BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF027P11

Length=698
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAT72900.1|  elongation factor 1A SMV resistance-related protein     216   6e-67   Glycine max [soybeans]
emb|CAA09041.1|  elongation factor 1-alpha                              214   7e-67   Cicer arietinum [garbanzo]
ref|XP_009773066.1|  PREDICTED: elongation factor 1-alpha               214   1e-66   Nicotiana sylvestris
gb|AGZ15393.1|  elongation factor 1-alpha                               218   5e-66   Phaseolus vulgaris [French bean]
gb|ACF81592.1|  unknown                                                 214   7e-66   Zea mays [maize]
gb|AAR83865.1|  elongation factor 1-alpha                               213   7e-66   Capsicum annuum
dbj|BAN42601.1|  putative elongation factor 1-alpha                     214   8e-66   Pyrus pyrifolia var. culta [Asian pear]
dbj|BAD95246.1|  translation elongation factor eEF-1 alpha chain        211   1e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010458012.1|  PREDICTED: elongation factor 1-alpha 1 isofo...    212   1e-65   Camelina sativa [gold-of-pleasure]
emb|CAL25349.1|  elongation factor 1 alpha                              213   2e-65   Platanus x hispanica [London plane tree]
dbj|BAH20400.1|  AT1G07940                                              212   3e-65   Arabidopsis thaliana [mouse-ear cress]
dbj|BAF75826.1|  hypothetical protein                                   211   5e-65   Malus domestica [apple tree]
ref|XP_006307730.1|  hypothetical protein CARUB_v100096370mg            211   5e-65   
gb|KDP29082.1|  hypothetical protein JCGZ_16471                         213   7e-65   Jatropha curcas
emb|CAN71914.1|  hypothetical protein VITISV_026485                     212   8e-65   Vitis vinifera
gb|KJB73628.1|  hypothetical protein B456_011G2414001                   209   8e-65   Gossypium raimondii
gb|KJB73626.1|  hypothetical protein B456_011G2412002                   211   8e-65   Gossypium raimondii
emb|CAL07988.1|  translation elongation factor 1 alpha                  213   1e-64   Platanus x hispanica [London plane tree]
gb|AAC06383.1|  elongation factor 1 alpha                               209   2e-64   Malus domestica [apple tree]
dbj|BAH56641.1|  elongation factor 1a                                   215   2e-64   Nelumbo nucifera [Indian lotus]
gb|ABW74483.1|  elongation factor                                       210   2e-64   Paeonia suffruticosa [moutan peony]
gb|ABR16818.1|  unknown                                                 209   2e-64   Picea sitchensis
gb|ADC68236.1|  elongation factor 1-alpha                               211   3e-64   Dendrobium nobile
ref|XP_002518072.1|  elongation factor 1-alpha, putative                213   3e-64   Ricinus communis
ref|XP_002539209.1|  elongation factor 1-alpha, putative                213   3e-64   Ricinus communis
dbj|BAF75825.1|  hypothetical protein                                   209   4e-64   Malus domestica [apple tree]
ref|XP_010456401.1|  PREDICTED: elongation factor 1-alpha 1             206   5e-64   Camelina sativa [gold-of-pleasure]
gb|AFW76429.1|  putative translation elongation factor Tu family ...    213   5e-64   
gb|ABS10822.1|  elongation factor 1-alpha                               209   5e-64   Phaseolus vulgaris [French bean]
emb|CAA06245.1|  elongation factor 1-alpha (EF1-a)                      213   1e-63   Cicer arietinum [garbanzo]
ref|XP_007151789.1|  hypothetical protein PHAVU_004G075100g             216   1e-63   Phaseolus vulgaris [French bean]
ref|XP_008465824.1|  PREDICTED: elongation factor 1-alpha-like          211   1e-63   Cucumis melo [Oriental melon]
gb|ADW83729.1|  elongation factor 1-alpha                               207   2e-63   Musa acuminata AAA Group [Cavendish banana]
ref|XP_002528020.1|  elongation factor 1-alpha, putative                213   2e-63   
gb|AAF79822.1|AC026875_2  T6D22.2                                       223   2e-63   Arabidopsis thaliana [mouse-ear cress]
gb|AAQ90154.1|  putative translation elongation factor protein          211   2e-63   Solanum tuberosum [potatoes]
gb|KDP29085.1|  hypothetical protein JCGZ_16474                         214   3e-63   Jatropha curcas
ref|XP_009388387.1|  PREDICTED: elongation factor 1-alpha-like          215   3e-63   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001237425.1|  elongation factor-1A                               215   3e-63   
dbj|BAN42602.1|  putative elongation factor 1-alpha                     207   3e-63   Pyrus pyrifolia var. culta [Asian pear]
gb|KHN18669.1|  Elongation factor 1-alpha                               215   3e-63   Glycine soja [wild soybean]
ref|XP_006600131.1|  PREDICTED: elongation factor-1A isoform X1         215   3e-63   
gb|AGZ90153.1|  elongation factor 1-alpha                               208   4e-63   Litsea cubeba [may chang]
emb|CAA65453.1|  elongation factor                                      208   4e-63   Narcissus pseudonarcissus
ref|XP_008783723.1|  PREDICTED: elongation factor 1-alpha isoform X2    210   6e-63   
gb|KJB53395.1|  hypothetical protein B456_009G4199001                   210   6e-63   Gossypium raimondii
gb|KDO48480.1|  hypothetical protein CISIN_1g0132372mg                  214   6e-63   Citrus sinensis [apfelsine]
ref|XP_006436251.1|  hypothetical protein CICLE_v10033471mg             214   6e-63   Citrus clementina [clementine]
gb|AAV92325.1|  translation elongation factor-1 alpha                   208   6e-63   Pseudotsuga menziesii var. menziesii
gb|AAL69396.1|  elongation factor 1-alpha                               214   6e-63   Elaeis oleifera
ref|WP_033581549.1|  elongation factor 1-alpha                          204   6e-63   
gb|ABF00115.1|  elongation factor 1-alpha                               214   6e-63   Litchi chinensis [litchi]
gb|KHG27341.1|  Elongation factor 1-alpha                               214   7e-63   Gossypium arboreum [tree cotton]
gb|ABK26215.1|  unknown                                                 203   7e-63   Picea sitchensis
ref|XP_010937806.1|  PREDICTED: elongation factor 1-alpha-like          214   7e-63   Elaeis guineensis
ref|XP_010916901.1|  PREDICTED: elongation factor 1-alpha               214   8e-63   Elaeis guineensis
gb|KJB53396.1|  hypothetical protein B456_009G4199001                   210   8e-63   Gossypium raimondii
ref|XP_010937512.1|  PREDICTED: elongation factor 1-alpha               213   1e-62   Elaeis guineensis
ref|XP_010244958.1|  PREDICTED: elongation factor 1-alpha-like          214   1e-62   Nelumbo nucifera [Indian lotus]
gb|AGH55661.1|  elongation factor 1-alpha                               210   1e-62   Atropa belladonna [deadly nightshade]
gb|KHG24249.1|  Elongation factor 1-alpha                               212   1e-62   Gossypium arboreum [tree cotton]
sp|P25698.2|EF1A_SOYBN  RecName: Full=Elongation factor 1-alpha; ...    213   1e-62   Glycine max [soybeans]
gb|KDP29084.1|  hypothetical protein JCGZ_16473                         212   1e-62   Jatropha curcas
ref|XP_011089340.1|  PREDICTED: elongation factor 1-alpha isoform X2    213   1e-62   
gb|AFY06644.1|  elongation factor 1-alpha                               210   2e-62   Carica papaya [mamon]
ref|XP_006304901.1|  hypothetical protein CARUB_v100092941mg            209   2e-62   
gb|KGN47308.1|  hypothetical protein Csa_6G290890                       209   2e-62   Cucumis sativus [cucumbers]
ref|XP_006340223.1|  PREDICTED: elongation factor 1-alpha-like          213   2e-62   Solanum tuberosum [potatoes]
ref|XP_009613861.1|  PREDICTED: elongation factor 1-alpha-like          213   2e-62   Nicotiana tomentosiformis
ref|XP_008792062.1|  PREDICTED: elongation factor 1-alpha               213   2e-62   Phoenix dactylifera
ref|XP_004489551.1|  PREDICTED: elongation factor 1-alpha-like          213   2e-62   Cicer arietinum [garbanzo]
ref|XP_003536362.1|  PREDICTED: elongation factor 1-alpha-like is...    213   2e-62   Glycine max [soybeans]
gb|KJB76528.1|  hypothetical protein B456_012G093800                    213   2e-62   Gossypium raimondii
gb|AAD27590.1|AF121261_1  elongation factor 1-alpha 1                   213   2e-62   Lilium longiflorum [Easter lily]
ref|XP_010535587.1|  PREDICTED: elongation factor 1-alpha               213   2e-62   Tarenaya hassleriana [spider flower]
dbj|BAO57272.1|  elongation factor 1-alpha                              213   2e-62   Ipomoea nil [qian niu]
ref|XP_008792073.1|  PREDICTED: elongation factor 1-alpha-like          213   2e-62   Phoenix dactylifera
gb|AGT16893.1|  elongation factor 1-alpha                               213   2e-62   Saccharum hybrid cultivar R570
ref|XP_009420035.1|  PREDICTED: elongation factor 1-alpha               213   2e-62   Musa acuminata subsp. malaccensis [pisang utan]
gb|AEI29162.1|  EF1a-like protein                                       211   2e-62   Phalaenopsis hybrid cultivar
gb|KJB48746.1|  hypothetical protein B456_008G084000                    211   2e-62   Gossypium raimondii
ref|XP_004962277.1|  PREDICTED: elongation factor 1-alpha-like is...    213   2e-62   Setaria italica
gb|AGT16628.1|  elongation factor 1 alpha                               211   3e-62   Saccharum hybrid cultivar R570
ref|XP_004962249.1|  PREDICTED: elongation factor 1-alpha-like          213   3e-62   
gb|AHA84124.1|  elongation factor 1-alpha                               213   3e-62   Phaseolus vulgaris [French bean]
ref|XP_002518073.1|  elongation factor 1-alpha, putative                213   3e-62   Ricinus communis
ref|XP_007151593.1|  hypothetical protein PHAVU_004G060000g             212   3e-62   Phaseolus vulgaris [French bean]
ref|XP_003547695.1|  PREDICTED: elongation factor 1-alpha isoform 2     212   3e-62   Glycine max [soybeans]
gb|KDP29086.1|  hypothetical protein JCGZ_16475                         212   3e-62   Jatropha curcas
gb|KDP29083.1|  hypothetical protein JCGZ_16472                         212   3e-62   Jatropha curcas
gb|AIX10769.1|  elongation factor 1 alpha                               213   3e-62   Panax notoginseng [san-qi]
ref|XP_006858667.1|  hypothetical protein AMTR_s00066p00072310          212   3e-62   Amborella trichopoda
dbj|BAA34348.1|  elongation factor-1 alpha                              212   3e-62   Nicotiana paniculata
ref|XP_002284964.1|  PREDICTED: elongation factor 1-alpha               212   3e-62   Vitis vinifera
ref|XP_007015467.1|  GTP binding Elongation factor Tu family prot...    209   3e-62   
ref|XP_002528028.1|  elongation factor 1-alpha, putative                212   3e-62   
ref|NP_001077483.1|  elongation factor 1-alpha 2                        210   3e-62   Arabidopsis thaliana [mouse-ear cress]
emb|CDX70032.1|  BnaA10g23810D                                          209   4e-62   
dbj|BAC66180.1|  elongation factor 1A                                   212   4e-62   Avicennia marina
gb|ABA12218.1|  translation elongation factor 1A-2                      212   4e-62   Gossypium hirsutum [American cotton]
emb|CAD60652.1|  elongation factor                                      212   4e-62   Solanum tuberosum [potatoes]
ref|XP_010541344.1|  PREDICTED: elongation factor 1-alpha               212   4e-62   Tarenaya hassleriana [spider flower]
gb|AIZ68131.1|  translation elongation factor 1-alpha                   212   4e-62   Ornithogalum longebracteatum [sea-onion]
sp|P43643.1|EF1A_TOBAC  RecName: Full=Elongation factor 1-alpha; ...    212   4e-62   Nicotiana tabacum [American tobacco]
gb|ABV26710.1|  elongation factor 1 alpha                               212   4e-62   Gerbera hybrid cultivar
ref|XP_009762748.1|  PREDICTED: elongation factor 1-alpha-like          212   4e-62   Nicotiana sylvestris
ref|XP_008385284.1|  PREDICTED: elongation factor 1-alpha-like          212   4e-62   
ref|XP_010542598.1|  PREDICTED: elongation factor 1-alpha-like          212   5e-62   Tarenaya hassleriana [spider flower]
gb|ABA12223.1|  translation elongation factor 1A-7                      212   5e-62   Gossypium hirsutum [American cotton]
ref|NP_001152668.1|  LOC100286309                                       212   5e-62   Zea mays [maize]
ref|XP_009783256.1|  PREDICTED: elongation factor 1-alpha               212   5e-62   Nicotiana sylvestris
ref|XP_009617039.1|  PREDICTED: elongation factor 1-alpha               212   5e-62   Nicotiana tomentosiformis
gb|ABB02622.1|  elongation factor 1-alpha-like protein                  211   5e-62   Solanum tuberosum [potatoes]
ref|XP_009793830.1|  PREDICTED: elongation factor 1-alpha-like          212   5e-62   Nicotiana sylvestris
gb|KJB48747.1|  hypothetical protein B456_008G084000                    211   5e-62   Gossypium raimondii
ref|XP_007207457.1|  hypothetical protein PRUPE_ppa005717mg             212   5e-62   Prunus persica
gb|AGV54713.1|  elongation factor 1-alpha                               212   5e-62   Phaseolus vulgaris [French bean]
gb|ABU63160.1|  elongation factor                                       212   5e-62   Saccharum officinarum [noble cane]
gb|KHG26926.1|  Elongation factor 1-alpha                               212   5e-62   Gossypium arboreum [tree cotton]
gb|AAL79775.1|  elongation factor 1 alpha                               211   5e-62   Saccharum hybrid cultivar CP72-2086
ref|XP_009392715.1|  PREDICTED: elongation factor 1-alpha-like          211   5e-62   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001275420.1|  elongation factor 1-alpha-like protein             210   6e-62   Solanum tuberosum [potatoes]
ref|XP_010542596.1|  PREDICTED: elongation factor 1-alpha-like          212   6e-62   Tarenaya hassleriana [spider flower]
ref|XP_004984833.1|  PREDICTED: elongation factor 1-alpha-like          211   6e-62   Setaria italica
ref|XP_004251154.1|  PREDICTED: elongation factor 1-alpha-like          211   6e-62   Solanum lycopersicum
gb|AFC88830.1|  putative elongation factor 1-alpha                      211   6e-62   Miscanthus sinensis
gb|ADR70875.1|  eukaryotic translation elongation factor 1-alpha        211   6e-62   Hevea brasiliensis [jebe]
gb|AIM48895.1|  elongation factor 1-alpha                               211   6e-62   Cinnamomum camphora
ref|XP_010920912.1|  PREDICTED: elongation factor 1-alpha-like          211   6e-62   Elaeis guineensis
ref|XP_010937804.1|  PREDICTED: elongation factor 1-alpha-like          211   6e-62   Elaeis guineensis
gb|KEH43533.1|  GTP-binding elongation factor Tu family protein         209   7e-62   Medicago truncatula
ref|NP_001234035.1|  elongation factor 1-alpha                          211   7e-62   Solanum lycopersicum
ref|XP_010043711.1|  PREDICTED: elongation factor 1-alpha               211   7e-62   Eucalyptus grandis [rose gum]
ref|XP_008656153.1|  PREDICTED: elongation factor 1-alpha-like          211   7e-62   Zea mays [maize]
ref|XP_002279598.1|  PREDICTED: elongation factor 1-alpha               211   7e-62   Vitis vinifera
ref|XP_008656156.1|  PREDICTED: elongation factor 1-alpha-like is...    211   7e-62   Zea mays [maize]
gb|AAL79774.1|AF331849_1  elongation factor 1 alpha                     211   7e-62   Saccharum hybrid cultivar CP65-357
gb|ACG31866.1|  elongation factor 1-alpha                               211   7e-62   Zea mays [maize]
gb|ACR38047.1|  unknown                                                 211   7e-62   Zea mays [maize]
ref|NP_001288407.1|  elongation factor 1-alpha-like                     211   8e-62   Zea mays [maize]
gb|ABA12221.1|  translation elongation factor 1A-5                      211   8e-62   Gossypium hirsutum [American cotton]
ref|XP_009593325.1|  PREDICTED: elongation factor 1-alpha               211   8e-62   Nicotiana tomentosiformis
ref|NP_001290506.1|  elongation factor 1-alpha                          211   8e-62   Elaeis guineensis
gb|AAX54511.1|  elongation factor 1 alpha                               211   8e-62   Actinidia deliciosa [Chinese gooseberry]
ref|XP_009381507.1|  PREDICTED: elongation factor 1-alpha-like          211   8e-62   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABB86283.1|  elongation factor-1 alpha-like                          211   8e-62   Solanum tuberosum [potatoes]
ref|XP_010067278.1|  PREDICTED: elongation factor 1-alpha-like          211   8e-62   Eucalyptus grandis [rose gum]
ref|NP_001274875.1|  elongation factor 1-alpha-like protein             211   8e-62   Solanum tuberosum [potatoes]
dbj|BAC23049.1|  Elongation factor 1-alpha                              211   8e-62   Solanum tuberosum [potatoes]
emb|CAJ38380.1|  translation elongation factor 1 alpha                  205   9e-62   Plantago major [cart-track plant]
ref|XP_006343452.1|  PREDICTED: elongation factor 1-alpha-like          211   9e-62   Solanum tuberosum [potatoes]
ref|XP_004157309.1|  PREDICTED: elongation factor 1-alpha-like          211   9e-62   
ref|NP_001275481.1|  elongation factor 1-alpha-like                     211   9e-62   Solanum tuberosum [potatoes]
gb|ABA12222.1|  translation elongation factor 1A-6                      211   9e-62   Gossypium hirsutum [American cotton]
gb|ACG34498.1|  elongation factor 1-alpha                               211   1e-61   Zea mays [maize]
dbj|BAM13877.1|  elongation factor 1 alpha                              211   1e-61   Arum maculatum [cuckoo-pint]
gb|AAN77897.1|  elongation factor 1 alpha                               211   1e-61   Stevia rebaudiana
gb|AFJ04514.1|  elongation factor 1-alpha                               211   1e-61   Vernicia fordii [tung oil tree]
gb|ADR70874.1|  eukaryotic translation elongation factor 1-alpha        211   1e-61   Hevea brasiliensis [jebe]
gb|KHG20498.1|  Elongation factor 1-alpha                               211   1e-61   Gossypium arboreum [tree cotton]
gb|AHE76183.1|  elongation factor 1-alpha                               211   1e-61   Chrysanthemum indicum
gb|AID52924.1|  elongation factor 1-alpha                               211   1e-61   Carthamus tinctorius
gb|KGN61480.1|  hypothetical protein Csa_2G139820                       207   1e-61   Cucumis sativus [cucumbers]
ref|XP_009342345.1|  PREDICTED: elongation factor 1-alpha-like          211   1e-61   Pyrus x bretschneideri [bai li]
dbj|BAL41369.1|  elongation factor 1-alpha                              201   1e-61   Arum maculatum [cuckoo-pint]
gb|AAC15413.1|  translation elongation factor-1 alpha                   211   1e-61   Oryza sativa Japonica Group [Japonica rice]
gb|KGN51227.1|  hypothetical protein Csa_5G495940                       207   1e-61   Cucumis sativus [cucumbers]
ref|NP_001280807.1|  elongation factor 1-alpha-like                     211   1e-61   Malus domestica [apple tree]
ref|XP_008224492.1|  PREDICTED: elongation factor 1-alpha               211   1e-61   Prunus mume [ume]
ref|XP_007015463.1|  GTP binding Elongation factor Tu family protein    211   1e-61   
gb|ABD66072.1|  elongation factor 1-alpha                               204   1e-61   Phoenix dactylifera
ref|XP_001763198.1|  predicted protein                                  208   1e-61   
gb|EEE58429.1|  hypothetical protein OsJ_09630                          210   1e-61   Oryza sativa Japonica Group [Japonica rice]
gb|ACS68200.1|  elongation factor 1 alpha                               211   1e-61   Brassica napus [oilseed rape]
ref|NP_001105617.1|  elongation factor alpha3                           210   2e-61   Zea mays [maize]
ref|NP_001105933.1|  elongation factor alpha2                           210   2e-61   
ref|XP_009403341.1|  PREDICTED: elongation factor 1-alpha-like          210   2e-61   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002277159.1|  PREDICTED: elongation factor 1-alpha               210   2e-61   Vitis vinifera
sp|Q41011.1|EF1A_PEA  RecName: Full=Elongation factor 1-alpha; Sh...    210   2e-61   Pisum sativum [garden pea]
ref|XP_008790814.1|  PREDICTED: elongation factor 1-alpha-like          210   2e-61   Phoenix dactylifera
dbj|BAA23658.1|  EF-1 alpha                                             210   2e-61   Oryza sativa [red rice]
gb|ABF94276.1|  Elongation factor 1-alpha, putative, expressed          210   2e-61   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008233357.1|  PREDICTED: elongation factor 1-alpha-like          210   2e-61   Prunus mume [ume]
gb|AFW77593.1|  putative translation elongation factor Tu family ...    210   2e-61   
ref|NP_001288465.1|  elongation factor 1-alpha-like                     210   2e-61   Zea mays [maize]
gb|ABA12220.1|  translation elongation factor 1A-4                      210   2e-61   Gossypium hirsutum [American cotton]
ref|XP_006417745.1|  hypothetical protein EUTSA_v10007619mg             210   2e-61   Eutrema salsugineum [saltwater cress]
gb|ABA12217.1|  translation elongation factor 1A-1                      210   2e-61   Gossypium hirsutum [American cotton]
gb|ABA12225.1|  translation elongation factor 1A-9                      210   2e-61   Gossypium hirsutum [American cotton]
ref|XP_006646939.1|  PREDICTED: elongation factor 1-alpha-like          210   2e-61   Oryza brachyantha
ref|NP_001049145.1|  Os03g0177400                                       210   2e-61   
sp|O49169.1|EF1A_MANES  RecName: Full=Elongation factor 1-alpha; ...    210   2e-61   Manihot esculenta [manioc]
emb|CDY22710.1|  BnaC08g43440D                                          209   2e-61   Brassica napus [oilseed rape]
gb|KHG23927.1|  Elongation factor 1-alpha                               210   2e-61   Gossypium arboreum [tree cotton]
gb|AAP80665.1|AF479046_1  elongation factor-1 alpha                     201   2e-61   Triticum aestivum [Canadian hard winter wheat]
emb|CDX88757.1|  BnaA03g08920D                                          209   2e-61   
gb|AGH32502.1|  translation elongation factor-1 alpha                   210   2e-61   Stylosanthes guianensis [stylo]
gb|EPS66340.1|  elongation factor 1-alpha                               210   2e-61   Genlisea aurea
dbj|BAC22125.1|  eukaryotic elongation factor 1A                        210   2e-61   Bruguiera sexangula
ref|XP_007218005.1|  hypothetical protein PRUPE_ppa005706mg             210   2e-61   Prunus persica
dbj|BAL14665.1|  elongation factor 1-alpha                              210   2e-61   Chrysanthemum seticuspe f. boreale
ref|XP_008789061.1|  PREDICTED: elongation factor 1-alpha-like          210   3e-61   Phoenix dactylifera
emb|CDY61938.1|  BnaCnng38780D                                          209   3e-61   Brassica napus [oilseed rape]
ref|XP_003553292.1|  PREDICTED: elongation factor 1-alpha isoform 1     210   3e-61   Glycine max [soybeans]
gb|AEN79476.1|  elongation factor 1-alpha                               210   3e-61   Ziziphus jujuba [Chinese jujube]
ref|XP_010032227.1|  PREDICTED: elongation factor 1-alpha-like          210   3e-61   Eucalyptus grandis [rose gum]
ref|NP_001105587.1|  elongation factor 1-alpha                          210   3e-61   Zea mays [maize]
ref|NP_001183947.1|  uncharacterized protein LOC100502553               208   3e-61   
gb|ABD66517.1|  EF-1 alpha                                              209   3e-61   Gymnadenia conopsea
ref|XP_010939624.1|  PREDICTED: elongation factor 1-alpha-like          209   3e-61   Elaeis guineensis
ref|NP_001104939.1|  elongation factor alpha6                           209   3e-61   Zea mays [maize]
sp|Q41803.1|EF1A_MAIZE  RecName: Full=Elongation factor 1-alpha; ...    209   3e-61   Zea mays [maize]
gb|ADI24333.1|  elongation factor 1-alpha                               209   3e-61   Miscanthus sinensis
ref|XP_009342341.1|  PREDICTED: elongation factor 1-alpha               209   3e-61   Pyrus x bretschneideri [bai li]
ref|XP_009358244.1|  PREDICTED: elongation factor 1-alpha-like          209   3e-61   Pyrus x bretschneideri [bai li]
sp|O24534.1|EF1A_VICFA  RecName: Full=Elongation factor 1-alpha; ...    209   4e-61   Vicia faba [broad bean]
gb|KJB09231.1|  hypothetical protein B456_001G130700                    209   4e-61   Gossypium raimondii
ref|XP_011026991.1|  PREDICTED: elongation factor 1-alpha isoform X1    209   4e-61   Populus euphratica
ref|XP_011031783.1|  PREDICTED: elongation factor 1-alpha-like          209   4e-61   Populus euphratica
dbj|BAC22127.1|  eukaryotic elongation factor 1A                        209   4e-61   Salsola komarovii
ref|XP_011091454.1|  PREDICTED: elongation factor 1-alpha-like          209   4e-61   Sesamum indicum [beniseed]
ref|XP_007015466.1|  GTP binding Elongation factor Tu family prot...    209   4e-61   Theobroma cacao [chocolate]
ref|XP_010669657.1|  PREDICTED: elongation factor 1-alpha               209   4e-61   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006424633.1|  hypothetical protein CICLE_v10028443mg             209   4e-61   Citrus clementina [clementine]
ref|XP_011026992.1|  PREDICTED: elongation factor 1-alpha isoform X2    209   4e-61   Populus euphratica
gb|KGN51228.1|  Elongation factor 1-alpha                               208   4e-61   Cucumis sativus [cucumbers]
