BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF027O14

Length=680
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009617344.1|  PREDICTED: patellin-3-like                         218   7e-63   Nicotiana tomentosiformis
ref|XP_004250845.1|  PREDICTED: patellin-3-like                         213   3e-61   Solanum lycopersicum
ref|XP_006339369.1|  PREDICTED: patellin-2-like                         212   7e-61   
ref|XP_009612346.1|  PREDICTED: patellin-3-like                         206   9e-59   Nicotiana tomentosiformis
ref|XP_010063754.1|  PREDICTED: patellin-3-like                         204   9e-58   Eucalyptus grandis [rose gum]
emb|CAB95829.1|  hypothetical protein                                   201   1e-57   Cicer arietinum [garbanzo]
ref|XP_004506377.1|  PREDICTED: patellin-2-like                         203   2e-57   Cicer arietinum [garbanzo]
ref|XP_004241867.1|  PREDICTED: patellin-3-like                         202   3e-57   
ref|XP_009775359.1|  PREDICTED: patellin-3-like                         201   4e-57   Nicotiana sylvestris
ref|XP_006356506.1|  PREDICTED: patellin-2-like                         201   5e-57   Solanum tuberosum [potatoes]
ref|XP_009774158.1|  PREDICTED: patellin-3-like                         198   1e-55   Nicotiana sylvestris
gb|KHG00007.1|  Patellin-5 -like protein                                196   2e-55   Gossypium arboreum [tree cotton]
gb|KJB81306.1|  hypothetical protein B456_013G138100                    196   4e-55   Gossypium raimondii
gb|KJB81305.1|  hypothetical protein B456_013G138100                    196   4e-55   Gossypium raimondii
ref|XP_011096139.1|  PREDICTED: patellin-3-like                         196   7e-55   Sesamum indicum [beniseed]
dbj|BAE71201.1|  putative cytosolic factor                              195   1e-54   Trifolium pratense [peavine clover]
ref|XP_007020114.1|  SEC14 cytosolic factor family protein / phos...    195   1e-54   
ref|XP_004141567.1|  PREDICTED: patellin-1-like                         183   2e-54   
gb|EYU22784.1|  hypothetical protein MIMGU_mgv1a003476mg                194   2e-54   Erythranthe guttata [common monkey flower]
ref|XP_007224786.1|  hypothetical protein PRUPE_ppa023884mg             194   2e-54   
ref|XP_006585750.1|  PREDICTED: patellin-3-like isoform X2              193   2e-54   Glycine max [soybeans]
gb|KHN32468.1|  Patellin-5                                              187   3e-54   Glycine soja [wild soybean]
ref|XP_003531832.1|  PREDICTED: patellin-3-like isoform X1              194   3e-54   Glycine max [soybeans]
emb|CBI39339.3|  unnamed protein product                                186   3e-54   Vitis vinifera
gb|KEH29320.1|  patellin-like protein                                   193   5e-54   Medicago truncatula
gb|KHM98825.1|  Patellin-3                                              193   7e-54   Glycine soja [wild soybean]
gb|KHG10355.1|  Patellin-5 -like protein                                192   2e-53   Gossypium arboreum [tree cotton]
gb|KDP27341.1|  hypothetical protein JCGZ_20273                         185   2e-53   Jatropha curcas
gb|KJB60075.1|  hypothetical protein B456_009G288200                    190   5e-53   Gossypium raimondii
ref|XP_007131297.1|  hypothetical protein PHAVU_011G002100g             191   5e-53   Phaseolus vulgaris [French bean]
ref|XP_007020115.1|  SEC14 cytosolic factor family protein / phos...    191   7e-53   
gb|KJB81308.1|  hypothetical protein B456_013G138100                    190   8e-53   Gossypium raimondii
gb|KJB60073.1|  hypothetical protein B456_009G288200                    190   8e-53   Gossypium raimondii
ref|XP_006473247.1|  PREDICTED: patellin-2-like                         188   3e-52   Citrus sinensis [apfelsine]
ref|XP_006591943.1|  PREDICTED: patellin-2-like isoform X3              188   3e-52   
ref|XP_006434672.1|  hypothetical protein CICLE_v10000682mg             188   3e-52   Citrus clementina [clementine]
ref|XP_006591942.1|  PREDICTED: patellin-2-like isoform X2              188   3e-52   Glycine max [soybeans]
ref|XP_003540055.1|  PREDICTED: patellin-2-like isoform X1              188   4e-52   Glycine max [soybeans]
ref|XP_011074963.1|  PREDICTED: patellin-3-like                         187   9e-52   Sesamum indicum [beniseed]
gb|ABK95051.1|  unknown                                                 176   1e-51   Populus trichocarpa [western balsam poplar]
ref|XP_010095907.1|  hypothetical protein L484_008304                   187   1e-51   Morus notabilis
ref|XP_011464747.1|  PREDICTED: patellin-3-like isoform X2              186   2e-51   Fragaria vesca subsp. vesca
ref|XP_002267428.1|  PREDICTED: patellin-3                              186   2e-51   Vitis vinifera
ref|XP_004299816.1|  PREDICTED: patellin-3-like isoform X1              186   2e-51   Fragaria vesca subsp. vesca
ref|XP_011003949.1|  PREDICTED: patellin-1-like                         174   5e-51   Populus euphratica
gb|KCW69563.1|  hypothetical protein EUGRSUZ_F02993                     181   2e-50   Eucalyptus grandis [rose gum]
gb|KGN52721.1|  hypothetical protein Csa_5G652260                       182   5e-50   Cucumis sativus [cucumbers]
ref|XP_004170401.1|  PREDICTED: patellin-3-like                         182   5e-50   
gb|EYU28219.1|  hypothetical protein MIMGU_mgv1a004573mg                181   5e-50   Erythranthe guttata [common monkey flower]
gb|ABB77236.1|  patellin 1                                              182   7e-50   Cucurbita pepo
ref|XP_008459681.1|  PREDICTED: patellin-3-like                         182   7e-50   
emb|CAN80424.1|  hypothetical protein VITISV_013163                     182   1e-49   Vitis vinifera
emb|CDP10711.1|  unnamed protein product                                182   1e-49   Coffea canephora [robusta coffee]
ref|XP_010062424.1|  PREDICTED: patellin-3-like                         181   2e-49   Eucalyptus grandis [rose gum]
ref|XP_008378750.1|  PREDICTED: patellin-3-like                         180   5e-49   
ref|XP_009379334.1|  PREDICTED: patellin-3-like                         179   1e-48   Pyrus x bretschneideri [bai li]
ref|XP_002521801.1|  Patellin-3, putative                               179   1e-48   Ricinus communis
ref|XP_006859149.1|  hypothetical protein AMTR_s00070p00121170          179   2e-48   Amborella trichopoda
ref|XP_010244944.1|  PREDICTED: patellin-3-like                         177   2e-48   Nelumbo nucifera [Indian lotus]
ref|XP_009362426.1|  PREDICTED: patellin-3-like                         177   3e-48   Pyrus x bretschneideri [bai li]
ref|XP_011031501.1|  PREDICTED: patellin-3                              177   5e-48   Populus euphratica
ref|XP_006371458.1|  hypothetical protein POPTR_0019s10830g             177   5e-48   Populus trichocarpa [western balsam poplar]
ref|XP_008361618.1|  PREDICTED: patellin-3-like                         175   3e-47   
ref|XP_008339156.1|  PREDICTED: patellin-3-like                         175   3e-47   
ref|XP_010245412.1|  PREDICTED: patellin-3-like                         174   3e-47   Nelumbo nucifera [Indian lotus]
ref|XP_011003948.1|  PREDICTED: patellin-3-like                         175   4e-47   Populus euphratica
ref|XP_006376222.1|  hypothetical protein POPTR_0013s11070g             174   6e-47   Populus trichocarpa [western balsam poplar]
ref|XP_003630420.1|  Patellin-5                                         172   1e-46   Medicago truncatula
ref|XP_010909148.1|  PREDICTED: patellin-3-like isoform X2              171   6e-46   Elaeis guineensis
ref|XP_010909147.1|  PREDICTED: patellin-3-like isoform X1              167   1e-44   
ref|XP_008783367.1|  PREDICTED: patellin-3-like                         167   2e-44   Phoenix dactylifera
ref|XP_010910883.1|  PREDICTED: patellin-3-like isoform X2              165   1e-43   Elaeis guineensis
gb|EMS62735.1|  Patellin-5                                              159   3e-43   Triticum urartu
ref|XP_009403697.1|  PREDICTED: patellin-3-like                         163   5e-43   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004970742.1|  PREDICTED: patellin-1-like                         163   6e-43   Setaria italica
gb|EPS65885.1|  hypothetical protein M569_08890                         162   7e-43   Genlisea aurea
dbj|BAJ87818.1|  predicted protein                                      162   8e-43   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT12738.1|  hypothetical protein F775_27688                         160   1e-42   
ref|XP_003564746.1|  PREDICTED: patellin-3-like                         162   1e-42   Brachypodium distachyon [annual false brome]
ref|XP_010683337.1|  PREDICTED: patellin-3                              162   1e-42   Beta vulgaris subsp. vulgaris [field beet]
emb|CDM85203.1|  unnamed protein product                                162   1e-42   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009404974.1|  PREDICTED: patellin-3-like                         161   2e-42   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010910878.1|  PREDICTED: patellin-3-like isoform X1              161   2e-42   Elaeis guineensis
gb|EAY76673.1|  hypothetical protein OsI_04628                          160   5e-42   Oryza sativa Indica Group [Indian rice]
gb|EPS60308.1|  hypothetical protein M569_14495                         157   6e-42   Genlisea aurea
ref|NP_001044958.1|  Os01g0874700                                       160   6e-42   
ref|XP_002456720.1|  hypothetical protein SORBIDRAFT_03g041370          160   6e-42   
gb|EAZ14338.1|  hypothetical protein OsJ_04261                          160   7e-42   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009385108.1|  PREDICTED: patellin-3-like                         159   1e-41   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010095909.1|  hypothetical protein L484_008306                   158   2e-41   Morus notabilis
ref|XP_010231340.1|  PREDICTED: patellin-3-like isoform X2              158   2e-41   
ref|XP_003568397.1|  PREDICTED: patellin-3-like isoform X1              158   3e-41   Brachypodium distachyon [annual false brome]
ref|XP_006645095.1|  PREDICTED: patellin-1-like                         157   4e-41   Oryza brachyantha
ref|XP_009410675.1|  PREDICTED: patellin-3-like                         157   5e-41   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001150957.1|  LOC100284590                                       156   1e-40   
gb|ACN27998.1|  unknown                                                 156   1e-40   Zea mays [maize]
ref|XP_004961988.1|  PREDICTED: patellin-2-like                         156   1e-40   Setaria italica
gb|EMT14507.1|  hypothetical protein F775_26247                         152   2e-40   
ref|XP_008352805.1|  PREDICTED: patellin-3-like                         149   3e-40   
ref|XP_008657015.1|  PREDICTED: patellin-3-like                         155   3e-40   
dbj|BAK04984.1|  predicted protein                                      155   4e-40   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010675154.1|  PREDICTED: patellin-3-like                         154   5e-40   Beta vulgaris subsp. vulgaris [field beet]
dbj|BAK01654.1|  predicted protein                                      155   5e-40   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002441147.1|  hypothetical protein SORBIDRAFT_09g021240          154   6e-40   
ref|NP_001055617.1|  Os05g0429400                                       154   1e-39   
gb|EEC79272.1|  hypothetical protein OsI_20058                          153   1e-39   Oryza sativa Indica Group [Indian rice]
gb|EEE63805.1|  hypothetical protein OsJ_18629                          152   1e-39   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008442083.1|  PREDICTED: patellin-3-like                         153   1e-39   Cucumis melo [Oriental melon]
ref|XP_009389513.1|  PREDICTED: patellin-3-like                         154   1e-39   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008378744.1|  PREDICTED: patellin-3-like                         152   2e-39   
ref|XP_010912526.1|  PREDICTED: patellin-3-like                         152   2e-39   Elaeis guineensis
ref|XP_008781563.1|  PREDICTED: patellin-3-like isoform X2              152   2e-39   Phoenix dactylifera
gb|KDP27342.1|  hypothetical protein JCGZ_20274                         152   3e-39   Jatropha curcas
ref|XP_004146380.1|  PREDICTED: patellin-3-like                         152   3e-39   Cucumis sativus [cucumbers]
ref|XP_006654435.1|  PREDICTED: patellin-2-like                         152   3e-39   Oryza brachyantha
ref|XP_010534098.1|  PREDICTED: patellin-3-like                         152   4e-39   Tarenaya hassleriana [spider flower]
ref|XP_002265124.2|  PREDICTED: patellin-3                              151   5e-39   Vitis vinifera
ref|XP_011099658.1|  PREDICTED: patellin-3-like                         151   6e-39   Sesamum indicum [beniseed]
ref|XP_006466197.1|  PREDICTED: patellin-3-like                         151   6e-39   Citrus sinensis [apfelsine]
ref|XP_006473246.1|  PREDICTED: patellin-3-like                         151   8e-39   Citrus sinensis [apfelsine]
ref|XP_009105873.1|  PREDICTED: patellin-1-like                         151   9e-39   Brassica rapa
ref|XP_010930773.1|  PREDICTED: patellin-3-like                         150   1e-38   Elaeis guineensis
emb|CAN80423.1|  hypothetical protein VITISV_013162                     151   1e-38   Vitis vinifera
ref|XP_009402649.1|  PREDICTED: patellin-3-like                         150   1e-38   Musa acuminata subsp. malaccensis [pisang utan]
emb|CBI39340.3|  unnamed protein product                                150   1e-38   Vitis vinifera
ref|XP_002521798.1|  Patellin-5, putative                               150   2e-38   Ricinus communis
ref|XP_006376221.1|  hypothetical protein POPTR_0013s11060g             149   2e-38   
ref|XP_006416189.1|  hypothetical protein EUTSA_v10007015mg             150   2e-38   Eutrema salsugineum [saltwater cress]
ref|XP_009379323.1|  PREDICTED: LOW QUALITY PROTEIN: patellin-3-like    149   3e-38   
ref|XP_008368135.1|  PREDICTED: patellin-3-like                         149   3e-38   
emb|CDX96377.1|  BnaA07g29880D                                          149   3e-38   
ref|XP_006434671.1|  hypothetical protein CICLE_v10000804mg             149   4e-38   Citrus clementina [clementine]
gb|KDO84003.1|  hypothetical protein CISIN_1g009270mg                   149   4e-38   Citrus sinensis [apfelsine]
ref|XP_011015061.1|  PREDICTED: patellin-3-like                         149   4e-38   Populus euphratica
ref|XP_011001253.1|  PREDICTED: patellin-3-like                         149   4e-38   Populus euphratica
ref|XP_006306912.1|  hypothetical protein CARUB_v10008471mg             150   4e-38   Capsella rubella
ref|XP_009362429.1|  PREDICTED: patellin-3-like                         149   5e-38   
ref|XP_011003950.1|  PREDICTED: patellin-3                              149   5e-38   Populus euphratica
ref|NP_001276245.1|  patellin-3-like                                    147   5e-38   Glycine max [soybeans]
ref|XP_011031504.1|  PREDICTED: patellin-3                              149   5e-38   Populus euphratica
ref|XP_007131298.1|  hypothetical protein PHAVU_011G002200g             147   7e-38   Phaseolus vulgaris [French bean]
ref|XP_010543667.1|  PREDICTED: patellin-5-like                         147   8e-38   Tarenaya hassleriana [spider flower]
ref|XP_007024015.1|  Patellin 1, putative                               141   9e-38   
emb|CDX68278.1|  BnaA07g23180D                                          147   9e-38   
ref|NP_001131001.1|  uncharacterized protein LOC100192106               148   1e-37   Zea mays [maize]
ref|XP_004299815.1|  PREDICTED: patellin-3                              148   1e-37   Fragaria vesca subsp. vesca
ref|XP_006390694.1|  hypothetical protein EUTSA_v10018354mg             148   1e-37   Eutrema salsugineum [saltwater cress]
ref|XP_007020120.1|  Sec14p-like phosphatidylinositol transfer fa...    148   1e-37   
ref|XP_002325536.2|  hypothetical protein POPTR_0019s10810g             147   1e-37   
ref|XP_004503864.1|  PREDICTED: patellin-5-like                         147   1e-37   Cicer arietinum [garbanzo]
emb|CDY50441.1|  BnaC06g24230D                                          147   2e-37   Brassica napus [oilseed rape]
gb|EYU22783.1|  hypothetical protein MIMGU_mgv1a004079mg                147   2e-37   Erythranthe guttata [common monkey flower]
ref|XP_009104870.1|  PREDICTED: patellin-3-like                         147   2e-37   Brassica rapa
ref|XP_002525405.1|  Patellin-3, putative                               147   2e-37   Ricinus communis
ref|XP_008807685.1|  PREDICTED: patellin-3-like                         147   2e-37   Phoenix dactylifera
ref|XP_010535265.1|  PREDICTED: patellin-1-like                         147   2e-37   Tarenaya hassleriana [spider flower]
gb|KHG01147.1|  Patellin-3 -like protein                                147   2e-37   Gossypium arboreum [tree cotton]
ref|XP_011011644.1|  PREDICTED: patellin-3-like                         147   3e-37   Populus euphratica
ref|XP_011096149.1|  PREDICTED: patellin-3                              147   3e-37   Sesamum indicum [beniseed]
dbj|BAD94747.1|  putative cytosolic factor protein                      141   3e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007020128.1|  Sec14p-like phosphatidylinositol transfer fa...    147   4e-37   
gb|EYU20559.1|  hypothetical protein MIMGU_mgv1a006872mg                145   4e-37   Erythranthe guttata [common monkey flower]
gb|KJB60043.1|  hypothetical protein B456_009G288100                    146   4e-37   Gossypium raimondii
gb|KJB60040.1|  hypothetical protein B456_009G288100                    146   4e-37   Gossypium raimondii
ref|XP_006390693.1|  hypothetical protein EUTSA_v10018429mg             145   5e-37   Eutrema salsugineum [saltwater cress]
ref|XP_007049994.1|  SEC14 cytosolic factor family protein / phos...    146   5e-37   
gb|EPS65571.1|  hypothetical protein M569_09207                         144   6e-37   Genlisea aurea
dbj|BAH57191.1|  AT1G22530                                              145   7e-37   Arabidopsis thaliana [mouse-ear cress]
emb|CDY03655.1|  BnaA02g15820D                                          145   7e-37   
ref|NP_173669.1|  patellin 2                                            146   8e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007159915.1|  hypothetical protein PHAVU_002G278300g             145   9e-37   Phaseolus vulgaris [French bean]
ref|XP_010428078.1|  PREDICTED: patellin-1                              145   1e-36   Camelina sativa [gold-of-pleasure]
ref|XP_003522462.1|  PREDICTED: patellin-3-like                         145   1e-36   Glycine max [soybeans]
ref|XP_008219012.1|  PREDICTED: patellin-3                              144   1e-36   Prunus mume [ume]
ref|XP_009127905.1|  PREDICTED: patellin-1-like                         144   2e-36   Brassica rapa
ref|XP_006384383.1|  hypothetical protein POPTR_0004s14530g             144   2e-36   
ref|XP_010471233.1|  PREDICTED: patellin-1-like                         144   2e-36   Camelina sativa [gold-of-pleasure]
ref|XP_006339368.1|  PREDICTED: patellin-3-like                         144   2e-36   Solanum tuberosum [potatoes]
ref|XP_004250635.1|  PREDICTED: patellin-3                              144   2e-36   Solanum lycopersicum
ref|XP_006302079.1|  hypothetical protein CARUB_v10020065mg             144   3e-36   Capsella rubella
gb|KEH35657.1|  patellin-3 protein                                      144   3e-36   Medicago truncatula
ref|XP_002325736.2|  hypothetical protein POPTR_0019s00780g             144   3e-36   
ref|XP_008781561.1|  PREDICTED: patellin-3-like isoform X1              144   3e-36   Phoenix dactylifera
gb|KHN32467.1|  Patellin-3                                              142   3e-36   Glycine soja [wild soybean]
ref|XP_002893236.1|  hypothetical protein ARALYDRAFT_472493             144   4e-36   Arabidopsis lyrata subsp. lyrata
ref|XP_002888860.1|  SEC14 cytosolic factor family protein              143   4e-36   Arabidopsis lyrata subsp. lyrata
ref|XP_006387528.1|  hypothetical protein POPTR_0895s00200g             144   4e-36   
ref|XP_010428080.1|  PREDICTED: patellin-3-like isoform X1              143   5e-36   Camelina sativa [gold-of-pleasure]
ref|XP_010414837.1|  PREDICTED: patellin-3-like                         143   5e-36   Camelina sativa [gold-of-pleasure]
ref|XP_006302172.1|  hypothetical protein CARUB_v10020182mg             143   5e-36   Capsella rubella
ref|XP_010414836.1|  PREDICTED: patellin-1-like                         143   5e-36   Camelina sativa [gold-of-pleasure]
ref|XP_010471234.1|  PREDICTED: patellin-3                              143   5e-36   Camelina sativa [gold-of-pleasure]
ref|XP_009416925.1|  PREDICTED: patellin-3-like                         143   5e-36   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002887418.1|  hypothetical protein ARALYDRAFT_895064             143   6e-36   Arabidopsis lyrata subsp. lyrata
emb|CDX82182.1|  BnaC02g21080D                                          143   6e-36   
ref|NP_177360.1|  patellin-1                                            143   7e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003532213.1|  PREDICTED: patellin-3-like                         142   7e-36   Glycine max [soybeans]
emb|CDX90715.1|  BnaA03g23950D                                          139   7e-36   
ref|XP_004169713.1|  PREDICTED: patellin-3-like                         140   8e-36   
gb|KFK41635.1|  hypothetical protein AALP_AA2G153200                    142   8e-36   Arabis alpina [alpine rockcress]
ref|XP_003525154.1|  PREDICTED: patellin-3-like                         142   8e-36   Glycine max [soybeans]
emb|CDY03654.1|  BnaA02g15830D                                          142   9e-36   
ref|XP_010415948.1|  PREDICTED: patellin-1-like isoform X1              142   9e-36   Camelina sativa [gold-of-pleasure]
ref|XP_010415949.1|  PREDICTED: patellin-1-like isoform X2              142   1e-35   Camelina sativa [gold-of-pleasure]
ref|XP_009127906.1|  PREDICTED: patellin-3-like                         142   1e-35   Brassica rapa
ref|XP_007222319.1|  hypothetical protein PRUPE_ppa003964mg             142   1e-35   Prunus persica
gb|AAK82462.1|  At1g72160/T9N14_8                                       140   1e-35   Arabidopsis thaliana [mouse-ear cress]
emb|CDX82180.1|  BnaC02g21100D                                          141   2e-35   
gb|KFK32084.1|  hypothetical protein AALP_AA6G197400                    142   2e-35   Arabis alpina [alpine rockcress]
ref|XP_010498725.1|  PREDICTED: patellin-2                              142   2e-35   Camelina sativa [gold-of-pleasure]
emb|CBI21668.3|  unnamed protein product                                140   2e-35   Vitis vinifera
ref|NP_177361.1|  patellin-3                                            140   3e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003526897.2|  PREDICTED: patellin-1-like                         141   3e-35   
ref|XP_010477513.1|  PREDICTED: patellin-2-like                         142   3e-35   Camelina sativa [gold-of-pleasure]
gb|KHN09674.1|  Patellin-3                                              140   3e-35   Glycine soja [wild soybean]
ref|XP_010460011.1|  PREDICTED: patellin-2-like                         142   4e-35   Camelina sativa [gold-of-pleasure]
ref|NP_192655.2|  patellin-5                                            141   4e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002271899.2|  PREDICTED: patellin-3-like                         140   4e-35   Vitis vinifera
gb|AFW81858.1|  putative patellin family protein                        140   4e-35   
ref|XP_010534141.1|  PREDICTED: patellin-2-like                         142   4e-35   Tarenaya hassleriana [spider flower]
ref|XP_004138674.1|  PREDICTED: patellin-3-like                         140   5e-35   
gb|KFK41636.1|  hypothetical protein AALP_AA2G153300                    140   5e-35   Arabis alpina [alpine rockcress]
ref|XP_002872438.1|  SEC14 cytosolic factor family protein              141   5e-35   Arabidopsis lyrata subsp. lyrata
ref|XP_004506378.1|  PREDICTED: patellin-3-like                         140   5e-35   Cicer arietinum [garbanzo]
ref|XP_009134136.1|  PREDICTED: patellin-5                              141   5e-35   Brassica rapa
gb|KDP31746.1|  hypothetical protein JCGZ_14978                         140   7e-35   Jatropha curcas
emb|CDY05051.1|  BnaC03g28490D                                          141   7e-35   
ref|XP_007137815.1|  hypothetical protein PHAVU_009G157900g             139   1e-34   Phaseolus vulgaris [French bean]
