGR+LL +LEH+LP FL+ A
Sbjct  575  LEEARQGRQLLSVLEHHLPPFLVTA  599



>gb|KDP29537.1| hypothetical protein JCGZ_19250 [Jatropha curcas]
Length=625

 Score =   222 bits (566),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 105/145 (72%), Positives = 124/145 (86%), Gaps = 1/145 (1%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL+++ F GDP ATYAVADSIARS+DEAVAPELR+FL EHWSEAA ++G +QG+EHY+NL
Sbjct  477  FLLRSDFLGDPVATYAVADSIARSDDEAVAPELRAFLREHWSEAAFLDGLKQGQEHYMNL  536

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGVT  316
            + I+N G SP+C+RDLP PLR+AIAYLPLYRECV AGGCL SQRLRGQLVEA +RL G +
Sbjct  537  MMILNWGSSPMCIRDLPGPLRVAIAYLPLYRECVAAGGCLFSQRLRGQLVEAVRRLGGGS  596

Query  315  LEDARQGRELLGILEHNLPTFLLNA  241
            LE   QGRELL ILEH LP FL++A
Sbjct  597  LEGVSQGRELLAILEHYLPPFLVHA  621



>ref|XP_002533338.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF29047.1| conserved hypothetical protein [Ricinus communis]
Length=626

 Score =   221 bits (563),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 105/145 (72%), Positives = 124/145 (86%), Gaps = 1/145 (1%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL+++ F GDPAATYAVADSIARS+DEAVAPELR+FL EHWSEAA ++G +QG+ HY+NL
Sbjct  478  FLLRSDFLGDPAATYAVADSIARSDDEAVAPELRAFLREHWSEAAFLDGLKQGQVHYMNL  537

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGVT  316
            VRI+  G SP+CLRDLP PLR+AIAYLPLYRECV AGGCL SQRLRGQLVE  +RL G +
Sbjct  538  VRILKWGGSPMCLRDLPGPLRVAIAYLPLYRECVAAGGCLFSQRLRGQLVEGVRRLGGGS  597

Query  315  LEDARQGRELLGILEHNLPTFLLNA  241
            LE   QGRELL ILEH+LP FL+++
Sbjct  598  LEGVSQGRELLAILEHHLPPFLVHS  622



>ref|XP_009618034.1| PREDICTED: ankyrin repeat protein SKIP35-like isoform X2 [Nicotiana 
tomentosiformis]
Length=600

 Score =   218 bits (555),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 124/147 (84%), Gaps = 3/147 (2%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDE--AVAPELRSFLHEHWSEAAAIEGKRQGEEHYL  502
            FL+++ F GDP ATYAVADSIA+S+D+  AV P L+SFL EHWSEAA  +G RQG+EHYL
Sbjct  451  FLLRSDFLGDPVATYAVADSIAKSDDDDDAVTPNLKSFLQEHWSEAAFFDGLRQGQEHYL  510

Query  501  NLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSG  322
            NLVRI+  GESPICL+DLP PLR+AIAYLPLYRE VKAGG LL Q+LRGQLVEAAKRL G
Sbjct  511  NLVRIVKWGESPICLKDLPGPLRVAIAYLPLYRESVKAGGYLLPQKLRGQLVEAAKRLGG  570

Query  321  VTLEDARQGRELLGILEHNLPTFLLNA  241
            V LE+A QG+ELL +LEH+LP FLLN 
Sbjct  571  VILEEANQGKELLAVLEHHLPPFLLNG  597



>ref|XP_009618028.1| PREDICTED: ankyrin repeat protein SKIP35-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009618029.1| PREDICTED: ankyrin repeat protein SKIP35-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009618030.1| PREDICTED: ankyrin repeat protein SKIP35-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009618031.1| PREDICTED: ankyrin repeat protein SKIP35-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009618033.1| PREDICTED: ankyrin repeat protein SKIP35-like isoform X1 [Nicotiana 
tomentosiformis]
Length=601

 Score =   218 bits (555),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 124/147 (84%), Gaps = 3/147 (2%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDE--AVAPELRSFLHEHWSEAAAIEGKRQGEEHYL  502
            FL+++ F GDP ATYAVADSIA+S+D+  AV P L+SFL EHWSEAA  +G RQG+EHYL
Sbjct  452  FLLRSDFLGDPVATYAVADSIAKSDDDDDAVTPNLKSFLQEHWSEAAFFDGLRQGQEHYL  511

Query  501  NLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSG  322
            NLVRI+  GESPICL+DLP PLR+AIAYLPLYRE VKAGG LL Q+LRGQLVEAAKRL G
Sbjct  512  NLVRIVKWGESPICLKDLPGPLRVAIAYLPLYRESVKAGGYLLPQKLRGQLVEAAKRLGG  571

Query  321  VTLEDARQGRELLGILEHNLPTFLLNA  241
            V LE+A QG+ELL +LEH+LP FLLN 
Sbjct  572  VILEEANQGKELLAVLEHHLPPFLLNG  598



>ref|XP_010313979.1| PREDICTED: ankyrin repeat protein SKIP35-like isoform X1 [Solanum 
lycopersicum]
 ref|XP_010313980.1| PREDICTED: ankyrin repeat protein SKIP35-like isoform X1 [Solanum 
lycopersicum]
Length=632

 Score =   218 bits (556),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 124/146 (85%), Gaps = 2/146 (1%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL+ + F  DP ATYAVADSIA+S+D+AV P LRSFL EHWSEAA  +G RQG++HYLN 
Sbjct  482  FLLHSDFLSDPVATYAVADSIAKSDDDAVPPGLRSFLREHWSEAAFSDGLRQGQQHYLNF  541

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAG-GCLLSQRLRGQLVEAAKRLSGV  319
            V+I+N GESPICL+DLP PLR+AIAYLPLYRE VKAG  CLLSQRLRGQLVEAAKRL GV
Sbjct  542  VQIVNYGESPICLKDLPGPLRVAIAYLPLYRESVKAGRCCLLSQRLRGQLVEAAKRLGGV  601

Query  318  TLEDARQGRELLGILEHNLPTFLLNA  241
             LE+A QG+EL+ +LEH+LP FLLNA
Sbjct  602  VLEEANQGKELVAVLEHHLPPFLLNA  627



>ref|XP_004251971.1| PREDICTED: ankyrin repeat protein SKIP35-like isoform X2 [Solanum 
lycopersicum]
Length=631

 Score =   218 bits (555),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 124/146 (85%), Gaps = 2/146 (1%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL+ + F  DP ATYAVADSIA+S+D+AV P LRSFL EHWSEAA  +G RQG++HYLN 
Sbjct  481  FLLHSDFLSDPVATYAVADSIAKSDDDAVPPGLRSFLREHWSEAAFSDGLRQGQQHYLNF  540

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAG-GCLLSQRLRGQLVEAAKRLSGV  319
            V+I+N GESPICL+DLP PLR+AIAYLPLYRE VKAG  CLLSQRLRGQLVEAAKRL GV
Sbjct  541  VQIVNYGESPICLKDLPGPLRVAIAYLPLYRESVKAGRCCLLSQRLRGQLVEAAKRLGGV  600

Query  318  TLEDARQGRELLGILEHNLPTFLLNA  241
             LE+A QG+EL+ +LEH+LP FLLNA
Sbjct  601  VLEEANQGKELVAVLEHHLPPFLLNA  626



>emb|CAN70678.1| hypothetical protein VITISV_044152 [Vitis vinifera]
Length=581

 Score =   216 bits (551),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 103/144 (72%), Positives = 126/144 (88%), Gaps = 1/144 (1%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL+++ F GDPAATYAVADSIARS+DEAVAPELR+FL ++WSEAA ++G R+G+EHY+N+
Sbjct  433  FLLRSDFLGDPAATYAVADSIARSDDEAVAPELRAFLRQNWSEAAFLDGLREGQEHYMNI  492

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGVT  316
            +RI+  GESPICLRDLP PL +AIAYLPLYRECV+A GCLLSQRLRGQLVEA +RL    
Sbjct  493  LRILKWGESPICLRDLPGPLLVAIAYLPLYRECVEASGCLLSQRLRGQLVEAVRRLGSGP  552

Query  315  LEDARQGRELLGILEHNLPTFLLN  244
            LE+ +QGRELL IL+H+LP FLL+
Sbjct  553  LEEVKQGRELLAILKHHLPPFLLS  576



>ref|XP_010650761.1| PREDICTED: ankyrin repeat protein SKIP35-like [Vitis vinifera]
 ref|XP_010650762.1| PREDICTED: ankyrin repeat protein SKIP35-like [Vitis vinifera]
Length=626

 Score =   216 bits (551),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 103/144 (72%), Positives = 126/144 (88%), Gaps = 1/144 (1%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL+++ F GDPAATYAVADSIARS+DEAVAPELR+FL ++WSEAA ++G R+G+EHY+N+
Sbjct  478  FLLRSDFLGDPAATYAVADSIARSDDEAVAPELRAFLRQNWSEAAFLDGLREGQEHYMNI  537

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGVT  316
            +RI+  GESPICLRDLP PL +AIAYLPLYRECV+A GCLLSQRLRGQLVEA +RL    
Sbjct  538  LRILKWGESPICLRDLPGPLLVAIAYLPLYRECVEASGCLLSQRLRGQLVEAVRRLGSGP  597

Query  315  LEDARQGRELLGILEHNLPTFLLN  244
            LE+ +QGRELL IL+H+LP FLL+
Sbjct  598  LEEVKQGRELLAILKHHLPPFLLS  621



>ref|XP_011005246.1| PREDICTED: ankyrin repeat protein SKIP35-like [Populus euphratica]
Length=625

 Score =   216 bits (549),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 100/144 (69%), Positives = 123/144 (85%), Gaps = 1/144 (1%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL+++ F GDP ATYAVADSIARS+DE+VAPELR+FL EHWSEAA ++G +QG+EHY+NL
Sbjct  477  FLLRSDFLGDPTATYAVADSIARSDDESVAPELRAFLREHWSEAAYLDGLKQGQEHYMNL  536

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGVT  316
            VRI+N G SPI LRDLP PLR+A+AYLPL+RECV  GGCLLSQ+ RGQLVEA ++L G +
Sbjct  537  VRILNWGGSPISLRDLPGPLRVAVAYLPLFRECVATGGCLLSQKQRGQLVEAVRKLGGGS  596

Query  315  LEDARQGRELLGILEHNLPTFLLN  244
            LED  QG+ELL +LEH LP FL++
Sbjct  597  LEDVSQGKELLAVLEHYLPPFLVH  620



>ref|XP_002309709.2| hypothetical protein POPTR_0007s00280g [Populus trichocarpa]
 gb|EEE90159.2| hypothetical protein POPTR_0007s00280g [Populus trichocarpa]
Length=625

 Score =   216 bits (549),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 120/147 (82%), Gaps = 0/147 (0%)
 Frame = -1

Query  684  G*PFFLVQTSFGDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHY  505
            G  F L     GDP ATYAVADSIARS+DE+VAPELR+FL EHWSEAA ++G +QG+EHY
Sbjct  474  GVAFLLCSDFLGDPTATYAVADSIARSDDESVAPELRAFLREHWSEAAYLDGLKQGQEHY  533

Query  504  LNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLS  325
            +NLVRI+N G SPI LRDLP PLR+A+AYLPL+RECV  GGCLLSQ+ RGQLVEA ++L 
Sbjct  534  MNLVRILNWGGSPISLRDLPGPLRVAVAYLPLFRECVATGGCLLSQKQRGQLVEAVRKLG  593

Query  324  GVTLEDARQGRELLGILEHNLPTFLLN  244
            G +LED  QG+ELL +LEH LP FL++
Sbjct  594  GGSLEDVSQGKELLAVLEHYLPPFLVH  620



>ref|XP_008243090.1| PREDICTED: ankyrin repeat protein SKIP35-like [Prunus mume]
Length=626

 Score =   214 bits (545),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 103/145 (71%), Positives = 120/145 (83%), Gaps = 1/145 (1%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL+ + F GDPAATYAVADSIARS+DE VAPEL++FL EHWSE A + G RQG+EHYL+L
Sbjct  478  FLLHSDFLGDPAATYAVADSIARSDDEGVAPELKAFLREHWSEEAFLRGIRQGQEHYLSL  537

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGVT  316
            VRI+  G SPICLRDLP+PLR+ IAYLPLYRECVKAGGCLLSQ+LRGQ+VEA  RL G  
Sbjct  538  VRILKWGGSPICLRDLPAPLRVTIAYLPLYRECVKAGGCLLSQKLRGQVVEAVSRLGGGV  597

Query  315  LEDARQGRELLGILEHNLPTFLLNA  241
            LE   Q  ELL +LEH+LP FLL++
Sbjct  598  LEGVSQCGELLAVLEHHLPPFLLHS  622



>ref|XP_006584140.1| PREDICTED: F-box/ankyrin repeat protein SKIP35-like isoform X1 
[Glycine max]
 ref|XP_006584141.1| PREDICTED: F-box/ankyrin repeat protein SKIP35-like isoform X2 
[Glycine max]
Length=605

 Score =   213 bits (543),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 102/144 (71%), Positives = 120/144 (83%), Gaps = 1/144 (1%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL+Q+ F GDPAATYAVAD IA+SEDEAVAPEL++FL EHWSE A  EG R G+EHY+NL
Sbjct  457  FLLQSDFLGDPAATYAVADIIAKSEDEAVAPELKTFLKEHWSEGAYKEGLRLGQEHYMNL  516

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGVT  316
            VRI+  GESPICLRDLP+PL +AIAYLPLYRECVK GGCL SQRLRGQLVEAA+R+    
Sbjct  517  VRIIKWGESPICLRDLPAPLTVAIAYLPLYRECVKTGGCLFSQRLRGQLVEAARRVGNRV  576

Query  315  LEDARQGRELLGILEHNLPTFLLN  244
            L++   GREL+ +LE +LP FLL+
Sbjct  577  LDEVTHGRELVVVLEQHLPHFLLH  600



>gb|KHN22618.1| F-box/ankyrin repeat protein SKIP35 [Glycine soja]
Length=605

 Score =   213 bits (542),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 102/144 (71%), Positives = 120/144 (83%), Gaps = 1/144 (1%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL+Q+ F GDPAATYAVAD IA+SEDEAVAPEL++FL EHWSE A  EG R G+EHY+NL
Sbjct  457  FLLQSDFLGDPAATYAVADIIAKSEDEAVAPELKTFLKEHWSEGAYKEGLRLGQEHYMNL  516

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGVT  316
            VRI+  GESPICLRDLP+PL +AIAYLPLYRECVK GGCL SQRLRGQLVEAA+R+    
Sbjct  517  VRIIKWGESPICLRDLPAPLTVAIAYLPLYRECVKTGGCLFSQRLRGQLVEAARRVGNRV  576

Query  315  LEDARQGRELLGILEHNLPTFLLN  244
            L++   GREL+ +LE +LP FLL+
Sbjct  577  LDEVTHGRELVVVLEQHLPHFLLH  600



>emb|CBI24769.3| unnamed protein product [Vitis vinifera]
Length=969

 Score =   216 bits (550),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 103/144 (72%), Positives = 126/144 (88%), Gaps = 1/144 (1%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL+++ F GDPAATYAVADSIARS+DEAVAPELR+FL ++WSEAA ++G R+G+EHY+N+
Sbjct  821  FLLRSDFLGDPAATYAVADSIARSDDEAVAPELRAFLRQNWSEAAFLDGLREGQEHYMNI  880

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGVT  316
            +RI+  GESPICLRDLP PL +AIAYLPLYRECV+A GCLLSQRLRGQLVEA +RL    
Sbjct  881  LRILKWGESPICLRDLPGPLLVAIAYLPLYRECVEASGCLLSQRLRGQLVEAVRRLGSGP  940

Query  315  LEDARQGRELLGILEHNLPTFLLN  244
            LE+ +QGRELL IL+H+LP FLL+
Sbjct  941  LEEVKQGRELLAILKHHLPPFLLS  964



>ref|XP_006478490.1| PREDICTED: F-box/ankyrin repeat protein SKIP35-like [Citrus sinensis]
Length=626

 Score =   213 bits (542),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 120/144 (83%), Gaps = 1/144 (1%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL+ + F GDPAATYAVADSIARS+DE VAP+L+ FL EHWSEAA ++G +QG+ HY+NL
Sbjct  478  FLLHSDFLGDPAATYAVADSIARSDDEGVAPDLKVFLREHWSEAAFLDGLKQGDVHYMNL  537

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGVT  316
            +RI+  GESPICLRDLP PLR+AI YLPLYRECVKAGG LLSQRLRGQLVEA +RL G  
Sbjct  538  LRILKWGESPICLRDLPGPLRVAITYLPLYRECVKAGGHLLSQRLRGQLVEAVRRLGGGV  597