gb|AAK82537.1|  At1g07930/T6D22_3                                       209   4e-61   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010669660.1|  PREDICTED: elongation factor 1-alpha-like          209   4e-61   Beta vulgaris subsp. vulgaris [field beet]
gb|AAF99703.1|  elongation factor                                       209   4e-61   Saccharum officinarum [noble cane]
ref|XP_009144204.1|  PREDICTED: elongation factor 1-alpha 1-like        209   4e-61   Brassica rapa
ref|XP_010557310.1|  PREDICTED: elongation factor 1-alpha-like          209   4e-61   Tarenaya hassleriana [spider flower]
gb|AAK32834.1|AF361822_1  At1g07930/T6D22_3                             209   4e-61   Arabidopsis thaliana [mouse-ear cress]
gb|KHN42761.1|  Elongation factor 1-alpha                               209   4e-61   Glycine soja [wild soybean]
ref|XP_008358325.1|  PREDICTED: elongation factor 1-alpha               209   4e-61   Malus domestica [apple tree]
gb|AAN31833.1|  putative translation elongation factor eEF-1 alph...    209   5e-61   Arabidopsis thaliana [mouse-ear cress]
gb|AAL57653.1|  At1g07930/T6D22_3                                       209   5e-61   Arabidopsis thaliana [mouse-ear cress]
dbj|BAF02151.1|  elongation factor 1-alpha                              209   5e-61   Arabidopsis thaliana [mouse-ear cress]
emb|CDX93604.1|  BnaA06g04440D                                          209   5e-61   
ref|NP_200847.1|  elongation factor 1-alpha 4                           209   5e-61   Arabidopsis thaliana [mouse-ear cress]
emb|CAA34456.1|  elongation factor 1-alpha                              209   5e-61   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007009760.1|  GTP binding Elongation factor Tu family prot...    209   5e-61   Theobroma cacao [chocolate]
gb|KHN14872.1|  Elongation factor 1-alpha                               209   5e-61   Glycine soja [wild soybean]
ref|XP_006280459.1|  hypothetical protein CARUB_v10026391mg             209   5e-61   Capsella rubella
ref|XP_006846237.1|  hypothetical protein AMTR_s00012p00237190          209   5e-61   Amborella trichopoda
ref|XP_009126609.1|  PREDICTED: elongation factor 1-alpha 1-like        209   5e-61   Brassica rapa
ref|XP_009148045.1|  PREDICTED: elongation factor 1-alpha 1             209   5e-61   Brassica rapa
gb|AAK25877.1|AF360167_1  putative translation elongation factor ...    209   5e-61   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008783722.1|  PREDICTED: elongation factor 1-alpha isoform X1    209   5e-61   
ref|XP_010521772.1|  PREDICTED: elongation factor 1-alpha-like          209   5e-61   Tarenaya hassleriana [spider flower]
gb|AAY56337.1|  elongation factor-1 alpha                               209   5e-61   Musa acuminata [banana]
ref|XP_002892424.1|  T6D22.2                                            216   5e-61   
gb|AAD56020.1|AF181492_1  elongation factor-1 alpha 3                   209   5e-61   Lilium longiflorum [Easter lily]
ref|XP_009403064.1|  PREDICTED: elongation factor 1-alpha-like          209   6e-61   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001151074.1|  elongation factor 1-alpha                          209   6e-61   
ref|XP_007205199.1|  hypothetical protein PRUPE_ppa005718mg             209   6e-61   Prunus persica
gb|ABA12219.1|  translation elongation factor 1A-3                      209   6e-61   Gossypium hirsutum [American cotton]
gb|AHB86963.1|  elongation factor 1-alpha                               209   7e-61   Sedum alfredii
ref|XP_008224543.1|  PREDICTED: elongation factor 1-alpha               209   7e-61   Prunus mume [ume]
ref|XP_004307410.1|  PREDICTED: elongation factor 1-alpha               209   7e-61   Fragaria vesca subsp. vesca
ref|XP_002460859.1|  hypothetical protein SORBIDRAFT_02g036420          209   7e-61   Sorghum bicolor [broomcorn]
ref|XP_007143679.1|  hypothetical protein PHAVU_007G092500g             209   8e-61   Phaseolus vulgaris [French bean]
sp|P34823.1|EF1A2_DAUCA  RecName: Full=Elongation factor 1-alpha;...    209   8e-61   Daucus carota [carrots]
ref|NP_001105565.1|  elongation factor alpha5                           209   8e-61   
ref|XP_008457229.1|  PREDICTED: elongation factor 1-alpha               209   8e-61   Cucumis melo [Oriental melon]
ref|XP_008782124.1|  PREDICTED: LOW QUALITY PROTEIN: elongation f...    201   8e-61   
ref|XP_010032225.1|  PREDICTED: elongation factor 1-alpha-like          209   8e-61   Eucalyptus grandis [rose gum]
gb|ACN40081.1|  unknown                                                 208   8e-61   Picea sitchensis
ref|XP_009380678.1|  PREDICTED: elongation factor 1-alpha-like          208   9e-61   
ref|XP_011089339.1|  PREDICTED: elongation factor 1-alpha isoform X1    208   9e-61   Sesamum indicum [beniseed]
gb|KJB76560.1|  hypothetical protein B456_012G094600                    208   9e-61   Gossypium raimondii
ref|XP_011089874.1|  PREDICTED: elongation factor 1-alpha               208   9e-61   Sesamum indicum [beniseed]
ref|XP_009421379.1|  PREDICTED: elongation factor 1-alpha-like          208   1e-60   
gb|AES62210.2|  GTP-binding elongation factor Tu family protein         208   1e-60   Medicago truncatula
gb|KHG01531.1|  Elongation factor 1-alpha                               208   1e-60   Gossypium arboreum [tree cotton]
gb|KEH43536.1|  GTP-binding elongation factor Tu family protein         208   1e-60   Medicago truncatula
emb|CDX95108.1|  BnaC05g05630D                                          209   1e-60   
ref|XP_001766482.1|  predicted protein                                  208   1e-60   
gb|ACN41180.1|  unknown                                                 208   1e-60   Picea sitchensis
ref|XP_010032221.1|  PREDICTED: elongation factor 1-alpha isoform X1    208   1e-60   Eucalyptus grandis [rose gum]
emb|CAC27139.1|  translation elongation factor-1 alpha                  208   1e-60   
gb|AES59072.2|  GTP-binding elongation factor Tu family protein         209   1e-60   
ref|XP_003588821.1|  Elongation factor 1-alpha                          208   1e-60   
ref|XP_004149547.1|  PREDICTED: elongation factor 1-alpha-like          208   1e-60   
ref|XP_008463920.1|  PREDICTED: elongation factor 1-alpha               208   1e-60   
gb|ABK25072.1|  unknown                                                 208   1e-60   
gb|ABK24265.1|  unknown                                                 208   1e-60   
ref|XP_006424629.1|  hypothetical protein CICLE_v10028446mg             208   1e-60   
ref|XP_004163381.1|  PREDICTED: LOW QUALITY PROTEIN: elongation f...    208   1e-60   
gb|EPS66069.1|  elongation factor 1-alpha                               208   2e-60   
gb|KHG28979.1|  Elongation factor 1-alpha                               208   2e-60   
ref|XP_003604823.1|  Elongation factor 1-alpha                          208   2e-60   
gb|ACN40740.1|  unknown                                                 207   2e-60   
gb|ABA12224.1|  translation elongation factor 1A-8                      207   2e-60   
ref|XP_006381487.1|  hypothetical protein POPTR_0006s13310g             207   2e-60   
gb|AGJ50595.1|  EF1alpha                                                207   2e-60   
ref|XP_011004182.1|  PREDICTED: elongation factor 1-alpha-like          207   2e-60   
ref|XP_010032224.1|  PREDICTED: elongation factor 1-alpha isoform X3    207   2e-60   
gb|AFQ37423.1|  translation elongation factor-1 alpha 2                 207   2e-60   
ref|XP_010032223.1|  PREDICTED: elongation factor 1-alpha isoform X2    207   2e-60   
ref|XP_004173991.1|  PREDICTED: elongation factor 1-alpha-like          197   3e-60   
ref|XP_004512426.1|  PREDICTED: elongation factor 1-alpha-like          207   3e-60   
gb|AES74993.2|  GTP-binding elongation factor Tu family protein         207   3e-60   
dbj|BAM13874.1|  elongation factor 1 alpha                              207   3e-60   
emb|CDY58828.1|  BnaAnng15460D                                          210   3e-60   
gb|AGC94754.1|  elongation factor 1 alpha                               207   3e-60   
gb|AGY80449.1|  elongation factor 1-alpha                               207   3e-60   
ref|XP_001753167.1|  predicted protein                                  207   3e-60   
ref|XP_001763201.1|  predicted protein                                  207   3e-60   
gb|AGD99674.1|  eukaryotic elongation factor 1A                         207   3e-60   
ref|XP_001763194.1|  predicted protein                                  207   4e-60   
ref|NP_001104938.1|  elongation factor 1 alpha                          207   4e-60   
gb|AEQ75495.1|  elongation factor 1-alpha                               207   4e-60   
ref|XP_001753181.1|  predicted protein                                  207   4e-60   
ref|XP_007027265.1|  GTP binding Elongation factor Tu family protein    209   4e-60   
ref|XP_004138964.1|  PREDICTED: elongation factor 1-alpha-like          207   4e-60   
dbj|BAC22126.1|  eukaryotic elongation factor 1A                        207   4e-60   
gb|AFQ37422.1|  translation elongation factor-1 alpha 1                 207   4e-60   
ref|XP_008380545.1|  PREDICTED: elongation factor 1-alpha-like          207   4e-60   
ref|XP_007222129.1|  hypothetical protein PRUPE_ppa005702mg             207   4e-60   
gb|AFP44110.1|  elongation factor 1-alpha                               207   4e-60   
dbj|BAH19898.1|  AT1G07930                                              206   5e-60   
ref|XP_002970579.1|  hypothetical protein SELMODRAFT_270852             206   5e-60   
ref|XP_004309880.1|  PREDICTED: elongation factor 1-alpha               206   6e-60   
ref|NP_001105935.1|  elongation factor alpha8                           206   6e-60   
ref|XP_010669658.1|  PREDICTED: elongation factor 1-alpha-like          206   6e-60   
ref|XP_002968419.1|  hypothetical protein SELMODRAFT_270693             206   6e-60   
ref|XP_011031786.1|  PREDICTED: elongation factor 1-alpha-like          203   6e-60   
gb|ACI96243.1|  elongation factor 1-alpha                               206   7e-60   
ref|XP_009126611.1|  PREDICTED: elongation factor 1-alpha 1-like        206   7e-60   
ref|XP_006373866.1|  hypothetical protein POPTR_0016s08780g             205   8e-60   
ref|XP_002968422.1|  hypothetical protein SELMODRAFT_169717             206   9e-60   
ref|XP_006378755.1|  hypothetical protein POPTR_0010s22560g             206   9e-60   
ref|XP_002970583.1|  hypothetical protein SELMODRAFT_171512             206   1e-59   
ref|XP_003558459.1|  PREDICTED: elongation factor 1-alpha               206   1e-59   
ref|XP_006856244.1|  hypothetical protein AMTR_s00059p00216110          206   1e-59   
sp|P29521.1|EF1A1_DAUCA  RecName: Full=Elongation factor 1-alpha;...    206   1e-59   
ref|XP_003591959.1|  Elongation factor 1-alpha                          208   1e-59   
gb|AAD56019.1|AF181491_1  elongation factor-1 alpha 2                   205   1e-59   
gb|AAR82894.1|  elongation factor 1-alpha                               205   1e-59   
gb|AAL32631.1|  putative elongation factor 1-a                          205   2e-59   
ref|XP_010521578.1|  PREDICTED: elongation factor 1-alpha               205   2e-59   
gb|ABK24843.1|  unknown                                                 205   2e-59   
ref|XP_011040946.1|  PREDICTED: elongation factor 1-alpha-like is...    205   2e-59   
gb|ABR25693.1|  putative elongation factor 1-alpha                      194   2e-59   
ref|XP_004143833.1|  PREDICTED: uncharacterized protein LOC101220517    211   2e-59   
ref|XP_002315287.1|  hypothetical protein POPTR_0010s22620g             204   3e-59   
ref|XP_009917077.1|  PREDICTED: elongation factor 1-alpha 1             201   3e-59   
ref|NP_001105934.1|  elongation factor alpha7                           204   4e-59   
gb|ABR17675.1|  unknown                                                 204   4e-59   
ref|XP_004309883.1|  PREDICTED: elongation factor 1-alpha-like          204   4e-59   
gb|EYU18863.1|  hypothetical protein MIMGU_mgv1a006280mg                204   4e-59   
ref|XP_007009751.1|  GTP binding Elongation factor Tu family prot...    204   4e-59   
ref|XP_006387491.1|  hypothetical protein POPTR_0966s00200g             204   5e-59   
gb|EYU36203.1|  hypothetical protein MIMGU_mgv1a006301mg                204   5e-59   
gb|AHZ58493.1|  translation elongation factor alpha                     203   7e-59   
ref|XP_003604587.1|  Elongation factor 1-alpha                          203   8e-59   
ref|XP_008380544.1|  PREDICTED: elongation factor 1-alpha-like          203   8e-59   
gb|ADK73624.1|  elongation factor 1 alpha                               199   9e-59   
gb|AGI15328.1|  elongation factor 1                                     203   1e-58   
gb|AIZ74328.1|  translation elongation factor 1-alpha                   202   1e-58   
gb|EMS49772.1|  Elongation factor 1-alpha                               202   2e-58   
gb|ABB72813.1|  elongation factor 1-alpha-like protein                  202   2e-58   
gb|AAF63516.1|AF242732_1  translation elongation factor 1a              202   2e-58   
gb|AER42621.1|  elongation factor 1 alpha                               202   2e-58   
sp|P34824.1|EF1A1_HORVU  RecName: Full=Elongation factor 1-alpha;...    202   2e-58   
sp|Q40034.1|EF1A2_HORVU  RecName: Full=Elongation factor 1-alpha;...    202   3e-58   
gb|AEE98364.1|  elongation factor 1-alpha                               202   3e-58   
gb|EMS52529.1|  Elongation factor 1-alpha                               201   4e-58   
ref|XP_001753059.1|  predicted protein                                  201   4e-58   
gb|EMT12343.1|  Elongation factor 1-alpha                               201   4e-58   
sp|Q03033.1|EF1A_WHEAT  RecName: Full=Elongation factor 1-alpha; ...    201   5e-58   
gb|KHG15275.1|  Elongation factor 1-alpha                               201   6e-58   
ref|XP_002311107.1|  ADR12-2 family protein                             201   6e-58   
ref|XP_002312029.1|  ADR12-2 family protein                             201   6e-58   
gb|EMS59091.1|  Elongation factor 1-alpha                               202   9e-58   
ref|XP_003618775.1|  Elongation factor 1-alpha                          207   1e-57   
gb|ABQ81942.1|  elongation factor 1-alpha                               193   1e-57   
ref|XP_002311106.1|  ADR12-2 family protein                             199   2e-57   
ref|XP_009131916.1|  PREDICTED: elongation factor 1-alpha 1-like        199   2e-57   
ref|XP_011031813.1|  PREDICTED: LOW QUALITY PROTEIN: HBS1-like pr...    205   6e-57   
gb|AGI78242.1|  elongation factor 1 alpha                               197   2e-56   
gb|EMS65134.1|  Elongation factor 1-alpha                               201   2e-56   
gb|ABQ81936.1|  elongation factor 1-alpha                               197   2e-56   
gb|AGO97079.1|  elongation factor 1-alpha                               189   3e-56   
gb|ABE01407.1|  translation elongation factor 1a-1                      186   3e-56   
dbj|BAK08818.1|  elongation factor 1-alpha                              196   3e-56   
dbj|BAK08744.1|  elongation factor 1-alpha                              196   4e-56   
dbj|BAK08819.1|  elongation factor 1-alpha                              196   4e-56   
gb|ABE01408.1|  translation elongation factor 1a-2                      186   4e-56   
gb|EMT09703.1|  Elongation factor 1-alpha                               200   9e-56   
gb|AJF94634.1|  elongation factor 1-alpha                               185   1e-55   
gb|AGO97080.1|  elongation factor 1-alpha                               187   3e-55   
gb|KCW65375.1|  hypothetical protein EUGRSUZ_G02807                     193   3e-55   
gb|AGO97078.1|  elongation factor 1-alpha                               186   3e-55   
gb|ADP36952.1|  hypothetical protein                                    182   3e-54   
gb|AEE98365.1|  elongation factor 1-alpha                               181   4e-54   
gb|AFO68185.1|  elongation factor 1A                                    179   9e-54   
gb|AFN42763.1|  elongation factor 1-alpha                               183   2e-53   
gb|ACU31840.1|  translation elongation factor 1 alpha                   179   2e-53   
gb|KJB30602.1|  hypothetical protein B456_005G151200                    183   7e-53   
gb|AGS43120.1|  elongation factor alpha5                                176   2e-52   
ref|WP_039311837.1|  hypothetical protein                               174   1e-51   
gb|AAV34150.1|  EF-1 alpha                                              177   2e-51   
ref|XP_004169868.1|  PREDICTED: elongation factor 1-alpha-like          173   4e-51   
ref|XP_009387472.1|  PREDICTED: LOW QUALITY PROTEIN: elongation f...    175   5e-51   
gb|AHZ44777.1|  elongation factor 1 alpha                               173   5e-51   
gb|AAO61852.1|  translation elongation factor-1 alpha                   181   1e-50   
gb|EMS24916.1|  translation elongation factor EF-1 alpha subunit        173   1e-50   
ref|XP_005650451.1|  translation elongation factor                      181   1e-50   
gb|ABD64137.1|  elongation factor-1 alpha                               172   2e-50   
gb|ACL97366.1|  elongation factor-1 alpha                               180   2e-50   
ref|XP_011069517.1|  PREDICTED: elongation factor 1-alpha               171   3e-50   
emb|CEI96289.1|  Putative Elongation factor 1-alpha                     172   4e-50   
gb|ADG23104.1|  elongation factor 1-alpha                               172   5e-50   
gb|EPY33803.1|  elongation factor 1-alpha                               177   5e-50   
gb|EPY25861.1|  elongation factor 1-alpha                               177   5e-50   
emb|CEJ91279.1|  Putative Elongation factor 1-alpha                     180   6e-50   
ref|NP_174788.1|  elongation factor Tu C-terminal domain-containi...    169   1e-49   
gb|AAZ81003.1|  eukaryotic translation elongation factor 1 alpha 1      171   1e-49   
dbj|BAH23674.1|  elongation factor 1-alpha                              172   1e-49   
gb|AAH12509.1|  EEF1A1 protein                                          171   1e-49   
gb|ACL97363.1|  elongation factor-1 alpha                               179   1e-49   
gb|AGW80518.1|  elongation factor 1-alpha 1                             171   2e-49   
gb|EDL77720.1|  rCG25445, isoform CRA_b                                 171   2e-49   
gb|ACO50109.1|  elongation factor 1 alpha                               174   2e-49   
emb|CCX11704.1|  Similar to Elongation factor 1-alpha; acc. no. Q...    175   2e-49   
gb|EDL26405.1|  mCG15232, isoform CRA_f                                 171   2e-49   
gb|ACF70735.1|  eukaryotic translation elongation factor 1              171   2e-49   
gb|ADK90073.1|  elongation factor 1 alpha                               178   3e-49   
gb|EWC64676.1|  hypothetical protein W893_14860                         171   3e-49   
gb|ABQ81935.1|  elongation factor 1-alpha                               177   4e-49   
ref|XP_011125707.1|  hypothetical protein AOL_s00169g48                 178   4e-49   
gb|ABB46371.1|  elongation factor-1 alpha                               171   5e-49   
gb|EPY27955.1|  elongation factor 1-alpha                               177   6e-49   
emb|CDP93913.1|  Protein Bm5195, isoform h                              170   6e-49   
gb|EKG07919.1|  elongation factor 1-alpha (ef-1-alpha), putative        170   7e-49   
gb|AEG78376.1|  elongation factor 1 alpha                               171   8e-49   
gb|EDL26404.1|  mCG15232, isoform CRA_e                                 171   8e-49   
gb|KHJ95470.1|  putative translation elongation factor EF-1, subu...    175   8e-49   
emb|CAM12250.1|  elongation factor 1a                                   169   8e-49   
dbj|BAI40097.1|  elongation factor-1 alpha                              169   1e-48   
gb|AJP77649.1|  elongation factor 1-alpha                               171   1e-48   
gb|ABC75588.1|  elongation factor 1-alpha                               168   1e-48   
ref|XP_003873869.1|  elongation factor 1-alpha                          170   1e-48   
gb|ADO22142.1|  translation elongation factor 1 alpha                   176   1e-48   
ref|XP_822464.1|  elongation factor 1-alpha                             174   1e-48   
emb|CCW70819.1|  unnamed protein product                                171   1e-48   
ref|XP_008712228.1|  elongation factor 1-alpha                          177   1e-48   
dbj|GAK62779.1|  elongation factor 1-alpha                              169   1e-48   
ref|XP_005675615.1|  PREDICTED: elongation factor 1-alpha 1-like        171   1e-48   
ref|XP_009899968.1|  PREDICTED: LOW QUALITY PROTEIN: elongation f...    175   2e-48   
ref|XP_002835319.1|  hypothetical protein                               173   2e-48   
gb|AAH14892.1|  Unknown (protein for IMAGE:3909122)                     171   2e-48   
ref|XP_001551786.1|  elongation factor 1-alpha                          176   2e-48   
emb|CCX05343.1|  Similar to Elongation factor 1-alpha; acc. no. Q...    176   2e-48   
gb|ELK00148.1|  Elongation factor 1-alpha 1                             171   2e-48   
gb|ABL10112.1|  translation elongation factor 1-alpha                   168   2e-48   
gb|ESA10680.1|  hypothetical protein GLOINDRAFT_348113                  176   2e-48   
gb|ESZ89813.1|  elongation factor 1-alpha                               176   2e-48   
ref|XP_007876992.1|  hypothetical protein PFL1_01298                    176   3e-48   
ref|XP_005941015.1|  PREDICTED: elongation factor 1-alpha-like          171   3e-48   
emb|CBY16376.1|  unnamed protein product                                170   3e-48   
gb|ACN60128.1|  translation elongation factor 1-alpha                   167   3e-48   
gb|AJP13557.1|  translation elongation factor-1 alpha                   167   4e-48   
gb|AAH65761.1|  EEF1A1 protein                                          170   4e-48   
gb|AIM46989.1|  translation elongation factor 1-alpha                   175   4e-48   
ref|XP_007671812.1|  hypothetical protein BAUCODRAFT_28973              175   4e-48   
gb|EKF27061.1|  elongation factor 1-alpha (ef-1-alpha), putative        168   4e-48   
gb|ACO50115.1|  elongation factor 1 alpha                               175   4e-48   
ref|XP_007921049.1|  hypothetical protein MYCFIDRAFT_209593             175   5e-48   
emb|CDH51884.1|  elongation factor 1-alpha                              170   5e-48   
gb|KDR85040.1|  hypothetical protein GALMADRAFT_233641                  175   5e-48   
gb|ACO50110.1|  elongation factor 1 alpha                               175   5e-48   
gb|AEU59990.1|  elongation factor 1 alpha                               167   6e-48   
gb|KIW72886.1|  elongation factor 1-alpha                               175   6e-48   
gb|ADO22134.1|  translation elongation factor 1 alpha                   174   6e-48   
gb|KIO08245.1|  hypothetical protein M404DRAFT_997171                   175   6e-48   
gb|KFX50753.1|  Elongation factor 1-alpha                               174   6e-48   
emb|CCG84075.1|  protein of unknown function                            175   6e-48   
gb|ADB55729.1|  elongation factor 1-alpha                               176   7e-48   
gb|KIJ68393.1|  hypothetical protein HYDPIDRAFT_185471                  175   7e-48   
emb|CDQ71533.1|  unnamed protein product                                169   7e-48   
emb|CAA40028.1|  42Sp48                                                 171   8e-48   
ref|XP_001594091.1|  elongation factor 1-alpha                          174   8e-48   
gb|EGA80599.1|  Tef1p                                                   167   9e-48   
gb|KHJ34692.1|  putative elongation factor 1-alpha                      174   9e-48   
ref|XP_004622541.1|  PREDICTED: elongation factor 1-alpha-like          172   9e-48   
gb|KIK43550.1|  hypothetical protein CY34DRAFT_699467                   174   9e-48   
dbj|GAM88379.1|  hypothetical protein ANO11243_064120                   174   1e-47   
gb|KIW01140.1|  elongation factor 1-alpha                               174   1e-47   
gb|ADO22145.1|  translation elongation factor 1 alpha                   174   1e-47   
ref|XP_002144043.1|  translation elongation factor EF-1 alpha sub...    174   1e-47   
ref|XP_003716248.1|  elongation factor 1-alpha                          174   1e-47   
gb|AEA51178.1|  elongation factor 1 alpha                               166   1e-47   
ref|XP_009154950.1|  elongation factor 1-alpha                          174   1e-47   
gb|KHK00115.1|  Translation elongation factor 1 alpha subunit           169   1e-47   
ref|XP_007524539.1|  PREDICTED: elongation factor 1-alpha 2-like        166   1e-47   
sp|P86933.1|EF1A_TRYBB  RecName: Full=Elongation factor 1-alpha; ...    174   1e-47   
emb|CBH15171.1|  elongation factor 1-alpha, putative                    174   1e-47   
ref|XP_002392294.1|  hypothetical protein MPER_08150                    170   1e-47   