gb|KCW69562.1|  hypothetical protein EUGRSUZ_F029921                    134   1e-34   Eucalyptus grandis [rose gum]
ref|XP_010064859.1|  PREDICTED: patellin-3                              134   2e-34   Eucalyptus grandis [rose gum]
ref|XP_008441140.1|  PREDICTED: patellin-3-like                         138   3e-34   Cucumis melo [Oriental melon]
ref|XP_003568396.1|  PREDICTED: patellin-3-like                         138   3e-34   Brachypodium distachyon [annual false brome]
emb|CDX68279.1|  BnaA07g23190D                                          137   4e-34   
gb|EPS60309.1|  hypothetical protein M569_14496                         134   5e-34   Genlisea aurea
ref|XP_006397198.1|  hypothetical protein EUTSA_v10028522mg             138   5e-34   Eutrema salsugineum [saltwater cress]
gb|ACJ85524.1|  unknown                                                 137   6e-34   Medicago truncatula
ref|XP_010455330.1|  PREDICTED: patellin-5-like                         137   1e-33   Camelina sativa [gold-of-pleasure]
ref|XP_010685643.1|  PREDICTED: patellin-3                              136   1e-33   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB71407.1|  hypothetical protein B456_011G121700                    136   1e-33   Gossypium raimondii
gb|KHG30248.1|  Patellin-3 -like protein                                136   2e-33   Gossypium arboreum [tree cotton]
gb|KHG11540.1|  Patellin-5 -like protein                                135   2e-33   Gossypium arboreum [tree cotton]
ref|XP_006426421.1|  hypothetical protein CICLE_v10025217mg             136   2e-33   Citrus clementina [clementine]
ref|XP_010435861.1|  PREDICTED: patellin-5-like                         136   2e-33   Camelina sativa [gold-of-pleasure]
gb|KDO58730.1|  hypothetical protein CISIN_1g007602mg                   135   3e-33   Citrus sinensis [apfelsine]
ref|XP_010421836.1|  PREDICTED: patellin-5                              135   5e-33   Camelina sativa [gold-of-pleasure]
gb|KFK44348.1|  hypothetical protein AALP_AA1G246000                    135   6e-33   Arabis alpina [alpine rockcress]
ref|XP_009123116.1|  PREDICTED: patellin-2                              134   2e-32   Brassica rapa
ref|XP_009393444.1|  PREDICTED: patellin-3-like                         132   6e-32   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABR18053.1|  unknown                                                 132   6e-32   Picea sitchensis
ref|XP_009617343.1|  PREDICTED: patellin-3                              130   1e-31   Nicotiana tomentosiformis
ref|XP_006287267.1|  hypothetical protein CARUB_v10000458mg             130   3e-31   Capsella rubella
ref|XP_009773028.1|  PREDICTED: patellin-3                              129   4e-31   Nicotiana sylvestris
ref|XP_006307148.1|  hypothetical protein CARUB_v10008738mg             129   4e-31   Capsella rubella
ref|XP_010499612.1|  PREDICTED: patellin-4-like                         129   4e-31   Camelina sativa [gold-of-pleasure]
dbj|BAD95021.1|  cytosolic factor                                       121   5e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010478499.1|  PREDICTED: patellin-4-like                         128   8e-31   Camelina sativa [gold-of-pleasure]
gb|KJB18714.1|  hypothetical protein B456_003G066500                    128   1e-30   Gossypium raimondii
emb|CDX77578.1|  BnaA07g07160D                                          127   2e-30   
ref|XP_009144742.1|  PREDICTED: patellin-4-like                         127   3e-30   Brassica rapa
emb|CDY58916.1|  BnaCnng33910D                                          120   3e-30   Brassica napus [oilseed rape]
emb|CDY50723.1|  BnaA05g35500D                                          125   7e-30   Brassica napus [oilseed rape]
emb|CBI31068.3|  unnamed protein product                                125   9e-30   Vitis vinifera
ref|XP_010521168.1|  PREDICTED: LOW QUALITY PROTEIN: patellin-3         125   9e-30   Tarenaya hassleriana [spider flower]
ref|XP_002268764.1|  PREDICTED: patellin-4                              125   1e-29   Vitis vinifera
ref|XP_009115058.1|  PREDICTED: patellin-4                              122   8e-29   Brassica rapa
emb|CDY02316.1|  BnaA09g25860D                                          122   8e-29   
gb|KDO77594.1|  hypothetical protein CISIN_1g011383mg                   122   1e-28   Citrus sinensis [apfelsine]
ref|XP_006448836.1|  hypothetical protein CICLE_v10015053mg             122   1e-28   Citrus clementina [clementine]
ref|XP_006468362.1|  PREDICTED: patellin-4-like                         122   1e-28   Citrus sinensis [apfelsine]
ref|XP_010460876.1|  PREDICTED: patellin-4-like                         122   2e-28   Camelina sativa [gold-of-pleasure]
ref|XP_002513365.1|  Patellin-4, putative                               122   2e-28   Ricinus communis
emb|CAN83643.1|  hypothetical protein VITISV_004911                     121   2e-28   Vitis vinifera
ref|XP_010053031.1|  PREDICTED: patellin-4                              120   3e-28   Eucalyptus grandis [rose gum]
ref|XP_006853302.1|  hypothetical protein AMTR_s00032p00036450          122   3e-28   Amborella trichopoda
ref|XP_002273072.1|  PREDICTED: patellin-4                              120   3e-28   Vitis vinifera
ref|XP_008235676.1|  PREDICTED: patellin-4-like                         120   5e-28   Prunus mume [ume]
ref|XP_010538273.1|  PREDICTED: patellin-4-like                         120   5e-28   Tarenaya hassleriana [spider flower]
ref|XP_002890888.1|  predicted protein                                  120   5e-28   Arabidopsis lyrata subsp. lyrata
gb|KJB29852.1|  hypothetical protein B456_005G121300                    120   6e-28   Gossypium raimondii
emb|CDY09549.1|  BnaC05g23700D                                          120   6e-28   
ref|NP_564360.1|  Sec14p-like phosphatidylinositol transfer prote...    120   8e-28   
gb|AAK59666.1|  unknown protein                                         120   9e-28   
ref|XP_004293682.1|  PREDICTED: patellin-4 isoform X1                   119   1e-27   
ref|XP_011460422.1|  PREDICTED: patellin-4 isoform X2                   119   1e-27   
ref|XP_011039291.1|  PREDICTED: patellin-4                              118   2e-27   
gb|KHG20731.1|  Patellin-4 -like protein                                118   2e-27   
ref|XP_008445767.1|  PREDICTED: patellin-4                              118   3e-27   
ref|XP_010098531.1|  hypothetical protein L484_025971                   118   4e-27   
ref|XP_010926887.1|  PREDICTED: patellin-4                              119   5e-27   
ref|XP_008661065.1|  PREDICTED: patellin-4-like                         116   6e-27   
ref|XP_003563396.1|  PREDICTED: patellin-4                              117   7e-27   
ref|XP_002299019.1|  hypothetical protein POPTR_0001s46570g             117   7e-27   
ref|XP_002437434.1|  hypothetical protein SORBIDRAFT_10g027000          117   7e-27   
ref|XP_010097608.1|  hypothetical protein L484_000774                   115   1e-26   
ref|XP_008805237.1|  PREDICTED: patellin-4-like                         115   2e-26   
ref|XP_004966295.1|  PREDICTED: patellin-4-like                         116   2e-26   
ref|XP_006415468.1|  hypothetical protein EUTSA_v10009675mg             110   2e-26   
ref|XP_007200855.1|  hypothetical protein PRUPE_ppa026824mg             115   2e-26   
ref|XP_006415435.1|  hypothetical protein EUTSA_v10007252mg             116   2e-26   
gb|EYU19094.1|  hypothetical protein MIMGU_mgv1a004827mg                115   3e-26   
ref|XP_010540642.1|  PREDICTED: patellin-4-like                         116   3e-26   
ref|XP_011086348.1|  PREDICTED: patellin-4-like                         116   3e-26   
ref|XP_007023035.1|  Sec14p-like phosphatidylinositol transfer fa...    115   4e-26   
ref|XP_004495099.1|  PREDICTED: patellin-4-like                         114   5e-26   
ref|XP_002523147.1|  Patellin-4, putative                               115   5e-26   
gb|KDP34841.1|  hypothetical protein JCGZ_09129                         114   5e-26   
ref|XP_009354950.1|  PREDICTED: patellin-4-like                         114   5e-26   
emb|CDP13579.1|  unnamed protein product                                115   8e-26   
ref|XP_007211823.1|  hypothetical protein PRUPE_ppa004336mg             114   8e-26   
ref|XP_008807187.1|  PREDICTED: patellin-4                              115   8e-26   
ref|NP_001149129.1|  LOC100282751                                       114   8e-26   
ref|XP_008364316.1|  PREDICTED: patellin-4-like                         113   9e-26   
ref|NP_001058333.1|  Os06g0671800                                       113   1e-25   
ref|XP_004135556.1|  PREDICTED: patellin-4-like                         113   2e-25   
dbj|BAD82082.1|  cytosolic factor-like protein                          111   2e-25   
ref|XP_010906382.1|  PREDICTED: LOW QUALITY PROTEIN: patellin-4-like    112   2e-25   
ref|XP_007147437.1|  hypothetical protein PHAVU_006G124500g             112   2e-25   
ref|XP_004486495.1|  PREDICTED: patellin-4-like                         112   2e-25   
ref|XP_008225675.1|  PREDICTED: patellin-4                              113   2e-25   
ref|XP_002990612.1|  hypothetical protein SELMODRAFT_132116             111   2e-25   
ref|XP_010673841.1|  PREDICTED: patellin-5-like                         109   3e-25   
ref|XP_010935907.1|  PREDICTED: patellin-4-like                         112   3e-25   
gb|KEH37089.1|  Sec14p-like phosphatidylinositol transfer family ...    112   3e-25   
gb|KDP25078.1|  hypothetical protein JCGZ_22613                         112   3e-25   
ref|XP_003535132.1|  PREDICTED: patellin-4-like                         112   4e-25   
gb|KHN44660.1|  Patellin-4                                              112   4e-25   
ref|XP_006656367.1|  PREDICTED: patellin-4-like                         112   6e-25   
ref|XP_008447424.1|  PREDICTED: patellin-4-like                         111   6e-25   
gb|EYU33790.1|  hypothetical protein MIMGU_mgv1a003190mg                112   7e-25   
ref|XP_002451242.1|  hypothetical protein SORBIDRAFT_05g026380          111   7e-25   
ref|XP_009768496.1|  PREDICTED: patellin-4                              111   8e-25   
ref|XP_009362181.1|  PREDICTED: patellin-4                              111   1e-24   
ref|XP_008365992.1|  PREDICTED: patellin-4-like                         111   1e-24   
ref|XP_006481119.1|  PREDICTED: patellin-6-like                         110   1e-24   
gb|KDO63274.1|  hypothetical protein CISIN_1g014036mg                   110   1e-24   
ref|XP_009598366.1|  PREDICTED: patellin-4                              110   2e-24   
ref|XP_002968725.1|  hypothetical protein SELMODRAFT_450422             109   2e-24   
ref|XP_010042244.1|  PREDICTED: patellin-4-like                         107   2e-24   
gb|KHN14294.1|  Patellin-4                                              109   2e-24   
ref|NP_001242249.1|  uncharacterized protein LOC100779100               109   2e-24   
ref|XP_009353862.1|  PREDICTED: patellin-4-like                         110   3e-24   
ref|XP_010104230.1|  hypothetical protein L484_016373                   108   3e-24   
ref|XP_010676841.1|  PREDICTED: patellin-6                              108   3e-24   
ref|XP_006429498.1|  hypothetical protein CICLE_v10011768mg             108   3e-24   
emb|CBI24189.3|  unnamed protein product                                109   4e-24   
ref|XP_011096706.1|  PREDICTED: patellin-4                              109   5e-24   
ref|XP_004152051.1|  PREDICTED: patellin-4-like                         108   5e-24   
gb|KGN57904.1|  hypothetical protein Csa_3G384790                       108   5e-24   
ref|XP_009387643.1|  PREDICTED: patellin-6-like isoform X2              108   6e-24   
ref|XP_009387637.1|  PREDICTED: patellin-6-like isoform X1              108   6e-24   
ref|XP_002526693.1|  Patellin-6, putative                               108   6e-24   
emb|CBI18097.3|  unnamed protein product                                108   7e-24   
ref|XP_007144897.1|  hypothetical protein PHAVU_007G192700g             108   7e-24   
ref|XP_002263951.1|  PREDICTED: patellin-4                              109   7e-24   
emb|CAN63609.1|  hypothetical protein VITISV_019134                     109   7e-24   
ref|XP_008392266.1|  PREDICTED: patellin-4-like isoform X1              108   8e-24   
ref|XP_002264479.1|  PREDICTED: patellin-6                              107   8e-24   
ref|XP_002307646.1|  hypothetical protein POPTR_0005s24620g             107   9e-24   
ref|XP_004233146.1|  PREDICTED: patellin-4                              107   1e-23   
ref|XP_007026555.1|  SEC14 cytosolic factor family protein / phos...    107   1e-23   
ref|XP_009399906.1|  PREDICTED: patellin-6-like                         107   1e-23   
ref|XP_008392269.1|  PREDICTED: patellin-4-like isoform X2              107   2e-23   
ref|XP_010039232.1|  PREDICTED: patellin-4-like                         107   2e-23   
ref|XP_006828153.1|  hypothetical protein AMTR_s00023p00086020          106   2e-23   
ref|XP_010037658.1|  PREDICTED: patellin-6                              106   2e-23   
ref|XP_010921052.1|  PREDICTED: LOW QUALITY PROTEIN: patellin-6-like    106   2e-23   
dbj|BAK05295.1|  predicted protein                                      105   3e-23   
ref|XP_009419547.1|  PREDICTED: patellin-4                              107   3e-23   
ref|XP_008793601.1|  PREDICTED: LOW QUALITY PROTEIN: patellin-4-like    105   3e-23   
ref|XP_011032599.1|  PREDICTED: patellin-6                              105   3e-23   
ref|XP_007213615.1|  hypothetical protein PRUPE_ppa002198mg             108   4e-23   
ref|XP_007050294.1|  Sec14p-like phosphatidylinositol transfer fa...    106   4e-23   
ref|XP_002981400.1|  hypothetical protein SELMODRAFT_114197             105   4e-23   
gb|ACL54702.1|  unknown                                                 103   4e-23   
ref|XP_004514256.1|  PREDICTED: patellin-6-like                         105   4e-23   
ref|XP_011458007.1|  PREDICTED: patellin-4-like                         105   4e-23   
ref|XP_007134632.1|  hypothetical protein PHAVU_010G063300g             105   5e-23   
ref|XP_006576481.1|  PREDICTED: patellin-6-like                         105   5e-23   
ref|XP_010247807.1|  PREDICTED: patellin-4-like                         105   5e-23   
ref|XP_009373098.1|  PREDICTED: patellin-6                              105   6e-23   
ref|XP_002969927.1|  hypothetical protein SELMODRAFT_65145              104   6e-23   
emb|CDP12598.1|  unnamed protein product                                106   6e-23   
ref|XP_006655212.1|  PREDICTED: patellin-6-like                         104   9e-23   
gb|KHG17179.1|  Patellin-6 -like protein                                104   9e-23   
gb|KJB36991.1|  hypothetical protein B456_006G185800                    105   1e-22   
ref|XP_008226129.1|  PREDICTED: patellin-4-like                         107   1e-22   
gb|ACF88405.1|  unknown                                                 103   1e-22   
ref|XP_008370205.1|  PREDICTED: patellin-6-like                         104   1e-22   
ref|XP_010262495.1|  PREDICTED: patellin-4-like                         104   1e-22   
emb|CAB78040.1|  putative protein                                       106   2e-22   
ref|NP_001148370.1|  patellin-5                                         103   2e-22   
gb|KDP22819.1|  hypothetical protein JCGZ_00406                         103   2e-22   
gb|EEE63334.1|  hypothetical protein OsJ_18145                          103   2e-22   
ref|XP_011004068.1|  PREDICTED: patellin-4-like                         103   2e-22   
gb|EAY97615.1|  hypothetical protein OsI_19539                          103   2e-22   
ref|XP_002323032.2|  SEC14 cytosolic factor family protein              103   3e-22   
gb|AAV43799.1|  hypothetical protein                                    103   3e-22   
ref|XP_010690123.1|  PREDICTED: patellin-4                              103   3e-22   
gb|EPS70777.1|  hypothetical protein M569_03982                         102   4e-22   
ref|XP_008388302.1|  PREDICTED: patellin-6-like                         102   4e-22   
ref|XP_004148600.1|  PREDICTED: patellin-6-like                         102   4e-22   
ref|XP_002439598.1|  hypothetical protein SORBIDRAFT_09g015930          102   4e-22   
ref|XP_003541355.1|  PREDICTED: patellin-4-like                         103   4e-22   
gb|KEH42526.1|  CRAL/TRIO, amino-terminal domain protein                103   4e-22   
ref|XP_004962411.1|  PREDICTED: patellin-6-like                         102   4e-22   
ref|XP_003516408.1|  PREDICTED: patellin-6-like                         102   5e-22   
ref|XP_009777461.1|  PREDICTED: patellin-6                              102   5e-22   
ref|XP_009417975.1|  PREDICTED: patellin-6-like isoform X2              102   5e-22   
ref|XP_009417974.1|  PREDICTED: patellin-6-like isoform X1              102   6e-22   
ref|XP_004246302.1|  PREDICTED: patellin-6                              102   7e-22   
ref|XP_009420495.1|  PREDICTED: patellin-4-like                         102   7e-22   
ref|XP_006360825.1|  PREDICTED: patellin-6-like                         102   7e-22   
ref|XP_008244793.1|  PREDICTED: patellin-6                              102   7e-22   
ref|XP_009591185.1|  PREDICTED: patellin-6                              102   7e-22   
gb|KHG22460.1|  Patellin-6 -like protein                                102   8e-22   
gb|KHN44959.1|  Patellin-4                                              102   1e-21   
ref|XP_004492509.1|  PREDICTED: patellin-6-like                         102   1e-21   
ref|XP_010257012.1|  PREDICTED: patellin-6-like                         101   1e-21   
ref|XP_003558543.1|  PREDICTED: patellin-6                              101   1e-21   
ref|XP_007205268.1|  hypothetical protein PRUPE_ppa006443mg             101   1e-21   
gb|ADZ24716.1|  Sec14-like protein                                      101   1e-21   
ref|XP_009115856.1|  PREDICTED: patellin-6                              101   1e-21   
ref|XP_008809969.1|  PREDICTED: patellin-6-like                         101   1e-21   
gb|KJB17128.1|  hypothetical protein B456_002G266700                    101   2e-21   
gb|KEH28820.1|  SEC14 cytosolic factor family protein                   101   2e-21   
ref|XP_004302562.1|  PREDICTED: LOW QUALITY PROTEIN: patellin-6         100   2e-21   
emb|CDX73705.1|  BnaC08g22980D                                          100   2e-21   
ref|XP_007140188.1|  hypothetical protein PHAVU_008G091400g             100   2e-21   
ref|XP_008364272.1|  PREDICTED: patellin-4-like                         102   3e-21   
ref|XP_008804155.1|  PREDICTED: patellin-6-like                         100   3e-21   
ref|XP_011095081.1|  PREDICTED: patellin-6-like                         100   3e-21   
ref|NP_001151467.1|  patellin-5                                         100   3e-21   
ref|XP_009392065.1|  PREDICTED: patellin-6-like                         100   4e-21   
emb|CAB43521.1|  hypothetical protein                                 96.3    4e-21   
gb|AFW77755.1|  putative patellin family protein                        100   5e-21   
ref|XP_008392314.1|  PREDICTED: patellin-4-like                       99.8    5e-21   
ref|XP_003623411.1|  Patellin-6                                         100   5e-21   
ref|XP_010937963.1|  PREDICTED: patellin-6-like                       99.8    6e-21   
dbj|BAJ87870.1|  predicted protein                                    99.4    7e-21   
ref|XP_007022594.1|  Sec14p-like phosphatidylinositol transfer fa...    100   1e-20   
gb|KHN40688.1|  Patellin-6                                            98.6    1e-20   
ref|XP_006857285.1|  hypothetical protein AMTR_s00067p00033540        99.4    1e-20   
ref|XP_006602689.1|  PREDICTED: patellin-6-like                       98.6    2e-20   
ref|XP_006589817.1|  PREDICTED: patellin-4-like                       99.0    2e-20   
gb|KHN03883.1|  Patellin-4                                            99.0    2e-20   
ref|XP_006290352.1|  hypothetical protein CARUB_v10017297mg           97.1    5e-20   
gb|KFK34411.1|  hypothetical protein AALP_AA5G141300                  97.1    5e-20   
ref|XP_002986839.1|  hypothetical protein SELMODRAFT_124840           98.6    6e-20   
gb|EYU41969.1|  hypothetical protein MIMGU_mgv1a006545mg              97.1    6e-20   
ref|XP_006443836.1|  hypothetical protein CICLE_v10023752mg           97.4    6e-20   
ref|XP_010426743.1|  PREDICTED: patellin-6-like                       96.7    6e-20   
ref|XP_010515597.1|  PREDICTED: patellin-6                            96.7    6e-20   
ref|XP_006403894.1|  hypothetical protein EUTSA_v10010417mg           96.7    7e-20   
ref|XP_002969274.1|  hypothetical protein SELMODRAFT_91570            98.2    7e-20   
ref|XP_002876098.1|  SEC14 cytosolic factor family protein            96.7    7e-20   
ref|NP_190735.1|  patellin-6                                          95.9    1e-19   
gb|KDO60492.1|  hypothetical protein CISIN_1g045317mg                 96.3    1e-19   
ref|XP_009631520.1|  PREDICTED: patellin-4-like                       95.5    2e-19   
ref|XP_010503862.1|  PREDICTED: patellin-6-like                       94.7    3e-19   
emb|CDP06420.1|  unnamed protein product                              93.6    5e-19   
ref|XP_010529922.1|  PREDICTED: patellin-6                            94.4    5e-19   
emb|CDY29036.1|  BnaC07g32420D                                        95.1    8e-19   
emb|CDX90637.1|  BnaA03g41440D                                        93.2    9e-19   
ref|XP_006352994.1|  PREDICTED: patellin-4-like                       94.0    9e-19   
ref|XP_010264525.1|  PREDICTED: patellin-6-like                       93.2    1e-18   
gb|KJB42255.1|  hypothetical protein B456_007G146400                  93.6    1e-18   
gb|AAT45009.1|  unknown                                               86.7    3e-18   
ref|XP_009136628.1|  PREDICTED: patellin-6-like                       91.7    4e-18   
gb|AEW08180.1|  hypothetical protein 2_2352_02                        85.9    5e-18   
ref|XP_009766462.1|  PREDICTED: patellin-4-like                       91.7    5e-18   
ref|XP_006351692.1|  PREDICTED: patellin-4-like                       91.7    6e-18   
ref|XP_004246944.1|  PREDICTED: patellin-4-like                       90.9    9e-18   
gb|KJB11324.1|  hypothetical protein B456_001G253700                  90.5    1e-17   
ref|XP_010679303.1|  PREDICTED: patellin-4-like                       90.5    2e-17   
gb|EMT33642.1|  hypothetical protein F775_33003                       87.0    5e-17   
emb|CDY21368.1|  BnaA09g30590D                                        88.6    2e-16   
ref|XP_011468862.1|  PREDICTED: patellin-5-like                       87.8    4e-16   
tpg|DAA39576.1|  TPA: hypothetical protein ZEAMMB73_704804            86.7    7e-16   
dbj|BAD94580.1|  hypothetical protein                                 79.7    8e-16   
emb|CDP03745.1|  unnamed protein product                              84.7    1e-15   
ref|XP_002532029.1|  Patellin-4, putative                             79.0    1e-13   
ref|NP_001055255.2|  Os05g0345100                                     69.7    6e-12   
gb|ABK95599.1|  unknown                                               68.6    7e-12   
gb|ABK94464.1|  unknown                                               68.6    7e-12   
gb|EAY97614.1|  hypothetical protein OsI_19538                        69.7    8e-12   
ref|XP_006480086.1|  PREDICTED: patellin-4-like                       73.6    1e-11   
gb|EYU46454.1|  hypothetical protein MIMGU_mgv1a007141mg              72.8    2e-11   
gb|EPS65619.1|  hypothetical protein M569_09158                       67.0    4e-11   
ref|XP_009784254.1|  PREDICTED: uncharacterized protein LOC104232692  70.9    7e-11   
gb|EMT23710.1|  hypothetical protein F775_32191                       68.2    3e-10   
ref|XP_011080044.1|  PREDICTED: patellin-4-like                       67.0    1e-09   
gb|KDP26528.1|  hypothetical protein JCGZ_17686                       64.7    3e-09   
emb|CDY66581.1|  BnaC05g50350D                                        65.5    5e-09   
gb|EPS68855.1|  hypothetical protein M569_05915                       63.9    9e-09   
emb|CBI17199.3|  unnamed protein product                              60.1    3e-07   
ref|XP_004173579.1|  PREDICTED: patellin-3-like                       52.8    9e-05   
gb|KFK38155.1|  hypothetical protein AALP_AA3G076100                  52.4    1e-04   
gb|KFK38154.1|  hypothetical protein AALP_AA3G076100                  52.0    1e-04   
emb|CDY28485.1|  BnaC02g36750D                                        47.8    3e-04   
ref|XP_007020127.1|  Sec14p-like phosphatidylinositol transfer fa...  51.2    3e-04   