Query  315  LEDARQGRELLGILEHNLPTFLLN  244
            LE+   G++LL ILEH+LP FL+ 
Sbjct  598  LEEVSHGKQLLAILEHHLPPFLVQ  621



>ref|XP_006441987.1| hypothetical protein CICLE_v10019310mg [Citrus clementina]
 ref|XP_006441988.1| hypothetical protein CICLE_v10019310mg [Citrus clementina]
 gb|ESR55227.1| hypothetical protein CICLE_v10019310mg [Citrus clementina]
 gb|ESR55228.1| hypothetical protein CICLE_v10019310mg [Citrus clementina]
Length=626

 Score =   213 bits (541),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 120/144 (83%), Gaps = 1/144 (1%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL+ + F GDPAATYAVADSIARS+DE VAP+L+ FL EHWSEAA ++G +QG+ HY+NL
Sbjct  478  FLLHSDFLGDPAATYAVADSIARSDDEGVAPDLKVFLREHWSEAAFLDGLKQGDVHYMNL  537

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGVT  316
            +RI+  GESPICLRDLP PLR+AI YLPLYRECVKAGG LLSQRLRGQLVEA +RL G  
Sbjct  538  LRILKWGESPICLRDLPGPLRVAITYLPLYRECVKAGGHLLSQRLRGQLVEAVRRLGGGV  597

Query  315  LEDARQGRELLGILEHNLPTFLLN  244
            L++   GR+LL ILEH+LP FL+ 
Sbjct  598  LQEVSHGRQLLAILEHHLPPFLVQ  621



>ref|XP_010251448.1| PREDICTED: ankyrin repeat protein SKIP35-like [Nelumbo nucifera]
 ref|XP_010251449.1| PREDICTED: ankyrin repeat protein SKIP35-like [Nelumbo nucifera]
Length=625

 Score =   213 bits (541),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 99/145 (68%), Positives = 122/145 (84%), Gaps = 1/145 (1%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL+ ++F GDPAATYAVADSIARSEDEAVAP+L++FL EHWSEAA ++G R  ++HY+N+
Sbjct  477  FLLHSNFLGDPAATYAVADSIARSEDEAVAPDLKAFLQEHWSEAAFLDGLRHEQDHYVNV  536

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGVT  316
             RI+  G SP+CLRDLP PL++AI YLPLYREC   GGCL SQRLRGQLVEAA+RLSG  
Sbjct  537  TRILKWGGSPLCLRDLPGPLKVAITYLPLYRECFAMGGCLFSQRLRGQLVEAARRLSGRP  596

Query  315  LEDARQGRELLGILEHNLPTFLLNA  241
            +++A QGRELL +LEH+LP FLL +
Sbjct  597  VDEASQGRELLAVLEHHLPPFLLGS  621



>ref|XP_011074019.1| PREDICTED: ankyrin repeat protein SKIP35-like [Sesamum indicum]
 ref|XP_011074020.1| PREDICTED: ankyrin repeat protein SKIP35-like [Sesamum indicum]
 ref|XP_011074021.1| PREDICTED: ankyrin repeat protein SKIP35-like [Sesamum indicum]
Length=640

 Score =   213 bits (541),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 103/145 (71%), Positives = 121/145 (83%), Gaps = 1/145 (1%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL+ + F GDPAATYAVADSIARS+DEAVAPEL+SFL EHWSEAA ++G R+GE H+ NL
Sbjct  494  FLLHSDFLGDPAATYAVADSIARSDDEAVAPELKSFLREHWSEAAFLDGLREGEAHFSNL  553

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGVT  316
            VRI+  G SPICLRDLP+PLR+A+AYLPLYRECVKAGG LLSQR RGQLVEAA+RL G  
Sbjct  554  VRILKWGNSPICLRDLPAPLRVAVAYLPLYRECVKAGGRLLSQRHRGQLVEAARRLGGQV  613

Query  315  LEDARQGRELLGILEHNLPTFLLNA  241
            L++  Q RELL +LEH+LP F +  
Sbjct  614  LDEPGQKRELLAVLEHHLPPFFIGG  638



>ref|XP_007026463.1| Ankyrin repeat family protein isoform 1 [Theobroma cacao]
 gb|EOY06965.1| Ankyrin repeat family protein isoform 1 [Theobroma cacao]
Length=620

 Score =   212 bits (540),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 102/145 (70%), Positives = 122/145 (84%), Gaps = 1/145 (1%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL+ + F GD AATYAVADSIARS+DEAVAPEL++FL EHWSEAA ++G +QG+E Y+NL
Sbjct  472  FLLHSDFLGDAAATYAVADSIARSDDEAVAPELKAFLQEHWSEAAFLDGLKQGQEQYMNL  531

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGVT  316
            +RI+  GESPICLRDLP+PLR+AI YLPLYREC++ GG LLSQRLRGQLVEA + L G  
Sbjct  532  MRILKRGESPICLRDLPAPLRVAITYLPLYRECIEVGGRLLSQRLRGQLVEAVQMLGGGA  591

Query  315  LEDARQGRELLGILEHNLPTFLLNA  241
            LE+  QGRELL ILEH+LP FL+ A
Sbjct  592  LEEVSQGRELLAILEHHLPPFLVRA  616



>gb|KEH32772.1| F-box/ankyrin repeat SKIP35-like protein [Medicago truncatula]
Length=600

 Score =   212 bits (539),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 118/143 (83%), Gaps = 1/143 (1%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL+Q+ F GDPAATYAVAD IA+ EDEAVAPEL++FL EHWSE A IEG + G+EHY+NL
Sbjct  452  FLLQSDFLGDPAATYAVADIIAKLEDEAVAPELKAFLKEHWSEGAYIEGLKLGQEHYMNL  511

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGVT  316
            VRI+  GESPICLRDLPSPL +AIAYLPLYRECVKAGGCL SQRLRGQLVEAA+RL    
Sbjct  512  VRIIERGESPICLRDLPSPLTVAIAYLPLYRECVKAGGCLFSQRLRGQLVEAARRLGDRV  571

Query  315  LEDARQGRELLGILEHNLPTFLL  247
             ++    R+LL ILE +LP FLL
Sbjct  572  FDEVTNARDLLVILERHLPQFLL  594



>gb|KJB11213.1| hypothetical protein B456_001G247600 [Gossypium raimondii]
 gb|KJB11214.1| hypothetical protein B456_001G247600 [Gossypium raimondii]
Length=620

 Score =   211 bits (537),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 100/145 (69%), Positives = 122/145 (84%), Gaps = 1/145 (1%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL+ + F GD AATYAVADSIA+S+DEAVAPELR+F+ EHWSEAA ++G +QG+EHY+ L
Sbjct  472  FLLHSDFLGDAAATYAVADSIAKSDDEAVAPELRAFVQEHWSEAAFLDGLKQGQEHYMKL  531

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGVT  316
            +RI+  GESPICLRDLP+PLR+ IAY+PLYRECV+ GG LLSQRLRGQLVEA + L G +
Sbjct  532  MRILKRGESPICLRDLPAPLRVGIAYMPLYRECVEVGGRLLSQRLRGQLVEAVRMLGGGS  591

Query  315  LEDARQGRELLGILEHNLPTFLLNA  241
            LE+  QGRELL  LEH+LP FL+ A
Sbjct  592  LEEVSQGRELLATLEHHLPPFLVRA  616



>ref|XP_007203611.1| hypothetical protein PRUPE_ppa002867mg [Prunus persica]
 gb|EMJ04810.1| hypothetical protein PRUPE_ppa002867mg [Prunus persica]
Length=626

 Score =   211 bits (537),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 102/145 (70%), Positives = 120/145 (83%), Gaps = 1/145 (1%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL+ + F GDPAATYAVADSIARS+DEAVAPEL++FL EHWSE A + G R G+EHYL+L
Sbjct  478  FLLHSDFLGDPAATYAVADSIARSDDEAVAPELKAFLREHWSEEAFLRGIRLGQEHYLSL  537

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGVT  316
            VRI+  G SPICLRDLP+PLR+ IAYLPLYRECVKAGGCLLSQ+LRG++VEA  RL G  
Sbjct  538  VRILKWGGSPICLRDLPAPLRVTIAYLPLYRECVKAGGCLLSQKLRGKVVEAVSRLGGGV  597

Query  315  LEDARQGRELLGILEHNLPTFLLNA  241
            LE   Q  ELL +LEH+LP FLL++
Sbjct  598  LEGVSQCGELLAVLEHHLPPFLLHS  622



>gb|AJF94393.1| F-box/ankyrin repeat protein SKIP35 [Gossypium hirsutum]
Length=620

 Score =   210 bits (535),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 100/145 (69%), Positives = 122/145 (84%), Gaps = 1/145 (1%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL+ + F GD AATYAVADSIA+S+DEAVAPELR+F+ EHWSEAA ++G +QG+EHY+ L
Sbjct  472  FLLHSDFLGDAAATYAVADSIAKSDDEAVAPELRAFVQEHWSEAAFLDGLKQGQEHYMKL  531

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGVT  316
            +RI+  GESPICLRDLP+PLR+ IAY+PLYRECV+ GG LLSQRLRGQLVEA + L G +
Sbjct  532  MRILKRGESPICLRDLPAPLRVGIAYIPLYRECVEVGGRLLSQRLRGQLVEAVRMLGGGS  591

Query  315  LEDARQGRELLGILEHNLPTFLLNA  241
            LE+  QGRELL  LEH+LP FL+ A
Sbjct  592  LEEVSQGRELLATLEHHLPPFLVRA  616



>ref|XP_004288739.1| PREDICTED: ankyrin repeat protein SKIP35-like [Fragaria vesca 
subsp. vesca]
 ref|XP_011466463.1| PREDICTED: ankyrin repeat protein SKIP35-like [Fragaria vesca 
subsp. vesca]
 ref|XP_011466484.1| PREDICTED: ankyrin repeat protein SKIP35-like [Fragaria vesca 
subsp. vesca]
Length=612

 Score =   209 bits (531),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 119/143 (83%), Gaps = 1/143 (1%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL+++ F GDPAATYAVAD+IARS++E VA ELR+FL EHWSE A ++G+RQ +EHY+NL
Sbjct  464  FLLRSDFLGDPAATYAVADNIARSDEEGVAHELRAFLREHWSEEAFLDGRRQEQEHYMNL  523

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGVT  316
            VRI+  G+SPICLRDLP+PLR  IAYLPLYRECVKAGGCLLSQRLRGQL+EA + L G  
Sbjct  524  VRILKWGDSPICLRDLPAPLRTTIAYLPLYRECVKAGGCLLSQRLRGQLIEAVRTLGGGI  583

Query  315  LEDARQGRELLGILEHNLPTFLL  247
            LE   Q +ELL  LEH+LP+F L
Sbjct  584  LEGVSQCKELLAFLEHHLPSFFL  606



>gb|KHN27707.1| F-box/ankyrin repeat protein SKIP35 [Glycine soja]
Length=605

 Score =   209 bits (531),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 102/144 (71%), Positives = 119/144 (83%), Gaps = 1/144 (1%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL+Q+ F GDPAATYAVAD IA+SEDEAVAPEL++FL EHWSE A  EG R G+EHY+NL
Sbjct  457  FLLQSDFLGDPAATYAVADIIAKSEDEAVAPELKTFLKEHWSEGAYKEGLRLGQEHYMNL  516

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGVT  316
            VRI+  GESPICLRDLP+PL +AIAYLPLYRECVK GG L SQRLRGQLVEAA+RL    
Sbjct  517  VRIIRWGESPICLRDLPAPLTVAIAYLPLYRECVKTGGFLFSQRLRGQLVEAARRLGNRV  576

Query  315  LEDARQGRELLGILEHNLPTFLLN  244
            L++   GREL+ +LE +LP FLL+
Sbjct  577  LDEVIHGRELVVVLEQHLPHFLLH  600



>ref|XP_006600252.1| PREDICTED: F-box/ankyrin repeat protein SKIP35-like isoform X1 
[Glycine max]
 ref|XP_006600253.1| PREDICTED: F-box/ankyrin repeat protein SKIP35-like isoform X2 
[Glycine max]
 ref|XP_006600254.1| PREDICTED: F-box/ankyrin repeat protein SKIP35-like isoform X3 
[Glycine max]
 ref|XP_006600255.1| PREDICTED: F-box/ankyrin repeat protein SKIP35-like isoform X4 
[Glycine max]
Length=605

 Score =   208 bits (530),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 102/144 (71%), Positives = 119/144 (83%), Gaps = 1/144 (1%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL+Q+ F GDPAATYAVAD IA+SEDEAVAPEL++FL EHWSE A  EG R G+EHY+NL
Sbjct  457  FLLQSDFLGDPAATYAVADIIAKSEDEAVAPELKTFLKEHWSEGAYKEGLRLGQEHYMNL  516

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGVT  316
            VRI+  GESPICLRDLP+PL +AIAYLPLYRECVK GG L SQRLRGQLVEAA+RL    
Sbjct  517  VRIIRWGESPICLRDLPAPLTVAIAYLPLYRECVKTGGFLFSQRLRGQLVEAARRLGNRV  576

Query  315  LEDARQGRELLGILEHNLPTFLLN  244
            L++   GREL+ +LE +LP FLL+
Sbjct  577  LDEVIHGRELVVVLEQHLPHFLLH  600



>ref|XP_010277855.1| PREDICTED: ankyrin repeat protein SKIP35 [Nelumbo nucifera]
 ref|XP_010277856.1| PREDICTED: ankyrin repeat protein SKIP35 [Nelumbo nucifera]
Length=626

 Score =   209 bits (531),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 99/145 (68%), Positives = 125/145 (86%), Gaps = 1/145 (1%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL+++ F GDPAATYAVAD+IARSEDEAVAP+L++FL EHWSEAA ++G R  ++HY+N+
Sbjct  478  FLLRSDFLGDPAATYAVADNIARSEDEAVAPDLKAFLREHWSEAAFLDGLRCEQDHYVNV  537

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGVT  316
            +RI+N G SP+CLRDLP PL++AI YLPLYREC+KAGG L SQRLRGQL+EAA+RL G  
Sbjct  538  MRILNWGGSPMCLRDLPGPLKVAITYLPLYRECLKAGGRLFSQRLRGQLLEAARRLGGGP  597

Query  315  LEDARQGRELLGILEHNLPTFLLNA  241
            +++A QGRELL +LEH+LP FLL A
Sbjct  598  VDEASQGRELLAVLEHHLPPFLLAA  622



>ref|XP_007153901.1| hypothetical protein PHAVU_003G074400g [Phaseolus vulgaris]
 gb|ESW25895.1| hypothetical protein PHAVU_003G074400g [Phaseolus vulgaris]
Length=610

 Score =   208 bits (530),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 120/144 (83%), Gaps = 1/144 (1%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL+Q+ F GDPAATYAVAD IA+SEDEAVAPEL++FL EHWSE A  EG R G+EH++NL
Sbjct  462  FLLQSDFLGDPAATYAVADIIAKSEDEAVAPELKTFLKEHWSEGAYKEGLRLGQEHHMNL  521

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGVT  316
            +RI+  GESPICLRDLP+PL +AIAYLPLYRECVKAGGCL SQRLRGQLVEAA+RL    
Sbjct  522  MRIIKWGESPICLRDLPAPLTVAIAYLPLYRECVKAGGCLYSQRLRGQLVEAARRLGNRV  581

Query  315  LEDARQGRELLGILEHNLPTFLLN  244
            L++   G EL+ +LE +LP FLL+
Sbjct  582  LDEVSHGGELVVVLEQHLPHFLLH  605



>ref|XP_010672531.1| PREDICTED: ankyrin repeat protein SKIP35-like [Beta vulgaris 
subsp. vulgaris]
Length=622

 Score =   206 bits (525),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 118/142 (83%), Gaps = 1/142 (1%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL+++ F GDP  TYAVADSIARS+D +VA ELR+FL EHWSE A  EG  QG+EH++N+
Sbjct  474  FLLRSDFLGDPVGTYAVADSIARSDDNSVASELRAFLQEHWSEDAFTEGLLQGQEHFVNM  533

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGVT  316
             RI+N GESP+CLRDLPSPLR+AIAYLP+YREC+KAGGCLLSQ+LRGQLVEA +RL G  
Sbjct  534  FRILNRGESPLCLRDLPSPLRVAIAYLPVYRECMKAGGCLLSQKLRGQLVEAVRRLGGGV  593

Query  315  LEDARQGRELLGILEHNLPTFL  250
            L D+ Q RELL +LEH+L  FL
Sbjct  594  LGDSSQCRELLAVLEHHLRPFL  615



>ref|XP_010087440.1| hypothetical protein L484_019643 [Morus notabilis]
 gb|EXB29121.1| hypothetical protein L484_019643 [Morus notabilis]
Length=611

 Score =   204 bits (520),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 99/144 (69%), Positives = 120/144 (83%), Gaps = 1/144 (1%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL+++ F GDPAATYAVAD I+RSED AVAPEL+SFL EHWSEAA ++G RQG+EHY+N+
Sbjct  463  FLLRSDFLGDPAATYAVADIISRSEDGAVAPELKSFLQEHWSEAAFLDGLRQGQEHYMNI  522