>gb|AAT72900.1| elongation factor 1A SMV resistance-related protein [Glycine 
max]
Length=193

 Score =   216 bits (551),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 102/104 (98%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM
Sbjct  79   IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  138

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  139  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  182



>emb|CAA09041.1| elongation factor 1-alpha [Cicer arietinum]
Length=130

 Score =   214 bits (545),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 101/104 (97%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM
Sbjct  16   IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGLVKM  75

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  76   IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  119



>ref|XP_009773066.1| PREDICTED: elongation factor 1-alpha, partial [Nicotiana sylvestris]
Length=149

 Score =   214 bits (546),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSGKELEKEPKFLKNGDAG VKM
Sbjct  35   IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKM  94

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  95   IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  138



>gb|AGZ15393.1| elongation factor 1-alpha [Phaseolus vulgaris]
Length=305

 Score =   218 bits (555),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 103/104 (99%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM
Sbjct  179  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  238

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  239  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  282



>gb|ACF81592.1| unknown [Zea mays]
Length=184

 Score =   214 bits (544),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM
Sbjct  70   IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKM  129

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  130  IPTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  173



>gb|AAR83865.1| elongation factor 1-alpha [Capsicum annuum]
Length=167

 Score =   213 bits (542),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 99/114 (87%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -2

Query  661  RGLLASPPRSIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFL  482
            +G  +   + IIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSGKELEKEPKFL
Sbjct  42   KGAASFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFL  101

Query  481  KNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            KNGDAG VKMIPTKPMVVETF+EYPPLGRFAVRDMRQTVAVGV+K+VDKKDPTG
Sbjct  102  KNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVVKNVDKKDPTG  155



>dbj|BAN42601.1| putative elongation factor 1-alpha, partial [Pyrus pyrifolia 
var. culta]
Length=201

 Score =   214 bits (544),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 101/104 (97%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIG GYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGFVKM
Sbjct  87   IIMNHPGQIGQGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGFVKM  146

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  147  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  190



>dbj|BAD95246.1| translation elongation factor eEF-1 alpha chain [Arabidopsis 
thaliana]
Length=143

 Score =   211 bits (538),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSGKE+EKEPKFLKNGDAG VKM
Sbjct  27   IIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKM  86

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
             PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG
Sbjct  87   TPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  130



>ref|XP_010458012.1| PREDICTED: elongation factor 1-alpha 1 isoform X3 [Camelina sativa]
Length=165

 Score =   212 bits (540),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSGKE+EKEPKFLKNGDAG VKM
Sbjct  49   IIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKM  108

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
             PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG
Sbjct  109  TPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  152



>emb|CAL25349.1| elongation factor 1 alpha [Platanus x acerifolia]
Length=199

 Score =   213 bits (542),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 99/104 (95%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSGKELEKEPKFLKNGDAGFVKM
Sbjct  85   IIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGFVKM  144

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDP+G
Sbjct  145  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  188



>dbj|BAH20400.1| AT1G07940 [Arabidopsis thaliana]
Length=186

 Score =   212 bits (539),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSGKE+EKEPKFLKNGDAG VKM
Sbjct  70   IIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKM  129

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
             PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG
Sbjct  130  TPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  173