>ref|XP_009617344.1| PREDICTED: patellin-3-like [Nicotiana tomentosiformis]
Length=629

 Score =   218 bits (554),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 104/127 (82%), Positives = 114/127 (90%), Gaps = 0/127 (0%)
 Frame = -2

Query  676  PEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVA  497
            PEQVP QYGGLSREG+ EFTT + ATEDTIKPTSKHTIEFPVTEK +LVWEARVIGWDV+
Sbjct  503  PEQVPAQYGGLSREGEQEFTTAEAATEDTIKPTSKHTIEFPVTEKTSLVWEARVIGWDVS  562

Query  496  YGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYR  317
            YG+EFVP+AEG YTIIVEKSRK+  ADET+I+N+Y    AGKVVLTFDNQTSKRKKLLYR
Sbjct  563  YGAEFVPSAEGGYTIIVEKSRKVAAADETVITNTYTAVEAGKVVLTFDNQTSKRKKLLYR  622

Query  316  SKTKGSD  296
            SKTK SD
Sbjct  623  SKTKPSD  629



>ref|XP_004250845.1| PREDICTED: patellin-3-like [Solanum lycopersicum]
Length=589

 Score =   213 bits (541),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 100/127 (79%), Positives = 111/127 (87%), Gaps = 0/127 (0%)
 Frame = -2

Query  676  PEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVA  497
            PEQVPVQYGGLSREG+ EFT  D ATEDT+KP SKHT+EFPVTEK  LVWEARV+GWDV 
Sbjct  463  PEQVPVQYGGLSREGEQEFTIADSATEDTVKPASKHTVEFPVTEKSNLVWEARVVGWDVC  522

Query  496  YGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYR  317
            YG+EFVP+AEG YTIIVEKSRKI  A+ET+I+N+Y    AGKVVLTFDNQTSKRKKL+YR
Sbjct  523  YGAEFVPSAEGGYTIIVEKSRKIAAANETVITNNYTAPEAGKVVLTFDNQTSKRKKLVYR  582

Query  316  SKTKGSD  296
            SKTK SD
Sbjct  583  SKTKSSD  589



>ref|XP_006339369.1| PREDICTED: patellin-2-like [Solanum tuberosum]
Length=616

 Score =   212 bits (540),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 100/127 (79%), Positives = 110/127 (87%), Gaps = 0/127 (0%)
 Frame = -2

Query  676  PEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVA  497
            PEQVPVQYGGLSREG+ EF   DPATED +KP SKHTIEFPVTEK  LVWEARV+GWDV 
Sbjct  490  PEQVPVQYGGLSREGEQEFPIADPATEDIVKPASKHTIEFPVTEKSNLVWEARVVGWDVC  549

Query  496  YGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYR  317
            YG+EFVP+AEG YTIIVEKSRKI  A+ET+I+N+Y    AGKVVLTFDNQTSKRKKL+YR
Sbjct  550  YGAEFVPSAEGGYTIIVEKSRKIAAANETVITNNYTAPEAGKVVLTFDNQTSKRKKLVYR  609

Query  316  SKTKGSD  296
            SKTK SD
Sbjct  610  SKTKPSD  616



>ref|XP_009612346.1| PREDICTED: patellin-3-like [Nicotiana tomentosiformis]
Length=569

 Score =   206 bits (523),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 97/127 (76%), Positives = 111/127 (87%), Gaps = 1/127 (1%)
 Frame = -2

Query  676  PEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVA  497
            PEQVPVQYGGLS+EG+ EFT  +PATED IKP SKHTIEFPVTEKCTLVWEARV GWDV+
Sbjct  444  PEQVPVQYGGLSKEGEQEFTIAEPATEDIIKPASKHTIEFPVTEKCTLVWEARVTGWDVS  503

Query  496  YGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYR  317
            YG+EFVP AEG YTII+EKSRK+G A+E +ISN+YK    GKVV+TFDNQ+SK+KKL+YR
Sbjct  504  YGAEFVPTAEGGYTIIIEKSRKVG-ANEKVISNTYKAGEPGKVVITFDNQSSKKKKLVYR  562

Query  316  SKTKGSD  296
            SK K SD
Sbjct  563  SKNKPSD  569



>ref|XP_010063754.1| PREDICTED: patellin-3-like [Eucalyptus grandis]
 gb|KCW71009.1| hypothetical protein EUGRSUZ_F04114 [Eucalyptus grandis]
Length=616

 Score =   204 bits (518),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 94/126 (75%), Positives = 110/126 (87%), Gaps = 0/126 (0%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APEQVPVQYGGLSREG++EFTT D AT+ TIKP SKHT+EFPVTEKC LVWE RV+GWDV
Sbjct  488  APEQVPVQYGGLSREGEHEFTTADAATDITIKPYSKHTVEFPVTEKCLLVWETRVVGWDV  547

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
             YG+EFVP+ EGAYT+IV+K+RK+ PADETIIS ++K    GK+VLT DNQ+SK+KKLLY
Sbjct  548  VYGAEFVPSTEGAYTVIVQKTRKVAPADETIISETFKGGEPGKIVLTIDNQSSKKKKLLY  607

Query  319  RSKTKG  302
            RSKTK 
Sbjct  608  RSKTKA  613



>emb|CAB95829.1| hypothetical protein [Cicer arietinum]
Length=482

 Score =   201 bits (511),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APEQVPVQYGGLSREGD EFTT DPATE TIKP +KH +EFP+ EK TLVWE RV+GWDV
Sbjct  354  APEQVPVQYGGLSREGDQEFTTADPATEVTIKPATKHAVEFPIPEKSTLVWEVRVVGWDV  413

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
            +YG+EFVP+AE  YT+IV+K+RKI PADET+I+N++K    GKVVLT DNQTSK+KKLLY
Sbjct  414  SYGAEFVPSAEDGYTVIVQKNRKIAPADETVINNTFKIGEPGKVVLTIDNQTSKKKKLLY  473

Query  319  RSKT  308
            RSKT
Sbjct  474  RSKT  477



>ref|XP_004506377.1| PREDICTED: patellin-2-like [Cicer arietinum]
Length=612

 Score =   203 bits (516),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APEQVPVQYGGLSREGD EFTT DPATE TIKP +KH +EFP+ EK TLVWE RV+GWDV
Sbjct  484  APEQVPVQYGGLSREGDQEFTTADPATEVTIKPATKHAVEFPIPEKSTLVWEVRVVGWDV  543

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
            +YG+EFVP+AE  YT+IV+K+RKI PADET+I+N++K    GKVVLT DNQTSK+KKLLY
Sbjct  544  SYGAEFVPSAEDGYTVIVQKNRKIAPADETVINNTFKIGEPGKVVLTIDNQTSKKKKLLY  603

Query  319  RSKT  308
            RSKT
Sbjct  604  RSKT  607



>ref|XP_004241867.1| PREDICTED: patellin-3-like [Solanum lycopersicum]
Length=580

 Score =   202 bits (513),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 96/128 (75%), Positives = 112/128 (88%), Gaps = 1/128 (1%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APEQVP QYGGLS+EG+ EFTT +PATE+ IKP SKHTIEFPVTEK TLVWEARV GWDV
Sbjct  453  APEQVPAQYGGLSKEGEEEFTTAEPATEEIIKPASKHTIEFPVTEKSTLVWEARVTGWDV  512

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
            +YG+EFVP+AEG YTI++EKSRK+G A+E++IS SYK   AGKVV+T DNQTSK+KKL+Y
Sbjct  513  SYGAEFVPSAEGGYTILIEKSRKVG-ANESVISTSYKASEAGKVVITIDNQTSKKKKLVY  571

Query  319  RSKTKGSD  296
            RSK K SD
Sbjct  572  RSKNKISD  579



>ref|XP_009775359.1| PREDICTED: patellin-3-like [Nicotiana sylvestris]
Length=566

 Score =   201 bits (512),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 95/127 (75%), Positives = 110/127 (87%), Gaps = 1/127 (1%)
 Frame = -2

Query  676  PEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVA  497
            PEQVP QYGGLS+EG+ EFT  +PATED IKP SKHTIEFPVTEKC+LVWEARV GWDV+
Sbjct  441  PEQVPAQYGGLSKEGEQEFTVAEPATEDIIKPASKHTIEFPVTEKCSLVWEARVTGWDVS  500

Query  496  YGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYR  317
            YG+EFVP AEG YTII+EKSRK+  A+ET+ISN+YK    GKVV+TFDNQ+SK+KKL+YR
Sbjct  501  YGAEFVPTAEGGYTIIIEKSRKVV-ANETVISNTYKAGEQGKVVITFDNQSSKKKKLVYR  559

Query  316  SKTKGSD  296
            SK K SD
Sbjct  560  SKNKPSD  566



>ref|XP_006356506.1| PREDICTED: patellin-2-like [Solanum tuberosum]
Length=577

 Score =   201 bits (511),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 95/128 (74%), Positives = 111/128 (87%), Gaps = 1/128 (1%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APEQVP QYGGLS+EG+ EF T +PATE+ IKP SK TIEFPVTEKCTLVWEARV GWDV
Sbjct  450  APEQVPAQYGGLSKEGEQEFITAEPATEEIIKPASKQTIEFPVTEKCTLVWEARVTGWDV  509

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
            +YG+EFVP+AEG YTI++EKSRK+G A+E++IS SYK   AGKVV+T DNQTSK+KKL+Y
Sbjct  510  SYGAEFVPSAEGGYTILIEKSRKVG-ANESVISTSYKASEAGKVVITIDNQTSKKKKLVY  568

Query  319  RSKTKGSD  296
            RSK K SD
Sbjct  569  RSKNKLSD  576



>ref|XP_009774158.1| PREDICTED: patellin-3-like [Nicotiana sylvestris]
Length=631

 Score =   198 bits (504),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 103/127 (81%), Positives = 114/127 (90%), Gaps = 0/127 (0%)
 Frame = -2

Query  676  PEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVA  497
            PEQVP QYGGLSREG+ EFTT + ATEDTIKPTSKHTIEFPVTEK TLVWEA VIGWDV+
Sbjct  505  PEQVPAQYGGLSREGEQEFTTTEAATEDTIKPTSKHTIEFPVTEKITLVWEATVIGWDVS  564

Query  496  YGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYR  317
            YG+EFVP+AEG YTIIVEKSRK+  ADET+I+N+Y T  AGK+VLTFDNQTSKRKKL+YR
Sbjct  565  YGAEFVPSAEGGYTIIVEKSRKVAAADETVITNTYTTVEAGKIVLTFDNQTSKRKKLVYR  624

Query  316  SKTKGSD  296
            SKTK SD
Sbjct  625  SKTKPSD  631



>gb|KHG00007.1| Patellin-5 -like protein [Gossypium arboreum]
Length=521

 Score =   196 bits (498),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APEQVPVQYGGLSR+G+ EFT  D ATE TIKP +KH++EFPVTEK T+VWE RV+GWDV
Sbjct  393  APEQVPVQYGGLSRDGEQEFTVADAATEVTIKPATKHSVEFPVTEKSTVVWEVRVVGWDV  452

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
             YG+EFVP AE  YT+IV K+RK+GPADET+ISNS+KT   GK+VLT DNQT+K+KKL+Y
Sbjct  453  NYGAEFVPTAEDGYTVIVSKTRKVGPADETVISNSFKTGEPGKIVLTIDNQTTKKKKLVY  512

Query  319  RSKTK  305
            RSK K
Sbjct  513  RSKAK  517



>gb|KJB81306.1| hypothetical protein B456_013G138100 [Gossypium raimondii]
Length=573

 Score =   196 bits (498),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APEQVPVQYGGLSR+G+ EFT  D ATE TIKP +KH++EFPVTEK T+VWE RV+GWDV
Sbjct  445  APEQVPVQYGGLSRDGEQEFTVADAATEVTIKPATKHSVEFPVTEKSTVVWEVRVVGWDV  504

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
             YG+EFVP AE  YT+IV K+RK+GPADET+ISNS+KT   GK+VLT DNQT+K+KKL+Y
Sbjct  505  NYGAEFVPTAEDGYTVIVSKTRKVGPADETVISNSFKTGEPGKIVLTIDNQTTKKKKLVY  564

Query  319  RSKTK  305
            RSK K
Sbjct  565  RSKAK  569



>gb|KJB81305.1| hypothetical protein B456_013G138100 [Gossypium raimondii]
Length=591

 Score =   196 bits (499),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APEQVPVQYGGLSR+G+ EFT  D ATE TIKP +KH++EFPVTEK T+VWE RV+GWDV
Sbjct  463  APEQVPVQYGGLSRDGEQEFTVADAATEVTIKPATKHSVEFPVTEKSTVVWEVRVVGWDV  522

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
             YG+EFVP AE  YT+IV K+RK+GPADET+ISNS+KT   GK+VLT DNQT+K+KKL+Y
Sbjct  523  NYGAEFVPTAEDGYTVIVSKTRKVGPADETVISNSFKTGEPGKIVLTIDNQTTKKKKLVY  582

Query  319  RSKTK  305
            RSK K
Sbjct  583  RSKAK  587



>ref|XP_011096139.1| PREDICTED: patellin-3-like [Sesamum indicum]
Length=601

 Score =   196 bits (497),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 92/128 (72%), Positives = 107/128 (84%), Gaps = 0/128 (0%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APEQVPVQYGGLS+EG+ EFT  DPATE+ IKPT KHT+E P+TE  TLVWE RV+GWDV
Sbjct  474  APEQVPVQYGGLSKEGEQEFTPADPATEEIIKPTCKHTVELPITEAGTLVWEVRVVGWDV  533

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
            +YG+EFVP+ EG YT IV+KSRKIGP DE +I  S+K    GK+VLTFDNQTSK+KKLLY
Sbjct  534  SYGAEFVPSDEGGYTWIVQKSRKIGPTDEQVIGCSFKVGETGKIVLTFDNQTSKKKKLLY  593

Query  319  RSKTKGSD  296
            RSKTK S+
Sbjct  594  RSKTKPSE  601



>dbj|BAE71201.1| putative cytosolic factor [Trifolium pratense]
Length=607

 Score =   195 bits (496),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 106/124 (85%), Gaps = 0/124 (0%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APEQVPVQYGGLSREG+ EFTT DPATE TIKP +KH +EFP++EK TLVWE RV+ W V
Sbjct  479  APEQVPVQYGGLSREGEQEFTTADPATEVTIKPATKHAVEFPISEKSTLVWEVRVVDWSV  538

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
             YG+EFVP+AE  YT+I++K+RK+ PADETIISN++K    GKV+LT DNQ+SK+KKLLY
Sbjct  539  NYGAEFVPSAEDGYTVIIQKNRKVAPADETIISNTFKIGEPGKVILTIDNQSSKKKKLLY  598

Query  319  RSKT  308
            RSKT
Sbjct  599  RSKT  602



>ref|XP_007020114.1| SEC14 cytosolic factor family protein / phosphoglyceride transfer 
family protein isoform 1 [Theobroma cacao]
 gb|EOY17339.1| SEC14 cytosolic factor family protein / phosphoglyceride transfer 
family protein isoform 1 [Theobroma cacao]
Length=625

 Score =   195 bits (496),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APEQVPVQYGGLSREG+ EFT  D  TE TIKP++KHT+EFP+TEKC LVWE RV+GWDV
Sbjct  497  APEQVPVQYGGLSREGEQEFTVADAVTEVTIKPSTKHTVEFPITEKCNLVWELRVVGWDV  556

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
             YG+EFVP+AE  YT+IV K+RK+  ADE +IS+S+KT   GKVVLT DNQTSK+KKLLY
Sbjct  557  NYGAEFVPSAEDGYTVIVSKTRKVTTADEAVISDSFKTGDPGKVVLTVDNQTSKKKKLLY  616

Query  319  RSKTK  305
            RSKTK
Sbjct  617  RSKTK  621



>ref|XP_004141567.1| PREDICTED: patellin-1-like [Cucumis sativus]
Length=152

 Score =   183 bits (464),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 104/126 (83%), Gaps = 1/126 (1%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APEQVPVQYGGLSREG+ EF+  DP TE  IK  +KHT+EFP++E   LVWE RV+GWDV
Sbjct  23   APEQVPVQYGGLSREGEQEFSVEDPVTEVAIKAAAKHTVEFPISEPSLLVWELRVVGWDV  82

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKK-LL  323
            +YG+EF P+AEG YT+IV+K+ K+GPADE +ISNSY+   AGK+VLT DN +SK+KK LL
Sbjct  83   SYGAEFSPSAEGGYTVIVQKTTKLGPADEPVISNSYRVGEAGKIVLTIDNLSSKKKKILL  142

Query  322  YRSKTK  305
            YRSKTK
Sbjct  143  YRSKTK  148



>gb|EYU22784.1| hypothetical protein MIMGU_mgv1a003476mg [Erythranthe guttata]
Length=583

 Score =   194 bits (493),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 108/129 (84%), Gaps = 1/129 (1%)
 Frame = -2

Query  679  APEQVPVQYGGLSRE-GDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWD  503
            APEQ+PVQYGGLS++  + EFTT DPATE+ IKP  KH +E P+TE  T VWEARVIGWD
Sbjct  455  APEQIPVQYGGLSKQDAEQEFTTADPATEEIIKPACKHIVELPITEAGTFVWEARVIGWD  514

Query  502  VAYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLL  323
            V+YG+EFVP+AEG YT IV+KSRKIGP DET++S S+K    GKVVLTFDNQTSK+KKLL
Sbjct  515  VSYGAEFVPSAEGGYTWIVQKSRKIGPVDETVVSCSFKVGETGKVVLTFDNQTSKKKKLL  574

Query  322  YRSKTKGSD  296
            YRSKTK S+
Sbjct  575  YRSKTKASE  583



>ref|XP_007224786.1| hypothetical protein PRUPE_ppa023884mg, partial [Prunus persica]
 gb|EMJ25985.1| hypothetical protein PRUPE_ppa023884mg, partial [Prunus persica]
Length=584

 Score =   194 bits (493),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APE VPVQYGGLSREG+ EFTT DP TE T+KP +KHT+E PV+E   LVWE RV+GWDV
Sbjct  456  APEHVPVQYGGLSREGEQEFTTSDPVTEITVKPATKHTVEIPVSENGLLVWEVRVVGWDV  515

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
            +YG+EFVP+AE  YTII++K+RK+ PADE +ISNSYK   AGKVVLT DNQ+SK+KKLLY
Sbjct  516  SYGAEFVPSAEDGYTIILQKTRKVAPADEPVISNSYKIGEAGKVVLTIDNQSSKKKKLLY  575

Query  319  RSKTK  305
            RSKTK
Sbjct  576  RSKTK  580



>ref|XP_006585750.1| PREDICTED: patellin-3-like isoform X2 [Glycine max]
 ref|XP_006585751.1| PREDICTED: patellin-3-like isoform X3 [Glycine max]
Length=540

 Score =   193 bits (491),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APE VPVQYGGLSRE + EFTT DP TE TIKP +KH +EFPV+EK   VWE RV+GWDV
Sbjct  412  APELVPVQYGGLSREAEQEFTTSDPVTEVTIKPATKHAVEFPVSEKSHAVWEIRVVGWDV  471

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
            +YG+EFVP AE  YT+IV+K+RKIGPADET+I+N++K    GK+VLT DNQTSK+KKLLY
Sbjct  472  SYGAEFVPGAEDGYTVIVQKNRKIGPADETVITNAFKIGEPGKIVLTIDNQTSKKKKLLY  531

Query  319  RSKTK  305
            RSKTK
Sbjct  532  RSKTK  536



>gb|KHN32468.1| Patellin-5 [Glycine soja]
Length=306

 Score =   187 bits (476),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APE VPVQYGGLSRE + EFT+  P TE TIKP +KH++EFPV+EK  LVWE RV+GWDV
Sbjct  178  APELVPVQYGGLSREAEQEFTSAYPVTEFTIKPATKHSVEFPVSEKSHLVWEIRVVGWDV  237

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
            +YG+EFVP+AE  YT+IV KSRKI PADET+++N +K    GK+VLT DNQTSK+KKLLY
Sbjct  238  SYGAEFVPSAEDGYTVIVHKSRKIAPADETVLTNGFKIGEPGKIVLTIDNQTSKKKKLLY  297

Query  319  RSKTK  305
            RSKTK
Sbjct  298  RSKTK  302



>ref|XP_003531832.1| PREDICTED: patellin-3-like isoform X1 [Glycine max]
Length=576

 Score =   194 bits (492),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APE VPVQYGGLSRE + EFTT DP TE TIKP +KH +EFPV+EK   VWE RV+GWDV
Sbjct  448  APELVPVQYGGLSREAEQEFTTSDPVTEVTIKPATKHAVEFPVSEKSHAVWEIRVVGWDV  507

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
            +YG+EFVP AE  YT+IV+K+RKIGPADET+I+N++K    GK+VLT DNQTSK+KKLLY
Sbjct  508  SYGAEFVPGAEDGYTVIVQKNRKIGPADETVITNAFKIGEPGKIVLTIDNQTSKKKKLLY  567

Query  319  RSKTK  305
            RSKTK
Sbjct  568  RSKTK  572



>emb|CBI39339.3| unnamed protein product [Vitis vinifera]
Length=274

 Score =   186 bits (473),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 87/128 (68%), Positives = 100/128 (78%), Gaps = 0/128 (0%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APEQVPVQYGGL R+GD EF+  DP T  TIKP  KH IEFP +E C L+WE RVIGWDV
Sbjct  147  APEQVPVQYGGLKRDGDTEFSICDPVTLVTIKPGCKHVIEFPYSEPCQLIWELRVIGWDV  206

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
             YG+EFVP  EG YT+IV+K+RKI P DE +ISNS+K    GKV+LT DNQTSK+KKLLY
Sbjct  207  TYGAEFVPTVEGGYTVIVQKARKIAPTDEPVISNSFKIGEPGKVILTIDNQTSKKKKLLY  266

Query  319  RSKTKGSD  296
            RSKT+  D
Sbjct  267  RSKTQPCD  274



>gb|KEH29320.1| patellin-like protein [Medicago truncatula]
Length=595

 Score =   193 bits (491),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APEQVPV+YGGLSR+G+ EFTT DPATE TIKP +KH +EFPV+EK TLVWE RV+ W+V
Sbjct  467  APEQVPVKYGGLSRDGEQEFTTADPATEVTIKPATKHAVEFPVSEKSTLVWEVRVVDWNV  526

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
            +YG+EFVP+AE  YT+I++K+RKI  ADET+ISN++K    GKVVLT DNQTSK+KKLLY
Sbjct  527  SYGAEFVPSAEDGYTVIIQKNRKIAAADETVISNTFKVGEPGKVVLTIDNQTSKKKKLLY  586

Query  319  RSKT  308
            RSKT
Sbjct  587  RSKT  590



>gb|KHM98825.1| Patellin-3 [Glycine soja]
Length=638

 Score =   193 bits (491),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APE VPVQYGGLSRE + EFTT DP TE TIKP +KH +EFPV+EK   VWE RV+GWDV
Sbjct  510  APELVPVQYGGLSREAEQEFTTSDPVTEVTIKPATKHAVEFPVSEKSHAVWEIRVVGWDV  569

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
            +YG+EFVP AE  YT+IV+K+RKIGPADET+I+N++K    GK+VLT DNQTSK+KKLLY
Sbjct  570  SYGAEFVPGAEDGYTVIVQKNRKIGPADETVITNAFKIGEPGKIVLTIDNQTSKKKKLLY  629

Query  319  RSKTK  305
            RSKTK
Sbjct  630  RSKTK  634



>gb|KHG10355.1| Patellin-5 -like protein [Gossypium arboreum]
Length=600

 Score =   192 bits (488),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APEQVPVQYGGLSREG+ EF+  D  TE TIKP +KH++EFP+TE C LVWE RV+GW+V
Sbjct  472  APEQVPVQYGGLSREGEQEFSVADAVTEVTIKPAAKHSVEFPITENCNLVWELRVVGWEV  531

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
             YG+EFVP AE  YT+IV K+RK+  ADET+IS+S+KT   GKVVLT DNQTSK+KKLLY
Sbjct  532  NYGAEFVPTAEDGYTVIVSKTRKVSSADETVISDSFKTGEPGKVVLTIDNQTSKKKKLLY  591

Query  319  RSKTK  305
            RSKTK
Sbjct  592  RSKTK  596



>gb|KDP27341.1| hypothetical protein JCGZ_20273 [Jatropha curcas]
Length=306

 Score =   185 bits (470),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 103/126 (82%), Gaps = 0/126 (0%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APEQVPVQYGGLSREGD EF+  DP TE  +KPT+KHT+EF  +E+  LVWE RV+GWDV
Sbjct  178  APEQVPVQYGGLSREGDQEFSVNDPVTEVVVKPTAKHTVEFSFSERTLLVWELRVLGWDV  237

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
            +YG+EFVP+AE  YT+IV K+RKI P DE +IS+++K    GKVVLT DNQ+SK+KKLLY
Sbjct  238  SYGAEFVPSAEDGYTVIVSKTRKISPTDEPVISDTFKISEPGKVVLTIDNQSSKKKKLLY  297

Query  319  RSKTKG  302
            RSKTK 
Sbjct  298  RSKTKS  303



>gb|KJB60075.1| hypothetical protein B456_009G288200 [Gossypium raimondii]
Length=545

 Score =   190 bits (482),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 103/125 (82%), Gaps = 0/125 (0%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APEQVPVQYGGLSREG+ EF+  D  TE TIKP +KH++EFP+TE C LVWE RV+GW+V
Sbjct  417  APEQVPVQYGGLSREGEQEFSVADAVTEVTIKPAAKHSVEFPITENCNLVWELRVVGWEV  476

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
             YG+EFVP AE  YT+IV K+RK+   DET+IS+S+KT   GKVVLT DNQTSK+KKLLY
Sbjct  477  NYGAEFVPTAEDGYTVIVSKTRKVSSVDETVISDSFKTGEPGKVVLTIDNQTSKKKKLLY  536