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGVT  316
            +RI+  G SPI LRDLP+PLR+ IAYLPLYRECV+AGG LLSQRLRG+LVEA  RL G  
Sbjct  523  MRILKWGGSPISLRDLPAPLRVTIAYLPLYRECVEAGGPLLSQRLRGKLVEAVTRLDGAV  582

Query  315  LEDARQGRELLGILEHNLPTFLLN  244
            L++  Q  ELL +LEH+LP FLL+
Sbjct  583  LKEVGQSSELLAVLEHHLPPFLLH  606



>ref|XP_010067585.1| PREDICTED: ankyrin repeat protein SKIP35-like [Eucalyptus grandis]
 gb|KCW88000.1| hypothetical protein EUGRSUZ_A00409 [Eucalyptus grandis]
Length=627

 Score =   204 bits (520),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 114/143 (80%), Gaps = 1/143 (1%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL+++ F GDP ATYAVADSIARSEDE++ P LR+FL EHWSEAA  +G RQG+ HY+N 
Sbjct  479  FLLRSDFLGDPVATYAVADSIARSEDESIDPVLRAFLQEHWSEAAFFDGLRQGQMHYMNF  538

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGVT  316
            +RI+  GESP+CL D+P PLR AIAYLPLYREC  AGGCLLSQRLRGQLVEA +RL    
Sbjct  539  MRILKRGESPLCLMDIPGPLRAAIAYLPLYRECTDAGGCLLSQRLRGQLVEAVRRLENAA  598

Query  315  LEDARQGRELLGILEHNLPTFLL  247
            LE  R  RELL ILEH+LP FLL
Sbjct  599  LEPVRPCRELLSILEHHLPRFLL  621



>ref|XP_010930324.1| PREDICTED: ankyrin repeat protein SKIP35 [Elaeis guineensis]
 ref|XP_010930325.1| PREDICTED: ankyrin repeat protein SKIP35 [Elaeis guineensis]
Length=637

 Score =   204 bits (519),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 102/158 (65%), Positives = 122/158 (77%), Gaps = 7/158 (4%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL++++F  DPAATYAVADSI+RS+DEAVAPEL++FL EHWSEAA  EG   G+EHY+N 
Sbjct  484  FLLRSNFLSDPAATYAVADSISRSDDEAVAPELKAFLREHWSEAAFTEGMSSGQEHYVNF  543

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGVT  316
            VRI+  G SPICLRDLP PL  AIAYLPLYRECVK+GG LL QRLRGQLVEAA RL    
Sbjct  544  VRILRRGCSPICLRDLPPPLGTAIAYLPLYRECVKSGGQLLPQRLRGQLVEAASRLGNKP  603

Query  315  LEDARQGRELLGILEHNLPTFLLNA*IKLITPHTHTMH  202
            ++   QG+ELL +LEH+LP FL+       +P T +MH
Sbjct  604  VDRVSQGKELLAVLEHHLPRFLIQ------SPSTLSMH  635



>ref|XP_008394247.1| PREDICTED: ankyrin repeat protein SKIP35 [Malus domestica]
Length=620

 Score =   203 bits (517),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 116/142 (82%), Gaps = 1/142 (1%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL+ + F GDP ATYAVA+SIA S+DE VAPEL++FL  HWS+ A ++G RQG++HY+N+
Sbjct  478  FLLHSDFLGDPVATYAVANSIALSDDEGVAPELKAFLRVHWSQEAFLDGIRQGQDHYINI  537

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGVT  316
            +RI+  GESPICLRDLP+PL IAI YLPLYRECV+AGGCLLSQRLRGQLVEA  RL G  
Sbjct  538  LRILKWGESPICLRDLPTPLGIAIGYLPLYRECVRAGGCLLSQRLRGQLVEAVSRLGGGV  597

Query  315  LEDARQGRELLGILEHNLPTFL  250
            LE A Q +ELL +LEH+LP F 
Sbjct  598  LEGAGQCKELLAVLEHHLPPFF  619



>ref|XP_008445478.1| PREDICTED: ankyrin repeat protein SKIP35-like [Cucumis melo]
 ref|XP_008445479.1| PREDICTED: ankyrin repeat protein SKIP35-like [Cucumis melo]
Length=623

 Score =   203 bits (516),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 96/144 (67%), Positives = 120/144 (83%), Gaps = 1/144 (1%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL+ ++F GD +ATYAVADSI++S DE+VAPELR+FL EHWSEAA ++G +QG+E+YLN 
Sbjct  475  FLLHSNFLGDLSATYAVADSISKSSDESVAPELRAFLREHWSEAAYVDGLKQGQENYLNF  534

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGVT  316
            VRI+  G SPI LRD+P+PLR+AIAYLPLYREC+K  G L SQ+LRGQLVEAA+RL G  
Sbjct  535  VRILRWGGSPISLRDIPAPLRVAIAYLPLYRECIKVNGYLFSQKLRGQLVEAARRLGGGV  594

Query  315  LEDARQGRELLGILEHNLPTFLLN  244
            LE+   GRELL +LEH+LP FLL+
Sbjct  595  LEEVSNGRELLAVLEHHLPPFLLH  618



>gb|KHG16914.1| F-box/ankyrin repeat SKIP35 -like protein [Gossypium arboreum]
Length=620

 Score =   202 bits (515),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 96/143 (67%), Positives = 119/143 (83%), Gaps = 1/143 (1%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL+ + F GD AATYAVADSIA+S+DEAVAPELR+F+ EHWSEAA ++G +QG++HY+ L
Sbjct  472  FLLHSDFLGDAAATYAVADSIAKSDDEAVAPELRAFVQEHWSEAAFLDGLKQGQQHYMKL  531

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGVT  316
            +RI+  GESPICLRDLP+PLR+ IAY+PLYRECV+ GG LLSQRLRGQLVEA + L G +
Sbjct  532  MRILKRGESPICLRDLPAPLRVGIAYMPLYRECVEVGGRLLSQRLRGQLVEAVRMLGGGS  591

Query  315  LEDARQGRELLGILEHNLPTFLL  247
            LE+  Q  ELL  LEH+LP FL+
Sbjct  592  LEEVSQAGELLATLEHHLPPFLV  614



>ref|XP_011085079.1| PREDICTED: ankyrin repeat protein SKIP35-like [Sesamum indicum]
 ref|XP_011085080.1| PREDICTED: ankyrin repeat protein SKIP35-like [Sesamum indicum]
Length=645

 Score =   202 bits (515),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 96/133 (72%), Positives = 113/133 (85%), Gaps = 0/133 (0%)
 Frame = -1

Query  648  DPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGES  469
            DPAATY+VADSIARS DEAVAPEL++FL EHWSEAA ++G RQGE H+ NLV+I+   +S
Sbjct  506  DPAATYSVADSIARSNDEAVAPELKAFLQEHWSEAAFLDGLRQGEAHFSNLVQILRYSQS  565

Query  468  PICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGVTLEDARQGRE  289
            PICL+DLP PLR+AIAYLPLYREC++AGG LLSQR RGQLVEAA+RL GV L+   Q RE
Sbjct  566  PICLQDLPGPLRVAIAYLPLYRECIEAGGSLLSQRHRGQLVEAARRLGGVVLDKPNQRRE  625

Query  288  LLGILEHNLPTFL  250
            LL +LEH+LP FL
Sbjct  626  LLAVLEHHLPPFL  638



>ref|XP_004144185.1| PREDICTED: F-box/ankyrin repeat protein SKIP35-like [Cucumis 
sativus]
 ref|XP_004158248.1| PREDICTED: F-box/ankyrin repeat protein SKIP35-like [Cucumis 
sativus]
 gb|KGN47633.1| hypothetical protein Csa_6G366310 [Cucumis sativus]
Length=623

 Score =   201 bits (510),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 95/144 (66%), Positives = 119/144 (83%), Gaps = 1/144 (1%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL+ ++F GD +ATYAVADSI++S DE+VAPELR+FL EHWSEAA ++G +QG+E+YLN 
Sbjct  475  FLLHSNFLGDVSATYAVADSISKSSDESVAPELRAFLREHWSEAAYVDGLKQGQENYLNF  534

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGVT  316
            VRI+  G  PI LRD+P+PLR+AIAYLPLYREC+K  G L SQ+LRGQLVEAA+RL G  
Sbjct  535  VRILRWGGFPISLRDIPAPLRVAIAYLPLYRECIKVNGYLFSQKLRGQLVEAARRLGGGV  594

Query  315  LEDARQGRELLGILEHNLPTFLLN  244
            LE+   GRELL +LEH+LP FLL+
Sbjct  595  LEEVSNGRELLAVLEHHLPPFLLH  618



>ref|XP_008801302.1| PREDICTED: ankyrin repeat protein SKIP35 [Phoenix dactylifera]
Length=637

 Score =   199 bits (507),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 99/152 (65%), Positives = 118/152 (78%), Gaps = 1/152 (1%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL+++ F  DPAATY+VADSI+RS DEAVAPEL++FL EHWSEAA  EG   G+EHY+N 
Sbjct  484  FLLRSDFLSDPAATYSVADSISRSNDEAVAPELKAFLREHWSEAAFSEGMSSGQEHYVNF  543

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGVT  316
            +RI+  G SPICLRDLPSPL  AIAYLPLYRECV+AGG LL QRLRGQLVEAA RL    
Sbjct  544  MRILRRGCSPICLRDLPSPLATAIAYLPLYRECVQAGGQLLPQRLRGQLVEAASRLGNRP  603

Query  315  LEDARQGRELLGILEHNLPTFLLNA*IKLITP  220
            ++   QG+ELL +LEH+LP FL+ +   L  P
Sbjct  604  VDRGSQGKELLAVLEHHLPRFLIQSPSTLSMP  635



>gb|EYU22360.1| hypothetical protein MIMGU_mgv1a017835mg [Erythranthe guttata]
Length=645

 Score =   199 bits (505),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 96/144 (67%), Positives = 116/144 (81%), Gaps = 1/144 (1%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL+++ F  DPAATYAVADSIA S+DEA+AP+LR+FL EHWSE A +EG R+GE H+ N+
Sbjct  498  FLLRSDFLADPAATYAVADSIATSDDEAIAPQLRAFLREHWSEEAFLEGVREGEVHFRNI  557

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGVT  316
            V IM  GESPICL DLP PLR+A+AYLPLYRECVKAGG LLSQR RGQL+EA++RL G  
Sbjct  558  VEIMKWGESPICLGDLPGPLRVAVAYLPLYRECVKAGGRLLSQRHRGQLLEASRRLGGGV  617

Query  315  LEDARQGRELLGILEHNLPTFLLN  244
            L+   Q  EL+ +LEHNLP F L+
Sbjct  618  LDGPGQKGELMAVLEHNLPPFFLD  641



>ref|XP_004499381.1| PREDICTED: F-box/ankyrin repeat protein SKIP35-like [Cicer arietinum]
Length=611

 Score =   198 bits (503),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 116/143 (81%), Gaps = 1/143 (1%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL+++ F GDPAATYAVAD IA+ EDEAVAPEL++FL EHWSE A IEG R G+EHY NL
Sbjct  462  FLLESDFLGDPAATYAVADIIAKLEDEAVAPELKAFLKEHWSEGAYIEGLRLGQEHYTNL  521

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGVT  316
            VRI+  G+SPICLRDLP+PL +AIAYLPLYRECVKAGG L SQRLRGQ+VEAA+RL    
Sbjct  522  VRIIKGGDSPICLRDLPAPLTVAIAYLPLYRECVKAGGRLFSQRLRGQMVEAARRLGERV  581

Query  315  LEDARQGRELLGILEHNLPTFLL  247
             ++   G +LL ILE +LP FLL
Sbjct  582  FDEVTYGGDLLVILERHLPHFLL  604



>ref|XP_008354473.1| PREDICTED: ankyrin repeat protein SKIP35-like [Malus domestica]
Length=467

 Score =   191 bits (485),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 118/142 (83%), Gaps = 1/142 (1%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL+ + F GDPAATYAVA+SIA S+DE VAPEL++FL  HWSE A ++G RQG+EHY+N+
Sbjct  325  FLLHSDFLGDPAATYAVANSIALSDDEGVAPELKAFLWGHWSEEAFLDGIRQGQEHYMNI  384

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGVT  316
            VRI+  GESPICLRDLP+PL IAI YLPLYRECV+AGGCLLSQRLRGQLVEA +RL G  
Sbjct  385  VRILKWGESPICLRDLPTPLGIAIGYLPLYRECVRAGGCLLSQRLRGQLVEAVRRLGGGV  444

Query  315  LEDARQGRELLGILEHNLPTFL  250
            LE A Q +ELL +LEH+LP F 
Sbjct  445  LEGASQCKELLALLEHHLPPFF  466



>ref|XP_008389252.1| PREDICTED: ankyrin repeat protein SKIP35 [Malus domestica]
Length=467

 Score =   191 bits (485),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 118/142 (83%), Gaps = 1/142 (1%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL+ + F GDPAATYAVA+SIA S+DE VAPEL++FL  HWSE A ++G RQG+EHY+N+
Sbjct  325  FLLHSDFLGDPAATYAVANSIALSDDEGVAPELKAFLWGHWSEEAFLDGIRQGQEHYMNI  384

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGVT  316
            VRI+  GESPICLRDLP+PL IAI YLPLYRECV+AGGCLLSQRLRGQLVEA +RL G  
Sbjct  385  VRILKWGESPICLRDLPTPLGIAIGYLPLYRECVRAGGCLLSQRLRGQLVEAVRRLGGGV  444

Query  315  LEDARQGRELLGILEHNLPTFL  250
            LE A Q +ELL +LEH+LP F 
Sbjct  445  LEGASQCKELLALLEHHLPPFF  466



>ref|XP_011004557.1| PREDICTED: ankyrin repeat protein SKIP35 [Populus euphratica]
Length=625

 Score =   194 bits (492),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 114/144 (79%), Gaps = 1/144 (1%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL+ + F GDP ATYAVADSIARS+DE+VAPEL++FL E+WSEAA ++G +QG+EHY+NL
Sbjct  477  FLLHSDFLGDPTATYAVADSIARSDDESVAPELKAFLRENWSEAAFLDGLKQGQEHYMNL  536

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGVT  316
            V I+N G SPI LR LP PLR+A+AYLPLYREC   GG L SQR RG LVEA +RL G +
Sbjct  537  VMILNWGRSPISLRHLPGPLRVAVAYLPLYRECAATGGRLFSQRQRGLLVEAVRRLGGGS  596

Query  315  LEDARQGRELLGILEHNLPTFLLN  244
             ED  QG+ELL +LE  LP FL++
Sbjct  597  SEDVSQGKELLAVLERYLPQFLVH  620



>ref|XP_006397583.1| hypothetical protein EUTSA_v10001361mg [Eutrema salsugineum]
 gb|ESQ39036.1| hypothetical protein EUTSA_v10001361mg [Eutrema salsugineum]
Length=618

 Score =   193 bits (491),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 90/147 (61%), Positives = 122/147 (83%), Gaps = 3/147 (2%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL+++ F GDPAATY+VAD+IA+SEDE+V  EL+SFL EHWSEAA  +G R+  E+++N 
Sbjct  469  FLLKSDFLGDPAATYSVADTIAKSEDESVPSELKSFLQEHWSEAAFNQGLRESRENFMNF  528

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSG--  322
            +R++ +GES ICL+DLP+PLR+AIAY+PLYRECVKAGG LLSQ+LRGQL+EAAK+L G  
Sbjct  529  MRVLKIGESAICLKDLPAPLRVAIAYMPLYRECVKAGGRLLSQKLRGQLMEAAKQLQGFD  588

Query  321  VTLEDARQGRELLGILEHNLPTFLLNA  241
            V  E+  +G +L+ +LEH+LP F++ A
Sbjct  589  VDTEEVYKGHQLMAVLEHHLPLFMVKA  615



>gb|KDO49748.1| hypothetical protein CISIN_1g006847mg [Citrus sinensis]
Length=629

 Score =   192 bits (489),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 91/128 (71%), Positives = 106/128 (83%), Gaps = 1/128 (1%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL+ + F GDPAATYAVADSIARS+DE VAP+L+ FL EHWSEAA ++G +QG+ HY+NL
Sbjct  478  FLLHSDFLGDPAATYAVADSIARSDDEGVAPDLKVFLREHWSEAAFLDGLKQGDVHYMNL  537

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGVT  316
            +RI+  GESPICLRDLP PLR+AI YLPLYRECVKAGG LLSQRLRGQLVEA +RL G  
Sbjct  538  LRILKWGESPICLRDLPGPLRVAITYLPLYRECVKAGGHLLSQRLRGQLVEAVRRLGGGV  597