>dbj|BAF75826.1| hypothetical protein [Malus domestica]
Length=184

 Score =   211 bits (538),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 99/104 (95%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSGKELEKEPKFLKNGDAG VKM
Sbjct  70   IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKM  129

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK+PTG
Sbjct  130  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKEPTG  173



>ref|XP_006307730.1| hypothetical protein CARUB_v100096370mg, partial [Capsella rubella]
 gb|EOA40628.1| hypothetical protein CARUB_v100096370mg, partial [Capsella rubella]
Length=188

 Score =   211 bits (538),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSGKE+EKEPKFLKNGDAG VKM
Sbjct  72   IIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKM  131

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
             PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG
Sbjct  132  TPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  175



>gb|KDP29082.1| hypothetical protein JCGZ_16471 [Jatropha curcas]
Length=247

 Score =   213 bits (542),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSGKELEKEPKFLKNGDAGFVKM
Sbjct  133  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKM  192

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDP+G
Sbjct  193  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  236



>emb|CAN71914.1| hypothetical protein VITISV_026485 [Vitis vinifera]
Length=226

 Score =   212 bits (540),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+ TKIDRRSGKELEKEPKFLKNGDAGFVKM
Sbjct  112  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEITTKIDRRSGKELEKEPKFLKNGDAGFVKM  171

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDP+G
Sbjct  172  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  215



>gb|KJB73628.1| hypothetical protein B456_011G2414001, partial [Gossypium raimondii]
Length=131

 Score =   209 bits (532),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 97/104 (93%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG +KM
Sbjct  15   IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMIKM  74

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            +PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIKSV+KKDP+G
Sbjct  75   VPTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  118



>gb|KJB73626.1| hypothetical protein B456_011G2412002, partial [Gossypium raimondii]
Length=187

 Score =   211 bits (537),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG +KM
Sbjct  72   IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMIKM  131

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            +PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  132  VPTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  175



>emb|CAL07988.1| translation elongation factor 1 alpha [Platanus x acerifolia]
Length=236

 Score =   213 bits (541),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 99/104 (95%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSGKELEKEPKFLKNGDAGFVKM
Sbjct  122  IIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGFVKM  181

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDP+G
Sbjct  182  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  225



>gb|AAC06383.1| elongation factor 1 alpha, partial [Malus domestica]
Length=143

 Score =   209 bits (531),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 96/104 (92%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKF E++TKIDRRSGKE+EKEPKFLKNGDAG VKM
Sbjct  29   IIMNHPGQIGNGYAPVLDCHTSHIAVKFGEILTKIDRRSGKEIEKEPKFLKNGDAGMVKM  88

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            +PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDP+G
Sbjct  89   LPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  132



>dbj|BAH56641.1| elongation factor 1a, partial [Nelumbo nucifera]
Length=355

 Score =   215 bits (548),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 102/104 (98%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGFVKM
Sbjct  252  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGFVKM  311

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  312  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKAVDKKDPTG  355



>gb|ABW74483.1| elongation factor [Paeonia suffruticosa]
Length=186

 Score =   210 bits (534),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 97/104 (93%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSGKE+EKEPKFLKNGDAG VKM
Sbjct  70   IIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKM  129

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
             PTKPMVVETFSEYPPLGRFAVRDMR+TVAVGVIKSVDKKDPTG
Sbjct  130  TPTKPMVVETFSEYPPLGRFAVRDMRRTVAVGVIKSVDKKDPTG  173



>gb|ABR16818.1| unknown [Picea sitchensis]
Length=167

 Score =   209 bits (532),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 96/103 (93%), Positives = 103/103 (100%), Gaps = 0/103 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+MTK+DRRSGKELE+EPKFLKNGDAGF+KM
Sbjct  52   IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEIMTKVDRRSGKELEREPKFLKNGDAGFIKM  111

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPT  323
            IP+KPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPT
Sbjct  112  IPSKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKAVEKKDPT  154



>gb|ADC68236.1| elongation factor 1-alpha [Dendrobium nobile]
Length=238

 Score =   211 bits (538),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 99/104 (95%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+MTKIDRRSGKELEKEPKFLKNGDAGFVKM
Sbjct  125  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEIMTKIDRRSGKELEKEPKFLKNGDAGFVKM  184

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            +PT+PMVVETFS+YPPLGRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  185  VPTRPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  228



>ref|XP_002518072.1| elongation factor 1-alpha, putative [Ricinus communis]
 gb|EEF44205.1| elongation factor 1-alpha, putative [Ricinus communis]
Length=295

 Score =   213 bits (543),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSGKELEKEPKFLKNGDAGFVKM
Sbjct  179  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKM  238

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDP+G
Sbjct  239  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  282



>ref|XP_002539209.1| elongation factor 1-alpha, putative [Ricinus communis]
 gb|EEF23174.1| elongation factor 1-alpha, putative [Ricinus communis]
Length=295

 Score =   213 bits (542),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSGKELEKEPKFLKNGDAGFVKM
Sbjct  179  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKM  238

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDP+G
Sbjct  239  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  282



>dbj|BAF75825.1| hypothetical protein [Malus domestica]
Length=184

 Score =   209 bits (532),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 96/104 (92%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKF E++TKIDRRSGKE+EKEPKFLKNGDAG VKM
Sbjct  70   IIMNHPGQIGNGYAPVLDCHTSHIAVKFGEILTKIDRRSGKEIEKEPKFLKNGDAGMVKM  129

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            +PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDP+G
Sbjct  130  LPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  173



>ref|XP_010456401.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 dbj|BAD94936.1| elongation factor 1-alpha [Arabidopsis thaliana]
 emb|CDY69678.1| BnaAnng31190D [Brassica napus]
 emb|CDY67376.1| BnaC03g71530D [Brassica napus]
 emb|CDY06288.1| BnaA09g49150D [Brassica napus]
 emb|CDY06290.1| BnaA09g49130D [Brassica napus]
Length=115

 Score =   206 bits (525),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 96/102 (94%), Positives = 100/102 (98%), Gaps = 0/102 (0%)
 Frame = -2

Query  625  MNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKMIP  446
            MNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSGKE+EKEPKFLKNGDAG VKM P
Sbjct  1    MNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTP  60

Query  445  TKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            TKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG
Sbjct  61   TKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  102



>gb|AFW76429.1| putative translation elongation factor Tu family protein [Zea 
mays]
Length=293

 Score =   213 bits (541),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM
Sbjct  179  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKM  238

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            +PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  239  VPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  282



>gb|ABS10822.1| elongation factor 1-alpha [Phaseolus vulgaris]
Length=201

 Score =   209 bits (532),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 98/102 (96%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKE+EKEPKFLKNGDAG+VKM
Sbjct  97   IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKEIEKEPKFLKNGDAGYVKM  156

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDP  326
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDP
Sbjct  157  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDP  198



>emb|CAA06245.1| elongation factor 1-alpha (EF1-a) [Cicer arietinum]
Length=326

 Score =   213 bits (541),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 101/104 (97%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM
Sbjct  212  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGLVKM  271

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  272  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  315



>ref|XP_007151789.1| hypothetical protein PHAVU_004G075100g [Phaseolus vulgaris]
 gb|ESW23783.1| hypothetical protein PHAVU_004G075100g [Phaseolus vulgaris]
Length=447

 Score =   216 bits (550),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 103/104 (99%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  393  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_008465824.1| PREDICTED: elongation factor 1-alpha-like [Cucumis melo]
Length=273

 Score =   211 bits (536),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSGKELEKEPKFLKNGDAGFVKM
Sbjct  157  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKM  216

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKD +G
Sbjct  217  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKAVEKKDASG  260



>gb|ADW83729.1| elongation factor 1-alpha [Musa acuminata AAA Group]
Length=191

 Score =   207 bits (528),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 101/104 (97%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIG GYAPVLDCH SHIAVKFAEL+TKIDRRSGK LEKEPKFLKNGDAGFVKM
Sbjct  77   IIMNHPGQIGIGYAPVLDCHASHIAVKFAELLTKIDRRSGKALEKEPKFLKNGDAGFVKM  136

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IP+KPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  137  IPSKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  180



>ref|XP_002528020.1| elongation factor 1-alpha, putative [Ricinus communis]
 gb|EEF34338.1| elongation factor 1-alpha, putative [Ricinus communis]
Length=348

 Score =   213 bits (541),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSGKELEKEPKFLKNGDAGFVKM
Sbjct  232  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKM  291

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDP+G
Sbjct  292  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  335



>gb|AAF79822.1|AC026875_2 T6D22.2 [Arabidopsis thaliana]
Length=967

 Score =   223 bits (567),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 121/176 (69%), Positives = 130/176 (74%), Gaps = 22/176 (13%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSGKE+EKEPKFLKNGDAG VKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTGakvtkaaqkkk*tVLA  272
             PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTGAKVT            
Sbjct  393  TPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTGAKVT------------  440

Query  271  HKLCFNNACQKEFSWFSNVVLVWSSFYFMCCSLLPCMF---GTHYSQNWVLDRRWR  113
             K        K+   F  + +VW   Y + C L  C         S+NWVLDRRWR
Sbjct  441  -KAAVKKGESKDSVSF--ITIVW---YLVAC-LCSCFVFSPSERCSRNWVLDRRWR  489


 Score =   208 bits (529),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSGKE+EKEPKFLKNGDAG VKM
Sbjct  851  IIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKM  910

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
             PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG
Sbjct  911  TPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  954



>gb|AAQ90154.1| putative translation elongation factor protein [Solanum tuberosum]
Length=287

 Score =   211 bits (536),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 99/114 (87%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -2

Query  661  RGLLASPPRSIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFL  482
            +G  +   + IIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSGKELEKEPKFL
Sbjct  162  KGAASFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFL  221

Query  481  KNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            KNGDAG VKMIPTKPMVVETF+EYPPLGRFAVRDMRQTVAVGV+K+VDKKDPTG
Sbjct  222  KNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVVKNVDKKDPTG  275



>gb|KDP29085.1| hypothetical protein JCGZ_16474 [Jatropha curcas]
Length=418

 Score =   214 bits (545),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSGKELEKEPKFLKNGDAGFVKM
Sbjct  230  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKM  289

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTGakvtkaaqkkk*tVLA  272
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDP+GAKVTK+A KKK   LA
Sbjct  290  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSGAKVTKSAAKKKDGELA  349

Query  271  HKLCFNNACQKEFSWFSNVVLV  206
             ++          S  +N +LV
Sbjct  350  TEVACVVVNLSALSNVANSMLV  371



>ref|XP_009388387.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   215 bits (547),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 102/104 (98%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGFVKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGFVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  393  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|NP_001237425.1| elongation factor-1A [Glycine max]
 gb|ACI42861.1| elongation factor-1A [Glycine max]
Length=447

 Score =   215 bits (547),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 102/104 (98%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  393  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>dbj|BAN42602.1| putative elongation factor 1-alpha, partial [Pyrus pyrifolia 
var. culta]
Length=201

 Score =   207 bits (527),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 95/104 (91%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKF E++TKIDRRSGKE+EKEPKFLKNGDAG VKM
Sbjct  87   IIMNHPGQIGNGYAPVLDCHTSHIAVKFGEILTKIDRRSGKEIEKEPKFLKNGDAGMVKM  146

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            +PT+PMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDP+G
Sbjct  147  LPTRPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  190



>gb|KHN18669.1| Elongation factor 1-alpha [Glycine soja]
Length=447

 Score =   215 bits (547),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 102/104 (98%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  393  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>ref|XP_006600131.1| PREDICTED: elongation factor-1A isoform X1 [Glycine max]
 gb|KHN40184.1| Elongation factor 1-alpha [Glycine soja]
Length=447

 Score =   215 bits (547),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 102/104 (98%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  393  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>gb|AGZ90153.1| elongation factor 1-alpha, partial [Litsea cubeba]
Length=239

 Score =   208 bits (530),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSGKELEKEPKFLKNGDAG VKM
Sbjct  125  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGLVKM  184

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIKSV+KKDP+G
Sbjct  185  IPTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  228



>emb|CAA65453.1| elongation factor [Narcissus pseudonarcissus]
Length=242

 Score =   208 bits (530),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 97/104 (93%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAV+FAE++TKIDRRSGKELEKEPKFLKNGDAG VKM
Sbjct  128  IIMNHPGQIGNGYAPVLDCHTSHIAVRFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKM  187

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETF+EYPP+GRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  188  IPTKPMVVETFAEYPPMGRFAVRDMRQTVAVGVIKSVEKKDPTG  231



>ref|XP_008783723.1| PREDICTED: elongation factor 1-alpha isoform X2 [Phoenix dactylifera]
Length=293

 Score =   210 bits (534),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSGKELEKEPKFLKNGDAGFVKM
Sbjct  179  IIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGFVKM  238

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIKSV+KKDP+G
Sbjct  239  IPTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  282



>gb|KJB53395.1| hypothetical protein B456_009G4199001 [Gossypium raimondii]
Length=300

 Score =   210 bits (534),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKF+EL+TKIDRRSGKELEKEPKFLKNGDAG +KM
Sbjct  186  IIMNHPGQIGNGYAPVLDCHTSHIAVKFSELLTKIDRRSGKELEKEPKFLKNGDAGMIKM  245

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            +PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  246  VPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  289



>gb|KDO48480.1| hypothetical protein CISIN_1g0132372mg [Citrus sinensis]
Length=447

 Score =   214 bits (545),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 101/104 (97%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSGKELEKEPKFLKNGDAGFVKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDP+G
Sbjct  393  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPSG  436



>ref|XP_006436251.1| hypothetical protein CICLE_v10033471mg [Citrus clementina]
 ref|XP_006485903.1| PREDICTED: elongation factor 1-alpha 1-like [Citrus sinensis]
 gb|ESR49491.1| hypothetical protein CICLE_v10033471mg [Citrus clementina]
Length=447

 Score =   214 bits (545),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 101/104 (97%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSGKELEKEPKFLKNGDAGFVKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDP+G
Sbjct  393  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPSG  436



>gb|AAV92325.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii 
var. menziesii]
 gb|AAV92326.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii 
var. menziesii]
 gb|AAV92327.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii 
var. menziesii]
 gb|AAV92328.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii 
var. menziesii]
 gb|AAV92329.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii 
var. menziesii]
 gb|AAV92330.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii 
var. menziesii]
 gb|AAV92331.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii 
var. menziesii]
 gb|AAV92332.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii 
var. menziesii]
 gb|AAV92333.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii 
var. menziesii]
 gb|AAV92334.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii 
var. menziesii]
 gb|AAV92335.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii 
var. menziesii]
 gb|AAV92336.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii 
var. menziesii]
 gb|AAV92337.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii 
var. menziesii]
 gb|AAV92338.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii 
var. menziesii]
 gb|AAV92339.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii 
var. menziesii]
 gb|AAV92340.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii 
var. menziesii]
 gb|AAV92341.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii]
 gb|AAV92342.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii 
var. menziesii]
 gb|AAV92343.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii 
var. menziesii]
 gb|AAV92344.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii 
var. menziesii]
 gb|AAV92345.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii 
var. menziesii]
 gb|AAV92346.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii 
var. menziesii]
 gb|AAV92347.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii 
var. menziesii]
 gb|AAV92348.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii]
 gb|AAV92349.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii]
 gb|AAV92350.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii]
 gb|AAV92351.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii]
Length=247

 Score =   208 bits (529),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 97/104 (93%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHT HIAVKF+E+MTK+DRRSGKELEKEPKFLKNGDAGFVKM
Sbjct  133  IIMNHPGQIGNGYAPVLDCHTCHIAVKFSEIMTKVDRRSGKELEKEPKFLKNGDAGFVKM  192

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETF+EYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  193  IPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKAVEKKDPTG  236



>gb|AAL69396.1| elongation factor 1-alpha [Elaeis oleifera]
Length=447

 Score =   214 bits (545),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 101/104 (97%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGFVKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGFVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            +PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  393  LPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|WP_033581549.1| elongation factor 1-alpha, partial [Dickeya zeae]
Length=147

 Score =   204 bits (520),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 100/101 (99%), Gaps = 0/101 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKE+EKEPKFLKNGDAG VKM
Sbjct  47   IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSGKEIEKEPKFLKNGDAGMVKM  106

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKD  329
            IPTKPMVVETF+EYPPLGRFAVRDMRQTVAVGVIKSV+KKD
Sbjct  107  IPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKSVEKKD  147



>gb|ABF00115.1| elongation factor 1-alpha [Litchi chinensis]
Length=446

 Score =   214 bits (545),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 101/104 (97%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+MTKIDRRSGKELEKEPKFLKNGDAG+VKM
Sbjct  332  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEIMTKIDRRSGKELEKEPKFLKNGDAGYVKM  391

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  392  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  435



>gb|KHG27341.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=449

 Score =   214 bits (545),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 102/104 (98%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGFVKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGFVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  393  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|ABK26215.1| unknown [Picea sitchensis]
Length=113

 Score =   203 bits (517),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 95/102 (93%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = -2

Query  625  MNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKMIP  446
            MNHPGQIGNGYAPVLDCHT HIAVKF+E+MTK+DRRSGKELEKEPKFLKNGDAGFVKMIP
Sbjct  1    MNHPGQIGNGYAPVLDCHTCHIAVKFSEIMTKVDRRSGKELEKEPKFLKNGDAGFVKMIP  60

Query  445  TKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            TKPMVVETF+EYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  61   TKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKAVEKKDPTG  102



>ref|XP_010937806.1| PREDICTED: elongation factor 1-alpha-like [Elaeis guineensis]
Length=447

 Score =   214 bits (544),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 101/104 (97%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSGKELEKEPKFLKNGDAGFVKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  393  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_010916901.1| PREDICTED: elongation factor 1-alpha [Elaeis guineensis]
 ref|XP_010910504.1| PREDICTED: elongation factor 1-alpha [Elaeis guineensis]
Length=447

 Score =   214 bits (544),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 101/104 (97%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSGKELEKEPKFLKNGDAGFVKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  393  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|KJB53396.1| hypothetical protein B456_009G4199001, partial [Gossypium raimondii]
Length=322

 Score =   210 bits (535),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKF+EL+TKIDRRSGKELEKEPKFLKNGDAG +KM
Sbjct  208  IIMNHPGQIGNGYAPVLDCHTSHIAVKFSELLTKIDRRSGKELEKEPKFLKNGDAGMIKM  267

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            +PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  268  VPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  311



>ref|XP_010937512.1| PREDICTED: elongation factor 1-alpha [Elaeis guineensis]
Length=447