Query  319  RSKTK  305
            RSKTK
Sbjct  537  RSKTK  541



>ref|XP_007131297.1| hypothetical protein PHAVU_011G002100g [Phaseolus vulgaris]
 gb|ESW03291.1| hypothetical protein PHAVU_011G002100g [Phaseolus vulgaris]
Length=612

 Score =   191 bits (485),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 89/126 (71%), Positives = 105/126 (83%), Gaps = 0/126 (0%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APE VP+QYGGLSREG+ EFTT D  TE TIKP +KH +EFPV+EK  LVWE RV+GWDV
Sbjct  484  APELVPLQYGGLSREGEQEFTTADAVTEVTIKPATKHAVEFPVSEKSHLVWEIRVVGWDV  543

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
            +Y +EFVP+ E  YT+IV+K+RKI PADET+ISN +K+  AGKVVLT DNQTSK+KKLLY
Sbjct  544  SYVAEFVPSTEDGYTVIVQKNRKIAPADETVISNGFKSGEAGKVVLTIDNQTSKKKKLLY  603

Query  319  RSKTKG  302
            RSKTK 
Sbjct  604  RSKTKA  609



>ref|XP_007020115.1| SEC14 cytosolic factor family protein / phosphoglyceride transfer 
family protein isoform 2 [Theobroma cacao]
 gb|EOY17340.1| SEC14 cytosolic factor family protein / phosphoglyceride transfer 
family protein isoform 2 [Theobroma cacao]
Length=626

 Score =   191 bits (484),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 106/126 (84%), Gaps = 1/126 (1%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTE-KCTLVWEARVIGWD  503
            APEQVPVQYGGLSREG+ EFT  D  TE TIKP++KHT+EFP+TE KC LVWE RV+GWD
Sbjct  497  APEQVPVQYGGLSREGEQEFTVADAVTEVTIKPSTKHTVEFPITEQKCNLVWELRVVGWD  556

Query  502  VAYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLL  323
            V YG+EFVP+AE  YT+IV K+RK+  ADE +IS+S+KT   GKVVLT DNQTSK+KKLL
Sbjct  557  VNYGAEFVPSAEDGYTVIVSKTRKVTTADEAVISDSFKTGDPGKVVLTVDNQTSKKKKLL  616

Query  322  YRSKTK  305
            YRSKTK
Sbjct  617  YRSKTK  622



>gb|KJB81308.1| hypothetical protein B456_013G138100 [Gossypium raimondii]
Length=590

 Score =   190 bits (482),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 106/125 (85%), Gaps = 1/125 (1%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APEQVPVQYGGLSR+G+ EFT  D ATE TIKP +KH++EFPVTE  T+VWE RV+GWDV
Sbjct  463  APEQVPVQYGGLSRDGEQEFTVADAATEVTIKPATKHSVEFPVTE-STVVWEVRVVGWDV  521

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
             YG+EFVP AE  YT+IV K+RK+GPADET+ISNS+KT   GK+VLT DNQT+K+KKL+Y
Sbjct  522  NYGAEFVPTAEDGYTVIVSKTRKVGPADETVISNSFKTGEPGKIVLTIDNQTTKKKKLVY  581

Query  319  RSKTK  305
            RSK K
Sbjct  582  RSKAK  586



>gb|KJB60073.1| hypothetical protein B456_009G288200 [Gossypium raimondii]
Length=598

 Score =   190 bits (483),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 103/125 (82%), Gaps = 0/125 (0%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APEQVPVQYGGLSREG+ EF+  D  TE TIKP +KH++EFP+TE C LVWE RV+GW+V
Sbjct  470  APEQVPVQYGGLSREGEQEFSVADAVTEVTIKPAAKHSVEFPITENCNLVWELRVVGWEV  529

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
             YG+EFVP AE  YT+IV K+RK+   DET+IS+S+KT   GKVVLT DNQTSK+KKLLY
Sbjct  530  NYGAEFVPTAEDGYTVIVSKTRKVSSVDETVISDSFKTGEPGKVVLTIDNQTSKKKKLLY  589

Query  319  RSKTK  305
            RSKTK
Sbjct  590  RSKTK  594



>ref|XP_006473247.1| PREDICTED: patellin-2-like [Citrus sinensis]
 gb|KDO84005.1| hypothetical protein CISIN_1g008033mg [Citrus sinensis]
Length=580

 Score =   188 bits (478),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 87/127 (69%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APEQVPVQYGGLSREG+ EFTT DP TE  +KP SK+T+E PVTE+  LVWE RV+GWDV
Sbjct  452  APEQVPVQYGGLSREGEQEFTTTDPVTEVVVKPASKYTVEIPVTERSILVWELRVLGWDV  511

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
            +YG+EFVP+AEG+YT+IV K+RK+ P DE +I +++K    GKVVLT DNQ+SK+KKLLY
Sbjct  512  SYGAEFVPSAEGSYTVIVSKTRKVAPTDEPVICDTFKIGEPGKVVLTIDNQSSKKKKLLY  571

Query  319  RSKTKGS  299
            RSKTK S
Sbjct  572  RSKTKPS  578



>ref|XP_006591943.1| PREDICTED: patellin-2-like isoform X3 [Glycine max]
Length=587

 Score =   188 bits (478),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APE VPVQYGGLSRE + EFT+  P TE TIKP +KH++EFPV+EK  LVWE RV+GWDV
Sbjct  459  APELVPVQYGGLSREAEQEFTSAYPVTEFTIKPATKHSVEFPVSEKSHLVWEIRVVGWDV  518

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
            +YG+EFVP+AE  YT+IV KSRKI PADET+++N +K    GK+VLT DNQTSK+KKLLY
Sbjct  519  SYGAEFVPSAEDGYTVIVHKSRKIAPADETVLTNGFKIGEPGKIVLTIDNQTSKKKKLLY  578

Query  319  RSKTK  305
            RSKTK
Sbjct  579  RSKTK  583



>ref|XP_006434672.1| hypothetical protein CICLE_v10000682mg [Citrus clementina]
 gb|ESR47912.1| hypothetical protein CICLE_v10000682mg [Citrus clementina]
Length=582

 Score =   188 bits (478),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 87/127 (69%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APEQVPVQYGGLSREG+ EFTT DP TE  +KP SK+T+E PVTE+  LVWE RV+GWDV
Sbjct  454  APEQVPVQYGGLSREGEQEFTTTDPVTEVVVKPASKYTVEIPVTERSILVWELRVLGWDV  513

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
            +YG+EFVP+AEG+YT+IV K+RK+ P DE +I +++K    GKVVLT DNQ+SK+KKLLY
Sbjct  514  SYGAEFVPSAEGSYTVIVSKTRKVAPTDEPVICDTFKIGEPGKVVLTIDNQSSKKKKLLY  573

Query  319  RSKTKGS  299
            RSKTK S
Sbjct  574  RSKTKPS  580



>ref|XP_006591942.1| PREDICTED: patellin-2-like isoform X2 [Glycine max]
Length=596

 Score =   188 bits (478),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APE VPVQYGGLSRE + EFT+  P TE TIKP +KH++EFPV+EK  LVWE RV+GWDV
Sbjct  468  APELVPVQYGGLSREAEQEFTSAYPVTEFTIKPATKHSVEFPVSEKSHLVWEIRVVGWDV  527

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
            +YG+EFVP+AE  YT+IV KSRKI PADET+++N +K    GK+VLT DNQTSK+KKLLY
Sbjct  528  SYGAEFVPSAEDGYTVIVHKSRKIAPADETVLTNGFKIGEPGKIVLTIDNQTSKKKKLLY  587

Query  319  RSKTK  305
            RSKTK
Sbjct  588  RSKTK  592



>ref|XP_003540055.1| PREDICTED: patellin-2-like isoform X1 [Glycine max]
Length=606

 Score =   188 bits (478),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APE VPVQYGGLSRE + EFT+  P TE TIKP +KH++EFPV+EK  LVWE RV+GWDV
Sbjct  478  APELVPVQYGGLSREAEQEFTSAYPVTEFTIKPATKHSVEFPVSEKSHLVWEIRVVGWDV  537

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
            +YG+EFVP+AE  YT+IV KSRKI PADET+++N +K    GK+VLT DNQTSK+KKLLY
Sbjct  538  SYGAEFVPSAEDGYTVIVHKSRKIAPADETVLTNGFKIGEPGKIVLTIDNQTSKKKKLLY  597

Query  319  RSKTK  305
            RSKTK
Sbjct  598  RSKTK  602



>ref|XP_011074963.1| PREDICTED: patellin-3-like [Sesamum indicum]
Length=581

 Score =   187 bits (475),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 89/128 (70%), Positives = 106/128 (83%), Gaps = 0/128 (0%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APEQVPVQYGGLS+EG++EFTT D ATE+TIKP SKHTI  P+ E  TL+WE RV GWDV
Sbjct  454  APEQVPVQYGGLSKEGEHEFTTADAATEETIKPASKHTIVLPIAEAGTLIWEVRVAGWDV  513

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
            +YG+EFVP+ E  YT IV+KSRK+G  DE ++S ++K   AGKVVLTFDNQTSK+KKLLY
Sbjct  514  SYGAEFVPSNEEGYTWIVQKSRKMGAGDEQVVSCTFKIGEAGKVVLTFDNQTSKKKKLLY  573

Query  319  RSKTKGSD  296
            RSKTK S+
Sbjct  574  RSKTKPSE  581



>gb|ABK95051.1| unknown [Populus trichocarpa]
Length=157

 Score =   176 bits (446),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/125 (68%), Positives = 103/125 (82%), Gaps = 2/125 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APE+VPVQYGGLS++G  EFT  D  T+ TIKPTSKHT+EFPV+E C LVWE RV GWDV
Sbjct  31   APEEVPVQYGGLSKDG--EFTGADTVTDVTIKPTSKHTVEFPVSEACVLVWELRVFGWDV  88

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
            +YG+EFVP+AE  YT+IV K+RKI  +D+ +IS+++K    GKVVLT DNQTSK+KKLLY
Sbjct  89   SYGAEFVPSAEDGYTVIVSKTRKIISSDDPVISDTFKIGEPGKVVLTIDNQTSKKKKLLY  148

Query  319  RSKTK  305
            RSKTK
Sbjct  149  RSKTK  153



>ref|XP_010095907.1| hypothetical protein L484_008304 [Morus notabilis]
 gb|EXB62501.1| hypothetical protein L484_008304 [Morus notabilis]
Length=635

 Score =   187 bits (475),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 87/127 (69%), Positives = 103/127 (81%), Gaps = 0/127 (0%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APE VPVQYGGLSREGD EFTT DP TE T+KP +KHT+E PV+E   LVWE R +GWDV
Sbjct  507  APEHVPVQYGGLSREGDQEFTTSDPVTEITVKPAAKHTVEIPVSESSILVWEIRALGWDV  566

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
             YG+EFVP+AE  YT+IV+K+RKI  ADE +I+NS+K    GK+VLT DNQ+SK+KKLLY
Sbjct  567  TYGAEFVPSAEDHYTVIVQKARKISLADEPVIANSFKVGEPGKIVLTIDNQSSKKKKLLY  626

Query  319  RSKTKGS  299
            RSKTK S
Sbjct  627  RSKTKPS  633



>ref|XP_011464747.1| PREDICTED: patellin-3-like isoform X2 [Fragaria vesca subsp. 
vesca]
Length=588

 Score =   186 bits (473),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/125 (69%), Positives = 102/125 (82%), Gaps = 0/125 (0%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APE VPVQYGGLS+EG+ EFTT DP TE T+KP  KHT+E PV+E   LVWE RV+ WDV
Sbjct  460  APEHVPVQYGGLSKEGECEFTTADPVTEVTVKPACKHTVEIPVSESGVLVWEVRVVAWDV  519

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
            +YG+EFVP+AE  YTII++K+RK+ P DE +ISNSYK   AGKVVLT DNQ+SK+KKLLY
Sbjct  520  SYGAEFVPSAEDGYTIILQKTRKVAPTDEPVISNSYKIGEAGKVVLTIDNQSSKKKKLLY  579

Query  319  RSKTK  305
            RSK K
Sbjct  580  RSKIK  584



>ref|XP_002267428.1| PREDICTED: patellin-3 [Vitis vinifera]
Length=606

 Score =   186 bits (473),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 87/128 (68%), Positives = 100/128 (78%), Gaps = 0/128 (0%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APEQVPVQYGGL R+GD EF+  DP T  TIKP  KH IEFP +E C L+WE RVIGWDV
Sbjct  479  APEQVPVQYGGLKRDGDTEFSICDPVTLVTIKPGCKHVIEFPYSEPCQLIWELRVIGWDV  538

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
             YG+EFVP  EG YT+IV+K+RKI P DE +ISNS+K    GKV+LT DNQTSK+KKLLY
Sbjct  539  TYGAEFVPTVEGGYTVIVQKARKIAPTDEPVISNSFKIGEPGKVILTIDNQTSKKKKLLY  598

Query  319  RSKTKGSD  296
            RSKT+  D
Sbjct  599  RSKTQPCD  606



>ref|XP_004299816.1| PREDICTED: patellin-3-like isoform X1 [Fragaria vesca subsp. 
vesca]
Length=603

 Score =   186 bits (473),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/125 (69%), Positives = 102/125 (82%), Gaps = 0/125 (0%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APE VPVQYGGLS+EG+ EFTT DP TE T+KP  KHT+E PV+E   LVWE RV+ WDV
Sbjct  475  APEHVPVQYGGLSKEGECEFTTADPVTEVTVKPACKHTVEIPVSESGVLVWEVRVVAWDV  534

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
            +YG+EFVP+AE  YTII++K+RK+ P DE +ISNSYK   AGKVVLT DNQ+SK+KKLLY
Sbjct  535  SYGAEFVPSAEDGYTIILQKTRKVAPTDEPVISNSYKIGEAGKVVLTIDNQSSKKKKLLY  594

Query  319  RSKTK  305
            RSK K
Sbjct  595  RSKIK  599



>ref|XP_011003949.1| PREDICTED: patellin-1-like [Populus euphratica]
Length=157

 Score =   174 bits (442),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 83/125 (66%), Positives = 101/125 (81%), Gaps = 2/125 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APE+VPVQYGGLSR+G  EFT  D  T+ TIKPTSKHT+EFPV+E C L WE RV+GWDV
Sbjct  31   APEEVPVQYGGLSRDG--EFTVADSVTDVTIKPTSKHTVEFPVSEACILAWELRVLGWDV  88

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
            +Y +EF+P+AE  YT+IV K+RK+   DE +IS+++K    GKVVLT DNQTSK+KKLLY
Sbjct  89   SYEAEFMPSAEDGYTVIVSKTRKVTSTDEPVISDTFKIGEPGKVVLTIDNQTSKKKKLLY  148

Query  319  RSKTK  305
            RSKTK
Sbjct  149  RSKTK  153



>gb|KCW69563.1| hypothetical protein EUGRSUZ_F02993 [Eucalyptus grandis]
Length=443

 Score =   181 bits (458),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/125 (69%), Positives = 101/125 (81%), Gaps = 0/125 (0%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APEQVP QYGGLS E + EFT  +PAT  TIKP SKHT+EFPVTE C LVWEA+V+G DV
Sbjct  310  APEQVPAQYGGLSMEAEQEFTAAEPATGVTIKPASKHTVEFPVTETCLLVWEAKVVGCDV  369

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
            +YG+EFVP+ EG+YT+IV+K+RKI PADE II   +K    GKVVLT DNQ+S+RK LLY
Sbjct  370  SYGAEFVPSTEGSYTVIVQKTRKITPADEPIICGRFKAGEPGKVVLTVDNQSSRRKTLLY  429

Query  319  RSKTK  305
            RSKTK
Sbjct  430  RSKTK  434



>gb|KGN52721.1| hypothetical protein Csa_5G652260 [Cucumis sativus]
Length=606

 Score =   182 bits (463),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 104/126 (83%), Gaps = 1/126 (1%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APEQVPVQYGGLSREG+ EF+  DP TE  IK  +KHT+EFP++E   LVWE RV+GWDV
Sbjct  477  APEQVPVQYGGLSREGEQEFSVEDPVTEVAIKAAAKHTVEFPISEPSLLVWELRVVGWDV  536

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKK-LL  323
            +YG+EF P+AEG YT+IV+K+ K+GPADE +ISNSY+   AGK+VLT DN +SK+KK LL
Sbjct  537  SYGAEFSPSAEGGYTVIVQKTTKLGPADEPVISNSYRVGEAGKIVLTIDNLSSKKKKILL  596

Query  322  YRSKTK  305
            YRSKTK
Sbjct  597  YRSKTK  602



>ref|XP_004170401.1| PREDICTED: patellin-3-like [Cucumis sativus]
Length=606

 Score =   182 bits (463),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 104/126 (83%), Gaps = 1/126 (1%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APEQVPVQYGGLSREG+ EF+  DP TE  IK  +KHT+EFP++E   LVWE RV+GWDV
Sbjct  477  APEQVPVQYGGLSREGEQEFSVEDPVTEVAIKAAAKHTVEFPISEPSLLVWELRVVGWDV  536

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKK-LL  323
            +YG+EF P+AEG YT+IV+K+ K+GPADE +ISNSY+   AGK+VLT DN +SK+KK LL
Sbjct  537  SYGAEFSPSAEGGYTVIVQKTTKLGPADEPVISNSYRVGEAGKIVLTIDNLSSKKKKILL  596

Query  322  YRSKTK  305
            YRSKTK
Sbjct  597  YRSKTK  602



>gb|EYU28219.1| hypothetical protein MIMGU_mgv1a004573mg [Erythranthe guttata]
Length=520

 Score =   181 bits (460),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 104/125 (83%), Gaps = 1/125 (1%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEK-CTLVWEARVIGWD  503
            APEQVP QYGGLS+EG+ EF T D ATE+TIKP  KHTIE P+TE   TLVWE RV+GWD
Sbjct  391  APEQVPAQYGGLSKEGEEEFATADAATEETIKPACKHTIELPITEGGTTLVWEVRVVGWD  450

Query  502  VAYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLL  323
            V+YG+EFVP+AEG YT IV+KSRKIG ADE  +S S+K+   GK+VLTFDNQTSK+KKL+
Sbjct  451  VSYGAEFVPSAEGGYTWIVQKSRKIGAADEQSLSCSFKSGETGKLVLTFDNQTSKKKKLV  510

Query  322  YRSKT  308
            YR+KT
Sbjct  511  YRTKT  515



>gb|ABB77236.1| patellin 1 [Cucurbita pepo]
Length=604

 Score =   182 bits (462),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 104/125 (83%), Gaps = 1/125 (1%)
 Frame = -2

Query  676  PEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVA  497
            PEQVPVQYGGLSREG+ EF+  DP TE  IK  +KHT+EFP++E   LVWE RV+GWDV+
Sbjct  476  PEQVPVQYGGLSREGEQEFSIDDPVTEVAIKAATKHTVEFPISEPSLLVWELRVVGWDVS  535

Query  496  YGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKK-LLY  320
            YG+EF+P+AEG YT+IV+K+ K+GPADE +ISNSY+   AGK+VLT DN +SK+KK LLY
Sbjct  536  YGAEFLPSAEGGYTVIVQKTAKLGPADEPVISNSYRVGEAGKIVLTIDNLSSKKKKILLY  595

Query  319  RSKTK  305
            RSKTK
Sbjct  596  RSKTK  600



>ref|XP_008459681.1| PREDICTED: patellin-3-like [Cucumis melo]
Length=603

 Score =   182 bits (462),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 104/126 (83%), Gaps = 1/126 (1%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APEQVPVQYGGLSREG+ EF+  DP TE  IK  +KHT+EFP++E   LVWE RV+GWDV
Sbjct  474  APEQVPVQYGGLSREGEQEFSVEDPVTEVAIKAATKHTVEFPISEPSLLVWELRVVGWDV  533

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKK-LL  323
            +YG+EF P+AEG YT+IV+K+ K+GPADE +ISNSY+   AGK+VLT DN +SK+KK LL
Sbjct  534  SYGAEFSPSAEGGYTVIVQKTTKLGPADEPVISNSYRVGEAGKIVLTIDNLSSKKKKILL  593

Query  322  YRSKTK  305
            YRSKTK
Sbjct  594  YRSKTK  599



>emb|CAN80424.1| hypothetical protein VITISV_013163 [Vitis vinifera]
Length=595

 Score =   182 bits (461),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 85/128 (66%), Positives = 98/128 (77%), Gaps = 0/128 (0%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APEQVPVQYGGL R+ D EF+  DP T  TIKP  KH IEFP +E C L+WE R IGWDV
Sbjct  468  APEQVPVQYGGLKRDXDTEFSICDPVTLVTIKPGCKHVIEFPYSEPCQLIWELRXIGWDV  527

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
             YG+EFVP  EG YT+IV+K+RKI P DE +ISNS+K    GKV+LT DNQTSK+KKLLY
Sbjct  528  TYGAEFVPTVEGGYTVIVQKARKIAPTDEPVISNSFKIGEPGKVILTIDNQTSKKKKLLY  587

Query  319  RSKTKGSD  296
            RSKT+  D
Sbjct  588  RSKTQPCD  595



>emb|CDP10711.1| unnamed protein product [Coffea canephora]
Length=620

 Score =   182 bits (461),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 87/126 (69%), Positives = 103/126 (82%), Gaps = 1/126 (1%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKC-TLVWEARVIGWD  503
            APEQVPVQYGGLSR G+ EFT  + ATE+ IKP+SK T+EFP TE   TLVWE RV+GW+
Sbjct  493  APEQVPVQYGGLSRGGEQEFTIAEAATEEIIKPSSKQTVEFPATEAGRTLVWEVRVVGWE  552

Query  502  VAYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLL  323
            V +G+EFVP+AEG YT+IV+KSRK GP DE +IS SYK    GK+VLTFDNQTS++KKLL
Sbjct  553  VTHGAEFVPSAEGGYTVIVQKSRKSGPTDEPVISGSYKIGEPGKIVLTFDNQTSRKKKLL  612

Query  322  YRSKTK  305
            YRSK K
Sbjct  613  YRSKIK  618



>ref|XP_010062424.1| PREDICTED: patellin-3-like [Eucalyptus grandis]
 gb|KCW69564.1| hypothetical protein EUGRSUZ_F02993 [Eucalyptus grandis]
Length=572

 Score =   181 bits (458),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 86/125 (69%), Positives = 101/125 (81%), Gaps = 0/125 (0%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APEQVP QYGGLS E + EFT  +PAT  TIKP SKHT+EFPVTE C LVWEA+V+G DV
Sbjct  439  APEQVPAQYGGLSMEAEQEFTAAEPATGVTIKPASKHTVEFPVTETCLLVWEAKVVGCDV  498

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
            +YG+EFVP+ EG+YT+IV+K+RKI PADE II   +K    GKVVLT DNQ+S+RK LLY
Sbjct  499  SYGAEFVPSTEGSYTVIVQKTRKITPADEPIICGRFKAGEPGKVVLTVDNQSSRRKTLLY  558

Query  319  RSKTK  305
            RSKTK
Sbjct  559  RSKTK  563



>ref|XP_008378750.1| PREDICTED: patellin-3-like [Malus domestica]
Length=615

 Score =   180 bits (456),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 88/132 (67%), Positives = 110/132 (83%), Gaps = 6/132 (5%)
 Frame = -2

Query  676  PEQVPVQYGGLSREG---DYEFTTGDPATEDTIKPTSKHTIEFPVTEKC--TLVWEARVI  512
            PE VPV+YGGLS+EG   ++EFTT DP TE T+KP SKHT+E PV+E C   LVWE RV+
Sbjct  484  PEHVPVKYGGLSKEGVEGEHEFTTSDPVTEVTVKPASKHTVEIPVSE-CGEVLVWEVRVV  542

Query  511  GWDVAYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRK  332
            GW+V+YG+EFVP+AE +YTII++K+RK+G ADE +ISN+YK   AGKVVLT DNQ+SK+K
Sbjct  543  GWEVSYGAEFVPSAEDSYTIILQKTRKVGAADEPVISNTYKIGEAGKVVLTIDNQSSKKK  602

Query  331  KLLYRSKTKGSD  296
            KLLYRSKTK S+
Sbjct  603  KLLYRSKTKPSE  614



>ref|XP_009379334.1| PREDICTED: patellin-3-like [Pyrus x bretschneideri]
Length=616

 Score =   179 bits (454),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 89/131 (68%), Positives = 109/131 (83%), Gaps = 6/131 (5%)
 Frame = -2

Query  676  PEQVPVQYGGLSREG---DYEFTTGDPATEDTIKPTSKHTIEFPVTEKC--TLVWEARVI  512
            PE VPV+YGGLS+EG   ++EFTT DP TE T+KP SKHTIE PV+E C   LVWE RV+
Sbjct  484  PEHVPVKYGGLSKEGVEGEHEFTTSDPVTEVTVKPASKHTIEIPVSE-CGEFLVWEVRVL  542

Query  511  GWDVAYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRK  332
            GW+V+YG+EFVP+AE +YTII++K+RK+G ADE +ISN+YK   AGKVVLT DNQ+SK+K
Sbjct  543  GWEVSYGAEFVPSAEDSYTIILQKTRKVGAADEPVISNTYKIGEAGKVVLTIDNQSSKKK  602

Query  331  KLLYRSKTKGS  299
            KLLYRSKTK S
Sbjct  603  KLLYRSKTKPS  613



>ref|XP_002521801.1| Patellin-3, putative [Ricinus communis]
 gb|EEF40611.1| Patellin-3, putative [Ricinus communis]
Length=627