Query  315  LEDARQGR  292
            LE+   G 
Sbjct  598  LEEVSHGN  605



>ref|XP_006372306.1| hypothetical protein POPTR_0017s00410g [Populus trichocarpa]
 ref|XP_006372307.1| hypothetical protein POPTR_0017s00410g [Populus trichocarpa]
 gb|ERP50103.1| hypothetical protein POPTR_0017s00410g [Populus trichocarpa]
 gb|ERP50104.1| hypothetical protein POPTR_0017s00410g [Populus trichocarpa]
Length=625

 Score =   192 bits (489),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 91/144 (63%), Positives = 114/144 (79%), Gaps = 1/144 (1%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL+ + F GDP ATYAVADSIARS+DE+VAPEL++FL E+WSEAA ++G +QG+EHY+NL
Sbjct  477  FLLHSDFLGDPTATYAVADSIARSDDESVAPELKAFLRENWSEAAFLDGLKQGQEHYMNL  536

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGVT  316
            V I+N G SPI LR LP PLR+A+AYLPLYREC    G L SQ+ RG LVEA ++L G +
Sbjct  537  VMILNWGRSPISLRHLPGPLRVAVAYLPLYRECAATAGRLFSQKQRGLLVEAVRKLGGGS  596

Query  315  LEDARQGRELLGILEHNLPTFLLN  244
             ED  QG+ELL +LEH LP FL++
Sbjct  597  SEDVSQGKELLAVLEHYLPQFLVH  620



>gb|EYU36630.1| hypothetical protein MIMGU_mgv1a002704mg [Erythranthe guttata]
Length=645

 Score =   192 bits (489),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 96/144 (67%), Positives = 116/144 (81%), Gaps = 1/144 (1%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL+++ F  DPAATYAVADSIA S+DEA+AP+LR+FL EHWSE A +EG R+GE H+ N+
Sbjct  498  FLLRSDFLADPAATYAVADSIATSDDEAIAPQLRAFLREHWSEEAFLEGVREGEVHFRNI  557

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGVT  316
            V IM  GESPICL DLP PLR+A+AYLPLYRECVKAGG LLSQR RGQL+EA++RL G  
Sbjct  558  VEIMKWGESPICLGDLPGPLRVAVAYLPLYRECVKAGGRLLSQRHRGQLLEASRRLGGGD  617

Query  315  LEDARQGRELLGILEHNLPTFLLN  244
            L+   Q  EL+ +LEHNLP F L+
Sbjct  618  LDGPGQKGELMAVLEHNLPPFFLD  641



>ref|XP_010912734.1| PREDICTED: ankyrin repeat protein SKIP35-like [Elaeis guineensis]
Length=635

 Score =   192 bits (488),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 115/145 (79%), Gaps = 1/145 (1%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL+++ F  DPAATYAVADSIARS+DEAVAPEL++FL E+WSEAA  EG   G+EHY+N 
Sbjct  484  FLLRSDFLSDPAATYAVADSIARSDDEAVAPELKAFLKENWSEAAFSEGISSGQEHYVNF  543

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGVT  316
            +RI+  G SPICLRDLP PL IA+AYLPLYREC KAGG LL QRLRGQLVEAA RL    
Sbjct  544  MRILRRGCSPICLRDLPLPLVIAVAYLPLYRECAKAGGWLLPQRLRGQLVEAASRLGNGP  603

Query  315  LEDARQGRELLGILEHNLPTFLLNA  241
            ++    G+ELL +LEH+LP FL+ +
Sbjct  604  VDRCCPGKELLAVLEHHLPPFLIQS  628



>ref|XP_009366266.1| PREDICTED: ankyrin repeat protein SKIP35-like [Pyrus x bretschneideri]
 ref|XP_009366267.1| PREDICTED: ankyrin repeat protein SKIP35-like [Pyrus x bretschneideri]
 ref|XP_009366268.1| PREDICTED: ankyrin repeat protein SKIP35-like [Pyrus x bretschneideri]
Length=619

 Score =   192 bits (488),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 119/142 (84%), Gaps = 1/142 (1%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL+ ++F GDPAATYAVA+SIA S+DE +APELR+FL  HWSE A ++G +QG+EHY+N+
Sbjct  477  FLLHSNFMGDPAATYAVANSIALSDDEGIAPELRAFLRGHWSEEAFLDGIKQGQEHYMNI  536

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGVT  316
            VRI+  GESPICLRDLP+PL IAI YLPLYRECV+AGGCLLSQRLRGQLVEA +RL G  
Sbjct  537  VRILKWGESPICLRDLPTPLGIAIGYLPLYRECVRAGGCLLSQRLRGQLVEAVRRLGGGV  596

Query  315  LEDARQGRELLGILEHNLPTFL  250
            LE A Q +ELL +LEH+LP F 
Sbjct  597  LEGASQCKELLALLEHHLPPFF  618



>ref|XP_009379908.1| PREDICTED: ankyrin repeat protein SKIP35-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009379909.1| PREDICTED: ankyrin repeat protein SKIP35-like [Musa acuminata 
subsp. malaccensis]
Length=627

 Score =   191 bits (486),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 96/143 (67%), Positives = 110/143 (77%), Gaps = 1/143 (1%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL++ +F GDPAATYAVADSIARS DEAVAP LR+FL EHWSEAA  EG   G+ HY+N 
Sbjct  475  FLLRNNFLGDPAATYAVADSIARSSDEAVAPNLRAFLKEHWSEAAYAEGLSYGQNHYVNF  534

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGVT  316
            +RI+  G SPICL+DLP PL  AIAYLPLYREC + GG LL Q+LRGQLVEAA R+ G  
Sbjct  535  MRILRRGGSPICLKDLPPPLVTAIAYLPLYRECQEKGGQLLPQKLRGQLVEAASRVGGRP  594

Query  315  LEDARQGRELLGILEHNLPTFLL  247
            +E   Q RELL ILE +LPTF L
Sbjct  595  VEKNSQARELLAILEQHLPTFFL  617



>ref|XP_009390785.1| PREDICTED: ankyrin repeat protein SKIP35-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009390786.1| PREDICTED: ankyrin repeat protein SKIP35-like [Musa acuminata 
subsp. malaccensis]
Length=627

 Score =   191 bits (484),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 115/145 (79%), Gaps = 1/145 (1%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL+++ F GDPAATYAVADS+ARS DE+VA +LR+FL EHWSEAA  EG R G++H++N+
Sbjct  474  FLLRSDFLGDPAATYAVADSMARSSDESVASDLRAFLKEHWSEAAFAEGLRFGQDHFVNI  533

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGVT  316
            +RI   G SPI L+DLP PL  AIAYLPLYREC++AGG LL Q+LRGQLVEAA R+SG  
Sbjct  534  MRIFRRGSSPIHLKDLPQPLVTAIAYLPLYRECLEAGGQLLPQKLRGQLVEAAHRVSGRP  593

Query  315  LEDARQGRELLGILEHNLPTFLLNA  241
            +    Q REL+ ILEH+LPTF L A
Sbjct  594  VSKNSQTRELMAILEHHLPTFFLQA  618



>ref|XP_008781953.1| PREDICTED: ankyrin repeat protein SKIP35-like [Phoenix dactylifera]
Length=635

 Score =   189 bits (481),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 97/145 (67%), Positives = 115/145 (79%), Gaps = 1/145 (1%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL++++F  DPAATYAVADSIARS+DEAVAPEL++FL EHWSEAA  EG   G+EHY+N 
Sbjct  484  FLLRSNFLSDPAATYAVADSIARSDDEAVAPELKAFLKEHWSEAAFSEGMSSGQEHYVNF  543

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGVT  316
            + I+  G SPI LRDLP PL IAIAYLPLYR+CVKAGG LL QRLRGQLVEAA RL    
Sbjct  544  MWILRRGCSPIRLRDLPLPLVIAIAYLPLYRDCVKAGGRLLPQRLRGQLVEAASRLGNRP  603

Query  315  LEDARQGRELLGILEHNLPTFLLNA  241
            +    QG+ELL +LEH+LP FL+ +
Sbjct  604  VHIGCQGKELLAVLEHHLPPFLIQS  628



>ref|XP_009404918.1| PREDICTED: ankyrin repeat protein SKIP35-like [Musa acuminata 
subsp. malaccensis]
Length=620

 Score =   188 bits (477),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 109/147 (74%), Gaps = 0/147 (0%)
 Frame = -1

Query  684  G*PFFLVQTSFGDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHY  505
            G  F L     GDPAATYAVADSIARS DEAVAPELR+FL E WSEAA  EG   G++H+
Sbjct  469  GVAFLLCSDFLGDPAATYAVADSIARSNDEAVAPELRAFLLEQWSEAAFAEGLSSGQDHF  528

Query  504  LNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLS  325
            +N +RI+  G SPICL DLP PL   IAY+PLYREC++AGG LLSQ+LRGQLVEAA+R+ 
Sbjct  529  VNFMRILRRGCSPICLMDLPPPLAATIAYMPLYRECMEAGGQLLSQKLRGQLVEAARRIG  588

Query  324  GVTLEDARQGRELLGILEHNLPTFLLN  244
            G  ++D  Q  ELL ILE NLP F L 
Sbjct  589  GRWVDDDSQANELLEILERNLPRFFLQ  615



>gb|AAX96769.1| expressed protein [Oryza sativa Japonica Group]
Length=589

 Score =   187 bits (475),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 114/144 (79%), Gaps = 1/144 (1%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL++++F  DPAATYAVAD+IA+S DEAV  +LRSF+ EHWSEAA  EG    +EH++N 
Sbjct  445  FLLRSNFLNDPAATYAVADNIAKSADEAVDAKLRSFMLEHWSEAAFSEGFASAQEHFVNF  504

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGVT  316
            +RIM  GESPICLRDLP  L IA+AYLPLYRECV++GG LL Q+LRGQLVEAA RL G  
Sbjct  505  MRIMEKGESPICLRDLPLELVIAMAYLPLYRECVESGGRLLPQKLRGQLVEAAGRLEGRQ  564

Query  315  LEDARQGRELLGILEHNLPTFLLN  244
            L+ A QG ELL ILEH+LP F++ 
Sbjct  565  LDRASQGTELLAILEHHLPCFMIQ  588



>gb|EEC67953.1| hypothetical protein OsI_35687 [Oryza sativa Indica Group]
Length=609

 Score =   187 bits (475),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 114/144 (79%), Gaps = 1/144 (1%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL++++F  DPAATYAVAD+IA+S DEAV  +LRSF+ EHWSEAA  EG    +EH++N 
Sbjct  465  FLLRSNFLNDPAATYAVADNIAKSADEAVDAKLRSFMLEHWSEAAFSEGFASAQEHFVNF  524

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGVT  316
            +RIM  GESPICLRDLP  L IA+AYLPLYRECV++GG LL Q+LRGQLVEAA RL G  
Sbjct  525  MRIMEKGESPICLRDLPLELVIAMAYLPLYRECVESGGRLLPQKLRGQLVEAAGRLEGRQ  584

Query  315  LEDARQGRELLGILEHNLPTFLLN  244
            L+ A QG ELL ILEH+LP F++ 
Sbjct  585  LDRASQGTELLAILEHHLPCFMIQ  608



>gb|ABA92347.2| expressed protein [Oryza sativa Japonica Group]
Length=609

 Score =   187 bits (475),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 114/144 (79%), Gaps = 1/144 (1%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL++++F  DPAATYAVAD+IA+S DEAV  +LRSF+ EHWSEAA  EG    +EH++N 
Sbjct  465  FLLRSNFLNDPAATYAVADNIAKSADEAVDAKLRSFMLEHWSEAAFSEGFASAQEHFVNF  524

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGVT  316
            +RIM  GESPICLRDLP  L IA+AYLPLYRECV++GG LL Q+LRGQLVEAA RL G  
Sbjct  525  MRIMEKGESPICLRDLPLELVIAMAYLPLYRECVESGGRLLPQKLRGQLVEAAGRLEGRQ  584

Query  315  LEDARQGRELLGILEHNLPTFLLN  244
            L+ A QG ELL ILEH+LP F++ 
Sbjct  585  LDRASQGTELLAILEHHLPCFMIQ  608



>ref|NP_001067610.1| Os11g0246900 [Oryza sativa Japonica Group]
 dbj|BAF27973.1| Os11g0246900, partial [Oryza sativa Japonica Group]
Length=576

 Score =   186 bits (473),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 114/144 (79%), Gaps = 1/144 (1%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL++++F  DPAATYAVAD+IA+S DEAV  +LRSF+ EHWSEAA  EG    +EH++N 
Sbjct  432  FLLRSNFLNDPAATYAVADNIAKSADEAVDAKLRSFMLEHWSEAAFSEGFASAQEHFVNF  491

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGVT  316
            +RIM  GESPICLRDLP  L IA+AYLPLYRECV++GG LL Q+LRGQLVEAA RL G  
Sbjct  492  MRIMEKGESPICLRDLPLELVIAMAYLPLYRECVESGGRLLPQKLRGQLVEAAGRLEGRQ  551

Query  315  LEDARQGRELLGILEHNLPTFLLN  244
            L+ A QG ELL ILEH+LP F++ 
Sbjct  552  LDRASQGTELLAILEHHLPCFMIQ  575



>gb|EEE51919.1| hypothetical protein OsJ_33524 [Oryza sativa Japonica Group]
Length=609

 Score =   187 bits (474),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 114/144 (79%), Gaps = 1/144 (1%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL++++F  DPAATYAVAD+IA+S DEAV  +LRSF+ EHWSEAA  EG    +EH++N 
Sbjct  465  FLLRSNFLNDPAATYAVADNIAKSADEAVDAKLRSFMLEHWSEAAFSEGFASAQEHFVNF  524

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGVT  316
            +RIM  GESPICLRDLP  L IA+AYLPLYRECV++GG LL Q+LRGQLVEAA RL G  
Sbjct  525  MRIMEKGESPICLRDLPLELVIAMAYLPLYRECVESGGRLLPQKLRGQLVEAAGRLEGRQ  584

Query  315  LEDARQGRELLGILEHNLPTFLLN  244
            L+ A QG ELL ILEH+LP F++ 
Sbjct  585  LDRASQGTELLAILEHHLPCFMIQ  608



>ref|XP_007026464.1| Ankyrin repeat family protein isoform 2 [Theobroma cacao]
 gb|EOY06966.1| Ankyrin repeat family protein isoform 2 [Theobroma cacao]
Length=597

 Score =   184 bits (467),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/123 (71%), Positives = 105/123 (85%), Gaps = 1/123 (1%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL+ + F GD AATYAVADSIARS+DEAVAPEL++FL EHWSEAA ++G +QG+E Y+NL
Sbjct  472  FLLHSDFLGDAAATYAVADSIARSDDEAVAPELKAFLQEHWSEAAFLDGLKQGQEQYMNL  531

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGVT  316
            +RI+  GESPICLRDLP+PLR+AI YLPLYREC++ GG LLSQRLRGQLVEA + L G  
Sbjct  532  MRILKRGESPICLRDLPAPLRVAITYLPLYRECIEVGGRLLSQRLRGQLVEAVQMLGGGA  591

Query  315  LED  307
            LE+
Sbjct  592  LEE  594



>ref|XP_010524207.1| PREDICTED: ankyrin repeat protein SKIP35 [Tarenaya hassleriana]
Length=616

 Score =   183 bits (464),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 90/146 (62%), Positives = 114/146 (78%), Gaps = 2/146 (1%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL+++ F GDP ATY+VADSIARS+DE+V PEL+SFL EHWSEAA  +G R+G+EH++NL
Sbjct  469  FLLKSDFLGDPTATYSVADSIARSDDESVPPELKSFLQEHWSEAAFDKGIREGQEHFVNL  528

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGVT  316
            +RI   GESPICL DLP+PLR+ I Y+ +YREC +  G LLSQRLRGQLVEA ++L G  
Sbjct  529  MRITERGESPICLSDLPAPLRVGIGYMSVYRECAETRGVLLSQRLRGQLVEAVRQLQGFV  588

Query  315  LE-DARQGRELLGILEHNLPTFLLNA  241
            +E +A Q   LL ILE +LP FL+ A
Sbjct  589  VETEAGQCGHLLAILERHLPPFLVKA  614



>ref|XP_006662854.1| PREDICTED: F-box/ankyrin repeat protein SKIP35-like [Oryza brachyantha]
Length=619

 Score =   183 bits (464),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 91/144 (63%), Positives = 114/144 (79%), Gaps = 1/144 (1%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL++++F  DPAATYAVAD+IA+S DEAV  +LR+F+ EHWSEAA  EG    +EH++N 
Sbjct  475  FLLRSNFLNDPAATYAVADNIAKSADEAVDAKLRTFMLEHWSEAAFSEGFASAQEHFVNF  534

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGVT  316
            +RIM  GESPICLRDLP  L IA+AYLPLYREC+++GG LL Q+LRGQLVEAA RL G  
Sbjct  535  MRIMEKGESPICLRDLPLELVIAMAYLPLYRECMESGGRLLPQKLRGQLVEAAGRLEGRQ  594