 Score =   213 bits (543),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 102/114 (89%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -2

Query  661  RGLLASPPRSIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFL  482
            +G  +   + IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFL
Sbjct  323  KGAASFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFL  382

Query  481  KNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            KNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKD +G
Sbjct  383  KNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDASG  436



>ref|XP_010244958.1| PREDICTED: elongation factor 1-alpha-like [Nelumbo nucifera]
 ref|XP_010244959.1| PREDICTED: elongation factor 1-alpha-like [Nelumbo nucifera]
Length=449

 Score =   214 bits (544),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 101/104 (97%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGLVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDP+G
Sbjct  393  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPSG  436



>gb|AGH55661.1| elongation factor 1-alpha, partial [Atropa belladonna]
Length=333

 Score =   210 bits (535),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 100/114 (88%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = -2

Query  661  RGLLASPPRSIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFL  482
            +G  +   + IIMNHPGQIGNGYAPVLDCHTSHIAVKFA ++TKIDRRSGKE+EKEPKFL
Sbjct  210  KGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAXILTKIDRRSGKEIEKEPKFL  269

Query  481  KNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            KNGDAG VKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG
Sbjct  270  KNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  323



>gb|KHG24249.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=401

 Score =   212 bits (540),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 101/104 (97%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGFVKM
Sbjct  285  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGFVKM  344

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDP+G
Sbjct  345  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  388



>sp|P25698.2|EF1A_SOYBN RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Glycine 
max]
 emb|CAA40182.1| eEF-1a [Glycine max]
Length=447

 Score =   213 bits (543),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 101/104 (97%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            II+NHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM
Sbjct  333  IIINHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  393  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>gb|KDP29084.1| hypothetical protein JCGZ_16473 [Jatropha curcas]
Length=399

 Score =   212 bits (539),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSGKELEKEPKFLKNGDAGFVKM
Sbjct  285  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKM  344

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDP+G
Sbjct  345  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  388



>ref|XP_011089340.1| PREDICTED: elongation factor 1-alpha isoform X2 [Sesamum indicum]
 ref|XP_011089341.1| PREDICTED: elongation factor 1-alpha isoform X3 [Sesamum indicum]
 ref|XP_011089342.1| PREDICTED: elongation factor 1-alpha isoform X4 [Sesamum indicum]
 ref|XP_011089875.1| PREDICTED: elongation factor 1-alpha [Sesamum indicum]
Length=449

 Score =   213 bits (543),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 101/104 (97%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGFVKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGFVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDP+G
Sbjct  393  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>gb|AFY06644.1| elongation factor 1-alpha, partial [Carica papaya]
Length=334

 Score =   210 bits (534),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSGKELEKEPKFLKNGDAGFVKM
Sbjct  220  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKM  279

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  280  IPTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKNVEKKDPSG  323



>ref|XP_006304901.1| hypothetical protein CARUB_v100092941mg, partial [Capsella rubella]
 gb|EOA37799.1| hypothetical protein CARUB_v100092941mg, partial [Capsella rubella]
Length=325

 Score =   209 bits (533),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSGKE+EKEPKFLKNGDAG VKM
Sbjct  209  IIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKM  268

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
             PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG
Sbjct  269  TPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  312



>gb|KGN47308.1| hypothetical protein Csa_6G290890 [Cucumis sativus]
Length=295

 Score =   209 bits (531),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 97/104 (93%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSGKELEKEPKFLKNGDAG +KM
Sbjct  179  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMIKM  238

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIKSV+KKDP+G
Sbjct  239  IPTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  282



>ref|XP_006340223.1| PREDICTED: elongation factor 1-alpha-like [Solanum tuberosum]
Length=447

 Score =   213 bits (542),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 101/114 (89%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -2

Query  661  RGLLASPPRSIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFL  482
            +G  +   + IIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSGKELEKEPKFL
Sbjct  323  KGAASFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFL  382

Query  481  KNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            KNGDAG VKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDP+G
Sbjct  383  KNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPSG  436



>ref|XP_009613861.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana tomentosiformis]
 ref|XP_009626606.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana tomentosiformis]
 ref|XP_009597916.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana tomentosiformis]
Length=447

 Score =   213 bits (542),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 101/114 (89%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -2

Query  661  RGLLASPPRSIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFL  482
            +G  +   + IIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSGKELEKEPKFL
Sbjct  323  KGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFL  382

Query  481  KNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            KNGDAG VKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  383  KNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  436



>ref|XP_008792062.1| PREDICTED: elongation factor 1-alpha [Phoenix dactylifera]
Length=447

 Score =   213 bits (541),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSGKELEKEPKFLKNGDAGFVKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  393  IPTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_004489551.1| PREDICTED: elongation factor 1-alpha-like [Cicer arietinum]
 ref|XP_004489552.1| PREDICTED: elongation factor 1-alpha-like [Cicer arietinum]
Length=447

 Score =   213 bits (541),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 101/104 (97%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGLVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  393  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_003536362.1| PREDICTED: elongation factor 1-alpha-like isoformX2 [Glycine 
max]
 ref|XP_006589439.1| PREDICTED: elongation factor 1-alpha-like isoform X3 [Glycine 
max]
 ref|XP_006589440.1| PREDICTED: elongation factor 1-alpha-like isoform X4 [Glycine 
max]
 gb|KHN17117.1| Elongation factor 1-alpha [Glycine soja]
Length=448

 Score =   213 bits (541),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 101/104 (97%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGLVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  393  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|KJB76528.1| hypothetical protein B456_012G093800 [Gossypium raimondii]
Length=449

 Score =   213 bits (541),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 101/104 (97%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGFVKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGFVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDP+G
Sbjct  393  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>gb|AAD27590.1|AF121261_1 elongation factor 1-alpha 1 [Lilium longiflorum]
Length=447

 Score =   213 bits (541),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSGKE+EKEPKFLKNGDAGFVKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKEIEKEPKFLKNGDAGFVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  393  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_010535587.1| PREDICTED: elongation factor 1-alpha [Tarenaya hassleriana]
Length=449

 Score =   213 bits (541),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 101/104 (97%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  393  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>dbj|BAO57272.1| elongation factor 1-alpha [Ipomoea nil]
Length=447

 Score =   213 bits (541),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 101/114 (89%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -2

Query  661  RGLLASPPRSIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFL  482
            +G  +   + IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFL
Sbjct  323  KGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFL  382

Query  481  KNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            KNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  383  KNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  436



>ref|XP_008792073.1| PREDICTED: elongation factor 1-alpha-like [Phoenix dactylifera]
Length=447

 Score =   213 bits (541),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSGKELEKEPKFLKNGDAGFVKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  393  IPTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AGT16893.1| elongation factor 1-alpha [Saccharum hybrid cultivar R570]
Length=447

 Score =   213 bits (541),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 101/104 (97%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  393  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_009420035.1| PREDICTED: elongation factor 1-alpha [Musa acuminata subsp. malaccensis]
 ref|XP_009420036.1| PREDICTED: elongation factor 1-alpha [Musa acuminata subsp. malaccensis]
Length=447

 Score =   213 bits (541),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSGKELEKEPKFLKNGDAGFVKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  393  IPTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AEI29162.1| EF1a-like protein [Phalaenopsis hybrid cultivar]
Length=398

 Score =   211 bits (537),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 99/104 (95%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSGKELEKEPKFLKNGDAGFVKM
Sbjct  284  IIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGFVKM  343

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETF+EYPPLGRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  344  IPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  387



>gb|KJB48746.1| hypothetical protein B456_008G084000 [Gossypium raimondii]
Length=400

 Score =   211 bits (538),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 99/104 (95%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG +KM
Sbjct  285  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMIKM  344

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            +PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  345  VPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  388



>ref|XP_004962277.1| PREDICTED: elongation factor 1-alpha-like isoform X1 [Setaria 
italica]
 ref|XP_004962278.1| PREDICTED: elongation factor 1-alpha-like isoform X2 [Setaria 
italica]
 ref|XP_004962279.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
Length=447

 Score =   213 bits (541),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 101/104 (97%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  393  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AGT16628.1| elongation factor 1 alpha [Saccharum hybrid cultivar R570]
Length=399

 Score =   211 bits (537),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM
Sbjct  285  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKM  344

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            +PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  345  VPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  388



>ref|XP_004962249.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
 ref|XP_004962250.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
 ref|XP_004962268.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
 ref|XP_004962269.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
 ref|XP_004962270.1| PREDICTED: elongation factor 1-alpha-like isoform X1 [Setaria 
italica]
 ref|XP_004962271.1| PREDICTED: elongation factor 1-alpha-like isoform X2 [Setaria 
italica]
Length=447

 Score =   213 bits (541),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 101/104 (97%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  393  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AHA84124.1| elongation factor 1-alpha [Phaseolus vulgaris]
Length=447

 Score =   213 bits (541),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKE+EKEPKFLKNGDAG+VKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKEIEKEPKFLKNGDAGYVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  393  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_002518073.1| elongation factor 1-alpha, putative [Ricinus communis]
 ref|XP_002518074.1| elongation factor 1-alpha, putative [Ricinus communis]
 gb|EEF44206.1| elongation factor 1-alpha, putative [Ricinus communis]
 gb|EEF44207.1| elongation factor 1-alpha, putative [Ricinus communis]
Length=449

 Score =   213 bits (541),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSGKELEKEPKFLKNGDAGFVKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDP+G
Sbjct  393  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_007151593.1| hypothetical protein PHAVU_004G060000g [Phaseolus vulgaris]
 gb|ESW23587.1| hypothetical protein PHAVU_004G060000g [Phaseolus vulgaris]
Length=447

 Score =   212 bits (540),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKE+EKEPKFLKNGDAG+VKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKEIEKEPKFLKNGDAGYVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  393  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_003547695.1| PREDICTED: elongation factor 1-alpha isoform 2 [Glycine max]
 gb|KHN27573.1| Elongation factor 1-alpha [Glycine soja]
Length=447

 Score =   212 bits (540),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKE+EKEPKFLKNGDAG+VKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKEIEKEPKFLKNGDAGYVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  393  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|KDP29086.1| hypothetical protein JCGZ_16475 [Jatropha curcas]
Length=447

 Score =   212 bits (540),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSGKELEKEPKFLKNGDAGFVKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDP+G
Sbjct  393  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>gb|KDP29083.1| hypothetical protein JCGZ_16472 [Jatropha curcas]
Length=447

 Score =   212 bits (540),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSGKELEKEPKFLKNGDAGFVKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDP+G
Sbjct  393  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>gb|AIX10769.1| elongation factor 1 alpha [Panax notoginseng]
Length=449

 Score =   213 bits (541),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKE+EKEPKFLKNGDAG VKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKEIEKEPKFLKNGDAGMVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  393  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKAVDKKDPTG  436



>ref|XP_006858667.1| hypothetical protein AMTR_s00066p00072310 [Amborella trichopoda]
 gb|ERN20134.1| hypothetical protein AMTR_s00066p00072310 [Amborella trichopoda]
Length=447

 Score =   212 bits (540),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSGKELEKEPKFLKNGDAGFVKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDP+G
Sbjct  393  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>dbj|BAA34348.1| elongation factor-1 alpha [Nicotiana paniculata]
Length=447

 Score =   212 bits (540),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 101/114 (89%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -2

Query  661  RGLLASPPRSIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFL  482
            +G  +   + IIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSGKELEKEPKFL
Sbjct  323  KGASSFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFL  382

Query  481  KNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            KNGDAG VKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  383  KNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  436



>ref|XP_002284964.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 ref|XP_002284924.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 ref|XP_010651131.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 emb|CAN64511.1| hypothetical protein VITISV_035691 [Vitis vinifera]
Length=447

 Score =   212 bits (540),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSGKELEKEPKFLKNGDAGFVKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDP+G
Sbjct  393  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_007015467.1| GTP binding Elongation factor Tu family protein isoform 2 [Theobroma 
cacao]
 gb|EOY33086.1| GTP binding Elongation factor Tu family protein isoform 2 [Theobroma 
cacao]
Length=348

 Score =   209 bits (533),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKF+EL+TKIDRRSGKELEKEPKFLKNGDAG VKM
Sbjct  232  IIMNHPGQIGNGYAPVLDCHTSHIAVKFSELLTKIDRRSGKELEKEPKFLKNGDAGMVKM  291

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            +PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  292  VPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  335



>ref|XP_002528028.1| elongation factor 1-alpha, putative [Ricinus communis]
 gb|EEF34346.1| elongation factor 1-alpha, putative [Ricinus communis]
Length=449

 Score =   212 bits (540),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSGKELEKEPKFLKNGDAGFVKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDP+G
Sbjct  393  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|NP_001077483.1| elongation factor 1-alpha 2 [Arabidopsis thaliana]
 gb|AEE28214.1| Elongation factor 1-alpha [Arabidopsis thaliana]
Length=372

 Score =   210 bits (535),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 99/106 (93%), Positives = 103/106 (97%), Gaps = 0/106 (0%)
 Frame = -2

Query  637  RSIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFV  458
            R IIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSGKE+EKEPKFLKNGDAG V
Sbjct  254  RVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMV  313

Query  457  KMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            KM PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG
Sbjct  314  KMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  359



>emb|CDX70032.1| BnaA10g23810D [Brassica napus]
Length=344

 Score =   209 bits (532),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSGKE+EKEPKFLKNGDAG VKM
Sbjct  228  IIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKM  287

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
             PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG
Sbjct  288  TPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  331



>dbj|BAC66180.1| elongation factor 1A [Avicennia marina]
Length=449

 Score =   212 bits (540),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 101/114 (89%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = -2

Query  661  RGLLASPPRSIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFL  482
            +G  +   + IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFL
Sbjct  323  KGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFL  382

Query  481  KNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            KNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK+P+G
Sbjct  383  KNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKEPSG  436



>gb|ABA12218.1| translation elongation factor 1A-2 [Gossypium hirsutum]
 gb|KHG05237.1| Elongation factor 1-alpha [Gossypium arboreum]
 gb|KJB14364.1| hypothetical protein B456_002G121500 [Gossypium raimondii]
Length=447

 Score =   212 bits (540),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG +KM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMIKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  393  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>emb|CAD60652.1| elongation factor [Solanum tuberosum]
Length=447

 Score =   212 bits (540),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 101/114 (89%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -2

Query  661  RGLLASPPRSIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFL  482
            +G  +   + IIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSGKELEKEPKFL
Sbjct  323  KGAASFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFL  382

Query  481  KNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            KNGDAG VKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDP+G
Sbjct  383  KNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPSG  436



>ref|XP_010541344.1| PREDICTED: elongation factor 1-alpha [Tarenaya hassleriana]
Length=449

 Score =   212 bits (540),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            +PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  393  VPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AIZ68131.1| translation elongation factor 1-alpha [Ornithogalum saundersiae]
Length=447

 Score =   212 bits (540),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 99/104 (95%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSGKELEKEPKFLKNGDAGFVKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            +PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDP+G
Sbjct  393  VPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>sp|P43643.1|EF1A_TOBAC RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha; AltName: 
Full=Vitronectin-like adhesion protein 1; Short=PVN1 
[Nicotiana tabacum]
 gb|AAA20836.1| vitronectin-like adhesion protein [Nicotiana tabacum]
Length=447

 Score =   212 bits (539),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 100/114 (88%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -2

Query  661  RGLLASPPRSIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFL  482
            +G  +   + IIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSGKE+EKEPKFL
Sbjct  323  KGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKEIEKEPKFL  382

Query  481  KNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            KNGDAG VKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  383  KNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  436



>gb|ABV26710.1| elongation factor 1 alpha [Gerbera hybrid cultivar]
Length=449

 Score =   212 bits (539),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKF+EL+TKIDRRSGKELEKEPKFLKNGDAG VKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFSELLTKIDRRSGKELEKEPKFLKNGDAGMVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETF+EYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG
Sbjct  393  IPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>ref|XP_009762748.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana sylvestris]
Length=447

 Score =   212 bits (539),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSGKELEKEPKFLKNGDAG VKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  393  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  436



>ref|XP_008385284.1| PREDICTED: elongation factor 1-alpha-like [Malus domestica]
 ref|XP_009338279.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
Length=447

 Score =   212 bits (539),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 101/104 (97%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIG GYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGFVKM
Sbjct  333  IIMNHPGQIGQGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGFVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  393  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_010542598.1| PREDICTED: elongation factor 1-alpha-like [Tarenaya hassleriana]
Length=449

 Score =   212 bits (539),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSGKELEKEPKFLKNGDAG VKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  393  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|ABA12223.1| translation elongation factor 1A-7 [Gossypium hirsutum]
Length=448

 Score =   212 bits (539),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 99/106 (93%), Positives = 104/106 (98%), Gaps = 0/106 (0%)
 Frame = -2

Query  637  RSIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFV  458
            + IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG +
Sbjct  331  QGIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMI  390

Query  457  KMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            KM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  391  KMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|NP_001152668.1| LOC100286309 [Zea mays]
 ref|XP_008647989.1| PREDICTED: LOC100286309 isoform X1 [Zea mays]
 gb|ACG48827.1| elongation factor 1-alpha [Zea mays]
 gb|AFW76430.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW76431.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
 gb|AFW76432.1| putative translation elongation factor Tu family protein isoform 
3 [Zea mays]
Length=447

 Score =   212 bits (539),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            +PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  393  VPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_009783256.1| PREDICTED: elongation factor 1-alpha [Nicotiana sylvestris]
 dbj|BAA09709.1| elongation factor-1 alpha [Nicotiana tabacum]
Length=447

 Score =   212 bits (539),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 100/114 (88%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -2

Query  661  RGLLASPPRSIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFL  482
            +G  +   + IIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSGKE+EKEPKFL
Sbjct  323  KGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKEIEKEPKFL  382

Query  481  KNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            KNGDAG VKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  383  KNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  436



>ref|XP_009617039.1| PREDICTED: elongation factor 1-alpha [Nicotiana tomentosiformis]
Length=447

 Score =   212 bits (539),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 100/114 (88%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -2

Query  661  RGLLASPPRSIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFL  482
            +G  +   + IIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSGKELEKEPKFL
Sbjct  323  KGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFL  382

Query  481  KNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            KNGDAG VKMIPTKPMVVETF+EYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  383  KNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  436



>gb|ABB02622.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
Length=400

 Score =   211 bits (536),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 99/114 (87%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -2

Query  661  RGLLASPPRSIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFL  482
            +G  +   + IIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSGKELEKEPKFL
Sbjct  275  KGAASFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFL  334