 Score =   179 bits (454),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 82/125 (66%), Positives = 101/125 (81%), Gaps = 0/125 (0%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            A EQVPVQYGGLSREG  EF+  D  TE TIKP +KHT+EF  +E+C LVWE RV+GWDV
Sbjct  499  AAEQVPVQYGGLSREGVQEFSVSDAVTEVTIKPATKHTVEFSFSERCLLVWELRVVGWDV  558

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
            +YG+EFVP+A+  YT+IV K+RK+ P+DE +I +++K    GKVVLT DNQTSK+KKLLY
Sbjct  559  SYGAEFVPSADDGYTVIVSKARKVSPSDEPVICDTFKISEPGKVVLTIDNQTSKKKKLLY  618

Query  319  RSKTK  305
            RSKTK
Sbjct  619  RSKTK  623



>ref|XP_006859149.1| hypothetical protein AMTR_s00070p00121170 [Amborella trichopoda]
 gb|ERN20616.1| hypothetical protein AMTR_s00070p00121170 [Amborella trichopoda]
Length=626

 Score =   179 bits (453),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/125 (66%), Positives = 101/125 (81%), Gaps = 0/125 (0%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APEQVPVQYGGLS+E D EF+T D ATE TIKP SK+T+E PVTE C LVWE R++GWDV
Sbjct  495  APEQVPVQYGGLSKENDTEFSTADAATEFTIKPASKNTVEIPVTEACILVWELRILGWDV  554

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
            +YG+EFVP+AE  YT+IV+K+RKI   DE +I NS+K    GK+VLT DN +SK+KKL+Y
Sbjct  555  SYGAEFVPSAEDGYTVIVQKARKIAITDEPVIRNSFKIGEPGKIVLTVDNTSSKKKKLIY  614

Query  319  RSKTK  305
            R KTK
Sbjct  615  RYKTK  619



>ref|XP_010244944.1| PREDICTED: patellin-3-like [Nelumbo nucifera]
Length=578

 Score =   177 bits (450),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 103/127 (81%), Gaps = 0/127 (0%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APE VPVQYGGLSREG+ EFTT D A+E TIK  +K T+EFPV+E   LVWE RV+GWDV
Sbjct  450  APEYVPVQYGGLSREGEGEFTTADTASEITIKSATKQTVEFPVSEASHLVWEVRVVGWDV  509

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
            +YG+EFVP+AE  YT+IV+KSRK+  ++E +I NS+K    GK+VLT DNQ+SK+KKLLY
Sbjct  510  SYGAEFVPSAEDGYTVIVQKSRKVAASEEPVICNSFKIGEPGKIVLTIDNQSSKKKKLLY  569

Query  319  RSKTKGS  299
            RSKTK S
Sbjct  570  RSKTKPS  576



>ref|XP_009362426.1| PREDICTED: patellin-3-like [Pyrus x bretschneideri]
Length=610

 Score =   177 bits (450),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 104/127 (82%), Gaps = 1/127 (1%)
 Frame = -2

Query  676  PEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKC-TLVWEARVIGWDV  500
            PE VPVQYGGLS+EG++EFTT D  TE T+KP SKHT+E PV+E    LVWE RV+GW+V
Sbjct  481  PEHVPVQYGGLSKEGEHEFTTSDAVTEITVKPASKHTVEIPVSESGEVLVWEVRVVGWEV  540

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
             YG+EFVP+AE  YTII++K+ K+G ADE +I+N+YK   AGKVVLT DNQ+SK+KKLLY
Sbjct  541  TYGAEFVPSAEDGYTIILQKAWKVGAADEPVITNTYKIGEAGKVVLTIDNQSSKKKKLLY  600

Query  319  RSKTKGS  299
            RSKTK S
Sbjct  601  RSKTKPS  607



>ref|XP_011031501.1| PREDICTED: patellin-3 [Populus euphratica]
Length=619

 Score =   177 bits (449),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 103/125 (82%), Gaps = 2/125 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APE+VPVQYGGLS++G  EFT  D  T+ TIKPTSKHT+EFPV+E C L+WE RV GWDV
Sbjct  493  APEEVPVQYGGLSKDG--EFTVADTVTDVTIKPTSKHTVEFPVSEACVLIWELRVFGWDV  550

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
            +YG+EFVP+AE  YT+IV K+RKI  +D+ +IS+++K    GKVVLT DNQTSK+KKLLY
Sbjct  551  SYGAEFVPSAEDGYTVIVSKTRKIISSDDPVISDTFKIGEPGKVVLTIDNQTSKKKKLLY  610

Query  319  RSKTK  305
            RSKTK
Sbjct  611  RSKTK  615



>ref|XP_006371458.1| hypothetical protein POPTR_0019s10830g [Populus trichocarpa]
 gb|ERP49255.1| hypothetical protein POPTR_0019s10830g [Populus trichocarpa]
Length=623

 Score =   177 bits (449),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 85/125 (68%), Positives = 103/125 (82%), Gaps = 2/125 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APE+VPVQYGGLS++G  EFT  D  T+ TIKPTSKHT+EFPV+E C LVWE RV GWDV
Sbjct  497  APEEVPVQYGGLSKDG--EFTGADTVTDVTIKPTSKHTVEFPVSEACVLVWELRVFGWDV  554

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
            +YG+EFVP+AE  YT+IV K+RKI  +D+ +IS+++K    GKVVLT DNQTSK+KKLLY
Sbjct  555  SYGAEFVPSAEDGYTVIVSKTRKIISSDDPVISDTFKIGEPGKVVLTIDNQTSKKKKLLY  614

Query  319  RSKTK  305
            RSKTK
Sbjct  615  RSKTK  619



>ref|XP_008361618.1| PREDICTED: patellin-3-like [Malus domestica]
Length=614

 Score =   175 bits (444),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 86/130 (66%), Positives = 104/130 (80%), Gaps = 4/130 (3%)
 Frame = -2

Query  676  PEQVPVQYGGLSREG---DYEFTTGDPATEDTIKPTSKHTIEFPVTEKC-TLVWEARVIG  509
            PE VPVQYGGLS+EG   ++EFTT D  TE T+KP SKHT+E PV+E    LVWE RV+G
Sbjct  482  PEHVPVQYGGLSKEGVEGEHEFTTSDXVTEITVKPASKHTVEIPVSESGEVLVWEVRVVG  541

Query  508  WDVAYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKK  329
            W+V YG+EFVP+AE  YTII+ K+RK+G ADE +I+N+YK   AGKVVLT DNQ+SK+KK
Sbjct  542  WEVTYGAEFVPSAEDGYTIILHKARKVGAADEPVITNTYKIGEAGKVVLTIDNQSSKKKK  601

Query  328  LLYRSKTKGS  299
            LLYRSKTK S
Sbjct  602  LLYRSKTKPS  611



>ref|XP_008339156.1| PREDICTED: patellin-3-like [Malus domestica]
 ref|XP_008368133.1| PREDICTED: patellin-3-like [Malus domestica]
Length=614

 Score =   175 bits (444),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 86/130 (66%), Positives = 104/130 (80%), Gaps = 4/130 (3%)
 Frame = -2

Query  676  PEQVPVQYGGLSREG---DYEFTTGDPATEDTIKPTSKHTIEFPVTEKC-TLVWEARVIG  509
            PE VPVQYGGLS+EG   ++EFTT D  TE T+KP SKHT+E PV+E    LVWE RV+G
Sbjct  482  PEHVPVQYGGLSKEGVEGEHEFTTSDXVTEITVKPASKHTVEIPVSESGEVLVWEVRVVG  541

Query  508  WDVAYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKK  329
            W+V YG+EFVP+AE  YTII+ K+RK+G ADE +I+N+YK   AGKVVLT DNQ+SK+KK
Sbjct  542  WEVTYGAEFVPSAEDGYTIILHKARKVGAADEPVITNTYKIGEAGKVVLTIDNQSSKKKK  601

Query  328  LLYRSKTKGS  299
            LLYRSKTK S
Sbjct  602  LLYRSKTKPS  611



>ref|XP_010245412.1| PREDICTED: patellin-3-like [Nelumbo nucifera]
Length=561

 Score =   174 bits (442),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 81/127 (64%), Positives = 101/127 (80%), Gaps = 0/127 (0%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APE VPVQ+GGLSR+G+ EFT  D A E TIK  +K T+EFP +E C LVWE RV+GWDV
Sbjct  433  APELVPVQFGGLSRDGEGEFTDSDAANEITIKAATKQTVEFPASEACHLVWEVRVVGWDV  492

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
            +YG+EFVP+AE  YT+IV+KSRKI  ++E ++ NS+K    GK+VLT DNQ+SK+KKLLY
Sbjct  493  SYGAEFVPSAEDGYTVIVQKSRKIASSEEPVLCNSFKIGEPGKIVLTIDNQSSKKKKLLY  552

Query  319  RSKTKGS  299
            RSKTK S
Sbjct  553  RSKTKPS  559



>ref|XP_011003948.1| PREDICTED: patellin-3-like [Populus euphratica]
Length=629

 Score =   175 bits (443),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 83/125 (66%), Positives = 101/125 (81%), Gaps = 2/125 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APE+VPVQYGGLSR+G  EFT  D  T+ TIKPTSKHT+EFPV+E C L WE RV+GWDV
Sbjct  503  APEEVPVQYGGLSRDG--EFTVADSVTDVTIKPTSKHTVEFPVSEACILAWELRVLGWDV  560

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
            +Y +EF+P+AE  YT+IV K+RK+   DE +IS+++K    GKVVLT DNQTSK+KKLLY
Sbjct  561  SYEAEFMPSAEDGYTVIVSKTRKVTSTDEPVISDTFKIGEPGKVVLTIDNQTSKKKKLLY  620

Query  319  RSKTK  305
            RSKTK
Sbjct  621  RSKTK  625



>ref|XP_006376222.1| hypothetical protein POPTR_0013s11070g [Populus trichocarpa]
 gb|ERP54019.1| hypothetical protein POPTR_0013s11070g [Populus trichocarpa]
Length=623

 Score =   174 bits (441),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 83/125 (66%), Positives = 100/125 (80%), Gaps = 2/125 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APE VPVQYGGLSR+G  EFT  D  T+ TIKPTSKHT+EFPV+E C L WE RV+GWDV
Sbjct  497  APEDVPVQYGGLSRDG--EFTVADSVTDVTIKPTSKHTVEFPVSEACILAWELRVLGWDV  554

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
            +Y +EF+P+AE  YT+IV K+RK+   DE +IS+++K    GKVVLT DNQTSK+KKLLY
Sbjct  555  SYEAEFMPSAEDGYTVIVSKTRKVTSTDEPVISDTFKIGEPGKVVLTIDNQTSKKKKLLY  614

Query  319  RSKTK  305
            RSKTK
Sbjct  615  RSKTK  619



>ref|XP_003630420.1| Patellin-5 [Medicago truncatula]
 gb|AET04896.1| patellin-3 protein [Medicago truncatula]
Length=503

 Score =   172 bits (435),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/127 (62%), Positives = 102/127 (80%), Gaps = 2/127 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APEQ+PV+YGGLS++G  EF   D  TE TI+P SKHT+EFPVTEKC L WE RVIGW+V
Sbjct  376  APEQLPVKYGGLSKDG--EFGNSDSVTEITIRPASKHTVEFPVTEKCLLSWEVRVIGWEV  433

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
             YG+EFVP+ EG+YT+IV+K+RK+  ++E ++ NS+K +  GKVVLT DN +S++KKLLY
Sbjct  434  RYGAEFVPSNEGSYTVIVQKARKVASSEEAVLCNSFKINEPGKVVLTIDNTSSRKKKLLY  493

Query  319  RSKTKGS  299
            R KTK S
Sbjct  494  RLKTKTS  500



>ref|XP_010909148.1| PREDICTED: patellin-3-like isoform X2 [Elaeis guineensis]
Length=588

 Score =   171 bits (434),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 80/127 (63%), Positives = 98/127 (77%), Gaps = 0/127 (0%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APEQVPVQYGGLS++GD +FT+ D  TE TIKP+SK T+E PV+E C LVWE RV+GW+V
Sbjct  458  APEQVPVQYGGLSKDGDPDFTSADAVTEVTIKPSSKQTVEIPVSETCLLVWELRVLGWEV  517

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
             YG+EFVP+AE  YT+IV+K RK+   DE ++   +K    GKVVLT DN TSK+KKLLY
Sbjct  518  IYGAEFVPSAEDGYTVIVQKMRKLAATDEPVMKAFFKVGEPGKVVLTIDNPTSKKKKLLY  577

Query  319  RSKTKGS  299
            RSK K S
Sbjct  578  RSKAKSS  584



>ref|XP_010909147.1| PREDICTED: patellin-3-like isoform X1 [Elaeis guineensis]
Length=589

 Score =   167 bits (424),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 80/128 (63%), Positives = 99/128 (77%), Gaps = 1/128 (1%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEK-CTLVWEARVIGWD  503
            APEQVPVQYGGLS++GD +FT+ D  TE TIKP+SK T+E PV+E+ C LVWE RV+GW+
Sbjct  458  APEQVPVQYGGLSKDGDPDFTSADAVTEVTIKPSSKQTVEIPVSEQTCLLVWELRVLGWE  517

Query  502  VAYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLL  323
            V YG+EFVP+AE  YT+IV+K RK+   DE ++   +K    GKVVLT DN TSK+KKLL
Sbjct  518  VIYGAEFVPSAEDGYTVIVQKMRKLAATDEPVMKAFFKVGEPGKVVLTIDNPTSKKKKLL  577

Query  322  YRSKTKGS  299
            YRSK K S
Sbjct  578  YRSKAKSS  585



>ref|XP_008783367.1| PREDICTED: patellin-3-like [Phoenix dactylifera]
Length=581

 Score =   167 bits (422),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 97/127 (76%), Gaps = 0/127 (0%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APEQVP+QYGGLS++ D +FTT D  TE TIKP+SK T+E PV E C +VWE RV+GW+V
Sbjct  451  APEQVPIQYGGLSKDSDPDFTTSDAVTEVTIKPSSKQTVEIPVAETCLVVWELRVLGWEV  510

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
            +YG+EFVP AE  YT+IV+K+RK+   D+ ++  S+K    GKVVL  DN TSK+KKLLY
Sbjct  511  SYGAEFVPDAEDGYTVIVQKTRKLAATDDPVVKTSFKVGEPGKVVLIVDNPTSKKKKLLY  570

Query  319  RSKTKGS  299
            RSK K S
Sbjct  571  RSKAKSS  577



>ref|XP_010910883.1| PREDICTED: patellin-3-like isoform X2 [Elaeis guineensis]
Length=575

 Score =   165 bits (417),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 96/127 (76%), Gaps = 0/127 (0%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APEQVPVQYGGLS++ D +FTT D   E TIKP+ K T+E PVTE C +VWE RV+GW+V
Sbjct  445  APEQVPVQYGGLSKDNDPDFTTSDAVAEVTIKPSFKQTVEIPVTEPCLVVWELRVLGWEV  504

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
            +YG+EFVP AE  YT+IV+K+RK+   +E ++  S+K    GKVVL  DN TSK+KKLLY
Sbjct  505  SYGAEFVPNAEDGYTVIVQKTRKLAATEEPVVKASFKVSEPGKVVLIVDNPTSKKKKLLY  564

Query  319  RSKTKGS  299
            RSK K S
Sbjct  565  RSKAKSS  571



>gb|EMS62735.1| Patellin-5 [Triticum urartu]
Length=312

 Score =   159 bits (402),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 96/127 (76%), Gaps = 0/127 (0%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APEQVPVQ+GGL +E D +FTT D  TE TIK +SK  IE PVTE  T+VWE RV+GW+V
Sbjct  181  APEQVPVQFGGLFKEDDPDFTTSDSVTELTIKASSKEAIEIPVTENSTIVWELRVLGWEV  240

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
            ++G+EF P AEGAYT+IV+K+RK+   +E I+  S+K   AGK+VLT  N  SK+KKLLY
Sbjct  241  SHGAEFTPDAEGAYTVIVQKTRKVPANEEPIMKGSFKAGEAGKIVLTVSNAASKKKKLLY  300

Query  319  RSKTKGS  299
            RSK K S
Sbjct  301  RSKVKSS  307



>ref|XP_009403697.1| PREDICTED: patellin-3-like [Musa acuminata subsp. malaccensis]
Length=576

 Score =   163 bits (412),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 94/127 (74%), Gaps = 0/127 (0%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APEQVPV+YGGLS+E D +FT+ D  TE TIKP+ +  IE  VTEKC LVWE RV+GW+V
Sbjct  446  APEQVPVRYGGLSKENDPDFTSSDAVTEITIKPSMRQAIEIQVTEKCLLVWELRVLGWEV  505

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
             YG+EFVP +E  YT+IV+K RK+  ADE ++  S+K   AGK+VLT  N  SKRKKLLY
Sbjct  506  TYGAEFVPRSENGYTVIVQKERKLVAADEPVLKGSFKIGEAGKIVLTVHNSGSKRKKLLY  565

Query  319  RSKTKGS  299
            R K K S
Sbjct  566  RYKIKSS  572



>ref|XP_004970742.1| PREDICTED: patellin-1-like [Setaria italica]
Length=597

 Score =   163 bits (412),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 97/127 (76%), Gaps = 0/127 (0%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APEQVPVQ+GGL +E D EFTT D  TE TIKP+SK T+E PVTE  T+VWE RV+GW+V
Sbjct  469  APEQVPVQFGGLFKEDDPEFTTSDAVTELTIKPSSKETVEIPVTENSTIVWELRVLGWEV  528

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
            +YG+EF P AEG YT+IV+K+RK+   +E I+  S+K    GK+VLT +N  SK+KKLLY
Sbjct  529  SYGAEFTPEAEGGYTVIVQKTRKVPANEEPIMKGSFKVGEPGKLVLTINNPASKKKKLLY  588

Query  319  RSKTKGS  299
            RSK K +
Sbjct  589  RSKVKST  595



>gb|EPS65885.1| hypothetical protein M569_08890, partial [Genlisea aurea]
Length=554

 Score =   162 bits (411),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 79/127 (62%), Positives = 99/127 (78%), Gaps = 1/127 (1%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APEQ+PVQYGGLS+EGD EF++ D A E+ IKP SKH IE PV+E  T+VWE RVIG DV
Sbjct  428  APEQLPVQYGGLSKEGDAEFSSADSAVEEIIKPASKHAIEIPVSEPGTVVWEVRVIGSDV  487

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADE-TIISNSYKTDCAGKVVLTFDNQTSKRKKLL  323
             YG+EFVP AEG+YT IV+K+RK+ P++E  +I  S+K    GKVV+TF+NQ SK+KKL+
Sbjct  488  IYGAEFVPDAEGSYTWIVQKARKMSPSEEQQLIFYSFKIGETGKVVVTFENQNSKKKKLV  547

Query  322  YRSKTKG  302
            YR K K 
Sbjct  548  YRFKIKN  554



>dbj|BAJ87818.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=580

 Score =   162 bits (411),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 96/127 (76%), Gaps = 0/127 (0%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APEQVPVQ+GGL +E D +FTT D  TE TIK +SK  IE PVTE  T+VWE RV+GW+V
Sbjct  450  APEQVPVQFGGLFKEDDPDFTTSDSVTELTIKASSKEAIEIPVTENSTIVWELRVLGWEV  509

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
            +YG+EF P AEGAYT+IV+K+RK+   +E I+  S+K   AGK+VLT  N  SK+KKLLY
Sbjct  510  SYGAEFTPDAEGAYTVIVQKTRKVPANEEPIMKGSFKASEAGKIVLTISNAASKKKKLLY  569

Query  319  RSKTKGS  299
            RSK K S
Sbjct  570  RSKVKSS  576



>gb|EMT12738.1| hypothetical protein F775_27688 [Aegilops tauschii]
Length=424

 Score =   160 bits (404),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 97/127 (76%), Gaps = 0/127 (0%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APEQVPVQ+GGL +E D +FTT D  TE TIK +SK TIE PVTE  T+VWE RV+GW+V
Sbjct  288  APEQVPVQFGGLFKEDDPDFTTSDSVTELTIKASSKETIEIPVTENSTIVWELRVLGWEV  347

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
            ++G+EF P AEGAYT+IV+K+RK+   +E I+  S+K   AGK+VLT  N  SK+KKLLY
Sbjct  348  SHGAEFTPDAEGAYTVIVQKTRKVPANEEPIMKGSFKAGEAGKIVLTVSNAASKKKKLLY  407

Query  319  RSKTKGS  299
            RSK K S
Sbjct  408  RSKVKCS  414



>ref|XP_003564746.1| PREDICTED: patellin-3-like [Brachypodium distachyon]
Length=585

 Score =   162 bits (410),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 97/127 (76%), Gaps = 0/127 (0%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APEQVPVQ+GGL +E D EFTT D  TE TIK +SK TIE PVTE  T+VWE RV+GW+V
Sbjct  455  APEQVPVQFGGLFKEDDPEFTTSDSVTELTIKASSKETIEIPVTENSTIVWELRVLGWEV  514

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
            +YG+EF P AEG YT+IV+K+RK+   +E I+  S+K   +GK+VLT +N  SK+KKLLY
Sbjct  515  SYGAEFTPDAEGGYTVIVQKTRKVPANEEPIMKGSFKVSESGKIVLTINNPASKKKKLLY  574

Query  319  RSKTKGS  299
            RSK K +
Sbjct  575  RSKVKST  581



>ref|XP_010683337.1| PREDICTED: patellin-3 [Beta vulgaris subsp. vulgaris]
Length=579

 Score =   162 bits (410),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 97/127 (76%), Gaps = 0/127 (0%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APEQVPVQ+GG S+ G++EF+  D  TE TIKP SKH IEF  +E+  LVWE RVIGWDV
Sbjct  452  APEQVPVQFGGHSKFGEHEFSPADTVTEVTIKPGSKHPIEFAFSEETELVWELRVIGWDV  511

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
            +YG+EF+P  EG YT+ + K +K+ PADE +I +++K    GKVV+T DNQ+SK+KKLLY
Sbjct  512  SYGAEFLPTKEGGYTLNIAKPKKVTPADEPVICDTFKVTEPGKVVITIDNQSSKKKKLLY  571

Query  319  RSKTKGS  299
            RSK K S
Sbjct  572  RSKVKTS  578



>emb|CDM85203.1| unnamed protein product [Triticum aestivum]
Length=578

 Score =   162 bits (409),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 97/127 (76%), Gaps = 0/127 (0%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APEQVPVQ+GGL +E D +FTT D  TE TIK +SK TIE PVTE  T+VWE RV+GW+V
Sbjct  447  APEQVPVQFGGLFKEDDPDFTTSDSVTELTIKASSKETIEIPVTENSTIVWELRVLGWEV  506

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
            ++G+EF P AEGAYT+IV+K+RK+   +E I+  S+K   AGK+VLT  N  SK+KKLLY
Sbjct  507  SHGAEFTPDAEGAYTVIVQKTRKVPANEEPIMKGSFKAGEAGKIVLTISNAASKKKKLLY  566

Query  319  RSKTKGS  299
            RSK K S
Sbjct  567  RSKVKSS  573



>ref|XP_009404974.1| PREDICTED: patellin-3-like [Musa acuminata subsp. malaccensis]
Length=604

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 95/127 (75%), Gaps = 0/127 (0%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APEQVPV  GGLS+E D +FTT D  TE TIKP+SK +IE PV E   LVWE RV+GW+V
Sbjct  474  APEQVPVAIGGLSKENDPDFTTADAVTEVTIKPSSKQSIEIPVPETTLLVWELRVLGWEV  533

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
            +YG+EFVP+AE  YT+IV+K+RK+   DE +I  S+K    GKVVL  +N TSK+KKLLY
Sbjct  534  SYGAEFVPSAEDGYTVIVQKTRKLIATDEPVIKTSFKIGEPGKVVLNIENPTSKKKKLLY  593

Query  319  RSKTKGS  299
            RSK K S
Sbjct  594  RSKAKSS  600



>ref|XP_010910878.1| PREDICTED: patellin-3-like isoform X1 [Elaeis guineensis]
Length=576

 Score =   161 bits (407),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 77/128 (60%), Positives = 97/128 (76%), Gaps = 1/128 (1%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEK-CTLVWEARVIGWD  503
            APEQVPVQYGGLS++ D +FTT D   E TIKP+ K T+E PVTE+ C +VWE RV+GW+
Sbjct  445  APEQVPVQYGGLSKDNDPDFTTSDAVAEVTIKPSFKQTVEIPVTEQPCLVVWELRVLGWE  504

Query  502  VAYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLL  323
            V+YG+EFVP AE  YT+IV+K+RK+   +E ++  S+K    GKVVL  DN TSK+KKLL
Sbjct  505  VSYGAEFVPNAEDGYTVIVQKTRKLAATEEPVVKASFKVSEPGKVVLIVDNPTSKKKKLL  564

Query  322  YRSKTKGS  299
            YRSK K S
Sbjct  565  YRSKAKSS  572



>gb|EAY76673.1| hypothetical protein OsI_04628 [Oryza sativa Indica Group]
Length=610

 Score =   160 bits (405),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 96/127 (76%), Gaps = 0/127 (0%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APEQVPVQ+GGL +E D EFTT D  TE TIKP+SK T+E PVTE  T+ WE RV+GW+V
Sbjct  480  APEQVPVQFGGLFKEDDPEFTTSDAVTELTIKPSSKETVEIPVTENSTIGWELRVLGWEV  539