Query  315  LEDARQGRELLGILEHNLPTFLLN  244
            L+ A QG ELL IL+H+LP F++ 
Sbjct  595  LDRASQGTELLAILKHHLPCFMIQ  618



>ref|XP_009404281.1| PREDICTED: ankyrin repeat protein SKIP35-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009404282.1| PREDICTED: ankyrin repeat protein SKIP35-like [Musa acuminata 
subsp. malaccensis]
Length=628

 Score =   182 bits (463),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 89/145 (61%), Positives = 110/145 (76%), Gaps = 1/145 (1%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL++ +F GDP ATYAVADSIA S DEAVAP+LR+FL EHWSEAA  EG   G+ H++N 
Sbjct  476  FLLRNNFLGDPVATYAVADSIAESSDEAVAPDLRAFLKEHWSEAAFAEGLNYGQNHFVNF  535

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGVT  316
            +RI+  G SPICLRDLP  L  AIAYL LYREC KAGG LL Q+LRGQLVEAA +++G  
Sbjct  536  MRILRRGGSPICLRDLPPSLVTAIAYLSLYRECRKAGGLLLPQKLRGQLVEAASKVAGRP  595

Query  315  LEDARQGRELLGILEHNLPTFLLNA  241
            ++   Q  +L+ +LEH+LPTF L +
Sbjct  596  VDKNSQAGDLMAVLEHHLPTFFLQS  620



>ref|XP_002881948.1| hypothetical protein ARALYDRAFT_483529 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58207.1| hypothetical protein ARALYDRAFT_483529 [Arabidopsis lyrata subsp. 
lyrata]
Length=547

 Score =   181 bits (458),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 118/148 (80%), Gaps = 4/148 (3%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL+++ F GDP ATY+VAD+IA+SEDE++  +L+SFL EHWSEAA  +G R+  E+++N 
Sbjct  397  FLLKSDFLGDPVATYSVADTIAKSEDESIPSDLKSFLQEHWSEAAFNQGLRESRENFMNF  456

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSG--  322
            +R++ LGES I + DLP+PLR+AIAY+PLYRECV AGG LLSQ+LRGQLVEA K+L G  
Sbjct  457  MRVLKLGESAISIMDLPAPLRVAIAYMPLYRECVNAGGWLLSQKLRGQLVEAVKQLQGFD  516

Query  321  VTLEDARQG-RELLGILEHNLPTFLLNA  241
            V  E+ ++G  +L+ +LEH+LP FL+ A
Sbjct  517  VETEEVKKGHHQLMAVLEHHLPLFLVKA  544



>ref|XP_010508343.1| PREDICTED: ankyrin repeat protein SKIP35-like isoform X2 [Camelina 
sativa]
Length=526

 Score =   180 bits (457),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 88/148 (59%), Positives = 119/148 (80%), Gaps = 4/148 (3%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL+++ F  DP ATY+VAD+IA+SEDE+V   L+SFL +HWSEAA  +G R+ +E+++N 
Sbjct  376  FLLKSDFLRDPVATYSVADTIAKSEDESVPSHLKSFLQKHWSEAAFNQGLRESQENFMNF  435

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSG--  322
            +R++ LGES I L+DLP+PLR+AIAY+PLYRECVKAGG LLSQ LRGQLVEAAK+L G  
Sbjct  436  MRVLKLGESAISLKDLPAPLRVAIAYMPLYRECVKAGGRLLSQNLRGQLVEAAKQLQGFD  495

Query  321  VTLEDARQG-RELLGILEHNLPTFLLNA  241
            V  E+ ++G  +L+ +LEH+LP FL+ A
Sbjct  496  VASEEVKKGHHQLMAVLEHHLPLFLVKA  523



>ref|NP_566008.1| Ankyrin repeat family protein [Arabidopsis thaliana]
 ref|NP_001031537.1| Ankyrin repeat family protein [Arabidopsis thaliana]
 gb|AAC23416.1| expressed protein [Arabidopsis thaliana]
 gb|AAM98104.1| At2g44090/F6E13.22 [Arabidopsis thaliana]
 dbj|BAH20169.1| AT2G44090 [Arabidopsis thaliana]
 gb|AEC10372.1| Ankyrin repeat family protein [Arabidopsis thaliana]
 gb|AEC10373.1| Ankyrin repeat family protein [Arabidopsis thaliana]
Length=582

 Score =   181 bits (458),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 119/148 (80%), Gaps = 4/148 (3%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL+++ F GDPAATY+VAD+IA+SEDE+V  +L+SFL E WSEAA  +G ++  E+Y+N 
Sbjct  432  FLLKSDFLGDPAATYSVADTIAKSEDESVPSDLKSFLQEQWSEAAFNQGLKESRENYMNF  491

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSG--  322
            +R++ LGES I L+DLP+PLR+AIAY+PLYRECV AGG LLSQ+LRGQLVEAA +L G  
Sbjct  492  MRVLKLGESAISLKDLPAPLRVAIAYMPLYRECVDAGGRLLSQKLRGQLVEAATQLEGFD  551

Query  321  VTLEDARQG-RELLGILEHNLPTFLLNA  241
            V  E+ ++G  +L+ ILEH+LP FL+ A
Sbjct  552  VDTEEVKKGHHQLMTILEHHLPLFLVKA  579



>ref|XP_010237787.1| PREDICTED: ankyrin repeat protein SKIP35-like isoform X2 [Brachypodium 
distachyon]
Length=606

 Score =   181 bits (458),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 111/144 (77%), Gaps = 1/144 (1%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL++++F  DPAATYAVADSIARS DEAV  +LRSF+ E WSEAA  EG    +EH++N+
Sbjct  462  FLLRSNFLNDPAATYAVADSIARSADEAVDAKLRSFMLEQWSEAAFSEGFASAQEHFVNI  521

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGVT  316
             RIM  GESP+ LR LP  L IA+AYLPLYREC+++GG LL QRLRGQLVEAA RL G  
Sbjct  522  TRIMQRGESPVLLRKLPIQLVIAMAYLPLYRECLESGGRLLPQRLRGQLVEAAGRLEGRQ  581

Query  315  LEDARQGRELLGILEHNLPTFLLN  244
            L+   QGRELL ILEH+LP FL+ 
Sbjct  582  LDRGSQGRELLAILEHHLPRFLVQ  605



>ref|XP_003577645.1| PREDICTED: ankyrin repeat protein SKIP35-like isoform X1 [Brachypodium 
distachyon]
Length=621

 Score =   181 bits (458),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 111/144 (77%), Gaps = 1/144 (1%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL++++F  DPAATYAVADSIARS DEAV  +LRSF+ E WSEAA  EG    +EH++N+
Sbjct  477  FLLRSNFLNDPAATYAVADSIARSADEAVDAKLRSFMLEQWSEAAFSEGFASAQEHFVNI  536

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGVT  316
             RIM  GESP+ LR LP  L IA+AYLPLYREC+++GG LL QRLRGQLVEAA RL G  
Sbjct  537  TRIMQRGESPVLLRKLPIQLVIAMAYLPLYRECLESGGRLLPQRLRGQLVEAAGRLEGRQ  596

Query  315  LEDARQGRELLGILEHNLPTFLLN  244
            L+   QGRELL ILEH+LP FL+ 
Sbjct  597  LDRGSQGRELLAILEHHLPRFLVQ  620



>gb|AAK82517.1| At2g44090/F6E13.22 [Arabidopsis thaliana]
Length=582

 Score =   180 bits (457),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 88/148 (59%), Positives = 119/148 (80%), Gaps = 4/148 (3%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL+++ F GDPAATY+VAD+IA+SEDE+V  +L+SFL E WSEAA  +G ++  E+Y+N 
Sbjct  432  FLLKSDFLGDPAATYSVADTIAKSEDESVPSDLKSFLQEQWSEAAFNQGLKESRENYMNF  491

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSG--  322
            +R++ LGES I L+DLP+PLR+AIAY+PLYRECV AGG LLSQ+LRGQLVEAA +L G  
Sbjct  492  MRVLKLGESAISLKDLPAPLRVAIAYMPLYRECVDAGGRLLSQKLRGQLVEAATQLEGFD  551

Query  321  VTLEDARQG-RELLGILEHNLPTFLLNA  241
            V  E+ ++G  +L+ IL+H+LP FL+ A
Sbjct  552  VDTEEVKKGHHQLMTILDHDLPLFLVKA  579



>ref|XP_010508342.1| PREDICTED: ankyrin repeat protein SKIP35-like isoform X1 [Camelina 
sativa]
Length=578

 Score =   180 bits (456),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 88/148 (59%), Positives = 119/148 (80%), Gaps = 4/148 (3%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL+++ F  DP ATY+VAD+IA+SEDE+V   L+SFL +HWSEAA  +G R+ +E+++N 
Sbjct  428  FLLKSDFLRDPVATYSVADTIAKSEDESVPSHLKSFLQKHWSEAAFNQGLRESQENFMNF  487

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSG--  322
            +R++ LGES I L+DLP+PLR+AIAY+PLYRECVKAGG LLSQ LRGQLVEAAK+L G  
Sbjct  488  MRVLKLGESAISLKDLPAPLRVAIAYMPLYRECVKAGGRLLSQNLRGQLVEAAKQLQGFD  547

Query  321  VTLEDARQG-RELLGILEHNLPTFLLNA  241
            V  E+ ++G  +L+ +LEH+LP FL+ A
Sbjct  548  VASEEVKKGHHQLMAVLEHHLPLFLVKA  575



>emb|CDX79783.1| BnaA05g03730D [Brassica napus]
Length=607

 Score =   180 bits (457),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 86/150 (57%), Positives = 120/150 (80%), Gaps = 6/150 (4%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL+++ F GDP ATY+VAD+IA+SEDE+V  EL++FL EHWSEAA  +G R+  ++++N 
Sbjct  455  FLLKSDFLGDPVATYSVADTIAKSEDESVPSELKTFLQEHWSEAALSQGVRESRDNFMNF  514

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGVT  316
            +R++ +GES I L+DLP PLR+A+AY+PLYRECVKAGG LLSQRLRGQL+EA K+L G+ 
Sbjct  515  MRVLKIGESAIRLKDLPGPLRVAVAYMPLYRECVKAGGRLLSQRLRGQLMEAVKQLQGIV  574

Query  315  L--EDARQG---RELLGILEHNLPTFLLNA  241
            +  E+A +G    +L+ +LEH+LP FL+ A
Sbjct  575  VDTEEACKGGHHHQLMAVLEHHLPLFLVKA  604



>ref|XP_010517993.1| PREDICTED: ankyrin repeat protein SKIP35-like [Camelina sativa]
 ref|XP_010517994.1| PREDICTED: ankyrin repeat protein SKIP35-like [Camelina sativa]
Length=591

 Score =   179 bits (453),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 90/156 (58%), Positives = 122/156 (78%), Gaps = 9/156 (6%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL+++ F  DP ATY+VAD+IA+SEDE+V   L+SFL EHWSEAA  +G R+ + +++N 
Sbjct  441  FLLKSDFLRDPVATYSVADTIAKSEDESVPSHLKSFLQEHWSEAAFNQGLRESQGNFMNF  500

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSG--  322
            +R++ LGES I L+DLP+PLR+AIAY+PLYRECV+AGG LLSQ+LRGQLVEAAK+L G  
Sbjct  501  MRVLKLGESAISLKDLPAPLRVAIAYMPLYRECVEAGGRLLSQKLRGQLVEAAKQLQGLD  560

Query  321  VTLEDARQG-RELLGILEHNLPTFLLNA*IKLITPH  217
            V  E+ ++G R L+ +LEH+LP FL+ A     +PH
Sbjct  561  VASEEVKKGYRHLVAVLEHHLPLFLVKA-----SPH  591



>ref|XP_004978972.1| PREDICTED: F-box/ankyrin repeat protein SKIP35-like isoform X3 
[Setaria italica]
Length=637

 Score =   179 bits (454),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 87/142 (61%), Positives = 108/142 (76%), Gaps = 1/142 (1%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL+++ F  DPAATYAVADSIA+S DEAV  +LRSF++EHWSEAA   G    ++ ++N 
Sbjct  493  FLLRSDFLNDPAATYAVADSIAKSADEAVDAKLRSFMNEHWSEAAFSAGFESAQQQFVNF  552

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGVT  316
            +RIM  GESPICLRDLP  L IA+AYLPLY+EC+ + G LL QRLRGQLVEAA RL G  
Sbjct  553  MRIMERGESPICLRDLPIELVIAMAYLPLYKECINSSGRLLPQRLRGQLVEAASRLEGRQ  612

Query  315  LEDARQGRELLGILEHNLPTFL  250
            ++   Q RELL ILEH++P F+
Sbjct  613  MDSGSQSRELLAILEHHIPQFM  634



>ref|XP_004978971.1| PREDICTED: F-box/ankyrin repeat protein SKIP35-like isoform X2 
[Setaria italica]
Length=638

 Score =   179 bits (454),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 87/142 (61%), Positives = 108/142 (76%), Gaps = 1/142 (1%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL+++ F  DPAATYAVADSIA+S DEAV  +LRSF++EHWSEAA   G    ++ ++N 
Sbjct  494  FLLRSDFLNDPAATYAVADSIAKSADEAVDAKLRSFMNEHWSEAAFSAGFESAQQQFVNF  553

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGVT  316
            +RIM  GESPICLRDLP  L IA+AYLPLY+EC+ + G LL QRLRGQLVEAA RL G  
Sbjct  554  MRIMERGESPICLRDLPIELVIAMAYLPLYKECINSSGRLLPQRLRGQLVEAASRLEGRQ  613

Query  315  LEDARQGRELLGILEHNLPTFL  250
            ++   Q RELL ILEH++P F+
Sbjct  614  MDSGSQSRELLAILEHHIPQFM  635



>ref|XP_009142990.1| PREDICTED: ankyrin repeat protein SKIP35 [Brassica rapa]
Length=607

 Score =   179 bits (453),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 86/150 (57%), Positives = 119/150 (79%), Gaps = 6/150 (4%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL+++ F GDP ATY+VAD+IA+SEDE+V  EL++FL E WSEAA  +G R+  E+++N 
Sbjct  455  FLLKSDFLGDPVATYSVADTIAKSEDESVPSELKTFLQEQWSEAALSQGVRESRENFMNF  514

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGVT  316
            +R++ +GES I L+DLP PLR+A+AY+PLYRECVKAGG LLSQRLRGQL+EA K+L G+ 
Sbjct  515  MRVLKIGESAIRLKDLPGPLRVAVAYMPLYRECVKAGGRLLSQRLRGQLMEAVKQLQGIV  574

Query  315  L--EDARQG---RELLGILEHNLPTFLLNA  241
            +  E+A +G    +L+ +LEH+LP FL+ A
Sbjct  575  VDTEEACKGGHHHQLMAVLEHHLPLFLVKA  604



>ref|XP_004978970.1| PREDICTED: F-box/ankyrin repeat protein SKIP35-like isoform X1 
[Setaria italica]
Length=672

 Score =   179 bits (454),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 87/142 (61%), Positives = 108/142 (76%), Gaps = 1/142 (1%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL+++ F  DPAATYAVADSIA+S DEAV  +LRSF++EHWSEAA   G    ++ ++N 
Sbjct  528  FLLRSDFLNDPAATYAVADSIAKSADEAVDAKLRSFMNEHWSEAAFSAGFESAQQQFVNF  587

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGVT  316
            +RIM  GESPICLRDLP  L IA+AYLPLY+EC+ + G LL QRLRGQLVEAA RL G  
Sbjct  588  MRIMERGESPICLRDLPIELVIAMAYLPLYKECINSSGRLLPQRLRGQLVEAASRLEGRQ  647

Query  315  LEDARQGRELLGILEHNLPTFL  250
            ++   Q RELL ILEH++P F+
Sbjct  648  MDSGSQSRELLAILEHHIPQFM  669



>emb|CDY23417.1| BnaC04g49450D [Brassica napus]
Length=535

 Score =   176 bits (447),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 84/148 (57%), Positives = 116/148 (78%), Gaps = 4/148 (3%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL+++ F  DP ATY+ AD++A+SEDE+V  ELRSFL EHWSEAA  +G ++  ++++N 
Sbjct  385  FLLKSDFLEDPVATYSAADTVAKSEDESVPLELRSFLQEHWSEAAFKQGVKESRDNFMNF  444

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSG--  322
            +R++ +GES ICL+DLP+PLR+AIAY+PLYR CVKAGG LLSQ+LRGQLVEA K+L G  
Sbjct  445  MRVLKIGESAICLKDLPAPLRVAIAYMPLYRGCVKAGGRLLSQKLRGQLVEAVKQLQGFD  504

Query  321  VTLEDARQG-RELLGILEHNLPTFLLNA  241
            V  E+  +G  +L+ +LEH+LP FL+  
Sbjct  505  VDTEEVYKGHHQLMAVLEHHLPIFLVKG  532



>ref|XP_009387780.1| PREDICTED: ankyrin repeat protein SKIP35-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009387781.1| PREDICTED: ankyrin repeat protein SKIP35-like [Musa acuminata 
subsp. malaccensis]
Length=605