Query  481  KNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            KNGDAG VKMIPTKPMVVETF+EYPPLGRFAVRDMRQTVAVGV+K+VDKKDPTG
Sbjct  335  KNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVVKNVDKKDPTG  388



>ref|XP_009793830.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana sylvestris]
Length=447

 Score =   212 bits (539),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSGKELEKEPKFLKNGDAG VKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  393  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  436



>gb|KJB48747.1| hypothetical protein B456_008G084000 [Gossypium raimondii]
Length=427

 Score =   211 bits (537),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 99/104 (95%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG +KM
Sbjct  312  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMIKM  371

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            +PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  372  VPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  415



>ref|XP_007207457.1| hypothetical protein PRUPE_ppa005717mg [Prunus persica]
 gb|EMJ08656.1| hypothetical protein PRUPE_ppa005717mg [Prunus persica]
Length=447

 Score =   212 bits (539),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIG GYAPVLDCHTSHIAVKFAE++TKIDRRSGKELEKEPKFLKNGDAGFVKM
Sbjct  333  IIMNHPGQIGQGYAPVLDCHTSHIAVKFAEMLTKIDRRSGKELEKEPKFLKNGDAGFVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  393  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AGV54713.1| elongation factor 1-alpha [Phaseolus vulgaris]
Length=447

 Score =   212 bits (539),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 101/104 (97%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETF EYPP GRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  393  IPTKPMVVETFFEYPPFGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|ABU63160.1| elongation factor [Saccharum officinarum]
 gb|AGT15989.1| elongation factor 1-alpha [Saccharum hybrid cultivar R570]
 gb|AGT15990.1| elongation factor 1-alpha [Saccharum hybrid cultivar R570]
 gb|AGT16629.1| elongation factor 1 alpha [Saccharum hybrid cultivar R570]
Length=447

 Score =   212 bits (539),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            +PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  393  VPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|KHG26926.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=448

 Score =   212 bits (539),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 99/104 (95%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG +KM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMIKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            +PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  393  VPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AAL79775.1| elongation factor 1 alpha [Saccharum hybrid cultivar CP72-2086]
Length=441

 Score =   211 bits (538),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM
Sbjct  327  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKM  386

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            +PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  387  VPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  430



>ref|XP_009392715.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009392716.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   211 bits (538),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 99/104 (95%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSGKELEKEPKFLKNGDAGFVKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETF++YPPLGRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  393  IPTKPMVVETFAQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|NP_001275420.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
 gb|ABB16975.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
Length=400

 Score =   210 bits (535),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 99/114 (87%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -2

Query  661  RGLLASPPRSIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFL  482
            +G  +   + IIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSGKELEKEPKFL
Sbjct  275  KGAASFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFL  334

Query  481  KNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            KNGDAG VKMIPTKPMVVETF+EYPPLGRFAVRDMRQTVAVGV+K+VDKKDPTG
Sbjct  335  KNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVVKNVDKKDPTG  388



>ref|XP_010542596.1| PREDICTED: elongation factor 1-alpha-like [Tarenaya hassleriana]
Length=449

 Score =   212 bits (539),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSGKELEKEPKFLKNGDAG VKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  393  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_004984833.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
 ref|XP_004984834.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
Length=447

 Score =   211 bits (538),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            +PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  393  VPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_004251154.1| PREDICTED: elongation factor 1-alpha-like [Solanum lycopersicum]
Length=447

 Score =   211 bits (538),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 100/114 (88%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -2

Query  661  RGLLASPPRSIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFL  482
            +G  +   + IIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSGKELEKEPKFL
Sbjct  323  KGAASFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFL  382

Query  481  KNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            KNGDAG VKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDP+G
Sbjct  383  KNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPSG  436



>gb|AFC88830.1| putative elongation factor 1-alpha [Miscanthus sinensis]
Length=447

 Score =   211 bits (538),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            +PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  393  VPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|ADR70875.1| eukaryotic translation elongation factor 1-alpha [Hevea brasiliensis]
Length=449

 Score =   211 bits (538),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSGKELEKEPKFLKNGDAGFVKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  393  IPTKPMVVETFSTYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AIM48895.1| elongation factor 1-alpha, partial [Cinnamomum camphora]
Length=432

 Score =   211 bits (537),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSGKELEKEPKFLKNGDAGFVKM
Sbjct  324  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKM  383

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  384  IPTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  427



>ref|XP_010920912.1| PREDICTED: elongation factor 1-alpha-like [Elaeis guineensis]
Length=447

 Score =   211 bits (538),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSGKELEKEPKFLKNGDAGFVKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  393  IPTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_010937804.1| PREDICTED: elongation factor 1-alpha-like [Elaeis guineensis]
 ref|XP_010937805.1| PREDICTED: elongation factor 1-alpha-like [Elaeis guineensis]
Length=447

 Score =   211 bits (538),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSGKELEKEPKFLKNGDAGFVKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  393  IPTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|KEH43533.1| GTP-binding elongation factor Tu family protein [Medicago truncatula]
Length=347

 Score =   209 bits (531),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 97/104 (93%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKE+EKEPKFLKNGDAG +KM
Sbjct  232  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKEIEKEPKFLKNGDAGIIKM  291

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  292  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKAVEKKDPSG  335



>ref|NP_001234035.1| elongation factor 1-alpha [Solanum lycopersicum]
 ref|XP_004240579.1| PREDICTED: elongation factor 1-alpha [Solanum lycopersicum]
 sp|P17786.1|EF1A_SOLLC RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Solanum 
lycopersicum]
 emb|CAA32618.1| unnamed protein product [Solanum lycopersicum]
 emb|CAA37212.1| elongation factor 1-alpha [Solanum lycopersicum]
Length=448

 Score =   211 bits (538),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 99/114 (87%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -2

Query  661  RGLLASPPRSIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFL  482
            +G  +   + IIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSGKELEKEPKFL
Sbjct  323  KGAASFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFL  382

Query  481  KNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            KNGDAG VKMIPTKPMVVETF+EYPPLGRFAVRDMRQTVAVGV+K+VDKKDPTG
Sbjct  383  KNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVVKNVDKKDPTG  436



>ref|XP_010043711.1| PREDICTED: elongation factor 1-alpha [Eucalyptus grandis]
 gb|KCW85696.1| hypothetical protein EUGRSUZ_B02473 [Eucalyptus grandis]
Length=449

 Score =   211 bits (538),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 99/104 (95%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSGKELEKEPKFLKNGDAGFVKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGFVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDP+G
Sbjct  393  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_008656153.1| PREDICTED: elongation factor 1-alpha-like [Zea mays]
 ref|XP_008656154.1| PREDICTED: elongation factor 1-alpha-like [Zea mays]
 gb|AFW81463.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW81464.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
 gb|AFW81465.1| putative translation elongation factor Tu family protein isoform 
3 [Zea mays]
Length=447

 Score =   211 bits (538),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  393  IPTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_002279598.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 emb|CAN66350.1| hypothetical protein VITISV_044270 [Vitis vinifera]
Length=447

 Score =   211 bits (538),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+ TKIDRRSGKELEKEPKFLKNGDAGFVKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEITTKIDRRSGKELEKEPKFLKNGDAGFVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDP+G
Sbjct  393  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_008656156.1| PREDICTED: elongation factor 1-alpha-like isoform X2 [Zea mays]
 gb|AFW81467.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW81468.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
 gb|AFW81469.1| putative translation elongation factor Tu family protein isoform 
3 [Zea mays]
Length=447

 Score =   211 bits (538),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  393  IPTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AAL79774.1|AF331849_1 elongation factor 1 alpha [Saccharum hybrid cultivar CP65-357]
Length=447

 Score =   211 bits (538),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            +PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  393  VPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|ACG31866.1| elongation factor 1-alpha [Zea mays]
Length=447

 Score =   211 bits (538),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  393  IPTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|ACR38047.1| unknown [Zea mays]
 gb|AFW77623.1| elongation factor alpha1 [Zea mays]
Length=447

 Score =   211 bits (538),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  393  IPTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|NP_001288407.1| elongation factor 1-alpha-like [Zea mays]
 gb|ACF87009.1| unknown [Zea mays]
Length=447

 Score =   211 bits (538),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  393  IPTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|ABA12221.1| translation elongation factor 1A-5 [Gossypium hirsutum]
Length=448

 Score =   211 bits (538),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 99/104 (95%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG +KM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMIKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            +PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  393  VPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_009593325.1| PREDICTED: elongation factor 1-alpha [Nicotiana tomentosiformis]
Length=447

 Score =   211 bits (537),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 100/114 (88%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -2

Query  661  RGLLASPPRSIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFL  482
            +G  +   + IIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSGKE+EKEPKFL
Sbjct  323  KGASSFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKEIEKEPKFL  382

Query  481  KNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            KNGDAG VKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  383  KNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  436



>ref|NP_001290506.1| elongation factor 1-alpha [Elaeis guineensis]
 ref|XP_010922532.1| PREDICTED: elongation factor 1-alpha [Elaeis guineensis]
 gb|AAT45847.1| elongation factor 1-alpha 1 [Elaeis guineensis]
Length=447

 Score =   211 bits (537),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 99/104 (95%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSGKELEKEPKFLKNGDAGFVKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIKSV+KKDP+G
Sbjct  393  IPTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>gb|AAX54511.1| elongation factor 1 alpha [Actinidia deliciosa]
Length=447

 Score =   211 bits (537),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGD+G VKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDSGMVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  393  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_009381507.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009381508.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009381509.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   211 bits (537),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGFVKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGFVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            +PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  393  VPTKPMVVETFSTYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|ABB86283.1| elongation factor-1 alpha-like [Solanum tuberosum]
Length=447

 Score =   211 bits (537),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 99/114 (87%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -2

Query  661  RGLLASPPRSIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFL  482
            +G  +   + IIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSGKELEKEPKFL
Sbjct  323  KGAASFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFL  382

Query  481  KNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            KNGDAG VKMIPTKPMVVETF+EYPPLGRFAVRDMRQTVAVGV+K+VDKKDPTG
Sbjct  383  KNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVVKNVDKKDPTG  436



>ref|XP_010067278.1| PREDICTED: elongation factor 1-alpha-like [Eucalyptus grandis]
Length=447

 Score =   211 bits (537),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKF+EL+TKIDRRSGKELEKEPKFLKNGDAG VKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFSELLTKIDRRSGKELEKEPKFLKNGDAGMVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  393  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|NP_001274875.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
 gb|ABC01896.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
Length=448

 Score =   211 bits (537),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 99/114 (87%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -2

Query  661  RGLLASPPRSIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFL  482
            +G  +   + IIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSGKELEKEPKFL
Sbjct  324  KGAASFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFL  383

Query  481  KNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            KNGDAG VKMIPTKPMVVETF+EYPPLGRFAVRDMRQTVAVGV+K+VDKKDPTG
Sbjct  384  KNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVVKNVDKKDPTG  437



>dbj|BAC23049.1| Elongation factor 1-alpha [Solanum tuberosum]
 gb|AHL27103.1| eukaryotic elongation factor 1A protein [Solanum chacoense]
Length=448

 Score =   211 bits (537),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 99/114 (87%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -2

Query  661  RGLLASPPRSIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFL  482
            +G  +   + IIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSGKELEKEPKFL
Sbjct  323  KGAASFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFL  382

Query  481  KNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            KNGDAG VKMIPTKPMVVETF+EYPPLGRFAVRDMRQTVAVGV+K+VDKKDPTG
Sbjct  383  KNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVVKNVDKKDPTG  436



>emb|CAJ38380.1| translation elongation factor 1 alpha [Plantago major]
Length=249

 Score =   205 bits (522),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 97/104 (93%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIG GYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM
Sbjct  133  IIMNHPGQIGQGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKM  192

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETF+EYPPLGRFAVRDMRQTVAVGVIKSV+KK+P+G
Sbjct  193  IPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKSVEKKEPSG  236



>ref|XP_006343452.1| PREDICTED: elongation factor 1-alpha-like [Solanum tuberosum]
 ref|XP_006343454.1| PREDICTED: elongation factor 1-alpha-like isoform X2 [Solanum 
tuberosum]
 ref|XP_006343455.1| PREDICTED: elongation factor 1-alpha-like [Solanum tuberosum]
 gb|ABB55388.1| elongation factor 1-alpha-like [Solanum tuberosum]
Length=448

 Score =   211 bits (537),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 99/114 (87%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -2

Query  661  RGLLASPPRSIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFL  482
            +G  +   + IIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSGKELEKEPKFL
Sbjct  323  KGAASFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFL  382

Query  481  KNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            KNGDAG VKMIPTKPMVVETF+EYPPLGRFAVRDMRQTVAVGV+K+VDKKDPTG
Sbjct  383  KNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVVKNVDKKDPTG  436



>ref|XP_004157309.1| PREDICTED: elongation factor 1-alpha-like [Cucumis sativus]
Length=449

 Score =   211 bits (537),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 99/104 (95%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKF E++TKIDRRSGKELEKEPKFLKNGDAGFVKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFGEILTKIDRRSGKELEKEPKFLKNGDAGFVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDP+G
Sbjct  393  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|NP_001275481.1| elongation factor 1-alpha-like [Solanum tuberosum]
 gb|ABB16996.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
Length=448

 Score =   211 bits (537),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 99/114 (87%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -2

Query  661  RGLLASPPRSIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFL  482
            +G  +   + IIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSGKELEKEPKFL
Sbjct  323  KGAASFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFL  382

Query  481  KNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            KNGDAG VKMIPTKPMVVETF+EYPPLGRFAVRDMRQTVAVGV+K+VDKKDPTG
Sbjct  383  KNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVVKNVDKKDPTG  436



>gb|ABA12222.1| translation elongation factor 1A-6 [Gossypium hirsutum]
 gb|KHG08414.1| Elongation factor 1-alpha [Gossypium arboreum]
 gb|KJB16823.1| hypothetical protein B456_002G249600 [Gossypium raimondii]
 gb|KJB16824.1| hypothetical protein B456_002G249600 [Gossypium raimondii]
 gb|KJB16825.1| hypothetical protein B456_002G249600 [Gossypium raimondii]
Length=447

 Score =   211 bits (537),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKF+EL+TKIDRRSGKELEKEPKFLKNGDAG VKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFSELLTKIDRRSGKELEKEPKFLKNGDAGMVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  393  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|ACG34498.1| elongation factor 1-alpha [Zea mays]
Length=447

 Score =   211 bits (537),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  393  IPTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>dbj|BAM13877.1| elongation factor 1 alpha [Arum maculatum]
Length=447

 Score =   211 bits (537),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 99/104 (95%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSGKELEKEPKFLKNGDAGFVKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IP+KPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDP+G
Sbjct  393  IPSKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>gb|AAN77897.1| elongation factor 1 alpha [Stevia rebaudiana]
Length=449

 Score =   211 bits (537),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 99/114 (87%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -2

Query  661  RGLLASPPRSIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFL  482
            +G  +   + IIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSGKELEKEPKFL
Sbjct  323  KGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKELEKEPKFL  382

Query  481  KNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            KNGDAG VKM+PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG
Sbjct  383  KNGDAGMVKMLPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>gb|AFJ04514.1| elongation factor 1-alpha, partial [Vernicia fordii]
Length=438

 Score =   211 bits (536),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 99/104 (95%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSGKELEKEPKFLKNGDAGFVKM
Sbjct  332  IIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGFVKM  391

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDP+G
Sbjct  392  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  435



>gb|ADR70874.1| eukaryotic translation elongation factor 1-alpha [Hevea brasiliensis]
Length=449

 Score =   211 bits (537),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSGKELEKEPKFLKNGDAGFVKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  393  IPTKPMVVETFSGYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|KHG20498.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=447

 Score =   211 bits (536),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 99/104 (95%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG +KM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMIKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  393  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>gb|AHE76183.1| elongation factor 1-alpha [Chrysanthemum indicum]
Length=449

 Score =   211 bits (536),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 99/114 (87%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = -2

Query  661  RGLLASPPRSIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFL  482
            +G  +   + IIMNHPGQIGNGYAPVLDCHTSHIAVKF E++TKIDRRSGKELEKEPKFL
Sbjct  323  KGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFGEILTKIDRRSGKELEKEPKFL  382

Query  481  KNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            KNGDAG VKM+PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG
Sbjct  383  KNGDAGMVKMLPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>gb|AID52924.1| elongation factor 1-alpha [Carthamus tinctorius]
Length=449

 Score =   211 bits (536),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 100/114 (88%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = -2

Query  661  RGLLASPPRSIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFL  482
            +G  +   + IIMNHPGQIGNGYAPVLDCHTSHIAVKF EL+TKIDRRSGKE+EKEPKFL
Sbjct  323  KGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFQELVTKIDRRSGKEIEKEPKFL  382

Query  481  KNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            KNGDAG VKMIPTKPMVVETF+EYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG
Sbjct  383  KNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>gb|KGN61480.1| hypothetical protein Csa_2G139820 [Cucumis sativus]
Length=330

 Score =   207 bits (528),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 101/104 (97%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRS KELEKEPKFLKNGDAG VKM
Sbjct  216  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSAKELEKEPKFLKNGDAGMVKM  275

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  276  IPTKPMVVETFSTYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  319



>ref|XP_009342345.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
Length=447

 Score =   211 bits (536),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIG GYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELE+EPKFLKNGDAGFVKM
Sbjct  333  IIMNHPGQIGQGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEREPKFLKNGDAGFVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  393  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>dbj|BAL41369.1| elongation factor 1-alpha, partial [Arum maculatum]
Length=124

 Score =   201 bits (510),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 94/98 (96%), Positives = 98/98 (100%), Gaps = 0/98 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSGKELEKEPKFLKNGDAGFVKM
Sbjct  27   IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKM  86

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  338
            IP+KPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+
Sbjct  87   IPSKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVE  124



>gb|AAC15413.1| translation elongation factor-1 alpha [Oryza sativa Japonica 
Group]
Length=447

 Score =   211 bits (536),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  393  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>gb|KGN51227.1| hypothetical protein Csa_5G495940 [Cucumis sativus]
Length=344

 Score =   207 bits (528),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 97/104 (93%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSGKELEKEPKFLKNGDAGFVKM
Sbjct  228  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKM  287

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIK+V+KKD +G
Sbjct  288  IPTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKAVEKKDASG  331



>ref|NP_001280807.1| elongation factor 1-alpha-like [Malus domestica]
 ref|XP_008349742.1| PREDICTED: elongation factor 1-alpha isoform X1 [Malus domestica]
 ref|XP_008366354.1| PREDICTED: elongation factor 1-alpha [Malus domestica]
 emb|CAA11705.1| elongation factor 1 alpha subunit [Malus domestica]
Length=447