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
            +YG+EF P AEG YT+IV+K+RK+   +E I+  S+K    GK+VLT +N  SK+KKLLY
Sbjct  540  SYGAEFTPDAEGGYTVIVQKTRKVPANEEPIMKGSFKVGEPGKIVLTINNPASKKKKLLY  599

Query  319  RSKTKGS  299
            RSK K +
Sbjct  600  RSKVKST  606



>gb|EPS60308.1| hypothetical protein M569_14495, partial [Genlisea aurea]
Length=384

 Score =   157 bits (397),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 82/131 (63%), Positives = 104/131 (79%), Gaps = 8/131 (6%)
 Frame = -2

Query  679  APEQVPVQYGGLS-REGDY---EFTTGDPATEDTIKPTSKHTIEFPVTEK--CTLVWEAR  518
            APEQ+PVQYGGLS R+GD+   +F+  DPATE+ +KPTSKHTIE PV+ +   +++WEAR
Sbjct  251  APEQLPVQYGGLSLRDGDHHHHQFSPTDPATEEILKPTSKHTIEIPVSSERSGSVIWEAR  310

Query  517  VIGWDVAYGSEFVPAAEGAYTIIVEKSRKIGPADET-IISNSYKTDCAGKVVLTFDNQTS  341
            VIGWDV YG+EFVP  EG+YT IV+K+RKI P DE  ++S S+K   AGK+VLTFDNQ S
Sbjct  311  VIGWDVRYGAEFVPNGEGSYTWIVDKARKIDPTDERFVVSYSFKIAEAGKIVLTFDNQLS  370

Query  340  -KRKKLLYRSK  311
             K+KKL+YR K
Sbjct  371  RKKKKLIYRFK  381



>ref|NP_001044958.1| Os01g0874700 [Oryza sativa Japonica Group]
 dbj|BAB86220.1| P0648C09.9 [Oryza sativa Japonica Group]
 dbj|BAB92436.1| cytosolic factor-like protein [Oryza sativa Japonica Group]
 dbj|BAF06872.1| Os01g0874700 [Oryza sativa Japonica Group]
 dbj|BAG93276.1| unnamed protein product [Oryza sativa Japonica Group]
Length=613

 Score =   160 bits (405),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 96/127 (76%), Gaps = 0/127 (0%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APEQVPVQ+GGL +E D EFTT D  TE TIKP+SK T+E PVTE  T+ WE RV+GW+V
Sbjct  483  APEQVPVQFGGLFKEDDPEFTTSDAVTELTIKPSSKETVEIPVTENSTIGWELRVLGWEV  542

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
            +YG+EF P AEG YT+IV+K+RK+   +E I+  S+K    GK+VLT +N  SK+KKLLY
Sbjct  543  SYGAEFTPDAEGGYTVIVQKTRKVPANEEPIMKGSFKVGEPGKIVLTINNPASKKKKLLY  602

Query  319  RSKTKGS  299
            RSK K +
Sbjct  603  RSKVKST  609



>ref|XP_002456720.1| hypothetical protein SORBIDRAFT_03g041370 [Sorghum bicolor]
 gb|EES01840.1| hypothetical protein SORBIDRAFT_03g041370 [Sorghum bicolor]
Length=580

 Score =   160 bits (404),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 96/127 (76%), Gaps = 0/127 (0%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APEQVPVQ+GGL +  D EFTT D  TE TIKP+SK TIE PVTE  T+VWE RV+GW+V
Sbjct  452  APEQVPVQFGGLFKVDDPEFTTSDIVTELTIKPSSKETIEIPVTENSTIVWELRVLGWEV  511

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
            +YG+EF P AEG YT+IV+KSRK+   +E I+  S+K    GK+VLT +N  SK+KKLLY
Sbjct  512  SYGAEFTPDAEGGYTVIVQKSRKVPANEEPIMKGSFKVGEPGKLVLTVNNPASKKKKLLY  571

Query  319  RSKTKGS  299
            RSK K +
Sbjct  572  RSKVKST  578



>gb|EAZ14338.1| hypothetical protein OsJ_04261 [Oryza sativa Japonica Group]
Length=595

 Score =   160 bits (404),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 96/127 (76%), Gaps = 0/127 (0%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APEQVPVQ+GGL +E D EFTT D  TE TIKP+SK T+E PVTE  T+ WE RV+GW+V
Sbjct  465  APEQVPVQFGGLFKEDDPEFTTSDAVTELTIKPSSKETVEIPVTENSTIGWELRVLGWEV  524

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
            +YG+EF P AEG YT+IV+K+RK+   +E I+  S+K    GK+VLT +N  SK+KKLLY
Sbjct  525  SYGAEFTPDAEGGYTVIVQKTRKVPANEEPIMKGSFKVGEPGKIVLTINNPASKKKKLLY  584

Query  319  RSKTKGS  299
            RSK K +
Sbjct  585  RSKVKST  591



>ref|XP_009385108.1| PREDICTED: patellin-3-like [Musa acuminata subsp. malaccensis]
Length=603

 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 92/126 (73%), Gaps = 0/126 (0%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APEQVPV  GGLS++ D +FT  D AT+ +IKP+SK TIE P TE C LVWE RV+GW+V
Sbjct  473  APEQVPVALGGLSKDDDRDFTAADAATDVSIKPSSKQTIEMPATEACVLVWELRVLGWEV  532

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
            +YG+EF P+AE  YT+IV K+RK+   DE +I  S+K    GKVVL+ DN TSK+K LLY
Sbjct  533  SYGAEFTPSAEDGYTVIVHKTRKLAAVDEPVIKGSFKIGEPGKVVLSIDNPTSKKKLLLY  592

Query  319  RSKTKG  302
            R K K 
Sbjct  593  RHKVKS  598



>ref|XP_010095909.1| hypothetical protein L484_008306 [Morus notabilis]
 gb|EXB62503.1| hypothetical protein L484_008306 [Morus notabilis]
Length=510

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 95/128 (74%), Gaps = 3/128 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSRE---GDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIG  509
            +PEQVP+QYGGLS +    + EF+  DP TE  IKP +K T+E  + EKC ++WE RV+G
Sbjct  379  SPEQVPIQYGGLSVDFCDCNPEFSISDPVTEVNIKPGTKQTVEIIIYEKCVIIWELRVVG  438

Query  508  WDVAYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKK  329
            W+V+YGSEFVP AEG YTII+ KSRK  P+DE ++  S+K D  GK++LT DN TSK+K+
Sbjct  439  WEVSYGSEFVPNAEGRYTIIIHKSRKFAPSDEPVVHTSFKVDELGKILLTIDNPTSKKKR  498

Query  328  LLYRSKTK  305
            LLYR K K
Sbjct  499  LLYRFKIK  506



>ref|XP_010231340.1| PREDICTED: patellin-3-like isoform X2 [Brachypodium distachyon]
Length=527

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 95/127 (75%), Gaps = 0/127 (0%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APEQVPVQ+GGL +E D EF+T D  TE T+KP+SK TIE P TE  T+VWE RV+GW+V
Sbjct  397  APEQVPVQFGGLFKEDDTEFSTSDAVTELTVKPSSKETIEIPATENSTVVWELRVLGWEV  456

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
            +YG EF P AEG YT+IV+K+RK+   +E I+  ++K    GKVVLT +N TS++KKLLY
Sbjct  457  SYGVEFTPDAEGGYTVIVQKTRKVPANEEPIMKGNFKVTEPGKVVLTVNNPTSRKKKLLY  516

Query  319  RSKTKGS  299
            R K K S
Sbjct  517  RFKVKSS  523



>ref|XP_003568397.1| PREDICTED: patellin-3-like isoform X1 [Brachypodium distachyon]
Length=592

 Score =   158 bits (399),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 95/127 (75%), Gaps = 0/127 (0%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APEQVPVQ+GGL +E D EF+T D  TE T+KP+SK TIE P TE  T+VWE RV+GW+V
Sbjct  462  APEQVPVQFGGLFKEDDTEFSTSDAVTELTVKPSSKETIEIPATENSTVVWELRVLGWEV  521

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
            +YG EF P AEG YT+IV+K+RK+   +E I+  ++K    GKVVLT +N TS++KKLLY
Sbjct  522  SYGVEFTPDAEGGYTVIVQKTRKVPANEEPIMKGNFKVTEPGKVVLTVNNPTSRKKKLLY  581

Query  319  RSKTKGS  299
            R K K S
Sbjct  582  RFKVKSS  588



>ref|XP_006645095.1| PREDICTED: patellin-1-like [Oryza brachyantha]
Length=605

 Score =   157 bits (398),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 95/127 (75%), Gaps = 0/127 (0%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APEQVPVQ+GGL +E D EFTT D  TE TIK +SK T+E P +E  T+VWE RV+GW+V
Sbjct  475  APEQVPVQFGGLFKEDDPEFTTSDAVTELTIKASSKETVEIPASENSTIVWELRVLGWEV  534

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
            +YG+EF P AEG YT+IV+K+RK+   +E I+  S+K    GK+VLT +N  SK+KKLLY
Sbjct  535  SYGAEFTPDAEGGYTVIVQKTRKVPANEEPIMKGSFKVGEPGKIVLTINNAASKKKKLLY  594

Query  319  RSKTKGS  299
            RSK K +
Sbjct  595  RSKVKST  601



>ref|XP_009410675.1| PREDICTED: patellin-3-like [Musa acuminata subsp. malaccensis]
Length=564

 Score =   157 bits (397),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 93/127 (73%), Gaps = 0/127 (0%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APEQVPV +GGLS E D EFTT D  TE TIK +SK +IE P TE   LVWE RV GW+V
Sbjct  434  APEQVPVAFGGLSNESDPEFTTADAVTEVTIKASSKQSIEIPATEATLLVWELRVSGWEV  493

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
            +YG+EF+P+AE  YT+IV+K+RK+   DE +I  S+K    GKVVL  +N TSK+KKLLY
Sbjct  494  SYGAEFMPSAEDGYTVIVQKTRKLVATDEPVIKTSFKIGEPGKVVLNIENPTSKKKKLLY  553

Query  319  RSKTKGS  299
            RSK K S
Sbjct  554  RSKAKSS  560



>ref|NP_001150957.1| LOC100284590 [Zea mays]
 gb|ACG41076.1| patellin-1 [Zea mays]
Length=567

 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 95/127 (75%), Gaps = 0/127 (0%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APEQVPVQ+GGL +E D EFTT D  +E TIKP+SK T+E PVTE  T+VWE RV+ W+V
Sbjct  439  APEQVPVQFGGLFKEDDPEFTTSDTVSELTIKPSSKETVEIPVTENSTIVWELRVLSWEV  498

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
            +YG+EF P AEG YT+IV+K+RK+   +E I+  S+K    GK+VLT +N  SK+K LLY
Sbjct  499  SYGAEFTPDAEGGYTVIVQKTRKVPANEEPIMKGSFKAGEPGKLVLTVNNPASKKKTLLY  558

Query  319  RSKTKGS  299
            RSK K +
Sbjct  559  RSKVKSA  565



>gb|ACN27998.1| unknown [Zea mays]
 tpg|DAA56595.1| TPA: putative patellin family protein [Zea mays]
Length=571

 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 95/127 (75%), Gaps = 0/127 (0%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APEQVPVQ+GGL +E D EFTT D  +E TIKP+SK T+E PVTE  T+VWE RV+ W+V
Sbjct  443  APEQVPVQFGGLFKEDDPEFTTSDTVSELTIKPSSKETVEIPVTENSTIVWELRVLSWEV  502

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
            +YG+EF P AEG YT+IV+K+RK+   +E I+  S+K    GK+VLT +N  SK+K LLY
Sbjct  503  SYGAEFTPDAEGGYTVIVQKTRKVPANEEPIMKGSFKAGEPGKLVLTVNNPASKKKTLLY  562

Query  319  RSKTKGS  299
            RSK K +
Sbjct  563  RSKVKST  569



>ref|XP_004961988.1| PREDICTED: patellin-2-like [Setaria italica]
Length=638

 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 94/127 (74%), Gaps = 0/127 (0%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APEQVPVQ+GGL +E D EF+T D  TE T+KP+SK TIE P TE  T+VWE RV+GW+V
Sbjct  508  APEQVPVQFGGLYKEDDTEFSTSDAVTELTVKPSSKETIEIPATENSTVVWELRVLGWEV  567

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
            +YG+EF P AEG YT+IV+K+RK+   +E I+  S+K    GKVVL  +N  SK+KKLLY
Sbjct  568  SYGAEFTPDAEGGYTVIVQKTRKVPAHEEPIMKGSFKVSEPGKVVLIVNNPASKKKKLLY  627

Query  319  RSKTKGS  299
            R K K +
Sbjct  628  RFKVKST  634



>gb|EMT14507.1| hypothetical protein F775_26247 [Aegilops tauschii]
Length=312

 Score =   152 bits (383),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 93/127 (73%), Gaps = 0/127 (0%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APEQVPVQ+GGL +E D EF+T D  TE T+KP+SK T+E P TE  T+VWE RV+GW+V
Sbjct  181  APEQVPVQFGGLYKEDDTEFSTSDGVTELTVKPSSKETVEIPATENSTVVWELRVLGWEV  240

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
            +YG EF P AEG YT+IV+K+RK+   +E I+  S+K    GKVVL  +N TSK+KKLL 
Sbjct  241  SYGVEFTPDAEGGYTVIVQKTRKVPANEEPIMKGSFKAGEPGKVVLIVNNPTSKKKKLLC  300

Query  319  RSKTKGS  299
            R K K S
Sbjct  301  RFKVKSS  307



>ref|XP_008352805.1| PREDICTED: patellin-3-like [Malus domestica]
Length=226

 Score =   149 bits (375),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 69/131 (53%), Positives = 94/131 (72%), Gaps = 3/131 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSRE---GDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIG  509
            +PE VP+QYGGLS +    + EFT  DP  + T+KP +K T+E  + EKCT+VWE RV+G
Sbjct  95   SPEHVPIQYGGLSVDYCDCNPEFTIEDPVADVTVKPATKQTVEIIIYEKCTIVWELRVVG  154

Query  508  WDVAYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKK  329
            W+V+YG+EFVP AE  YTIIV+K+ K+ P DE ++SNS+K    GK++L  DN T K+K+
Sbjct  155  WEVSYGAEFVPNAENGYTIIVQKATKMSPTDEPVVSNSFKVTELGKILLKIDNPTPKKKR  214

Query  328  LLYRSKTKGSD  296
            LLYR K +  D
Sbjct  215  LLYRFKIEPLD  225



>ref|XP_008657015.1| PREDICTED: patellin-3-like [Zea mays]
 gb|AFW84436.1| putative patellin family protein [Zea mays]
Length=556

 Score =   155 bits (391),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 93/126 (74%), Gaps = 0/126 (0%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APEQVPVQ+GGL +E D EFTT D  TE TIKP+SK TIE PVTE   +VWE RV+GW+V
Sbjct  428  APEQVPVQFGGLFKEDDPEFTTLDTVTELTIKPSSKETIEIPVTENSAIVWELRVLGWEV  487

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
            +Y +EF P  EG YT+I++K+RK+   +E I+  S+K    GK+VLT +N  SK+KKLLY
Sbjct  488  SYSAEFTPDTEGGYTVIIQKTRKVPANEEPIMKGSFKVGEPGKLVLTVNNPASKKKKLLY  547

Query  319  RSKTKG  302
            RSK K 
Sbjct  548  RSKVKS  553



>dbj|BAK04984.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=681

 Score =   155 bits (392),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 94/127 (74%), Gaps = 0/127 (0%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APEQVPVQ+GGL +E D EF+T D  TE T+KP+SK TIE P TE  T+VWE RV+GW+V
Sbjct  551  APEQVPVQFGGLFKEDDTEFSTSDGVTELTVKPSSKETIEIPATENSTVVWELRVLGWEV  610

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
            +YG EF P AEG YT+IV+K+RK+   +E I+  S+K    GKV+LT +N TSK+KKLL 
Sbjct  611  SYGVEFTPDAEGGYTVIVQKTRKVPANEEPIMKGSFKASEPGKVLLTVNNPTSKKKKLLC  670

Query  319  RSKTKGS  299
            R K K S
Sbjct  671  RFKVKSS  677



>ref|XP_010675154.1| PREDICTED: patellin-3-like [Beta vulgaris subsp. vulgaris]
Length=563

 Score =   154 bits (390),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 94/123 (76%), Gaps = 3/123 (2%)
 Frame = -2

Query  676  PEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVA  497
            PEQVPV+YGG S+    EF   D AT+  +KPTSK T+EF VTE C L WE RV+GW+V+
Sbjct  439  PEQVPVRYGGFSK---GEFGNKDGATQIMVKPTSKETVEFAVTEACHLTWEVRVLGWEVS  495

Query  496  YGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYR  317
            YG+EFVP A+  YT+I++K RK+GP +ETIISN++KT   GKVVLT  N +SK+K+LLYR
Sbjct  496  YGAEFVPNAKDGYTVIIQKLRKVGPTEETIISNTFKTSEPGKVVLTIHNSSSKKKRLLYR  555

Query  316  SKT  308
             K+
Sbjct  556  LKS  558



>dbj|BAK01654.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=639

 Score =   155 bits (391),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 94/127 (74%), Gaps = 0/127 (0%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APEQVPVQ+GGL +E D EF+T D  TE T+KP+SK TIE P TE  T+VWE RV+GW+V
Sbjct  509  APEQVPVQFGGLFKEDDTEFSTSDGVTELTVKPSSKETIEIPATENSTVVWELRVLGWEV  568

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
            +YG EF P AEG YT+IV+K+RK+   +E I+  S+K    GKV+LT +N TSK+KKLL 
Sbjct  569  SYGVEFTPDAEGGYTVIVQKTRKVPANEEPIMKGSFKASEPGKVLLTVNNPTSKKKKLLC  628

Query  319  RSKTKGS  299
            R K K S
Sbjct  629  RFKVKSS  635



>ref|XP_002441147.1| hypothetical protein SORBIDRAFT_09g021240 [Sorghum bicolor]
 gb|EES19577.1| hypothetical protein SORBIDRAFT_09g021240 [Sorghum bicolor]
Length=624

 Score =   154 bits (390),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 0/127 (0%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APEQVPVQ+GGL +E D EF+T D  TE T+KP+SK TIE P TE  T+VWE RV+GW+V
Sbjct  492  APEQVPVQFGGLYKEDDTEFSTSDAVTELTVKPSSKETIEIPATENSTVVWELRVLGWEV  551

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
            +YG+EF P AEG YT+IV+K+RK+   +E I+  S+K    GKVVL  +N  S +KKLLY
Sbjct  552  SYGAEFTPDAEGGYTVIVQKTRKVPAHEEPIMKGSFKVTEPGKVVLAVNNPASTKKKLLY  611

Query  319  RSKTKGS  299
            R K K +
Sbjct  612  RFKVKST  618



>ref|NP_001055617.1| Os05g0429400 [Oryza sativa Japonica Group]
 gb|AAV59419.1| putative cellular retinaldehyde-binding/triple function [Oryza 
sativa Japonica Group]
 dbj|BAF17531.1| Os05g0429400 [Oryza sativa Japonica Group]
Length=585

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 75/128 (59%), Positives = 94/128 (73%), Gaps = 1/128 (1%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APEQVPVQ+GGL +E D EF+T D  TE  IKP+SK T+E P TE  T+VWE RV+GW+V
Sbjct  454  APEQVPVQFGGLYKEDDTEFSTSDAVTELPIKPSSKETVEIPATENSTVVWELRVLGWEV  513

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKK-LL  323
            +YG+EF P AEG YT+IV+K+RK+   +E I+  S+K    GK+VLT DN  SK+KK LL
Sbjct  514  SYGAEFTPDAEGGYTVIVQKTRKVPANEEPIMKGSFKVGEPGKIVLTVDNAASKKKKQLL  573

Query  322  YRSKTKGS  299
            YR K K S
Sbjct  574  YRFKVKSS  581



>gb|EEC79272.1| hypothetical protein OsI_20058 [Oryza sativa Indica Group]
Length=583

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 75/128 (59%), Positives = 94/128 (73%), Gaps = 1/128 (1%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APEQVPVQ+GGL +E D EF+T D  TE  IKP+SK T+E P TE  T+VWE RV+GW+V
Sbjct  452  APEQVPVQFGGLYKEDDTEFSTSDAVTELPIKPSSKETVEIPATENSTVVWELRVLGWEV  511

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKK-LL  323
            +YG+EF P AEG YT+IV+K+RK+   +E I+  S+K    GK+VLT DN  SK+KK LL
Sbjct  512  SYGAEFTPDAEGGYTVIVQKTRKVPANEEPIMKGSFKVGEPGKIVLTVDNAASKKKKQLL  571

Query  322  YRSKTKGS  299
            YR K K S
Sbjct  572  YRFKVKSS  579



>gb|EEE63805.1| hypothetical protein OsJ_18629 [Oryza sativa Japonica Group]
Length=465

 Score =   152 bits (385),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 75/128 (59%), Positives = 94/128 (73%), Gaps = 1/128 (1%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APEQVPVQ+GGL +E D EF+T D  TE  IKP+SK T+E P TE  T+VWE RV+GW+V
Sbjct  334  APEQVPVQFGGLYKEDDTEFSTSDAVTELPIKPSSKETVEIPATENSTVVWELRVLGWEV  393

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKK-LL  323
            +YG+EF P AEG YT+IV+K+RK+   +E I+  S+K    GK+VLT DN  SK+KK LL
Sbjct  394  SYGAEFTPDAEGGYTVIVQKTRKVPANEEPIMKGSFKVGEPGKIVLTVDNAASKKKKQLL  453

Query  322  YRSKTKGS  299
            YR K K S
Sbjct  454  YRFKVKSS  461



>ref|XP_008442083.1| PREDICTED: patellin-3-like [Cucumis melo]
Length=570

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/126 (55%), Positives = 99/126 (79%), Gaps = 4/126 (3%)
 Frame = -2

Query  673  EQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAY  494
            E++PV+YGG+S++G  EF T D  TE T+KP++KH++E+PV + C + WE RV+GWDV Y
Sbjct  446  EELPVKYGGMSKDG--EFETCDSVTEITVKPSAKHSVEYPVAQGCAVTWEVRVVGWDVNY  503

Query  493  GSEFVPAAEGAYTIIVEKSRKIGPA--DETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
            G+EFVP+ EG+YT+I++K+R++G +  D  +ISN++K    GKVVL+ DN TSK+KKLLY
Sbjct  504  GAEFVPSGEGSYTVIIDKARRVGSSSQDHPVISNTFKISEPGKVVLSVDNPTSKKKKLLY  563

Query  319  RSKTKG  302
            R KTK 
Sbjct  564  RFKTKS  569



>ref|XP_009389513.1| PREDICTED: patellin-3-like [Musa acuminata subsp. malaccensis]
Length=652

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 81/127 (64%), Positives = 98/127 (77%), Gaps = 0/127 (0%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APEQVPVQ+GGLS+E D +F+T D   E TIKP++K  IE PV E C LVWE RV+GWDV
Sbjct  522  APEQVPVQFGGLSKENDTDFSTADAVIETTIKPSTKQAIEIPVAESCILVWELRVLGWDV  581

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
             YG+EFVP+AE  YT+IV+KSRK+   DE ++ +S+K   AGKVVLT DN TSK+KKLLY
Sbjct  582  NYGAEFVPSAEDGYTVIVQKSRKMVVTDEPVVKDSFKIGEAGKVVLTVDNTTSKKKKLLY  641

Query  319  RSKTKGS  299
            R KTK S
Sbjct  642  RYKTKSS  648



>ref|XP_008378744.1| PREDICTED: patellin-3-like [Malus domestica]
 ref|XP_008347858.1| PREDICTED: patellin-3-like [Malus domestica]
Length=515

 Score =   152 bits (385),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 95/133 (71%), Gaps = 7/133 (5%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDY-----EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARV  515
            +PE VP+QYGGLS   DY     EFT  DP  + TIKP +K T+E  + EKCT+VWE RV
Sbjct  381  SPEHVPIQYGGLS--VDYCDCNPEFTIADPVADVTIKPATKQTVEIIIYEKCTIVWELRV  438

Query  514  IGWDVAYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKR  335
            +GW+V+YG+EFVP AE  YTII++K+ K+ P DE ++SNS+K    GK++L  DN TSK+
Sbjct  439  VGWEVSYGAEFVPEAENGYTIIIQKATKMSPTDEPVVSNSFKVGELGKILLKIDNPTSKK  498

Query  334  KKLLYRSKTKGSD  296
            K+LLYR K +  D
Sbjct  499  KRLLYRFKIEPLD  511



>ref|XP_010912526.1| PREDICTED: patellin-3-like [Elaeis guineensis]
Length=558

 Score =   152 bits (385),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 87/113 (77%), Gaps = 0/113 (0%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APEQVPVQYGGLS+E D +FT+ D   E TIKP++K  IE PVTEKC LVWE RV+GWDV
Sbjct  428  APEQVPVQYGGLSKEKDPDFTSADAVAEITIKPSAKQVIEIPVTEKCLLVWELRVLGWDV  487

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTS  341
             YG+EFVP++E  YTIIV+K+RK+   DE +  NS+K   AGKVVLT DN +S
Sbjct  488  IYGAEFVPSSEDGYTIIVQKARKLVATDEPVEKNSFKIGEAGKVVLTVDNTSS  540



>ref|XP_008781563.1| PREDICTED: patellin-3-like isoform X2 [Phoenix dactylifera]
Length=546