 Score =   177 bits (448),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 88/146 (60%), Positives = 102/146 (70%), Gaps = 0/146 (0%)
 Frame = -1

Query  684  G*PFFLVQTSFGDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHY  505
            G  F L     GDP ATYAVADSIA S DE VAPELR+FL EHWSE A  EG   G++HY
Sbjct  458  GVAFLLCNDFLGDPTATYAVADSIASSNDEVVAPELRAFLKEHWSEDAFAEGLSSGQDHY  517

Query  504  LNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLS  325
            +N +RI+  G SPICL DLP PL  AI Y PLYREC +AGG LL Q+LRG+LVEAA RL 
Sbjct  518  VNFMRILQRGGSPICLMDLPPPLVTAIVYKPLYRECTEAGGKLLPQKLRGKLVEAASRLG  577

Query  324  GVTLEDARQGRELLGILEHNLPTFLL  247
            G  +++    +ELL ILEH+LP   L
Sbjct  578  GRQVDNDSPAKELLAILEHHLPRHFL  603



>emb|CDY17887.1| BnaC04g03320D [Brassica napus]
Length=599

 Score =   175 bits (443),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 86/150 (57%), Positives = 115/150 (77%), Gaps = 6/150 (4%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL+++ F GDP ATY+VAD+IA SEDE+V  EL++FL EHWSEAA  +G R+  + ++N 
Sbjct  447  FLLKSDFLGDPVATYSVADTIANSEDESVPSELKTFLQEHWSEAALSQGVRESRDDFMNF  506

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLS--G  322
            +R++  GES I L+DLP PLR+A+AY+PLYRECVKAGG LLSQRLRGQL+EA K+L   G
Sbjct  507  MRVLKNGESAIRLKDLPGPLRVAVAYMPLYRECVKAGGRLLSQRLRGQLMEAVKQLQGIG  566

Query  321  VTLEDARQG---RELLGILEHNLPTFLLNA  241
            V  E+  +G    +L+ +LEH+LP FL+ A
Sbjct  567  VDTEEVWKGGHHHQLMAVLEHHLPLFLVKA  596



>dbj|BAJ86308.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK07142.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=621

 Score =   174 bits (441),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 108/144 (75%), Gaps = 1/144 (1%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL+++ F  DPAATYAVADSIAR  DEAV  +LRSF+ E WSE A +EG    +EH++N+
Sbjct  477  FLLRSDFLNDPAATYAVADSIARCADEAVDAKLRSFMLEQWSEEAFLEGFASSQEHFVNI  536

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGVT  316
             RIM  GESP+ LR+LP  L IA+AYLPLYREC ++GG LL QRLRGQLVEAA RL G  
Sbjct  537  TRIMQRGESPVALRELPLQLVIAMAYLPLYRECNESGGRLLPQRLRGQLVEAAGRLEGRQ  596

Query  315  LEDARQGRELLGILEHNLPTFLLN  244
            L+   Q RELL ILEH+LP FL+ 
Sbjct  597  LDRGTQQRELLAILEHHLPRFLVQ  620



>gb|KFK37227.1| hypothetical protein AALP_AA4G230300 [Arabis alpina]
Length=588

 Score =   174 bits (440),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 84/147 (57%), Positives = 114/147 (78%), Gaps = 3/147 (2%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL+++ F  DP ATY+ A++IA+SEDE+V  EL+S+L EHWSEAA  +G  +  E+++N 
Sbjct  439  FLLKSDFLDDPVATYSAAETIAKSEDESVPSELKSYLQEHWSEAAFNQGLNESRENFMNF  498

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSG--  322
            +R++ LGES I L+DLP+PLR+AIAY+PLYRECVKAGG LLSQ+LRGQLVEA K+L G  
Sbjct  499  MRVLKLGESAIRLKDLPAPLRVAIAYMPLYRECVKAGGRLLSQKLRGQLVEAIKQLQGFE  558

Query  321  VTLEDARQGRELLGILEHNLPTFLLNA  241
            V  ++   G +L+  LEH+LP FL+ A
Sbjct  559  VDTKEVNNGHQLMADLEHHLPLFLVKA  585



>ref|XP_008370850.1| PREDICTED: ankyrin repeat protein SKIP35-like [Malus domestica]
Length=535

 Score =   172 bits (435),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 88/143 (62%), Positives = 104/143 (73%), Gaps = 3/143 (2%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARS-EDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLN  499
            FL+ + F GDPA TY VAD+ A S +D+   PELR+FL EHWSE A  +G RQG+EHY+N
Sbjct  391  FLLGSDFLGDPATTYTVADTFAGSGDDDDANPELRAFLQEHWSERAFSDGIRQGQEHYMN  450

Query  498  LVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGC-LLSQRLRGQLVEAAKRLSG  322
            +VR++  GESPICL  LP  LR+AIAYLPLYRECV A G  L+SQRLRGQLVEA  RL G
Sbjct  451  IVRVLKWGESPICLAVLPPELRVAIAYLPLYRECVNAAGSRLVSQRLRGQLVEAVTRLGG  510

Query  321  VTLEDARQGRELLGILEHNLPTF  253
              L+   Q RELL +LE  LP F
Sbjct  511  GVLDGVNQCRELLAVLERRLPQF  533



>gb|EYU29406.1| hypothetical protein MIMGU_mgv1a003332mg [Erythranthe guttata]
Length=592

 Score =   172 bits (436),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 90/146 (62%), Positives = 109/146 (75%), Gaps = 3/146 (2%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARS--EDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYL  502
            FL++  F  DP ATYAVAD IARS  E+ A  PELR+FL EHWSE A ++G R GE H+L
Sbjct  441  FLLRADFLADPVATYAVADVIARSSGEEGAATPELRAFLREHWSEEAYLDGLRLGELHFL  500

Query  501  NLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSG  322
            N+VRI+  G    CLRDLP PL++A+AYLPLYRECV  GG LLSQR RG LVEA++RL G
Sbjct  501  NVVRILKRGGLESCLRDLPGPLQVAVAYLPLYRECVGPGGKLLSQRHRGLLVEASRRLGG  560

Query  321  VTLEDARQGRELLGILEHNLPTFLLN  244
            V L++  Q RELL +LE +LP FLL+
Sbjct  561  VVLDEPGQRRELLAVLEQHLPPFLLD  586



>emb|CDY30455.1| BnaA04g25560D [Brassica napus]
Length=672

 Score =   171 bits (432),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 81/148 (55%), Positives = 113/148 (76%), Gaps = 4/148 (3%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL+++ F  DP ATY+ AD+IA SEDE+V  EL++FL EHWSEAA  +G ++  +++LN 
Sbjct  522  FLLKSDFLEDPLATYSAADTIANSEDESVPLELKTFLQEHWSEAAFKQGVKESRDNFLNF  581

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGVT  316
            +R++ +GES I L+DLP+PLR+A+AY+PLYRECVKAGG LLSQ+LRGQLVEA K+L G  
Sbjct  582  MRVLKIGESGIRLKDLPAPLRVAVAYMPLYRECVKAGGRLLSQKLRGQLVEAVKQLQGFD  641

Query  315  LED---ARQGRELLGILEHNLPTFLLNA  241
            +E     +   +L+ +LEH+LP FL+  
Sbjct  642  VETEGVYKSHHQLMAVLEHHLPIFLVKG  669



>gb|EPS60182.1| hypothetical protein M569_14622 [Genlisea aurea]
Length=606

 Score =   169 bits (428),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 107/144 (74%), Gaps = 3/144 (2%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARS--EDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYL  502
            FL+++ F GDPAATYAVA+SIA +  EDE VAPELR FL EHWSEAA  +G R+GE HY 
Sbjct  456  FLLRSDFLGDPAATYAVAESIAAASGEDETVAPELRRFLREHWSEAAFSDGAREGEAHYA  515

Query  501  NLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSG  322
            N+   +  GESP+ LRDLP+ LR+AIAYLPLYRECV+AGG LLSQR RGQ+  AA+RL G
Sbjct  516  NVAAAVMFGESPMRLRDLPAQLRVAIAYLPLYRECVEAGGRLLSQRQRGQVAVAARRLGG  575

Query  321  VTLEDARQGRELLGILEHNLPTFL  250
               E   +  ELL +LE NLP F 
Sbjct  576  EVGEGPGKRMELLEVLERNLPPFF  599



>ref|NP_001169323.1| uncharacterized protein LOC100383189 [Zea mays]
 gb|ACN33414.1| unknown [Zea mays]
 gb|AFW60563.1| hypothetical protein ZEAMMB73_944374 [Zea mays]
Length=621

 Score =   169 bits (429),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 86/143 (60%), Positives = 106/143 (74%), Gaps = 1/143 (1%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL+++ F  DPAATYAVADSIAR  DEAV  +LRSF++EHWSEAA   G    ++H++N 
Sbjct  477  FLLRSDFLNDPAATYAVADSIARCTDEAVDAKLRSFMNEHWSEAAFCAGFESAQQHFVNF  536

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGVT  316
            +RIM  GESPI L DLP  L IA+AYLPLY+EC+ + G LL QRLRGQLVEAA RL    
Sbjct  537  MRIMERGESPIRLGDLPLELVIAMAYLPLYKECMNSNGRLLPQRLRGQLVEAASRLEDRQ  596

Query  315  LEDARQGRELLGILEHNLPTFLL  247
            +E   Q RELL ILEH++P F++
Sbjct  597  VERDSQSRELLAILEHHIPRFMI  619



>ref|XP_002450553.1| hypothetical protein SORBIDRAFT_05g006915 [Sorghum bicolor]
 gb|EES09541.1| hypothetical protein SORBIDRAFT_05g006915 [Sorghum bicolor]
Length=624

 Score =   167 bits (422),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 86/142 (61%), Positives = 105/142 (74%), Gaps = 1/142 (1%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL+++ F  DPAATYAVADSIAR  DEAV  +LRSF++EHWSEAA   G    ++H++N 
Sbjct  480  FLLRSDFLNDPAATYAVADSIARCTDEAVDAKLRSFMNEHWSEAAFSAGFESAQQHFVNF  539

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGVT  316
            +RIM  GESPI L DLP  L IA+AYLPLY+EC+ + G LL QRLRGQLVEAA RL    
Sbjct  540  MRIMERGESPIRLGDLPLELVIAMAYLPLYKECMNSIGRLLPQRLRGQLVEAASRLEDRQ  599

Query  315  LEDARQGRELLGILEHNLPTFL  250
            +E   Q RELL ILEH++P F+
Sbjct  600  VERDSQSRELLAILEHHIPRFM  621



>ref|XP_010469258.1| PREDICTED: ankyrin repeat protein SKIP35 [Camelina sativa]
Length=612

 Score =   166 bits (420),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 84/145 (58%), Positives = 109/145 (75%), Gaps = 4/145 (3%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIAR-SEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLN  499
            FL+++ F GD AATY+VADSIAR SEDE+V  +L+SFL EHWSE A  +G R+  E+++N
Sbjct  467  FLLKSDFLGDSAATYSVADSIARASEDESVPSDLKSFLKEHWSETAFEKGVRESHENFMN  526

Query  498  LVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSG-  322
             +R++  GES I LRDLP+PLR+AIAY+PLYRECVKA G LLSQRLRGQLVEA ++L G 
Sbjct  527  FMRVLKKGESAISLRDLPAPLRVAIAYMPLYRECVKADGGLLSQRLRGQLVEAVRQLQGC  586

Query  321  -VTLEDARQGRELLGILEHNLPTFL  250
             V + D  +   L+ +LEH+L    
Sbjct  587  AVAVVDVSETHHLMSVLEHHLTAIF  611



>ref|XP_010512283.1| PREDICTED: ankyrin repeat protein SKIP35-like [Camelina sativa]
Length=606

 Score =   166 bits (419),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 83/145 (57%), Positives = 109/145 (75%), Gaps = 4/145 (3%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIAR-SEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLN  499
            FL+++ F GD AATY+VADSIAR SEDE+V  +L+SFL EHWSE A  +G R+  E+++N
Sbjct  461  FLLKSDFLGDSAATYSVADSIARASEDESVPSDLKSFLKEHWSETAFEKGMRESHENFMN  520

Query  498  LVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSG-  322
             +R++  GES I LRDLP+PLR+AIAY+PLYRECVKA G LLSQR+RGQLVEA ++L G 
Sbjct  521  FMRVLKKGESAISLRDLPAPLRVAIAYMPLYRECVKADGGLLSQRIRGQLVEAVRQLQGC  580

Query  321  -VTLEDARQGRELLGILEHNLPTFL  250
             V + D  +   L+ +LEH+L    
Sbjct  581  AVAVMDVSETHHLMSVLEHHLTAIF  605



>gb|EMS56943.1| hypothetical protein TRIUR3_08812 [Triticum urartu]
Length=648

 Score =   166 bits (420),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 88/144 (61%), Positives = 104/144 (72%), Gaps = 1/144 (1%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL+++ F  DPAATYAVADSIAR  DEAV  +LR F+ E WSE A  +G    +EH++N+
Sbjct  504  FLLRSDFLNDPAATYAVADSIARCADEAVDAKLRLFMLEQWSEEAFNKGFVSSQEHFVNI  563

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGVT  316
             RIM  GESP+ LR LP  L IA+AYLPLYRECV +GG LL QRLRGQLVEAA RL G  
Sbjct  564  TRIMQRGESPVVLRQLPLQLVIAMAYLPLYRECVGSGGRLLPQRLRGQLVEAAGRLEGRQ  623

Query  315  LEDARQGRELLGILEHNLPTFLLN  244
            L+   Q  ELL ILEH+LP FL+ 
Sbjct  624  LDRGMQQSELLAILEHHLPRFLIQ  647



>ref|XP_002878304.1| hypothetical protein ARALYDRAFT_486455 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54563.1| hypothetical protein ARALYDRAFT_486455 [Arabidopsis lyrata subsp. 
lyrata]
Length=611

 Score =   164 bits (416),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 82/145 (57%), Positives = 109/145 (75%), Gaps = 4/145 (3%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARS-EDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLN  499
            FL+++ F GD  ATY+VADSIARS EDE+V  +L+SFL EHWSE+A  +G R+  E+++N
Sbjct  466  FLLKSDFLGDSTATYSVADSIARSSEDESVPSDLKSFLQEHWSESAFEKGMRESHENFMN  525

Query  498  LVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSG-  322
             +R++  GES I LRDLP+PLR+AIAY+PLYREC+K  G LLSQRLRGQLVEA ++L G 
Sbjct  526  FMRVLKKGESAISLRDLPAPLRVAIAYMPLYRECMKGDGRLLSQRLRGQLVEAVRQLQGC  585

Query  321  -VTLEDARQGRELLGILEHNLPTFL  250
             V + +  Q R L+ +LEH+L    
Sbjct  586  AVAVVEVSQTRNLMAVLEHHLTAIF  610



>ref|XP_010413621.1| PREDICTED: ankyrin repeat protein SKIP35-like [Camelina sativa]
Length=600

 Score =   164 bits (416),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 83/145 (57%), Positives = 109/145 (75%), Gaps = 4/145 (3%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIAR-SEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLN  499
            FL+++ F GD AATY+VADSIAR SEDE+V  +L+SFL EHWSE A  +G R+  E+++N
Sbjct  455  FLLKSDFLGDSAATYSVADSIARASEDESVPSDLKSFLKEHWSETAFEKGMRESHENFMN  514

Query  498  LVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSG-  322
             +R++  GES I LRDLP+PLR+AIAY+PLYRECVKA G LLSQRLRGQLVEA ++L G 
Sbjct  515  FMRVLKKGESAISLRDLPAPLRVAIAYMPLYRECVKADGGLLSQRLRGQLVEAVRQLQGC  574

Query  321  -VTLEDARQGRELLGILEHNLPTFL  250
             V + +  +   L+ +LEH+L    
Sbjct  575  AVAVVEVSETHHLMSVLEHHLTAIF  599



>ref|NP_191550.1| Ankyrin repeat family protein [Arabidopsis thaliana]
 sp|Q9M1Y3.1|SKI35_ARATH RecName: Full=Ankyrin repeat protein SKIP35; AltName: Full=SKP1-interacting 
partner 35 [Arabidopsis thaliana]
 emb|CAB75810.1| putative protein [Arabidopsis thaliana]
 gb|AAM20716.1| putative protein [Arabidopsis thaliana]
 gb|AAP37740.1| At3g59910 [Arabidopsis thaliana]
 gb|AEE79984.1| Ankyrin repeat family protein [Arabidopsis thaliana]
Length=611

 Score =   164 bits (416),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 82/145 (57%), Positives = 109/145 (75%), Gaps = 4/145 (3%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARS-EDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLN  499
            FL+++ F GD  ATY+VADSIARS EDE+V  +L+SFL EHWSE+A  +G R+  + ++N
Sbjct  466  FLLKSDFLGDSTATYSVADSIARSSEDESVPSDLKSFLQEHWSESAFEKGMRESHDDFMN  525