 Score =   211 bits (536),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIG GYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGFVKM
Sbjct  333  IIMNHPGQIGQGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGFVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            +PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  393  LPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_008224492.1| PREDICTED: elongation factor 1-alpha [Prunus mume]
Length=447

 Score =   211 bits (536),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 99/104 (95%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIG GYAPVLDCHTSHIAVKFAE++TKIDRRSGKELEKEPKFLKNGDAGFVKM
Sbjct  333  IIMNHPGQIGQGYAPVLDCHTSHIAVKFAEMLTKIDRRSGKELEKEPKFLKNGDAGFVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            +PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  393  VPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_007015463.1| GTP binding Elongation factor Tu family protein [Theobroma cacao]
 gb|EOY33082.1| GTP binding Elongation factor Tu family protein [Theobroma cacao]
Length=449

 Score =   211 bits (536),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 99/104 (95%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            +PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  393  VPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>gb|ABD66072.1| elongation factor 1-alpha [Phoenix dactylifera]
Length=245

 Score =   204 bits (520),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 96/102 (94%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++T+IDRRSGKELEKEPKFLK+GDAGFVKM
Sbjct  144  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTEIDRRSGKELEKEPKFLKSGDAGFVKM  203

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDP  326
            IPTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIKSV+KKDP
Sbjct  204  IPTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKDP  245



>ref|XP_001763198.1| predicted protein [Physcomitrella patens]
 gb|EDQ72075.1| predicted protein [Physcomitrella patens]
Length=352

 Score =   208 bits (529),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 96/104 (92%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TK+DRRSGKELEKEPKFLKNGDAGFVKM
Sbjct  238  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKVDRRSGKELEKEPKFLKNGDAGFVKM  297

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPM VETF+EYPPLGRFAVRDMRQTVAVGVIK+V+KK+PTG
Sbjct  298  IPTKPMTVETFAEYPPLGRFAVRDMRQTVAVGVIKAVEKKEPTG  341



>gb|EEE58429.1| hypothetical protein OsJ_09630 [Oryza sativa Japonica Group]
Length=427

 Score =   210 bits (534),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM
Sbjct  313  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKM  372

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  373  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  416



>gb|ACS68200.1| elongation factor 1 alpha [Brassica napus]
Length=449

 Score =   211 bits (536),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 103/127 (81%), Positives = 109/127 (86%), Gaps = 13/127 (10%)
 Frame = -2

Query  661  RGLLASPPRS-------------IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDR  521
            RG +AS P+              IIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDR
Sbjct  310  RGYVASNPKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDR  369

Query  520  RSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV  341
            RSGKE+EKEPKFLKNGDAG VKM PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV
Sbjct  370  RSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV  429

Query  340  DKKDPTG  320
            DKKDPTG
Sbjct  430  DKKDPTG  436



>ref|NP_001105617.1| elongation factor alpha3 [Zea mays]
 gb|AAF42977.1| elongation factor 1 alpha [Zea mays]
Length=447

 Score =   210 bits (535),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  393  IPTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|NP_001105933.1| elongation factor alpha2 [Zea mays]
 gb|AAF42976.1| elongation factor 1 alpha [Zea mays]
Length=447

 Score =   210 bits (535),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  393  IPTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_009403341.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   210 bits (535),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGFVKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGFVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIKSV+KKDP+G
Sbjct  393  IPTKPMVVETFSGYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_002277159.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 ref|XP_010658430.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 emb|CAN76417.1| hypothetical protein VITISV_018410 [Vitis vinifera]
 emb|CAN69000.1| hypothetical protein VITISV_022484 [Vitis vinifera]
Length=447

 Score =   210 bits (535),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 99/104 (95%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+MTKIDRRSGKELEKEPKFLKNGDAG VKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEIMTKIDRRSGKELEKEPKFLKNGDAGLVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  393  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPSG  436



>sp|Q41011.1|EF1A_PEA RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Pisum 
sativum]
 emb|CAA65391.1| elongation factor 1-alpha [Pisum sativum]
Length=447

 Score =   210 bits (535),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 99/104 (95%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKE+EKEPKFLKNGDAG VKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSGKEIEKEPKFLKNGDAGMVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETF+EYPPLGRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  393  IPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_008790814.1| PREDICTED: elongation factor 1-alpha-like [Phoenix dactylifera]
Length=447

 Score =   210 bits (535),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGLVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  393  IPTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>dbj|BAA23658.1| EF-1 alpha [Oryza sativa]
Length=447

 Score =   210 bits (535),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  393  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>gb|ABF94276.1| Elongation factor 1-alpha, putative, expressed [Oryza sativa 
Japonica Group]
 gb|ABF94277.1| Elongation factor 1-alpha, putative, expressed [Oryza sativa 
Japonica Group]
Length=449

 Score =   210 bits (535),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM
Sbjct  335  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKM  394

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  395  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  438



>ref|XP_008233357.1| PREDICTED: elongation factor 1-alpha-like [Prunus mume]
Length=447

 Score =   210 bits (535),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 99/104 (95%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKF E++TKIDRRSGKELEKEPKFLKNGDAGFVKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFNEILTKIDRRSGKELEKEPKFLKNGDAGFVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDP+G
Sbjct  393  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>gb|AFW77593.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW77594.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
Length=447

 Score =   210 bits (535),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  393  IPTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|NP_001288465.1| elongation factor 1-alpha-like [Zea mays]
 ref|XP_008647262.1| PREDICTED: elongation factor alpha2 isoform X1 [Zea mays]
 gb|ACG25290.1| elongation factor 1-alpha [Zea mays]
 gb|AFW77596.1| putative translation elongation factor Tu family protein [Zea 
mays]
 gb|AFW77599.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW77600.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
Length=447

 Score =   210 bits (535),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  393  IPTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|ABA12220.1| translation elongation factor 1A-4 [Gossypium hirsutum]
 gb|KJB62497.1| hypothetical protein B456_009G420000 [Gossypium raimondii]
 gb|KJB62498.1| hypothetical protein B456_009G420000 [Gossypium raimondii]
 gb|KJB62499.1| hypothetical protein B456_009G420100 [Gossypium raimondii]
 gb|KJB62500.1| hypothetical protein B456_009G420100 [Gossypium raimondii]
Length=447

 Score =   210 bits (535),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKF+EL+TKIDRRSGKELEKEPKFLKNGDAG +KM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFSELLTKIDRRSGKELEKEPKFLKNGDAGMIKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            +PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  393  VPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_006417745.1| hypothetical protein EUTSA_v10007619mg [Eutrema salsugineum]
 ref|XP_006417746.1| hypothetical protein EUTSA_v10007619mg [Eutrema salsugineum]
 ref|XP_006417749.1| hypothetical protein EUTSA_v10007620mg [Eutrema salsugineum]
 ref|XP_006417750.1| hypothetical protein EUTSA_v10007618mg [Eutrema salsugineum]
 ref|XP_006417751.1| hypothetical protein EUTSA_v10007618mg [Eutrema salsugineum]
 ref|XP_006400853.1| hypothetical protein EUTSA_v10013526mg [Eutrema salsugineum]
 dbj|BAJ33644.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ36098.1| hypothetical protein EUTSA_v10007619mg [Eutrema salsugineum]
 gb|ESQ36099.1| hypothetical protein EUTSA_v10007619mg [Eutrema salsugineum]
 gb|ESQ36102.1| hypothetical protein EUTSA_v10007620mg [Eutrema salsugineum]
 gb|ESQ36103.1| hypothetical protein EUTSA_v10007618mg [Eutrema salsugineum]
 gb|ESQ36104.1| hypothetical protein EUTSA_v10007618mg [Eutrema salsugineum]
 gb|ESQ42306.1| hypothetical protein EUTSA_v10013526mg [Eutrema salsugineum]
Length=449

 Score =   210 bits (535),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 99/104 (95%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSGKELEKEPKFLKNGDAG VKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGMVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
             PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG
Sbjct  393  TPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>gb|ABA12217.1| translation elongation factor 1A-1 [Gossypium hirsutum]
Length=447

 Score =   210 bits (535),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKF+EL+TKIDRRSGKELEKEPKFLKNGDAG +KM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFSELLTKIDRRSGKELEKEPKFLKNGDAGMIKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            +PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  393  VPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|ABA12225.1| translation elongation factor 1A-9 [Gossypium hirsutum]
Length=448

 Score =   210 bits (535),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG +KM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMIKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            +PTKPM+VETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  393  VPTKPMLVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_006646939.1| PREDICTED: elongation factor 1-alpha-like [Oryza brachyantha]
Length=447

 Score =   210 bits (535),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  393  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>ref|NP_001049145.1| Os03g0177400 [Oryza sativa Japonica Group]
 ref|NP_001049146.1| Os03g0177500 [Oryza sativa Japonica Group]
 ref|NP_001049147.1| Os03g0177900 [Oryza sativa Japonica Group]
 ref|NP_001049148.1| Os03g0178000 [Oryza sativa Japonica Group]
 ref|XP_006649493.1| PREDICTED: elongation factor 1-alpha-like [Oryza brachyantha]
 ref|XP_006649494.1| PREDICTED: elongation factor 1-alpha-like [Oryza brachyantha]
 sp|O64937.2|EF1A_ORYSJ RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Oryza 
sativa Japonica Group]
 dbj|BAA23657.1| EF-1 alpha [Oryza sativa]
 dbj|BAA23659.1| EF-1 alpha [Oryza sativa]
 dbj|BAA23660.1| EF-1 alpha [Oryza sativa]
 gb|ABF94269.1| Elongation factor 1-alpha, putative [Oryza sativa Japonica Group]
 gb|ABF94270.1| Elongation factor 1-alpha, putative, expressed [Oryza sativa 
Japonica Group]
 gb|ABF94273.1| Elongation factor 1-alpha, putative, expressed [Oryza sativa 
Japonica Group]
 gb|ABF94274.1| Elongation factor 1-alpha, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11059.1| Os03g0177400 [Oryza sativa Japonica Group]
 dbj|BAF11060.1| Os03g0177500 [Oryza sativa Japonica Group]
 dbj|BAF11061.1| Os03g0177900 [Oryza sativa Japonica Group]
 dbj|BAF11062.1| Os03g0178000 [Oryza sativa Japonica Group]
 gb|EAZ25788.1| hypothetical protein OsJ_09631 [Oryza sativa Japonica Group]
 gb|EAZ25791.1| hypothetical protein OsJ_09634 [Oryza sativa Japonica Group]
 gb|EAZ25792.1| hypothetical protein OsJ_09635 [Oryza sativa Japonica Group]
 dbj|BAG87945.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93078.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97075.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74621.1| hypothetical protein OsI_10237 [Oryza sativa Indica Group]
 gb|EEC74622.1| hypothetical protein OsI_10241 [Oryza sativa Indica Group]
 gb|EEC74623.1| hypothetical protein OsI_10242 [Oryza sativa Indica Group]
 gb|ADM86871.1| elongation factor-1 alpha [Oryza sativa Japonica Group]
 gb|ADM86885.1| elongation factor-1 alpha [Oryza sativa Japonica Group]
 gb|ADM86886.1| elongation factor-1 alpha [Oryza sativa Japonica Group]
 gb|ADM86887.1| elongation factor-1 alpha [Oryza sativa Japonica Group]
Length=447

 Score =   210 bits (535),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  393  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>sp|O49169.1|EF1A_MANES RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Manihot 
esculenta]
 gb|AAC39447.1| elongation factor 1-alpha [Manihot esculenta]
Length=449

 Score =   210 bits (535),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 99/104 (95%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSGKELEKEPKFLKNGDAGFVKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIKSV+KKDP+G
Sbjct  393  IPTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>emb|CDY22710.1| BnaC08g43440D [Brassica napus]
 emb|CDY22711.1| BnaC08g43450D [Brassica napus]
Length=427

 Score =   209 bits (533),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSGKE+EKEPKFLKNGDAG VKM
Sbjct  311  IIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKM  370

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
             PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG
Sbjct  371  TPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  414



>gb|KHG23927.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=449

 Score =   210 bits (535),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG +KM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMIKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            +PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDP+G
Sbjct  393  VPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>gb|AAP80665.1|AF479046_1 elongation factor-1 alpha, partial [Triticum aestivum]
Length=143

 Score =   201 bits (510),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 93/104 (89%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQI NGYAPVLDCHTSHIAVKFAE+ TKIDRRSGKE+E  PKFLKNGDAGFVKM
Sbjct  29   IIMNHPGQISNGYAPVLDCHTSHIAVKFAEIQTKIDRRSGKEIEAAPKFLKNGDAGFVKM  88

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETF++YPPLGRFAVRDMRQTVAVGVIK+V+ KDPTG
Sbjct  89   IPTKPMVVETFAQYPPLGRFAVRDMRQTVAVGVIKAVEXKDPTG  132



>emb|CDX88757.1| BnaA03g08920D [Brassica napus]
Length=401

 Score =   209 bits (531),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSGKE+EKEPKFLKNGDAG VKM
Sbjct  285  IIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKM  344

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
             PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG
Sbjct  345  TPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  388



>gb|AGH32502.1| translation elongation factor-1 alpha [Stylosanthes guianensis]
Length=447

 Score =   210 bits (534),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 99/104 (95%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGLVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  393  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPSG  436



>gb|EPS66340.1| elongation factor 1-alpha, partial [Genlisea aurea]
Length=441

 Score =   210 bits (534),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 99/104 (95%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSGKELEKEPKFLKNGDAGFVKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKD +G
Sbjct  393  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDASG  436



>dbj|BAC22125.1| eukaryotic elongation factor 1A [Bruguiera sexangula]
Length=449

 Score =   210 bits (534),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSGKELEKEPKFLKNGDAGFVKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGFVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK+P+G
Sbjct  393  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKEPSG  436



>ref|XP_007218005.1| hypothetical protein PRUPE_ppa005706mg [Prunus persica]
 gb|EMJ19204.1| hypothetical protein PRUPE_ppa005706mg [Prunus persica]
Length=447

 Score =   210 bits (534),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 99/104 (95%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKF E++TKIDRRSGKELEKEPKFLKNGDAGFVKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFNEILTKIDRRSGKELEKEPKFLKNGDAGFVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDP+G
Sbjct  393  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>dbj|BAL14665.1| elongation factor 1-alpha [Chrysanthemum seticuspe f. boreale]
Length=449

 Score =   210 bits (534),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/114 (86%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = -2

Query  661  RGLLASPPRSIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFL  482
            +G  +   + IIMNHPGQIGNGYAPVLDCHTSHIAVKF E++TKIDRRSGKE+EKEPKFL
Sbjct  323  KGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFGEILTKIDRRSGKEIEKEPKFL  382

Query  481  KNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            KNGDAG VKM+PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG
Sbjct  383  KNGDAGMVKMLPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>ref|XP_008789061.1| PREDICTED: elongation factor 1-alpha-like [Phoenix dactylifera]
 ref|XP_008789062.1| PREDICTED: elongation factor 1-alpha-like [Phoenix dactylifera]
 ref|XP_008789063.1| PREDICTED: elongation factor 1-alpha-like [Phoenix dactylifera]
Length=447

 Score =   210 bits (534),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 99/104 (95%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSGKELEKEPKFLKNGDAGFVKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGFVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  393  IPTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>emb|CDY61938.1| BnaCnng38780D [Brassica napus]
 emb|CDY34479.1| BnaC04g13200D [Brassica napus]
 emb|CDY10804.1| BnaA05g11320D [Brassica napus]
 emb|CDY09211.1| BnaA02g06370D [Brassica napus]
Length=428

 Score =   209 bits (532),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSGKE+EKEPKFLKNGDAG VKM
Sbjct  312  IIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKM  371

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
             PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG
Sbjct  372  TPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  415



>ref|XP_003553292.1| PREDICTED: elongation factor 1-alpha isoform 1 [Glycine max]
Length=447

 Score =   210 bits (534),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 99/104 (95%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSGKELEKEPKFLKNGDAG VKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGMVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  393  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AEN79476.1| elongation factor 1-alpha [Ziziphus jujuba]
Length=447

 Score =   210 bits (534),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELE+EPKFLKNGDAG VKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEREPKFLKNGDAGMVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            +PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDP+G
Sbjct  393  VPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_010032227.1| PREDICTED: elongation factor 1-alpha-like [Eucalyptus grandis]
 gb|KCW51630.1| hypothetical protein EUGRSUZ_J01121 [Eucalyptus grandis]
Length=447

 Score =   210 bits (534),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 99/104 (95%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IP+KPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDP+G
Sbjct  393  IPSKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|NP_001105587.1| elongation factor 1-alpha [Zea mays]
 gb|AAB64207.1| elongation factor 1-alpha [Zea mays]
 gb|ACG32939.1| elongation factor 1-alpha [Zea mays]
 gb|AFW87114.1| LOW QUALITY PROTEIN: putative translation elongation factor Tu 
family protein [Zea mays]
Length=447

 Score =   210 bits (534),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 99/104 (95%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            +PTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  393  VPTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|NP_001183947.1| uncharacterized protein LOC100502553 [Zea mays]
 gb|ACF84684.1| unknown [Zea mays]
Length=399

 Score =   208 bits (530),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 99/104 (95%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKF+EL+TKIDRRSGKELE  PKFLKNGDAGFVKM
Sbjct  285  IIMNHPGQIGNGYAPVLDCHTSHIAVKFSELLTKIDRRSGKELESAPKFLKNGDAGFVKM  344

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  345  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  388



>gb|ABD66517.1| EF-1 alpha [Gymnadenia conopsea]
Length=447

 Score =   209 bits (533),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSGKELEKEPKFLKNGDAGFVKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IP+KPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK+P+G
Sbjct  393  IPSKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKEPSG  436



>ref|XP_010939624.1| PREDICTED: elongation factor 1-alpha-like [Elaeis guineensis]
 ref|XP_010939625.1| PREDICTED: elongation factor 1-alpha-like [Elaeis guineensis]
Length=447

 Score =   209 bits (533),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 99/104 (95%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKF+EL++KIDRRSGKELEKEPKFLKNGDAGFVKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFSELLSKIDRRSGKELEKEPKFLKNGDAGFVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEY PLGRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  393  IPTKPMVVETFSEYSPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|NP_001104939.1| elongation factor alpha6 [Zea mays]
 gb|AAF42980.1| elongation factor 1 alpha [Zea mays]
Length=447