 Score =   152 bits (385),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 86/113 (76%), Gaps = 0/113 (0%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APEQVPVQYGGLS+E D +FT  D  TE  IKP++K  IE PV EKC LVWE RV+GWDV
Sbjct  416  APEQVPVQYGGLSKEKDPDFTAADAVTEIAIKPSTKQVIEIPVNEKCLLVWELRVLGWDV  475

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTS  341
             +G+EFVP++E  YT+IV+K+RK+  ADE +  NS+K   AGKVVLT DN TS
Sbjct  476  TFGAEFVPSSEDGYTVIVQKARKLVAADEPVEKNSFKIGEAGKVVLTVDNTTS  528



>gb|KDP27342.1| hypothetical protein JCGZ_20274 [Jatropha curcas]
Length=589

 Score =   152 bits (385),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 97/130 (75%), Gaps = 7/130 (5%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDY-----EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARV  515
            +PEQVP+QYGGLS   DY     EFT  DPATE T+KP +K T++  + EKC +VWE RV
Sbjct  458  SPEQVPIQYGGLS--VDYCDCNPEFTVADPATEITVKPGTKQTVQIIIYEKCVIVWEIRV  515

Query  514  IGWDVAYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKR  335
            +GW+V+YG+EFVP A+ AYT+I++K  K+ P DE +I++S+K    GK++LT DN TSK+
Sbjct  516  VGWEVSYGAEFVPEAKDAYTVIIQKPTKLAPTDEPVITSSFKVGELGKILLTVDNSTSKK  575

Query  334  KKLLYRSKTK  305
            KKLLYR K +
Sbjct  576  KKLLYRFKIQ  585



>ref|XP_004146380.1| PREDICTED: patellin-3-like [Cucumis sativus]
 gb|KGN54828.1| Patellin-3 [Cucumis sativus]
Length=568

 Score =   152 bits (384),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 99/127 (78%), Gaps = 5/127 (4%)
 Frame = -2

Query  673  EQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAY  494
            E++PV+YGG+S++G  EF   D  TE T+KP++KHT+E+PVT+ C + WE RV+GWDV Y
Sbjct  443  EELPVKYGGMSKDG--EFEACDSVTEITVKPSAKHTVEYPVTQGCAVTWEVRVVGWDVNY  500

Query  493  GSEFVPAAEGAYTIIVEKSRKIGPADET---IISNSYKTDCAGKVVLTFDNQTSKRKKLL  323
            G+EFVP+ EG+YT+I++K+R++G + +    +ISN++K    GKVVL+ DN TSK+KKLL
Sbjct  501  GAEFVPSGEGSYTVIIDKARRVGSSSQDQQPVISNTFKISEPGKVVLSVDNPTSKKKKLL  560

Query  322  YRSKTKG  302
            YR KTK 
Sbjct  561  YRFKTKS  567



>ref|XP_006654435.1| PREDICTED: patellin-2-like [Oryza brachyantha]
Length=598

 Score =   152 bits (385),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 94/127 (74%), Gaps = 1/127 (1%)
 Frame = -2

Query  676  PEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVA  497
            PEQVPVQ+GGL +E D EF+T D  TE T+KP+SK T+E P TE   +VWE RV+GW+V+
Sbjct  468  PEQVPVQFGGLYKEDDTEFSTSDVVTELTVKPSSKETVEIPATENSIVVWELRVLGWEVS  527

Query  496  YGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKK-LLY  320
            YG+EF P AEG+YT+IV+K+RK+   +E I+  S+K    GK+VLT DN  SK+KK LLY
Sbjct  528  YGAEFTPDAEGSYTVIVQKTRKVPANEEPIMKGSFKVGDTGKIVLTIDNAASKKKKQLLY  587

Query  319  RSKTKGS  299
            R K K S
Sbjct  588  RFKVKSS  594



>ref|XP_010534098.1| PREDICTED: patellin-3-like [Tarenaya hassleriana]
Length=518

 Score =   152 bits (383),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 70/128 (55%), Positives = 96/128 (75%), Gaps = 3/128 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSREG---DYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIG  509
            +PEQVP+QYGGLS +    + +FT  DPATE T+KP +K T+E  + EKC +VWE RV+G
Sbjct  388  SPEQVPIQYGGLSVDSCDCNPDFTMADPATEITVKPGTKQTVEIIIYEKCEMVWEIRVVG  447

Query  508  WDVAYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKK  329
            W+V+Y +EFVP A GAYT++++K RK+ P+DE ++S+ +K    GKV+LT DN T K+KK
Sbjct  448  WEVSYTAEFVPEASGAYTMVIQKPRKMVPSDEPVVSHCFKVTQLGKVLLTVDNATPKKKK  507

Query  328  LLYRSKTK  305
            LLYR K K
Sbjct  508  LLYRFKVK  515



>ref|XP_002265124.2| PREDICTED: patellin-3 [Vitis vinifera]
Length=530

 Score =   151 bits (382),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 70/130 (54%), Positives = 96/130 (74%), Gaps = 7/130 (5%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDY-----EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARV  515
            +PEQVP+QYGGLS   DY     +F   DP TE T+KP++K T+E  V+E+C +VWE RV
Sbjct  399  SPEQVPIQYGGLS--VDYCDCNPDFGIADPVTEITVKPSTKQTVEILVSEQCVIVWEVRV  456

Query  514  IGWDVAYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKR  335
            +GW+VAYG+EF+P AE  YT++V+K+ K+ P D+ ++ NS+K    GK+V+T DN TSK+
Sbjct  457  VGWEVAYGAEFIPDAEDEYTVVVQKATKMAPTDDPVMCNSFKIKELGKIVITIDNPTSKK  516

Query  334  KKLLYRSKTK  305
            KKLLYR K K
Sbjct  517  KKLLYRFKVK  526



>ref|XP_011099658.1| PREDICTED: patellin-3-like [Sesamum indicum]
Length=521

 Score =   151 bits (381),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 93/125 (74%), Gaps = 2/125 (2%)
 Frame = -2

Query  673  EQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAY  494
            EQ+P QYGGLS++GD  F   D  TE  IKP++KH +EFPV + C + WEARV+GW+V Y
Sbjct  397  EQIPTQYGGLSKDGD--FGLADSVTEIIIKPSAKHIVEFPVPQACDVSWEARVVGWEVGY  454

Query  493  GSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRS  314
            G+EFVP+A   YTII++K R+IG ++E +I +SYK    GK+VL  +N +SK+KKLLYR 
Sbjct  455  GAEFVPSAADGYTIIIQKMRRIGTSEEQVICSSYKVGEPGKMVLAINNLSSKKKKLLYRF  514

Query  313  KTKGS  299
            KTK S
Sbjct  515  KTKSS  519



>ref|XP_006466197.1| PREDICTED: patellin-3-like [Citrus sinensis]
Length=594

 Score =   151 bits (382),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 98/126 (78%), Gaps = 3/126 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            A EQ+PV+YGGLS+ G  EF   D  TE T+KP +KHT+EFPVTE+C L WE RV+GW+V
Sbjct  454  AAEQLPVKYGGLSKVG--EFAATDAVTEITVKPAAKHTVEFPVTEECHLTWEVRVVGWEV  511

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGP-ADETIISNSYKTDCAGKVVLTFDNQTSKRKKLL  323
            +YG+EFVP+ EG+YT+I++K++K+   A++ ++ +S+K    GKVVLT DN TSK+KKLL
Sbjct  512  SYGAEFVPSTEGSYTVIIQKAKKLASNAEQPVVCDSFKIVEPGKVVLTIDNPTSKKKKLL  571

Query  322  YRSKTK  305
            YR + K
Sbjct  572  YRYRLK  577



>ref|XP_006473246.1| PREDICTED: patellin-3-like [Citrus sinensis]
Length=538

 Score =   151 bits (381),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 94/130 (72%), Gaps = 7/130 (5%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDY-----EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARV  515
            +PE VP+QYGGLS   DY     EFT  DPATE T+KP +K  +E  + EKCT+VWE RV
Sbjct  409  SPEHVPIQYGGLS--VDYCDCNPEFTIDDPATEITVKPATKQNVEIIIYEKCTVVWEIRV  466

Query  514  IGWDVAYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKR  335
            +GW+V+YG+EFVP A+  YTII++K  K+ PADE ++   +K D  GK++LT DN TSK+
Sbjct  467  VGWEVSYGAEFVPEAKDKYTIIIQKPTKLSPADEPVVCQRFKVDELGKILLTVDNPTSKK  526

Query  334  KKLLYRSKTK  305
            KKLLYR K +
Sbjct  527  KKLLYRFKVE  536



>ref|XP_009105873.1| PREDICTED: patellin-1-like [Brassica rapa]
Length=558

 Score =   151 bits (381),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 94/125 (75%), Gaps = 2/125 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            +PEQVPV+YGGLS+  D   T GD  TE  +KP +K+TIE P +E CTL WE RV+G DV
Sbjct  431  SPEQVPVKYGGLSK--DIPLTNGDTVTEAIVKPAAKYTIELPASEACTLSWELRVLGADV  488

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
            +YG++F P  EG+Y +IV K+RKIG  DE +I++S+K    GK+V+T DNQTSK+KK+LY
Sbjct  489  SYGAQFEPTTEGSYVVIVSKNRKIGLTDEPVITDSFKVGEPGKIVITIDNQTSKKKKVLY  548

Query  319  RSKTK  305
            R KT+
Sbjct  549  RFKTQ  553



>ref|XP_010930773.1| PREDICTED: patellin-3-like [Elaeis guineensis]
Length=486

 Score =   150 bits (379),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 83/113 (73%), Gaps = 0/113 (0%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APEQVPVQYGGLS+E D EFT  D  TE TIKP  K  IE P+ EKC LVWE RV+GWDV
Sbjct  356  APEQVPVQYGGLSKENDPEFTAADAVTEITIKPLMKQLIEIPLNEKCLLVWELRVLGWDV  415

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTS  341
             +G+EFVP++E  YT+IV+K+RK+   DE +  N +K   AGKVVLT DN TS
Sbjct  416  TFGAEFVPSSEDGYTVIVQKARKLVATDEPVEKNRFKIGEAGKVVLTVDNTTS  468



>emb|CAN80423.1| hypothetical protein VITISV_013162 [Vitis vinifera]
Length=591

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 96/129 (74%), Gaps = 7/129 (5%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDY-----EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARV  515
            +PEQVP+QYGGLS   DY     +F   DP TE T+KP++K T+E  V+E+C +VWE RV
Sbjct  399  SPEQVPIQYGGLS--VDYCDCNPDFGIADPVTEITVKPSTKQTVEILVSEQCVIVWEVRV  456

Query  514  IGWDVAYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKR  335
            +GW+VAYG+EF+P AE  YT++V+K+ K+ P D+ ++ NS+K    GK+V+T DN TSK+
Sbjct  457  VGWEVAYGAEFIPDAEDEYTVVVQKATKMAPTDDPVMCNSFKIKELGKIVITIDNPTSKK  516

Query  334  KKLLYRSKT  308
            KKLLYR KT
Sbjct  517  KKLLYRFKT  525



>ref|XP_009402649.1| PREDICTED: patellin-3-like [Musa acuminata subsp. malaccensis]
Length=580

 Score =   150 bits (380),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 93/127 (73%), Gaps = 0/127 (0%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APEQVPV +GGLS+E D +F+T D  T+ +IKP+SK TIE P TE C +VWE RV+G +V
Sbjct  450  APEQVPVAFGGLSKEKDPDFSTADVVTDVSIKPSSKQTIEIPATETCLIVWELRVLGCEV  509

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
            +YG+EF P+AE  YT+IV+K+RK+   DE +I  S+K    GKVVL  +N TSK+K LLY
Sbjct  510  SYGAEFTPSAEDGYTVIVQKNRKLAADDEPVIKGSFKNGEPGKVVLNVENLTSKKKLLLY  569

Query  319  RSKTKGS  299
            R K K S
Sbjct  570  RYKVKSS  576



>emb|CBI39340.3| unnamed protein product [Vitis vinifera]
Length=470

 Score =   150 bits (378),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 95/126 (75%), Gaps = 3/126 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSRE---GDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIG  509
            +PEQVP+QYGGLS +    + +F   DP TE T+KP++K T+E  V+E+C +VWE RV+G
Sbjct  287  SPEQVPIQYGGLSVDYCDCNPDFGIADPVTEITVKPSTKQTVEILVSEQCVIVWEVRVVG  346

Query  508  WDVAYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKK  329
            W+VAYG+EF+P AE  YT++V+K+ K+ P D+ ++ NS+K    GK+V+T DN TSK+KK
Sbjct  347  WEVAYGAEFIPDAEDEYTVVVQKATKMAPTDDPVMCNSFKIKELGKIVITIDNPTSKKKK  406

Query  328  LLYRSK  311
            LLYR K
Sbjct  407  LLYRFK  412



>ref|XP_002521798.1| Patellin-5, putative [Ricinus communis]
 gb|EEF40608.1| Patellin-5, putative [Ricinus communis]
Length=587

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 93/126 (74%), Gaps = 7/126 (6%)
 Frame = -2

Query  673  EQVPVQYGGLSREGDY-----EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIG  509
            EQVP+QYGGLS   DY     EFT  DPATE T+KP +K T+E  + EKC +VWE RV+G
Sbjct  458  EQVPIQYGGLS--VDYCDCNPEFTVADPATEITVKPATKQTVEIIIYEKCVIVWELRVVG  515

Query  508  WDVAYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKK  329
            WDV+YG+EF P A+ AYT+I++K  K+ P DE +I++S+K    GK++LT DN TSK+KK
Sbjct  516  WDVSYGAEFAPDAKDAYTVIIQKPTKLSPTDEPVITSSFKVGELGKILLTVDNPTSKKKK  575

Query  328  LLYRSK  311
            LLYR K
Sbjct  576  LLYRFK  581



>ref|XP_006376221.1| hypothetical protein POPTR_0013s11060g [Populus trichocarpa]
 gb|ERP54018.1| hypothetical protein POPTR_0013s11060g [Populus trichocarpa]
Length=499

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/126 (56%), Positives = 93/126 (74%), Gaps = 3/126 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSRE---GDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIG  509
            +PEQVP+QYGGL  +    + EFT  DPAT+ T+KP +K T+E  + EKC LVWE RV+G
Sbjct  368  SPEQVPIQYGGLCVDFCDCNPEFTIADPATDITVKPATKQTVEIIIYEKCILVWELRVVG  427

Query  508  WDVAYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKK  329
            W+V+Y +EF+P A+ AYTII+ K  K+ P DE ++SNS+K    GK++LT DN TSK+KK
Sbjct  428  WEVSYSAEFMPEAKDAYTIIITKPTKMSPTDEPVVSNSFKVGELGKILLTVDNPTSKKKK  487

Query  328  LLYRSK  311
            LLYR K
Sbjct  488  LLYRFK  493



>ref|XP_006416189.1| hypothetical protein EUTSA_v10007015mg [Eutrema salsugineum]
 gb|ESQ34542.1| hypothetical protein EUTSA_v10007015mg [Eutrema salsugineum]
Length=660

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 93/126 (74%), Gaps = 2/126 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APE VPV+YGGLS+E    FT  D  TE  +K ++KHTIE P TE CTL WE RV+G DV
Sbjct  537  APEVVPVKYGGLSKESP--FTVEDGVTEVVVKSSAKHTIELPATEACTLSWELRVLGVDV  594

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
            +YG++F P  E +YT+IV K+RKIG  DE +I++S+K    GK+V+T DNQT K+KKLLY
Sbjct  595  SYGAQFEPTNEASYTVIVSKNRKIGLTDEPVITDSFKASEPGKIVITIDNQTFKKKKLLY  654

Query  319  RSKTKG  302
            R KT+G
Sbjct  655  RFKTQG  660



>ref|XP_009379323.1| PREDICTED: LOW QUALITY PROTEIN: patellin-3-like [Pyrus x bretschneideri]
Length=516

 Score =   149 bits (376),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 71/128 (55%), Positives = 92/128 (72%), Gaps = 7/128 (5%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDY-----EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARV  515
            +PE VP+QYGGLS   DY     EFT  DP  + TIKP +K T+E  + EKCT+VWE RV
Sbjct  386  SPEHVPIQYGGLS--VDYCDCNPEFTIADPVADVTIKPATKQTVEIIIYEKCTIVWELRV  443

Query  514  IGWDVAYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKR  335
            +GW+V+ G+EFVP AE  YTII++K+ K  P DE ++SNS+K D  GK++L  DN TSK+
Sbjct  444  VGWEVSCGAEFVPEAENGYTIIIQKATKTSPTDEPVVSNSFKVDELGKILLKIDNPTSKK  503

Query  334  KKLLYRSK  311
            K+LLYR K
Sbjct  504  KRLLYRFK  511



>ref|XP_008368135.1| PREDICTED: patellin-3-like [Malus domestica]
Length=534

 Score =   149 bits (376),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 94/133 (71%), Gaps = 7/133 (5%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDY-----EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARV  515
            +PE VP+QYGGLS   DY     EFT  DP  + T+KP +K T+E  + EKCT+VWE RV
Sbjct  403  SPEHVPIQYGGLS--VDYCDCNPEFTIEDPVADVTVKPATKQTVEIIIYEKCTIVWELRV  460

Query  514  IGWDVAYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKR  335
            +GW+V+YG+EFVP AE  YTIIV+K+ K+ P DE ++SNS+K    GK++L  DN T K+
Sbjct  461  VGWEVSYGAEFVPNAENGYTIIVQKATKMSPTDEPVVSNSFKVTELGKILLKIDNPTPKK  520

Query  334  KKLLYRSKTKGSD  296
            K+LLYR K +  D
Sbjct  521  KRLLYRFKIEPLD  533



>emb|CDX96377.1| BnaA07g29880D [Brassica napus]
Length=556

 Score =   149 bits (377),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 94/125 (75%), Gaps = 2/125 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            +PEQVPV+YGGLS+  D   T GD  TE  +KP +K+TIE P +E CTL WE RV+G DV
Sbjct  429  SPEQVPVKYGGLSK--DIPSTNGDTVTEAIVKPAAKYTIELPASEACTLSWELRVLGADV  486

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
            +YG++F P  EG+Y +IV K+RKIG  DE +I++S+K    GK+V+T DNQTSK+KK+LY
Sbjct  487  SYGAQFEPTTEGSYVVIVSKNRKIGLTDEPVITDSFKVGEPGKIVITIDNQTSKKKKVLY  546

Query  319  RSKTK  305
            R KT+
Sbjct  547  RFKTQ  551



>ref|XP_006434671.1| hypothetical protein CICLE_v10000804mg [Citrus clementina]
 gb|ESR47911.1| hypothetical protein CICLE_v10000804mg [Citrus clementina]
Length=538

 Score =   149 bits (376),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 71/130 (55%), Positives = 93/130 (72%), Gaps = 7/130 (5%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDY-----EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARV  515
            +PE VP+QYGGLS   DY     EFT  DPATE T+KP +K  +E  + EKCT+VWE RV
Sbjct  409  SPEHVPIQYGGLS--VDYCDCNPEFTIDDPATEITVKPATKQNVEIIIYEKCTVVWEIRV  466

Query  514  IGWDVAYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKR  335
            +GW+V+YG+EFVP A+  YTII++K  K+ P DE ++   +K D  GK++LT DN TSK+
Sbjct  467  VGWEVSYGAEFVPEAKDKYTIIIQKPTKLSPTDEPVVCQRFKVDELGKILLTVDNPTSKK  526

Query  334  KKLLYRSKTK  305
            KKLLYR K +
Sbjct  527  KKLLYRFKVE  536



>gb|KDO84003.1| hypothetical protein CISIN_1g009270mg [Citrus sinensis]
Length=538

 Score =   149 bits (376),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 71/130 (55%), Positives = 93/130 (72%), Gaps = 7/130 (5%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDY-----EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARV  515
            +PE VP+QYGGLS   DY     EFT  DPATE T+KP +K  +E  + EKCT+VWE RV
Sbjct  409  SPEHVPIQYGGLS--VDYCDCNPEFTIDDPATEITVKPATKQNVEIIIYEKCTVVWEIRV  466

Query  514  IGWDVAYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKR  335
            +GW+V+YG+EFVP A+  YTII++K  K+ P DE ++   +K D  GK++LT DN TSK+
Sbjct  467  VGWEVSYGAEFVPEAKDKYTIIIQKPTKLSPTDEPVVCQRFKVDELGKILLTVDNPTSKK  526

Query  334  KKLLYRSKTK  305
            KKLLYR K +
Sbjct  527  KKLLYRFKVE  536



>ref|XP_011015061.1| PREDICTED: patellin-3-like [Populus euphratica]
Length=606

 Score =   149 bits (376),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 88/110 (80%), Gaps = 2/110 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            A EQ+PV+YGGLS++G  EF T D  TE T+KP++KHT+EFPVTE C L WE RV+GWDV
Sbjct  480  AAEQIPVKYGGLSKDG--EFGTADAVTEITVKPSAKHTVEFPVTETCLLTWEMRVVGWDV  537

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDN  350
            +YG+EFVP+AE +YT+I++K+RK+   +E ++SNS+K    GKVVLT DN
Sbjct  538  SYGAEFVPSAEDSYTVIIQKARKVATTEEPVVSNSFKVGEPGKVVLTIDN  587



>ref|XP_011001253.1| PREDICTED: patellin-3-like [Populus euphratica]
Length=606

 Score =   149 bits (376),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 88/110 (80%), Gaps = 2/110 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            A EQ+PV+YGGLS++G  EF T D  TE T+KP++KHT+EFPVTE C L WE RV+GWDV
Sbjct  480  AAEQIPVKYGGLSKDG--EFGTADAVTEITVKPSAKHTVEFPVTETCLLTWEMRVVGWDV  537

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDN  350
            +YG+EFVP+AE +YT+I++K+RK+   +E ++SNS+K    GKVVLT DN
Sbjct  538  SYGAEFVPSAEDSYTVIIQKARKVATTEEPVVSNSFKVGEPGKVVLTIDN  587



>ref|XP_006306912.1| hypothetical protein CARUB_v10008471mg [Capsella rubella]
 gb|EOA39810.1| hypothetical protein CARUB_v10008471mg [Capsella rubella]
Length=694

 Score =   150 bits (378),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 94/126 (75%), Gaps = 2/126 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APE VPV YGGLS+  D  FT  D  TE  +KPTSK+TI+ P TE  TL WE RV+G DV
Sbjct  571  APEVVPVMYGGLSK--DSPFTVEDGVTEAVVKPTSKYTIDLPATEGSTLSWELRVLGADV  628

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
            +YG++F P+ E +YT+IV K+RKIG  DE +I++S+K    GKVV+T DNQTSK+KK+LY
Sbjct  629  SYGAQFEPSNEASYTVIVTKNRKIGLTDEPVITDSFKASEPGKVVITIDNQTSKKKKVLY  688

Query  319  RSKTKG  302
            RSKT+ 
Sbjct  689  RSKTQA  694



>ref|XP_009362429.1| PREDICTED: patellin-3-like [Pyrus x bretschneideri]
Length=527

 Score =   149 bits (375),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 94/133 (71%), Gaps = 7/133 (5%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDY-----EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARV  515
            +PE VP+QYGGLS   DY     EFT  DP  + T+KP +K T+E  + EKCT+VWE RV
Sbjct  396  SPEHVPIQYGGLS--VDYCDCNPEFTIEDPVADVTVKPATKQTVEIIIYEKCTIVWELRV  453

Query  514  IGWDVAYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKR  335
            +GW+V+YG+EFVP AE  YTII++K+ K+ P DE ++SNS+K    GK++L  DN T K+
Sbjct  454  VGWEVSYGAEFVPEAENGYTIIIQKATKMSPIDEPVVSNSFKVTELGKILLKIDNPTPKK  513

Query  334  KKLLYRSKTKGSD  296
            K+LLYR K +  D
Sbjct  514  KRLLYRFKIEPLD  526



>ref|XP_011003950.1| PREDICTED: patellin-3 [Populus euphratica]
Length=566

 Score =   149 bits (375),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 69/126 (55%), Positives = 93/126 (74%), Gaps = 3/126 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSRE---GDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIG  509
            +PEQVP+QYGGLS +    + EFT  DPAT+ T+KP +K T+E  + EKC LVWE RV+G
Sbjct  435  SPEQVPIQYGGLSVDFCDCNPEFTIADPATDITVKPATKQTVEIIIYEKCILVWELRVVG  494

Query  508  WDVAYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKK  329
            W+V+Y +EF+P ++ AY II+ K  K+ P DE ++SNS+K    GK++LT DN TSK+KK
Sbjct  495  WEVSYSAEFMPESKDAYAIIITKPTKMSPTDEPVVSNSFKVGELGKILLTVDNPTSKKKK  554

Query  328  LLYRSK  311
            LLYR K
Sbjct  555  LLYRFK  560



>ref|NP_001276245.1| patellin-3-like [Glycine max]
 gb|ACU22967.1| unknown [Glycine max]
Length=424

 Score =   147 bits (371),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 69/128 (54%), Positives = 93/128 (73%), Gaps = 3/128 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSRE---GDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIG  509
            +PEQVPVQYGGLS +    + +FT  DP TE  IKPT+K T+E  + EKC +VWE RV+G
Sbjct  293  SPEQVPVQYGGLSVDFCDCNPDFTMSDPVTEIPIKPTTKQTVEIAIYEKCIIVWELRVVG  352