Query  498  LVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSG-  322
             +R++  GES I LRDLP+PLR+AIAY+PLYREC+KA G LLSQRLRGQLVEA ++L G 
Sbjct  526  FMRVLKKGESAISLRDLPAPLRVAIAYMPLYRECMKADGRLLSQRLRGQLVEAVRQLQGC  585

Query  321  -VTLEDARQGRELLGILEHNLPTFL  250
             V + +  Q R L+ +LEH+L    
Sbjct  586  AVAVVEVSQTRNLMAVLEHHLTAIF  610



>ref|XP_006402640.1| hypothetical protein EUTSA_v10005846mg [Eutrema salsugineum]
 gb|ESQ44093.1| hypothetical protein EUTSA_v10005846mg [Eutrema salsugineum]
Length=606

 Score =   164 bits (415),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 82/145 (57%), Positives = 108/145 (74%), Gaps = 4/145 (3%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARS-EDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLN  499
            FL+++ F GD  ATY+VAD IARS EDE+V   L+SFL EHWSE+A  EG+R+  E+++N
Sbjct  461  FLLKSDFLGDSVATYSVADGIARSSEDESVPWNLKSFLQEHWSESAFEEGRRESHENFMN  520

Query  498  LVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSG-  322
             +R++  GES I LRDLP+PLR+AIAY+PLYRECV  GG LLSQRLRGQLVEA ++L G 
Sbjct  521  FMRVLKKGESEISLRDLPAPLRVAIAYMPLYRECVNTGGRLLSQRLRGQLVEAVRQLQGC  580

Query  321  -VTLEDARQGRELLGILEHNLPTFL  250
             V + +  + R L+ +LEH+L    
Sbjct  581  VVAVVEVSETRNLMAVLEHHLTAIF  605



>ref|XP_008788289.1| PREDICTED: ankyrin repeat protein SKIP35-like isoform X4 [Phoenix 
dactylifera]
Length=390

 Score =   160 bits (405),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 78/141 (55%), Positives = 103/141 (73%), Gaps = 1/141 (1%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL+ + F  DP ATYA A+ +A S +EA+ PEL+ FL EHWS  A +EG R GE HY+NL
Sbjct  250  FLLSSDFLRDPIATYAFANRLATSNEEAITPELKVFLLEHWSAEAFVEGMRAGEVHYVNL  309

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGVT  316
            +RI+  G+S ICLR+LP PL I IAYLPLYREC+ + G LL QRLRG+L+ AA+RLS   
Sbjct  310  MRILRRGKSEICLRELPPPLVIVIAYLPLYRECLASSGSLLPQRLRGELMVAARRLSNWA  369

Query  315  LEDARQGRELLGILEHNLPTF  253
            +++  + RELL IL+ ++P F
Sbjct  370  VDEMSEKRELLEILQQHMPCF  390



>gb|EMT24392.1| hypothetical protein F775_29756 [Aegilops tauschii]
Length=648

 Score =   162 bits (411),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 87/144 (60%), Positives = 103/144 (72%), Gaps = 1/144 (1%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL+++ F  DPAATYAVADSIAR  DEAV  +LR F+ E WSE A  +G    +EH++N+
Sbjct  504  FLLRSDFLNDPAATYAVADSIARCADEAVDAKLRLFMLEQWSEEAFNKGFVSSQEHFVNI  563

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGVT  316
             RIM  GESP+ LR LP  L IA+AYLPL RECV +GG LL QRLRGQLVEAA RL G  
Sbjct  564  TRIMQRGESPVVLRQLPLQLVIAMAYLPLSRECVGSGGRLLPQRLRGQLVEAAGRLEGRQ  623

Query  315  LEDARQGRELLGILEHNLPTFLLN  244
            L+   Q  ELL ILEH+LP FL+ 
Sbjct  624  LDRGTQQSELLAILEHHLPRFLVQ  647



>ref|XP_009116666.1| PREDICTED: ankyrin repeat protein SKIP35 [Brassica rapa]
Length=604

 Score =   162 bits (409),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 81/145 (56%), Positives = 108/145 (74%), Gaps = 4/145 (3%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARS-EDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLN  499
            FL+++ F GDP ATY+VADSIA+S EDE V  +L+SFL EHWSE+A  +G R+  E+++N
Sbjct  459  FLLKSDFLGDPTATYSVADSIAKSSEDETVPSDLKSFLREHWSESAFEKGMRESHENFIN  518

Query  498  LVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSG-  322
             +R++  GE  I LRDLP+PLR+AIAY+PLYRECV AGG LLSQRLRGQLVEA ++L G 
Sbjct  519  FMRVLKRGECAISLRDLPAPLRVAIAYMPLYRECVNAGGRLLSQRLRGQLVEAVRQLQGC  578

Query  321  -VTLEDARQGRELLGILEHNLPTFL  250
             V + +  +   L+ +LEH+L    
Sbjct  579  DVPVVEVSETPHLMAVLEHHLTAIF  603



>ref|XP_008788288.1| PREDICTED: ankyrin repeat protein SKIP35-like isoform X3 [Phoenix 
dactylifera]
Length=484

 Score =   160 bits (406),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 78/141 (55%), Positives = 103/141 (73%), Gaps = 1/141 (1%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL+ + F  DP ATYA A+ +A S +EA+ PEL+ FL EHWS  A +EG R GE HY+NL
Sbjct  344  FLLSSDFLRDPIATYAFANRLATSNEEAITPELKVFLLEHWSAEAFVEGMRAGEVHYVNL  403

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGVT  316
            +RI+  G+S ICLR+LP PL I IAYLPLYREC+ + G LL QRLRG+L+ AA+RLS   
Sbjct  404  MRILRRGKSEICLRELPPPLVIVIAYLPLYRECLASSGSLLPQRLRGELMVAARRLSNWA  463

Query  315  LEDARQGRELLGILEHNLPTF  253
            +++  + RELL IL+ ++P F
Sbjct  464  VDEMSEKRELLEILQQHMPCF  484



>ref|XP_006290752.1| hypothetical protein CARUB_v10016852mg [Capsella rubella]
 ref|XP_006290753.1| hypothetical protein CARUB_v10016852mg [Capsella rubella]
 gb|EOA23650.1| hypothetical protein CARUB_v10016852mg [Capsella rubella]
 gb|EOA23651.1| hypothetical protein CARUB_v10016852mg [Capsella rubella]
Length=615

 Score =   161 bits (407),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 81/145 (56%), Positives = 108/145 (74%), Gaps = 4/145 (3%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIAR-SEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLN  499
            FL+++ F GD  ATY+VADSIAR SEDE+V  +L+SFL EHWSE+A  +G R+  E ++N
Sbjct  470  FLLKSDFLGDSTATYSVADSIARASEDESVPSDLKSFLQEHWSESAFEKGMRESHEDFMN  529

Query  498  LVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLS--  325
             +R++  GES I +RDLP+PLR+AIAY+PLYRECVKA G LLSQRLRGQLVEA ++L   
Sbjct  530  FMRVLKRGESEISIRDLPAPLRVAIAYMPLYRECVKADGRLLSQRLRGQLVEAVRQLQGC  589

Query  324  GVTLEDARQGRELLGILEHNLPTFL  250
            GV + +  +   L+ +LEH+L    
Sbjct  590  GVAVVEVSETHHLMSVLEHHLTAIF  614



>emb|CDX71861.1| BnaC08g30130D [Brassica napus]
Length=604

 Score =   160 bits (406),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 81/145 (56%), Positives = 106/145 (73%), Gaps = 4/145 (3%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARS-EDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLN  499
            FL+++ F GDP ATY+VADSIARS +DE+V  +L+SFL EHWSE+A  +G R+  E ++N
Sbjct  459  FLLKSDFLGDPTATYSVADSIARSSDDESVPSDLKSFLREHWSESAFEKGMRESHEDFMN  518

Query  498  LVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGV  319
             +R++  GE  I LRDLP+PLR+AIAY+PLYRECV AGG LLSQRLRGQLVEA ++L G 
Sbjct  519  FMRVLKRGECAISLRDLPAPLRVAIAYMPLYRECVNAGGRLLSQRLRGQLVEAVRQLQGC  578

Query  318  TLEDARQGR--ELLGILEHNLPTFL  250
             +     G    L+ +LEH+L    
Sbjct  579  DVPVVEVGETPRLMAVLEHHLTAIF  603



>ref|XP_008788283.1| PREDICTED: ankyrin repeat protein SKIP35-like isoform X1 [Phoenix 
dactylifera]
 ref|XP_008788285.1| PREDICTED: ankyrin repeat protein SKIP35-like isoform X1 [Phoenix 
dactylifera]
 ref|XP_008788286.1| PREDICTED: ankyrin repeat protein SKIP35-like isoform X1 [Phoenix 
dactylifera]
Length=569

 Score =   160 bits (405),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 78/141 (55%), Positives = 103/141 (73%), Gaps = 1/141 (1%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL+ + F  DP ATYA A+ +A S +EA+ PEL+ FL EHWS  A +EG R GE HY+NL
Sbjct  429  FLLSSDFLRDPIATYAFANRLATSNEEAITPELKVFLLEHWSAEAFVEGMRAGEVHYVNL  488

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGVT  316
            +RI+  G+S ICLR+LP PL I IAYLPLYREC+ + G LL QRLRG+L+ AA+RLS   
Sbjct  489  MRILRRGKSEICLRELPPPLVIVIAYLPLYRECLASSGSLLPQRLRGELMVAARRLSNWA  548

Query  315  LEDARQGRELLGILEHNLPTF  253
            +++  + RELL IL+ ++P F
Sbjct  549  VDEMSEKRELLEILQQHMPCF  569



>ref|XP_008788287.1| PREDICTED: ankyrin repeat protein SKIP35-like isoform X2 [Phoenix 
dactylifera]
Length=563

 Score =   160 bits (404),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 78/141 (55%), Positives = 103/141 (73%), Gaps = 1/141 (1%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL+ + F  DP ATYA A+ +A S +EA+ PEL+ FL EHWS  A +EG R GE HY+NL
Sbjct  423  FLLSSDFLRDPIATYAFANRLATSNEEAITPELKVFLLEHWSAEAFVEGMRAGEVHYVNL  482

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGVT  316
            +RI+  G+S ICLR+LP PL I IAYLPLYREC+ + G LL QRLRG+L+ AA+RLS   
Sbjct  483  MRILRRGKSEICLRELPPPLVIVIAYLPLYRECLASSGSLLPQRLRGELMVAARRLSNWA  542

Query  315  LEDARQGRELLGILEHNLPTF  253
            +++  + RELL IL+ ++P F
Sbjct  543  VDEMSEKRELLEILQQHMPCF  563



>emb|CDY05963.1| BnaA09g38170D [Brassica napus]
Length=604

 Score =   159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 80/145 (55%), Positives = 108/145 (74%), Gaps = 4/145 (3%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARS-EDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLN  499
            FL+++ F GDP ATY+VADSIA+S EDE+V  +L+SFL E WSE+A  +G R+  E+++N
Sbjct  459  FLLKSDFLGDPTATYSVADSIAKSSEDESVPSDLKSFLRERWSESAFEKGMRESHENFIN  518

Query  498  LVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSG-  322
             +R++  GE  I LRDLP+PLR+AIAY+PLYRECV AGG LLSQRLRGQLVEA ++L G 
Sbjct  519  FMRVLKRGECAISLRDLPAPLRVAIAYMPLYRECVNAGGRLLSQRLRGQLVEAVRQLQGC  578

Query  321  -VTLEDARQGRELLGILEHNLPTFL  250
             V + +  +   L+ +LEH+L    
Sbjct  579  DVPVVEVSETPRLMAVLEHHLTAIF  603



>ref|XP_002985572.1| hypothetical protein SELMODRAFT_122416 [Selaginella moellendorffii]
 gb|EFJ13446.1| hypothetical protein SELMODRAFT_122416 [Selaginella moellendorffii]
Length=570

 Score =   150 bits (379),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 80/149 (54%), Positives = 104/149 (70%), Gaps = 7/149 (5%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL+Q+ F  +P ATY +AD+I+RSEDEA+ PELRSFL E WSEAA   G+R GE H+LN+
Sbjct  417  FLLQSDFLSNPEATYRLADTISRSEDEAITPELRSFLQEQWSEAAFARGRRLGEAHHLNV  476

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGVT  316
            +R++  G S + L +LP  L++ IAY+PLY+ECV A G +LSQ LRGQL +AA RLS  T
Sbjct  477  MRVLKKGNSALHLDELPLQLQVIIAYIPLYKECVAAKGVILSQLLRGQLFDAALRLSAGT  536

Query  315  L---ED---ARQGRELLGILEHNLPTFLL  247
            L   ED       + LL I++   PTFLL
Sbjct  537  LPGTEDMLLKSNKQTLLSIVQSRFPTFLL  565



>ref|XP_002987003.1| hypothetical protein SELMODRAFT_125287 [Selaginella moellendorffii]
 gb|EFJ11846.1| hypothetical protein SELMODRAFT_125287 [Selaginella moellendorffii]
Length=555

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 80/149 (54%), Positives = 104/149 (70%), Gaps = 7/149 (5%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL+Q+ F  +P ATY +AD+I+RSEDEA+ PELRSFL E WSEAA   G+R GE H+LN+
Sbjct  402  FLLQSDFLSNPEATYRLADTISRSEDEAITPELRSFLQEQWSEAAFARGRRLGEVHHLNV  461

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGVT  316
            +R++  G S + L +LP  L++ IAY+PLY+ECV A G +LSQ LRGQL +AA RLS  T
Sbjct  462  MRVLKKGNSALHLDELPLQLQVIIAYIPLYKECVAAKGVILSQLLRGQLFDAALRLSAGT  521

Query  315  L---ED---ARQGRELLGILEHNLPTFLL  247
            L   ED       + LL I++   PTFLL
Sbjct  522  LPGTEDMLLKSNKQTLLSIVQSRFPTFLL  550



>ref|XP_006848543.1| hypothetical protein AMTR_s00169p00037240 [Amborella trichopoda]
 gb|ERN10124.1| hypothetical protein AMTR_s00169p00037240 [Amborella trichopoda]
Length=701

 Score =   150 bits (380),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 82/151 (54%), Positives = 104/151 (69%), Gaps = 7/151 (5%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARS-EDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLN  499
            FL+++ F G   ATY  A+ +AR+ E+E V PELR F  E WSE A + G+R GEEHY+N
Sbjct  548  FLLRSDFLGGAEATYGAAERVARAKEEEGVTPELRDFFREGWSEGAFLRGRRCGEEHYVN  607

Query  498  LVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGV  319
            L R++  G S + + DLP+PL++AIAYLPLY+ECV+AGG LLSQ LRGQLVEA  RL G 
Sbjct  608  LERVLKRGASALRVWDLPTPLQVAIAYLPLYKECVEAGGQLLSQWLRGQLVEAVWRLEGA  667

Query  318  TLEDARQ--GR---ELLGILEHNLPTFLLNA  241
                  Q  GR   ELL ILE +LP+FL+  
Sbjct  668  AFGSVDQLCGRSKDELLTILESHLPSFLITG  698



>dbj|BAD15575.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD16555.1| unknown protein [Oryza sativa Japonica Group]
Length=237

 Score =   142 bits (357),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/145 (51%), Positives = 96/145 (66%), Gaps = 2/145 (1%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL++++F  D AATYAVADSIA +    +  +L  FL E WS+AA  EG   GE+H++N+
Sbjct  94   FLLRSNFLNDAAATYAVADSIATTSTMDIPQDLVDFLKEQWSQAAFAEGVEAGEDHFVNI  153

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGVT  316
             R++  G SPI L DLP P+ +AIAYLPLYR C  A G LL QRLRG+LVEA  RL GV 
Sbjct  154  TRVLRRGASPIRLHDLPEPMALAIAYLPLYRACASARGQLLPQRLRGELVEAVGRL-GVP  212

Query  315  LEDARQGRELLGILEHNLPTFLLNA  241
            +      R+ L +LEH  P+F+  A
Sbjct  213  VNMENNRRDFLAVLEHYFPSFITGA  237



>ref|XP_006858696.1| hypothetical protein AMTR_s00066p00097810 [Amborella trichopoda]
 gb|ERN20163.1| hypothetical protein AMTR_s00066p00097810 [Amborella trichopoda]
Length=617

 Score =   145 bits (367),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 71/145 (49%), Positives = 99/145 (68%), Gaps = 1/145 (1%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL+Q++F G P ATY  +D +A+ EDE V  +L+ FL E+WSE A ++G+ +  +HY+N+
Sbjct  472  FLLQSNFLGSPEATYTASDIVAKCEDEGVKSKLKEFLIENWSEEAFMKGREESRDHYVNV  531

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGVT  316
            +R+++ G S + + DLP  LR+ IAYLPLYRECV  GG LLSQRLRGQ+VEA  RL    
Sbjct  532  MRVVSRGGSELSIGDLPVELRVGIAYLPLYRECVACGGKLLSQRLRGQVVEAVWRLGAGD  591