 Score =   209 bits (533),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 99/104 (95%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKEL +EPKFLKNGDAGFVKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSGKELGEEPKFLKNGDAGFVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            +PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  393  VPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>sp|Q41803.1|EF1A_MAIZE RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Zea 
mays]
 dbj|BAA08249.1| alpha subunit of tlanslation elongation factor 1 [Zea mays]
Length=447

 Score =   209 bits (533),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 99/104 (95%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            +PTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  393  VPTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|ADI24333.1| elongation factor 1-alpha [Miscanthus sinensis]
Length=447

 Score =   209 bits (533),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 99/104 (95%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            +PTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  393  VPTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_009342341.1| PREDICTED: elongation factor 1-alpha [Pyrus x bretschneideri]
Length=447

 Score =   209 bits (533),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 99/104 (95%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSGKELEKEPKFLKNGDAG VKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK+PTG
Sbjct  393  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKEPTG  436



>ref|XP_009358244.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
 ref|XP_009338285.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
Length=447

 Score =   209 bits (533),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 99/104 (95%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSGKELEKEPKFLKNGDAG VKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK+PTG
Sbjct  393  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKEPTG  436



>sp|O24534.1|EF1A_VICFA RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Vicia 
faba]
 emb|CAA10847.1| elongation factor 1-alpha (EF1-a) [Vicia faba]
Length=447

 Score =   209 bits (533),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 99/104 (95%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKE+EKEPKFLKNGDAG VKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSGKEIEKEPKFLKNGDAGMVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETF+EYPPLGRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  393  IPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|KJB09231.1| hypothetical protein B456_001G130700 [Gossypium raimondii]
 gb|KJB09232.1| hypothetical protein B456_001G130700 [Gossypium raimondii]
Length=447

 Score =   209 bits (533),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG +KM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMIKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  393  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPSG  436



>ref|XP_011026991.1| PREDICTED: elongation factor 1-alpha isoform X1 [Populus euphratica]
 ref|XP_011026997.1| PREDICTED: elongation factor 1-alpha [Populus euphratica]
 ref|XP_011040951.1| PREDICTED: elongation factor 1-alpha [Populus euphratica]
Length=449

 Score =   209 bits (533),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSGKELEKEPKFLKNGDAG +KM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMIKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDP+G
Sbjct  393  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_011031783.1| PREDICTED: elongation factor 1-alpha-like [Populus euphratica]
 ref|XP_011040944.1| PREDICTED: elongation factor 1-alpha-like isoform X1 [Populus 
euphratica]
 ref|XP_011040945.1| PREDICTED: elongation factor 1-alpha-like isoform X1 [Populus 
euphratica]
Length=449

 Score =   209 bits (533),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSGKELEKEPKFLKNGDAG +KM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMIKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDP+G
Sbjct  393  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>dbj|BAC22127.1| eukaryotic elongation factor 1A [Salsola komarovii]
Length=447

 Score =   209 bits (533),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG +KM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMIKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            +PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  393  VPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>ref|XP_011091454.1| PREDICTED: elongation factor 1-alpha-like [Sesamum indicum]
Length=449

 Score =   209 bits (533),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 99/104 (95%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKK+P+G
Sbjct  393  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKEPSG  436



>ref|XP_007015466.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 gb|EOY33085.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
Length=449

 Score =   209 bits (533),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKF+EL+TKIDRRSGKELEKEPKFLKNGDAG VKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFSELLTKIDRRSGKELEKEPKFLKNGDAGMVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            +PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  393  VPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>ref|XP_010669657.1| PREDICTED: elongation factor 1-alpha [Beta vulgaris subsp. vulgaris]
 ref|XP_010669662.1| PREDICTED: elongation factor 1-alpha [Beta vulgaris subsp. vulgaris]
Length=447

 Score =   209 bits (533),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 99/104 (95%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKE+EKEPKFLKNGDAG VKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKEIEKEPKFLKNGDAGMVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  393  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>ref|XP_006424633.1| hypothetical protein CICLE_v10028443mg [Citrus clementina]
 ref|XP_006488149.1| PREDICTED: elongation factor 1-alpha-like [Citrus sinensis]
 gb|ESR37873.1| hypothetical protein CICLE_v10028443mg [Citrus clementina]
Length=447

 Score =   209 bits (533),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 99/104 (95%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKF+EL+TKIDRRSGKELEKEPKFLKNGDAG VKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  393  IPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_011026992.1| PREDICTED: elongation factor 1-alpha isoform X2 [Populus euphratica]
 ref|XP_011026993.1| PREDICTED: elongation factor 1-alpha isoform X2 [Populus euphratica]
 ref|XP_011026995.1| PREDICTED: elongation factor 1-alpha isoform X2 [Populus euphratica]
 ref|XP_011026996.1| PREDICTED: elongation factor 1-alpha isoform X3 [Populus euphratica]
Length=449

 Score =   209 bits (533),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSGKELEKEPKFLKNGDAG +KM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMIKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDP+G
Sbjct  393  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>gb|KGN51228.1| Elongation factor 1-alpha [Cucumis sativus]
Length=402

 Score =   208 bits (530),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIM HPGQIGNGYAPVLDCHTSHIAVKF E++TKIDRRSGKELEKEPKFLKNGDAGFVKM
Sbjct  286  IIMKHPGQIGNGYAPVLDCHTSHIAVKFGEILTKIDRRSGKELEKEPKFLKNGDAGFVKM  345

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDP+G
Sbjct  346  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  389



>gb|AAK82537.1| At1g07930/T6D22_3 [Arabidopsis thaliana]
Length=449

 Score =   209 bits (533),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSGKE+EKEPKFLKNGDAG VKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
             PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG
Sbjct  393  TPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>ref|XP_010669660.1| PREDICTED: elongation factor 1-alpha-like [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010669661.1| PREDICTED: elongation factor 1-alpha-like [Beta vulgaris subsp. 
vulgaris]
Length=447

 Score =   209 bits (532),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 99/104 (95%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKE+EKEPKFLKNGDAG VKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKEIEKEPKFLKNGDAGMVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  393  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>gb|AAF99703.1| elongation factor [Saccharum officinarum]
Length=448

 Score =   209 bits (533),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 101/116 (87%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = -2

Query  667  QPRGLLASPPRSIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPK  488
             P    AS    +IMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKE K
Sbjct  322  DPAKEAASFTSQVIMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSGKELEKEAK  381

Query  487  FLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            FLKNGDAG VKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG+IKSV+KKDPTG
Sbjct  382  FLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGIIKSVEKKDPTG  437



>ref|XP_009144204.1| PREDICTED: elongation factor 1-alpha 1-like [Brassica rapa]
Length=449

 Score =   209 bits (533),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSGKE+EKEPKFLKNGDAG VKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
             PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG
Sbjct  393  TPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>ref|XP_010557310.1| PREDICTED: elongation factor 1-alpha-like [Tarenaya hassleriana]
 ref|XP_010557311.1| PREDICTED: elongation factor 1-alpha-like [Tarenaya hassleriana]
Length=449

 Score =   209 bits (533),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSGKELEKEPKFLKNGDAG VKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            +PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  393  VPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>gb|AAK32834.1|AF361822_1 At1g07930/T6D22_3 [Arabidopsis thaliana]
 gb|AAL15385.1| At1g07930/T6D22_3 [Arabidopsis thaliana]
Length=449

 Score =   209 bits (532),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSGKE+EKEPKFLKNGDAG VKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
             PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG
Sbjct  393  TPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>gb|KHN42761.1| Elongation factor 1-alpha [Glycine soja]
Length=447

 Score =   209 bits (532),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSGKELEKEPKFLKNGDAG VKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGMVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            +PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  393  VPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_008358325.1| PREDICTED: elongation factor 1-alpha [Malus domestica]
 ref|XP_008385282.1| PREDICTED: elongation factor 1-alpha [Malus domestica]
Length=447

 Score =   209 bits (532),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 99/104 (95%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSGKELEKEPKFLKNGDAG VKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK+PTG
Sbjct  393  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKEPTG  436



>gb|AAN31833.1| putative translation elongation factor eEF-1 alpha chain (gene 
A4) [Arabidopsis thaliana]
Length=449

 Score =   209 bits (532),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSGKE+EKEPKFLKNGDAG VKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
             PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG
Sbjct  393  TPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>gb|AAL57653.1| At1g07930/T6D22_3 [Arabidopsis thaliana]
Length=449

 Score =   209 bits (532),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSGKE+EKEPKFLKNGDAG VKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
             PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG
Sbjct  393  TPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>dbj|BAF02151.1| elongation factor 1-alpha [Arabidopsis thaliana]
Length=449

 Score =   209 bits (532),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSGKE+EKEPKFLKNGDAG VKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
             PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG
Sbjct  393  TPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>emb|CDX93604.1| BnaA06g04440D [Brassica napus]
Length=460

 Score =   209 bits (533),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSGKE+EKEPKFLKNGDAG VKM
Sbjct  344  IIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKM  403

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
             PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG
Sbjct  404  TPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  447



>ref|NP_200847.1| elongation factor 1-alpha 4 [Arabidopsis thaliana]
 ref|NP_563799.1| elongation factor 1-alpha 3 [Arabidopsis thaliana]
 ref|NP_563800.1| elongation factor 1-alpha 2 [Arabidopsis thaliana]
 ref|NP_563801.1| elongation factor 1-alpha 1 [Arabidopsis thaliana]
 ref|NP_001030993.1| elongation factor 1-alpha 1 [Arabidopsis thaliana]
 ref|NP_001119464.1| elongation factor 1-alpha 4 [Arabidopsis thaliana]
 ref|XP_002864684.1| elongation factor 1-alpha [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002889674.1| elongation factor 1-alpha [Arabidopsis lyrata subsp. lyrata]
 sp|P0DH99.1|EF1A1_ARATH RecName: Full=Elongation factor 1-alpha 1; Short=EF-1-alpha 1; 
AltName: Full=eEF-1A1 [Arabidopsis thaliana]
 sp|Q8W4H7.2|EF1A2_ARATH RecName: Full=Elongation factor 1-alpha 2; Short=EF-1-alpha 2; 
AltName: Full=eEF-1A2 [Arabidopsis thaliana]
 sp|Q0WL56.2|EF1A3_ARATH RecName: Full=Elongation factor 1-alpha 3; Short=EF-1-alpha 3; 
AltName: Full=eEF-1A3 [Arabidopsis thaliana]
 sp|Q8GTY0.2|EF1A4_ARATH RecName: Full=Elongation factor 1-alpha 4; Short=EF-1-alpha 4; 
AltName: Full=eEF-1A4 [Arabidopsis thaliana]
 gb|AAF79847.1|AC026875_27 T6D22.3 [Arabidopsis thaliana]
 gb|AAL31918.1|AF419586_1 AT5g60390/muf9_40 [Arabidopsis thaliana]
 emb|CAA34453.1| elongation factor 1-alpha [Arabidopsis thaliana]
 emb|CAA34454.1| elongation factor 1-alpha [Arabidopsis thaliana]
 emb|CAA34455.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAB07882.1| EF-1alpha-A1 [Arabidopsis thaliana]
 gb|AAB07883.1| EF-1alpha-A2 [Arabidopsis thaliana]
 gb|AAB07884.1| EF-1alpha-A3 [Arabidopsis thaliana]
 dbj|BAB08224.1| elongation factor 1-alpha (EF-1-alpha) [Arabidopsis thaliana]
 gb|AAK62638.1| At1g07940/T6D22_14 [Arabidopsis thaliana]
 gb|AAL24386.1| elongation factor 1-alpha (EF-1-alpha) [Arabidopsis thaliana]
 gb|AAL31193.1| AT5g60390/muf9_40 [Arabidopsis thaliana]
 gb|AAL86336.1| putative elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAM65897.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAM67562.1| putative elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAM91202.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAM91362.1| At5g60390/muf9_40 [Arabidopsis thaliana]
 gb|AAM98236.1| unknown protein [Arabidopsis thaliana]
 gb|AAM98240.1| unknown protein [Arabidopsis thaliana]
 gb|AAN18164.1| At1g07940/T6D22_14 [Arabidopsis thaliana]
 gb|AAO00783.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAO00802.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAO00870.1| Unknown protein [Arabidopsis thaliana]
 gb|AAO29944.1| Unknown protein [Arabidopsis thaliana]
 gb|AAP21177.1| At5g60390/muf9_40 [Arabidopsis thaliana]
 dbj|BAE99963.1| elongation factor 1-alpha [Arabidopsis thaliana]
 dbj|BAE98497.1| translation elongation factor eEF-1 alpha chain [Arabidopsis 
thaliana]
 dbj|BAE98750.1| translation elongation factor eEF-1 alpha chain [Arabidopsis 
thaliana]
 gb|EFH40943.1| elongation factor 1-alpha [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65933.1| elongation factor 1-alpha [Arabidopsis lyrata subsp. lyrata]
 gb|AED97318.1| elongation factor 1-alpha 4 [Arabidopsis thaliana]
 gb|AED97320.1| elongation factor 1-alpha 4 [Arabidopsis thaliana]
 gb|AEE28212.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AEE28213.1| Elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AEE28215.1| Elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AEE28216.1| Elongation factor 1-alpha [Arabidopsis thaliana]
Length=449

 Score =   209 bits (532),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSGKE+EKEPKFLKNGDAG VKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
             PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG
Sbjct  393  TPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>emb|CAA34456.1| elongation factor 1-alpha [Arabidopsis thaliana]
Length=449

 Score =   209 bits (532),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSGKE+EKEPKFLKNGDAG VKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
             PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG
Sbjct  393  TPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>ref|XP_007009760.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007009761.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 gb|EOY18570.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 gb|EOY18571.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
Length=449

 Score =   209 bits (532),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGD+G VKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDSGMVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            +PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  393  VPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>gb|KHN14872.1| Elongation factor 1-alpha [Glycine soja]
Length=447

 Score =   209 bits (532),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSGKELEKEPKFLKNGDAG VKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGMVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            +PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  393  VPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_006280459.1| hypothetical protein CARUB_v10026391mg [Capsella rubella]
 ref|XP_006304491.1| hypothetical protein CARUB_v10011249mg [Capsella rubella]
 ref|XP_010456336.1| PREDICTED: elongation factor 1-alpha 1 isoform X1 [Camelina sativa]
 ref|XP_010456344.1| PREDICTED: elongation factor 1-alpha 1 isoform X2 [Camelina sativa]
 ref|XP_010456350.1| PREDICTED: elongation factor 1-alpha 1 isoform X3 [Camelina sativa]
 ref|XP_010456355.1| PREDICTED: elongation factor 1-alpha 1 isoform X4 [Camelina sativa]
 ref|XP_010456361.1| PREDICTED: elongation factor 1-alpha 1 isoform X5 [Camelina sativa]
 ref|XP_010456369.1| PREDICTED: elongation factor 1-alpha 1 isoform X6 [Camelina sativa]
 ref|XP_010488164.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010488173.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010505603.1| PREDICTED: elongation factor 1-alpha 1 isoform X1 [Camelina sativa]
 ref|XP_010505604.1| PREDICTED: elongation factor 1-alpha 1 isoform X2 [Camelina sativa]
 ref|XP_010509026.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010517279.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010443836.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010443839.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010458006.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010458008.1| PREDICTED: elongation factor 1-alpha 1 isoform X1 [Camelina sativa]
 ref|XP_010458009.1| PREDICTED: elongation factor 1-alpha 1 isoform X1 [Camelina sativa]
 ref|XP_010475572.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010475573.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010475574.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010483684.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010483687.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 gb|EOA13357.1| hypothetical protein CARUB_v10026391mg [Capsella rubella]
 gb|EOA37389.1| hypothetical protein CARUB_v10011249mg [Capsella rubella]
Length=449

 Score =   209 bits (532),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSGKE+EKEPKFLKNGDAG VKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
             PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG
Sbjct  393  TPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>ref|XP_006846237.1| hypothetical protein AMTR_s00012p00237190 [Amborella trichopoda]
 gb|ERN07912.1| hypothetical protein AMTR_s00012p00237190 [Amborella trichopoda]
Length=447

 Score =   209 bits (532),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHT HIAVKFAE++TKIDRRSGKELEKEPKFLKNGDAGFVKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTCHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  393  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKAVEKKDPSG  436



>ref|XP_009126609.1| PREDICTED: elongation factor 1-alpha 1-like [Brassica rapa]
Length=449

 Score =   209 bits (532),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSGKE+EKEPKFLKNGDAG VKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
             PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG
Sbjct  393  TPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>ref|XP_009148045.1| PREDICTED: elongation factor 1-alpha 1 [Brassica rapa]
 ref|XP_009110915.1| PREDICTED: elongation factor 1-alpha 1 [Brassica rapa]
 ref|XP_009118409.1| PREDICTED: elongation factor 1-alpha 1 isoform X1 [Brassica rapa]
 ref|XP_009118410.1| PREDICTED: elongation factor 1-alpha 1 isoform X2 [Brassica rapa]
 ref|XP_009118411.1| PREDICTED: elongation factor 1-alpha 1 isoform X3 [Brassica rapa]
 ref|XP_009120571.1| PREDICTED: elongation factor 1-alpha 1 [Brassica rapa]
 gb|ACS68201.1| elongation factor 1 alpha [Brassica napus]
 gb|AGK07381.1| elongation factor 1-alpha protein [Brassica oleracea var. botrytis]
Length=449

 Score =   209 bits (532),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSGKE+EKEPKFLKNGDAG VKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
             PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG
Sbjct  393  TPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>gb|AAK25877.1|AF360167_1 putative translation elongation factor eEF-1 alpha chain A4 [Arabidopsis 
thaliana]
Length=449

 Score =   209 bits (532),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSGKE+EKEPKFLKNGDAG VKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
             PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG
Sbjct  393  TPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>ref|XP_008783722.1| PREDICTED: elongation factor 1-alpha isoform X1 [Phoenix dactylifera]
Length=447

 Score =   209 bits (532),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSGKELEKEPKFLKNGDAGFVKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGFVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIKSV+KKDP+G
Sbjct  393  IPTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_010521772.1| PREDICTED: elongation factor 1-alpha-like [Tarenaya hassleriana]
Length=449

 Score =   209 bits (532),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSGKELEKEPKFLKNGDAG VKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            +PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  393  VPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>gb|AAY56337.1| elongation factor-1 alpha [Musa acuminata]
Length=447

 Score =   209 bits (532),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 99/104 (95%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = -2

Query  631  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKM  452
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM
Sbjct  333  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGLVKM  392

Query  451  IPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  320
            IPTKPMVVETF+EY PLGRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct  393  IPTKPMVVETFAEYSPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1185322056160