Query  315  LEDARQGRELLGILEHNLPTFLLNA  241
            +       ELL + E +LP FL+ A
Sbjct  592  VASMSSQDELLTVFERHLPPFLIRA  616



>ref|XP_001775776.1| predicted protein [Physcomitrella patens]
 gb|EDQ59459.1| predicted protein [Physcomitrella patens]
Length=553

 Score =   145 bits (365),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 77/151 (51%), Positives = 103/151 (68%), Gaps = 7/151 (5%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL+Q  F  +  ATY++ADSIA+SEDEA+  ELR+FL E WSE A ++G+  G+ H+LN+
Sbjct  401  FLLQADFLNNSEATYSIADSIAKSEDEAITVELRTFLLEEWSEEAFLKGRLLGQAHHLNV  460

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGVT  316
            +R +  G SP+ L++LP  L++ +AYLPLY+ECV A G +LSQ LRGQLVEAA RL+   
Sbjct  461  MRALKRGSSPLHLQELPLQLQVTVAYLPLYKECVAASGVVLSQWLRGQLVEAALRLNQGN  520

Query  315  LEDARQ------GRELLGILEHNLPTFLLNA  241
            L    +        ELL ILE  LP FLL +
Sbjct  521  LRSTEEVFLKLSKHELLSILESRLPGFLLTS  551



>ref|XP_001771374.1| predicted protein [Physcomitrella patens]
 gb|EDQ63764.1| predicted protein [Physcomitrella patens]
Length=535

 Score =   144 bits (362),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 102/149 (68%), Gaps = 7/149 (5%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL+Q  F  +P ATY +ADSIA+SEDEA+  ELR+FL + WSE A  +G+  GE H+LN+
Sbjct  382  FLLQADFLNNPEATYTIADSIAKSEDEAITTELRAFLLDEWSEEAFFKGRLLGEAHHLNV  441

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLS--G  322
            +R +  G SP+ L++LP  L++ +AYLPLY+ECV A G +LSQ LRGQLVEAA RL+  G
Sbjct  442  MRALKRGSSPLHLQELPLQLQVTVAYLPLYKECVAASGVILSQLLRGQLVEAAVRLNQGG  501

Query  321  VTLEDAR----QGRELLGILEHNLPTFLL  247
            +   +         ELL +LE  LP FLL
Sbjct  502  LFFTEEMLLKFSKHELLSVLESRLPGFLL  530



>ref|NP_001047152.1| Os02g0562400 [Oryza sativa Japonica Group]
 dbj|BAF09066.1| Os02g0562400, partial [Oryza sativa Japonica Group]
Length=480

 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/145 (51%), Positives = 96/145 (66%), Gaps = 2/145 (1%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL++++F  D AATYAVADSIA +    +  +L  FL E WS+AA  EG   GE+H++N+
Sbjct  337  FLLRSNFLNDAAATYAVADSIATTSTMDIPQDLVDFLKEQWSQAAFAEGVEAGEDHFVNI  396

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGVT  316
             R++  G SPI L DLP P+ +AIAYLPLYR C  A G LL QRLRG+LVEA  RL GV 
Sbjct  397  TRVLRRGASPIRLHDLPEPMALAIAYLPLYRACASARGQLLPQRLRGELVEAVGRL-GVP  455

Query  315  LEDARQGRELLGILEHNLPTFLLNA  241
            +      R+ L +LEH  P+F+  A
Sbjct  456  VNMENNRRDFLAVLEHYFPSFITGA  480



>ref|XP_001760791.1| predicted protein [Physcomitrella patens]
 gb|EDQ74530.1| predicted protein [Physcomitrella patens]
Length=545

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 102/149 (68%), Gaps = 7/149 (5%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL+Q  F  +P ATY +AD+IA+SEDEA+  ELR+FL E WSE A + G+  G+ H+LN+
Sbjct  395  FLLQADFLNNPEATYRIADNIAKSEDEAITSELRTFLLEEWSEEAFLSGRLLGQAHHLNV  454

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGVT  316
            +R +  G SP+ L++LP  L+  +AYLPLY+EC+ + G +LSQ LRGQLVEAA RL+ V 
Sbjct  455  MRALKRGSSPLHLQELPLQLQATVAYLPLYKECIASSGVVLSQWLRGQLVEAALRLNQVG  514

Query  315  LEDARQ------GRELLGILEHNLPTFLL  247
            L  + +        ELL IL+  LP F+L
Sbjct  515  LRSSEEVLVKCSKHELLSILKSRLPGFML  543



>ref|XP_006647390.1| PREDICTED: F-box/ankyrin repeat protein SKIP35-like [Oryza brachyantha]
Length=546

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 73/145 (50%), Positives = 98/145 (68%), Gaps = 4/145 (3%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL++++F  D A+TYA ADSIA + D  V  +L +FL E WS+AA  EG   GE+H++N+
Sbjct  403  FLLRSNFLNDAASTYAAADSIATTSDMDVPQDLVAFLKEQWSQAAFAEGVEAGEDHFVNI  462

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGVT  316
             R++  G SPI L DLP P+ +AI YLPLYR C  A G LL QRLRG+LVEA  RL G+ 
Sbjct  463  TRVLRRGASPILLHDLPEPITLAITYLPLYRACAAASGQLLPQRLRGELVEAVGRL-GIP  521

Query  315  L--EDARQGRELLGILEHNLPTFLL  247
                    G++LL +LEH LP+F++
Sbjct  522  FPANMENNGKDLLAVLEHYLPSFVI  546



>gb|EAZ23465.1| hypothetical protein OsJ_07159 [Oryza sativa Japonica Group]
Length=595

 Score =   141 bits (356),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 74/145 (51%), Positives = 96/145 (66%), Gaps = 2/145 (1%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL++++F  D AATYAVADSIA +    +  +L  FL E WS+AA  EG   GE+H++N+
Sbjct  452  FLLRSNFLNDAAATYAVADSIATTSTMDIPQDLVDFLKEQWSQAAFAEGVEAGEDHFVNI  511

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGVT  316
             R++  G SPI L DLP P+ +AIAYLPLYR C  A G LL QRLRG+LVEA  RL GV 
Sbjct  512  TRVLRRGASPIRLHDLPEPMALAIAYLPLYRACASARGQLLPQRLRGELVEAVGRL-GVP  570

Query  315  LEDARQGRELLGILEHNLPTFLLNA  241
            +      R+ L +LEH  P+F+  A
Sbjct  571  VNMENNRRDFLAVLEHYFPSFITGA  595



>ref|XP_001755132.1| predicted protein [Physcomitrella patens]
 gb|EDQ80076.1| predicted protein [Physcomitrella patens]
Length=520

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 102/149 (68%), Gaps = 7/149 (5%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL+Q  F  +P ATY  ADSI++SEDEA+  ELR+FL E WSE A ++G+  G+ H+LN+
Sbjct  367  FLLQADFLNNPTATYRTADSISKSEDEAITLELRTFLQEEWSEDAFLKGRLLGQAHHLNV  426

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGVT  316
            +R +  G SP+ L++LP  L++ +AYLPLY+EC+ + G +LSQ LRGQLVEAA RL+   
Sbjct  427  MRALKRGSSPLHLQELPLQLQVTVAYLPLYKECMASSGVVLSQWLRGQLVEAALRLNEGD  486

Query  315  LEDARQ------GRELLGILEHNLPTFLL  247
            L  + +        ELL ILE  LP F+L
Sbjct  487  LCSSEELFMKCSKHELLLILESRLPGFVL  515



>ref|XP_004952744.1| PREDICTED: F-box/ankyrin repeat protein SKIP35-like isoform X1 
[Setaria italica]
 ref|XP_004952745.1| PREDICTED: F-box/ankyrin repeat protein SKIP35-like isoform X2 
[Setaria italica]
 ref|XP_004952746.1| PREDICTED: F-box/ankyrin repeat protein SKIP35-like isoform X3 
[Setaria italica]
 ref|XP_004952747.1| PREDICTED: F-box/ankyrin repeat protein SKIP35-like isoform X4 
[Setaria italica]
Length=582

 Score =   135 bits (341),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 71/146 (49%), Positives = 101/146 (69%), Gaps = 3/146 (2%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL++++F  D AATY  AD IAR       P+L +FL EHWS+AA  EG   GE H++N+
Sbjct  438  FLLRSNFLKDAAATYEAADLIARGATNGEPPDLVAFLKEHWSQAAFAEGVSAGEAHFVNV  497

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECV-KAGGCLLSQRLRGQLVEAAKRLSGV  319
            +R++  G SPICL +LPS + + IAYLPLY+ CV ++GG LL QRLRG++VEA  RL G 
Sbjct  498  MRVLRRGASPICLDNLPSQMVLGIAYLPLYQACVSESGGQLLPQRLRGEMVEAMSRL-GE  556

Query  318  TLEDARQGRELLGILEHNLPTFLLNA  241
             +    QG++L+  LE ++P+FL+ +
Sbjct  557  PIGAESQGKDLVMALERHMPSFLVGS  582



>gb|ACN33692.1| unknown [Zea mays]
 gb|AFW71860.1| hypothetical protein ZEAMMB73_373645 [Zea mays]
 gb|AFW71861.1| hypothetical protein ZEAMMB73_373645 [Zea mays]
 gb|AFW71862.1| hypothetical protein ZEAMMB73_373645 [Zea mays]
 gb|AFW71863.1| hypothetical protein ZEAMMB73_373645 [Zea mays]
 gb|AFW71864.1| hypothetical protein ZEAMMB73_373645 [Zea mays]
Length=589

 Score =   134 bits (338),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 97/145 (67%), Gaps = 2/145 (1%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL++++F  D AATY  AD IA        P+L +FL EHWS+ A  EG   GE H++N+
Sbjct  446  FLLRSNFLRDAAATYEAADIIATGGTNGELPDLVAFLKEHWSQDAFAEGVSAGEMHFVNV  505

Query  495  VRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRLSGVT  316
            +R++  G SPICL DLP  + + I YLPLYREC+ AGG LL QRLRG+L+EA  RL G  
Sbjct  506  MRVLRRGASPICLEDLPPEMVLGITYLPLYRECLSAGGQLLPQRLRGELLEAVHRL-GEP  564

Query  315  LEDARQGRELLGILEHNLPTFLLNA  241
            +    QG++L+  LE ++P+FL+ +
Sbjct  565  VGPESQGKDLVLALERHMPSFLVGS  589



>ref|XP_002962852.1| hypothetical protein SELMODRAFT_62282, partial [Selaginella moellendorffii]
 gb|EFJ36315.1| hypothetical protein SELMODRAFT_62282, partial [Selaginella moellendorffii]
Length=499

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 80/117 (68%), Gaps = 2/117 (2%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARS-EDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLN  499
            FL+   F G+P  TY VAD+IA + E+E V  ELR FL E WS AA   G++ G  H++N
Sbjct  382  FLLHADFLGNPDETYRVADAIATAAEEEGVTLELRDFLAEEWSLAAFAAGRQIGARHHVN  441

Query  498  LVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRL  328
             +R +  G SP+ L+DLP  L+  +AYLPLY+ECV + G LLSQRLRGQLVEA  RL
Sbjct  442  FMRALKRGSSPLSLQDLPLQLQATVAYLPLYKECVSSAGVLLSQRLRGQLVEAVSRL  498



>ref|XP_002989433.1| hypothetical protein SELMODRAFT_42326, partial [Selaginella moellendorffii]
 gb|EFJ09524.1| hypothetical protein SELMODRAFT_42326, partial [Selaginella moellendorffii]
Length=499

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 79/117 (68%), Gaps = 2/117 (2%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARS-EDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLN  499
            FL+   F G+P  TY VAD+IA + E+E V  ELR FL E WS AA   G++ G  H++N
Sbjct  382  FLLHADFLGNPDETYRVADAIATAAEEEGVTLELRDFLAEEWSLAAFAAGRQIGARHHVN  441

Query  498  LVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRL  328
             +R +  G SP+ L+DLP  L+  +AYLPLY+ECV   G LLSQRLRGQLVEA  RL
Sbjct  442  FMRALKRGSSPLSLQDLPLQLQATVAYLPLYKECVSCAGVLLSQRLRGQLVEAVSRL  498



>ref|XP_001765794.1| predicted protein [Physcomitrella patens]
 gb|EDQ69385.1| predicted protein [Physcomitrella patens]
Length=786

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 58/102 (57%), Gaps = 0/102 (0%)
 Frame = -1

Query  633  YAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLR  454
            Y + +++  +E     P ++  L   WS  A   G + GE H+L+ + +     SP+ + 
Sbjct  523  YTLTEAVMLAELPETDPSVKMALKTEWSPKAFEAGVQAGENHFLSFMLVKKHARSPLRVG  582

Query  453  DLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRL  328
            +LP  L+ AI YLPLY++C    G LLSQR RG+L+ A +R+
Sbjct  583  ELPLDLQAAIGYLPLYKDCWNTPGSLLSQRQRGELIAALRRI  624



>ref|XP_001770027.1| predicted protein [Physcomitrella patens]
 gb|EDQ65203.1| predicted protein [Physcomitrella patens]
Length=630

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 55/86 (64%), Gaps = 0/86 (0%)
 Frame = -1

Query  585  PELRSFLHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLY  406
            P +++ L   WS+ A   GK+ GE H+ +++ +    +SP+ + +LP  L++AI YLPLY
Sbjct  382  PSVKTALRTEWSQEAFEAGKQAGERHFFSVMLVRKHAKSPLRVGELPLDLQVAIGYLPLY  441

Query  405  RECVKAGGCLLSQRLRGQLVEAAKRL  328
            ++C    G LLS R RG+L+ A ++L
Sbjct  442  KDCSNTPGSLLSLRQRGELLAALRQL  467



>ref|XP_001757638.1| predicted protein [Physcomitrella patens]
 gb|EDQ77695.1| predicted protein [Physcomitrella patens]
Length=559

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 36/91 (40%), Positives = 56/91 (62%), Gaps = 4/91 (4%)
 Frame = -1

Query  600  DEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIA  421
            D +V   LRS     WS+ A  EG + G+ H+LN + +     SP+ + +LP  +++AI 
Sbjct  428  DVSVKMALRS----EWSQQAFNEGIQAGQRHFLNWMLVRKHALSPLRVGELPLEIQVAIG  483

Query  420  YLPLYRECVKAGGCLLSQRLRGQLVEAAKRL  328
            Y PLYR+C+   G L+SQR RG++V A ++L
Sbjct  484  YFPLYRDCLNTPGSLISQRQRGEVVVALQQL  514



>ref|XP_001759714.1| predicted protein [Physcomitrella patens]
 gb|EDQ75626.1| predicted protein [Physcomitrella patens]
Length=676

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 53/136 (39%), Positives = 72/136 (53%), Gaps = 15/136 (11%)
 Frame = -1

Query  648  DPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGES  469
            DPA T   A+ +  SE       ++  L E WS  A  EG + G+ HY+  + +    +S
Sbjct  526  DPATTLREAEIL--SELPKTDHLVKRRLIEEWSPQAFNEGVKAGDAHYMTWMLLRRRSDS  583

Query  468  PICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRL---SGVTLEDARQ  298
                ++LP  L++AIAYLPLYR C +A G LLSQR RG+L  A   L   SG  L DA+ 
Sbjct  584  G--FKELPVELQVAIAYLPLYRACSQAPGTLLSQRQRGELTTAVLHLYRGSG-KLADAK-  639

Query  297  GRELLGILEHNLPTFL  250
                  +LE + PT L
Sbjct  640  ------VLEADKPTLL  649



>gb|EAY86310.1| hypothetical protein OsI_07683 [Oryza sativa Indica Group]
Length=522

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 41/63 (65%), Gaps = 1/63 (2%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHYLNL  496
            FL++++F  D AATYAVADSIA +    +  +L  FL E WS+ A  EG   GE+H++ +
Sbjct  452  FLLRSNFLNDAAATYAVADSIATTSTMDIPQDLVDFLKEQWSQTAFAEGVEAGEDHFVRI  511

Query  495  VRI  487
             R+
Sbjct  512  TRV  514



>ref|XP_008344056.1| PREDICTED: LOW QUALITY PROTEIN: ankyrin repeat protein SKIP35-like 
[Malus domestica]
Length=534

 Score = 53.9 bits (128),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 34/45 (76%), Gaps = 4/45 (9%)
 Frame = -1

Query  672  FLVQTSF-GDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAA  541
            FL+ + F GDPAATYAVA+SIA S+DE VAPEL++FL   W   A
Sbjct  478  FLLHSDFLGDPAATYAVANSIALSDDEGVAPELKAFL---WGTGA  519


 Score = 22.3 bits (46),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 10/11 (91%), Positives = 10/11 (91%), Gaps = 0/11 (0%)
 Frame = -3

Query  685  GVAFLLSSDFL  653
            GVAFLL SDFL
Sbjct  475  GVAFLLHSDFL  485



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1144913349700