Query  508  WDVAYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKK  329
            W+V+Y +EF P  E AYT+I++K+ K+ P DE ++SNS+K    GK++LT DN T K+K+
Sbjct  353  WEVSYNAEFKPDVEDAYTVIIQKATKMSPTDEPVVSNSFKVVELGKLLLTIDNPTLKKKR  412

Query  328  LLYRSKTK  305
            LLYR K K
Sbjct  413  LLYRFKIK  420



>ref|XP_011031504.1| PREDICTED: patellin-3 [Populus euphratica]
 ref|XP_011031505.1| PREDICTED: patellin-3 [Populus euphratica]
Length=589

 Score =   149 bits (375),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 70/126 (56%), Positives = 94/126 (75%), Gaps = 3/126 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSRE---GDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIG  509
            +PEQVP+QYGGLS +    + EFT  DPATE T+KP +K T+E  + EKC +VWE RV+G
Sbjct  458  SPEQVPIQYGGLSVDFCDCNPEFTIADPATEITVKPATKQTVEIIIYEKCFIVWELRVVG  517

Query  508  WDVAYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKK  329
            W+V+Y +EFVP ++ AYTII+ K  K+ P +E ++SNS+K    GK++LT DN TSK+KK
Sbjct  518  WEVSYSAEFVPDSKDAYTIIITKPTKMTPTNEPVVSNSFKVGELGKILLTVDNSTSKKKK  577

Query  328  LLYRSK  311
            LLYR K
Sbjct  578  LLYRFK  583



>ref|XP_007131298.1| hypothetical protein PHAVU_011G002200g [Phaseolus vulgaris]
 gb|ESW03292.1| hypothetical protein PHAVU_011G002200g [Phaseolus vulgaris]
Length=478

 Score =   147 bits (372),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 68/128 (53%), Positives = 95/128 (74%), Gaps = 3/128 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSRE---GDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIG  509
            +PEQVPVQYGGLS +    + +FTT DP TE +IKPT+K T+E  + EKC +VWE RV+G
Sbjct  347  SPEQVPVQYGGLSVDFCDCNPDFTTSDPVTELSIKPTTKQTVEIAIYEKCIIVWELRVVG  406

Query  508  WDVAYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKK  329
            W+V+Y +EF P A+ AYT++++K+ K+ P DE ++SNS+K    GK++LT DN T K+K+
Sbjct  407  WEVSYNAEFKPDAKDAYTVVIQKATKMSPTDEPVVSNSFKVGELGKLLLTIDNPTLKKKR  466

Query  328  LLYRSKTK  305
            LLYR   K
Sbjct  467  LLYRFMIK  474



>ref|XP_010543667.1| PREDICTED: patellin-5-like [Tarenaya hassleriana]
Length=423

 Score =   147 bits (370),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 70/128 (55%), Positives = 93/128 (73%), Gaps = 3/128 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSREG---DYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIG  509
            +PEQVP+QYGGLS +      EFT  D ATE TIKPT+K T+E  + EKCT+VWE RV+G
Sbjct  292  SPEQVPIQYGGLSVDNCDCGSEFTRDDTATEITIKPTTKQTVEIIIYEKCTIVWELRVVG  351

Query  508  WDVAYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKK  329
            W+V YG+EF+P    AYT+I++K RK+   DE ++S S+K    GK++LT DN T+K+KK
Sbjct  352  WEVTYGAEFLPENREAYTVIIQKPRKMSSEDEPVVSQSFKVGELGKILLTIDNPTAKKKK  411

Query  328  LLYRSKTK  305
            L+YR K K
Sbjct  412  LVYRFKVK  419



>ref|XP_007024015.1| Patellin 1, putative [Theobroma cacao]
 gb|EOY26637.1| Patellin 1, putative [Theobroma cacao]
Length=190

 Score =   141 bits (355),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 86/113 (76%), Gaps = 2/113 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            A EQVPV+YGGLS++G  EF   D  TE T+KP+ KHTIEFPVTE C L W+ RV+GWDV
Sbjct  64   AAEQVPVKYGGLSKDG--EFANTDAVTEITVKPSVKHTIEFPVTETCLLTWQVRVVGWDV  121

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTS  341
            +YG+EF+P+AE +YT+I+ K+RK+   +E ++ N++K    GKV+LT DN TS
Sbjct  122  SYGAEFIPSAEDSYTVIIRKARKVASTEEPVVCNNFKIGEPGKVILTSDNPTS  174



>emb|CDX68278.1| BnaA07g23180D [Brassica napus]
Length=439

 Score =   147 bits (370),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 69/128 (54%), Positives = 96/128 (75%), Gaps = 3/128 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSREG---DYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIG  509
            +PEQVPVQYGGLS +    + +F+  DPA+E T+KP +K T+E  + EKC +VWE RVIG
Sbjct  310  SPEQVPVQYGGLSVDPCDCNPDFSLDDPASEVTVKPGTKQTVEIIIYEKCEIVWEIRVIG  369

Query  508  WDVAYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKK  329
            W+V+Y +EFVP  + AYT++V+K RK+ PADE +++ S+K +  GKV+LT DN TSK+KK
Sbjct  370  WEVSYKAEFVPEEKDAYTVVVQKPRKMKPADEPVLTQSFKVNELGKVLLTVDNPTSKKKK  429

Query  328  LLYRSKTK  305
            L+YR   K
Sbjct  430  LVYRFNVK  437



>ref|NP_001131001.1| uncharacterized protein LOC100192106 [Zea mays]
 gb|ACF79422.1| unknown [Zea mays]
 gb|ACL54628.1| unknown [Zea mays]
 gb|AFW78093.1| putative patellin family protein [Zea mays]
Length=620

 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 93/127 (73%), Gaps = 0/127 (0%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APEQVPVQ+GGL +E D EF+T D  TE T+KP+SK T+E P TE  T+VWE RV+GW+V
Sbjct  492  APEQVPVQFGGLYKEDDTEFSTSDAVTELTVKPSSKETVEIPATENSTVVWELRVLGWEV  551

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
            +YG+EF P AEG YT+IV+K+RK+   +E I+  S+K    GK+VL  +N  S++KKLL 
Sbjct  552  SYGAEFTPDAEGGYTVIVQKTRKVPAHEEPIMKGSFKATEPGKLVLGVNNPASRKKKLLC  611

Query  319  RSKTKGS  299
            R K + +
Sbjct  612  RFKVRSA  618



>ref|XP_004299815.1| PREDICTED: patellin-3 [Fragaria vesca subsp. vesca]
Length=542

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/128 (53%), Positives = 94/128 (73%), Gaps = 3/128 (2%)
 Frame = -2

Query  673  EQVPVQYGGLSR---EGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWD  503
            E VP+QYGGLS    E + EFT  DP  E TIKP +K T+E  + EKCT+VWE RV+GW+
Sbjct  414  EHVPIQYGGLSVDYCECNPEFTIADPVAEVTIKPGTKKTVEIIIYEKCTIVWELRVVGWE  473

Query  502  VAYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLL  323
            V+YG+EFVP ++GAYT+I++K+ K+ P DE ++ + +K    GK++LT DN TSK+K+LL
Sbjct  474  VSYGAEFVPDSQGAYTLIIQKATKMNPTDEPVLHHRFKVSELGKILLTIDNPTSKKKRLL  533

Query  322  YRSKTKGS  299
            YR K + S
Sbjct  534  YRFKIEPS  541



>ref|XP_006390694.1| hypothetical protein EUTSA_v10018354mg [Eutrema salsugineum]
 gb|ESQ27980.1| hypothetical protein EUTSA_v10018354mg [Eutrema salsugineum]
Length=561

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 94/125 (75%), Gaps = 2/125 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APEQVPV+YGGLS+  D   TT D  TE  +KP +++TI+ P +E CTL WE RV+G DV
Sbjct  434  APEQVPVKYGGLSK--DVPLTTEDTVTEAIVKPAAQYTIDLPASEACTLSWELRVLGADV  491

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
            +YG++F P  EG+Y +IV K+RKIG  DE +I++S+K    GK+V+T DNQTSK+KK+LY
Sbjct  492  SYGAQFEPTTEGSYAVIVSKNRKIGLTDEPVITDSFKVGEPGKIVITIDNQTSKKKKVLY  551

Query  319  RSKTK  305
            R KT+
Sbjct  552  RFKTQ  556



>ref|XP_007020120.1| Sec14p-like phosphatidylinositol transfer family protein isoform 
1 [Theobroma cacao]
 ref|XP_007020121.1| Sec14p-like phosphatidylinositol transfer family protein isoform 
1 [Theobroma cacao]
 ref|XP_007020122.1| Sec14p-like phosphatidylinositol transfer family protein isoform 
1 [Theobroma cacao]
 ref|XP_007020123.1| Sec14p-like phosphatidylinositol transfer family protein isoform 
1 [Theobroma cacao]
 ref|XP_007020124.1| Sec14p-like phosphatidylinositol transfer family protein isoform 
1 [Theobroma cacao]
 ref|XP_007020125.1| Sec14p-like phosphatidylinositol transfer family protein isoform 
1 [Theobroma cacao]
 ref|XP_007020126.1| Sec14p-like phosphatidylinositol transfer family protein isoform 
1 [Theobroma cacao]
 gb|EOY17345.1| Sec14p-like phosphatidylinositol transfer family protein isoform 
1 [Theobroma cacao]
 gb|EOY17346.1| Sec14p-like phosphatidylinositol transfer family protein isoform 
1 [Theobroma cacao]
 gb|EOY17347.1| Sec14p-like phosphatidylinositol transfer family protein isoform 
1 [Theobroma cacao]
 gb|EOY17348.1| Sec14p-like phosphatidylinositol transfer family protein isoform 
1 [Theobroma cacao]
 gb|EOY17349.1| Sec14p-like phosphatidylinositol transfer family protein isoform 
1 [Theobroma cacao]
 gb|EOY17350.1| Sec14p-like phosphatidylinositol transfer family protein isoform 
1 [Theobroma cacao]
 gb|EOY17351.1| Sec14p-like phosphatidylinositol transfer family protein isoform 
1 [Theobroma cacao]
Length=611

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 94/130 (72%), Gaps = 7/130 (5%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDY-----EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARV  515
            APEQVP+QYGGLS   DY     EF   DPATE T+KP +K T+E  + EKC LVWE RV
Sbjct  477  APEQVPIQYGGLS--VDYCDCNPEFGDADPATEITVKPGTKQTVEITIYEKCDLVWEIRV  534

Query  514  IGWDVAYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKR  335
            +GW+V+YG+EF+P A+ +YT+I++K  K+ P DE ++S  +K    GKV+LT DN TSK+
Sbjct  535  VGWEVSYGAEFMPNAKDSYTVIIQKPTKMSPKDEPVVSQCFKVGELGKVLLTVDNPTSKK  594

Query  334  KKLLYRSKTK  305
            KKL+YR K K
Sbjct  595  KKLVYRFKVK  604



>ref|XP_002325536.2| hypothetical protein POPTR_0019s10810g [Populus trichocarpa]
 gb|EEE99917.2| hypothetical protein POPTR_0019s10810g [Populus trichocarpa]
Length=531

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/126 (56%), Positives = 94/126 (75%), Gaps = 3/126 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSRE---GDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIG  509
            +PEQVP+QYGGLS +    + EFT  DPATE T+KP +K T+E  + EKC +VWE RV+G
Sbjct  400  SPEQVPIQYGGLSVDFCDCNPEFTFADPATEITVKPATKQTVEIIIYEKCFIVWELRVVG  459

Query  508  WDVAYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKK  329
            W+V+Y +EFVP ++ AYTII+ K  K+ P +E ++SNS+K    GK++LT DN TSK+KK
Sbjct  460  WEVSYSAEFVPDSKDAYTIIMTKPTKMTPTNEPVVSNSFKVGELGKILLTVDNSTSKKKK  519

Query  328  LLYRSK  311
            LLYR K
Sbjct  520  LLYRFK  525



>ref|XP_004503864.1| PREDICTED: patellin-5-like [Cicer arietinum]
Length=557

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 89/113 (79%), Gaps = 2/113 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APEQ+PV+YGGLS++G  EF   D  TE TI+P +KHT+EFPVTEKC L WE RVIGW+V
Sbjct  430  APEQLPVKYGGLSKDG--EFGDSDAVTEITIRPAAKHTVEFPVTEKCLLSWEVRVIGWEV  487

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTS  341
            +YG+EFVP+ EG+YT+I++K+R +  ++E +I N++K    GKVVLT DN +S
Sbjct  488  SYGAEFVPSTEGSYTVIIQKARNVASSEEPVICNNFKIGEPGKVVLTIDNTSS  540



>emb|CDY50441.1| BnaC06g24230D [Brassica napus]
Length=485

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/128 (54%), Positives = 96/128 (75%), Gaps = 3/128 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSREG---DYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIG  509
            +PEQVPVQYGGLS +    + +F+  DPA+E T+KP +K T+E  + EKC +VWE RVIG
Sbjct  356  SPEQVPVQYGGLSVDPCDCNPDFSLDDPASEVTVKPGTKQTVEIIIYEKCEIVWEIRVIG  415

Query  508  WDVAYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKK  329
            W+V+Y +EFVP  + AYT++V+K RK+ PADE +++ S+K +  GKV+LT DN TSK+KK
Sbjct  416  WEVSYKAEFVPEEKDAYTVVVQKPRKMKPADEPVLTQSFKVNELGKVLLTVDNPTSKKKK  475

Query  328  LLYRSKTK  305
            L+YR   K
Sbjct  476  LVYRFNVK  483



>gb|EYU22783.1| hypothetical protein MIMGU_mgv1a004079mg [Erythranthe guttata]
Length=545

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/126 (56%), Positives = 93/126 (74%), Gaps = 5/126 (4%)
 Frame = -2

Query  679  APEQVPVQYGGLSR---EGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIG  509
            APEQVP QYGGLS    E + EFT  DP TE T+KP +K  +E  V EKCTLVWE RV+G
Sbjct  416  APEQVPTQYGGLSVDFCECNPEFTVDDPVTEITVKPATKQIVEIIVNEKCTLVWELRVVG  475

Query  508  WDVAYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKK  329
            W+V+Y +E+VP     YT+I+EK+RK+ P+DE +ISN++  +  GK++LT +N T+K+KK
Sbjct  476  WEVSYSAEYVP--NSGYTVIIEKTRKLLPSDEPVISNNFNINELGKILLTINNPTAKKKK  533

Query  328  LLYRSK  311
            LLYR K
Sbjct  534  LLYRFK  539



>ref|XP_009104870.1| PREDICTED: patellin-3-like [Brassica rapa]
Length=504

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/128 (54%), Positives = 96/128 (75%), Gaps = 3/128 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSREG---DYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIG  509
            +PEQVPVQYGGLS +    + +F+  DPA+E T+KP +K T+E  + EKC +VWE RVIG
Sbjct  375  SPEQVPVQYGGLSVDPCDCNPDFSLDDPASEVTVKPGTKQTVEIIIYEKCEIVWEIRVIG  434

Query  508  WDVAYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKK  329
            W+V+Y +EFVP  + AYT++V+K RK+ PADE +++ S+K +  GKV+LT DN TSK+KK
Sbjct  435  WEVSYKAEFVPEEKDAYTVVVQKPRKMKPADEPVLTQSFKVNELGKVLLTVDNPTSKKKK  494

Query  328  LLYRSKTK  305
            L+YR   K
Sbjct  495  LVYRFNVK  502



>ref|XP_002525405.1| Patellin-3, putative [Ricinus communis]
 gb|EEF36972.1| Patellin-3, putative [Ricinus communis]
Length=606

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 87/113 (77%), Gaps = 2/113 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            A EQ+PV+YGGLS++G  EF T D  TE TIKP  KHT+EFPV+E C L WE RV+GWDV
Sbjct  480  AAEQIPVKYGGLSKDG--EFGTTDTVTEITIKPAGKHTVEFPVSEACLLTWEVRVVGWDV  537

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTS  341
             YG+EFVP+AE +YT+I++K+RKIG  +E ++ NS+K    GK+VLT DN TS
Sbjct  538  NYGAEFVPSAEQSYTVIIQKARKIGVTEEPVVCNSFKIGEPGKIVLTIDNPTS  590



>ref|XP_008807685.1| PREDICTED: patellin-3-like [Phoenix dactylifera]
Length=559

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 84/112 (75%), Gaps = 0/112 (0%)
 Frame = -2

Query  676  PEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVA  497
            PEQVP+QYGGLS E D +FT  D  TE TIKP++K  +E PVTEKC LVWE RV+GWDV 
Sbjct  430  PEQVPLQYGGLSTEKDTDFTAADAVTEITIKPSTKQVVEIPVTEKCLLVWELRVLGWDVT  489

Query  496  YGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTS  341
            YG+EFVP +E  YTIIV+K+RK+   DE +  NS+K   AG+VVLT +N TS
Sbjct  490  YGAEFVPTSEDGYTIIVQKARKLVATDEPMEKNSFKIGEAGEVVLTVNNTTS  541



>ref|XP_010535265.1| PREDICTED: patellin-1-like [Tarenaya hassleriana]
Length=615

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/127 (54%), Positives = 97/127 (76%), Gaps = 2/127 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYE--FTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGW  506
            APEQVPV+YGGLS+E   E  F T +  TE  +KP +K++I+ P +E CT+ WE RV+G 
Sbjct  485  APEQVPVKYGGLSKESHSESLFATEETVTEAIVKPAAKYSIDLPASEACTISWELRVLGS  544

Query  505  DVAYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKL  326
            DV+YG++F P+ EG+YT+IV K+RK+G  DE ++++++K    GKVV+T DNQ+SK+KKL
Sbjct  545  DVSYGAQFEPSTEGSYTVIVSKNRKMGLTDEPVMTDAFKVGEPGKVVITIDNQSSKKKKL  604

Query  325  LYRSKTK  305
            LYR KT+
Sbjct  605  LYRFKTQ  611



>gb|KHG01147.1| Patellin-3 -like protein [Gossypium arboreum]
 gb|KHG12050.1| Patellin-3 -like protein [Gossypium arboreum]
Length=598

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 93/129 (72%), Gaps = 7/129 (5%)
 Frame = -2

Query  676  PEQVPVQYGGLSREGDY-----EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVI  512
            PEQVP+QYGGLS   DY     EF+  DPATE T+KP +K T+E  + EKC LVWE RV+
Sbjct  468  PEQVPIQYGGLSV--DYCDCNPEFSDADPATEMTVKPGTKQTVEITIFEKCILVWEIRVV  525

Query  511  GWDVAYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRK  332
            GW+V+YG+EFVP A+ +Y +I++K  K+   DE ++S S+K    GKV+LT DN TSK+K
Sbjct  526  GWEVSYGAEFVPDAKDSYAVIIQKPTKMTAKDEPVVSQSFKVGELGKVLLTVDNPTSKKK  585

Query  331  KLLYRSKTK  305
            KLLYR K K
Sbjct  586  KLLYRFKVK  594



>ref|XP_011011644.1| PREDICTED: patellin-3-like [Populus euphratica]
Length=608

 Score =   147 bits (371),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 87/113 (77%), Gaps = 2/113 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            A EQ+PV+YGGLS++G  EF + D  TE T+KP +KHT+EFPVTE C L WE RV GWDV
Sbjct  480  AAEQIPVKYGGLSKDG--EFGSADAVTEITVKPAAKHTVEFPVTETCLLTWEVRVAGWDV  537

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTS  341
            +YG+EFVP+AE +YT+I++K+RK+   +E ++ NS+K    GKVVLT DN TS
Sbjct  538  SYGAEFVPSAEDSYTVIIQKARKVAATEEPVVCNSFKIGEPGKVVLTIDNSTS  590



>ref|XP_011096149.1| PREDICTED: patellin-3 [Sesamum indicum]
Length=552

 Score =   147 bits (370),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 72/131 (55%), Positives = 95/131 (73%), Gaps = 8/131 (6%)
 Frame = -2

Query  679  APEQVPVQYGGLSR---EGDYEFTTGDPATEDTIKPTSKHTIEFPVTE-----KCTLVWE  524
            +PEQVP QYGGLS    E + EFT  DPATE TIKP +K T+E  V E     KCTLVWE
Sbjct  416  SPEQVPTQYGGLSVDFCECNPEFTVDDPATEITIKPATKQTVEIIVNELCENEKCTLVWE  475

Query  523  ARVIGWDVAYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQT  344
             RV+GW+V+Y +E+VP AE  YT+I++K+RK+ P DE ++S+S+     GK++LT DN +
Sbjct  476  LRVVGWEVSYSAEYVPNAERGYTVIIQKTRKMLPTDEPVVSSSFNVTELGKILLTIDNPS  535

Query  343  SKRKKLLYRSK  311
            +K+KKLLYR K
Sbjct  536  AKKKKLLYRFK  546



>dbj|BAD94747.1| putative cytosolic factor protein [Arabidopsis thaliana]
Length=228

 Score =   141 bits (355),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 92/125 (74%), Gaps = 3/125 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APEQVPV+YGGLS++      T +  TE  +KP + +TIE P +E CTL WE RV+G DV
Sbjct  107  APEQVPVKYGGLSKDTPL---TEETITEAIVKPAANYTIELPASEACTLSWELRVLGADV  163

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
            +YG++F P  EG+Y +IV K+RKIG  DE +I++S+K    GK+V+T DNQTSK+KK+LY
Sbjct  164  SYGAQFEPTTEGSYAVIVSKTRKIGSTDEPVITDSFKVGEPGKIVITIDNQTSKKKKVLY  223

Query  319  RSKTK  305
            R KT+
Sbjct  224  RFKTQ  228



>ref|XP_007020128.1| Sec14p-like phosphatidylinositol transfer family protein isoform 
9, partial [Theobroma cacao]
 gb|EOY17353.1| Sec14p-like phosphatidylinositol transfer family protein isoform 
9, partial [Theobroma cacao]
Length=611

 Score =   147 bits (370),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 71/128 (55%), Positives = 93/128 (73%), Gaps = 7/128 (5%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDY-----EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARV  515
            APEQVP+QYGGLS   DY     EF   DPATE T+KP +K T+E  + EKC LVWE RV
Sbjct  477  APEQVPIQYGGLS--VDYCDCNPEFGDADPATEITVKPGTKQTVEITIYEKCDLVWEIRV  534

Query  514  IGWDVAYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKR  335
            +GW+V+YG+EF+P A+ +YT+I++K  K+ P DE ++S  +K    GKV+LT DN TSK+
Sbjct  535  VGWEVSYGAEFMPNAKDSYTVIIQKPTKMSPKDEPVVSQCFKVGELGKVLLTVDNPTSKK  594

Query  334  KKLLYRSK  311
            KKL+YR K
Sbjct  595  KKLVYRFK  602



>gb|EYU20559.1| hypothetical protein MIMGU_mgv1a006872mg [Erythranthe guttata]
Length=428

 Score =   145 bits (366),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 74/129 (57%), Positives = 95/129 (74%), Gaps = 7/129 (5%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLV-WEARVIGWD  503
            A EQ+P QYGGLS++G  EF   D  TE T+KP++KH +EFPVT+ C +V WEA V+GW+
Sbjct  298  AAEQIPTQYGGLSKDG--EFGASDSVTEVTVKPSAKHIVEFPVTQGCCVVSWEASVVGWE  355

Query  502  VAYGSEFVPAAEGAYTIIVEKSRKI---GPADETIISNSYKTDCAGKVVLTFDNQTSKRK  332
            V YG+EFVP+AE  YTII++K RKI   G  D+ I SN Y+    GK++LT DN TS++K
Sbjct  356  VRYGAEFVPSAENGYTIIIQKMRKINNNGGNDQVIRSN-YRVGEPGKLILTIDNLTSRKK  414

Query  331  KLLYRSKTK  305
            KLLYR KTK
Sbjct  415  KLLYRFKTK  423



>gb|KJB60043.1| hypothetical protein B456_009G288100 [Gossypium raimondii]
Length=556

 Score =   146 bits (369),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 93/129 (72%), Gaps = 7/129 (5%)
 Frame = -2

Query  676  PEQVPVQYGGLSREGDY-----EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVI  512
            PEQVP+QYGGLS   DY     EF+  DPATE T+KP +K T+E  + E+C LVWE RV+
Sbjct  426  PEQVPIQYGGLSV--DYCDCNPEFSDADPATEMTVKPGTKQTVEITIFERCILVWEIRVV  483

Query  511  GWDVAYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRK  332
            GW+V+YG+EFVP A+ +Y +I++K  K+   DE ++S S+K    GKV+LT DN TSK+K
Sbjct  484  GWEVSYGAEFVPDAKDSYAVIIQKPTKMTAKDEPVVSQSFKVGELGKVLLTVDNPTSKKK  543

Query  331  KLLYRSKTK  305
            KLLYR K K
Sbjct  544  KLLYRFKVK  552



>gb|KJB60040.1| hypothetical protein B456_009G288100 [Gossypium raimondii]
 gb|KJB60044.1| hypothetical protein B456_009G288100 [Gossypium raimondii]
Length=593

 Score =   146 bits (369),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 93/129 (72%), Gaps = 7/129 (5%)
 Frame = -2

Query  676  PEQVPVQYGGLSREGDY-----EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVI  512
            PEQVP+QYGGLS   DY     EF+  DPATE T+KP +K T+E  + E+C LVWE RV+
Sbjct  463  PEQVPIQYGGLSV--DYCDCNPEFSDADPATEMTVKPGTKQTVEITIFERCILVWEIRVV  520

Query  511  GWDVAYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRK  332
            GW+V+YG+EFVP A+ +Y +I++K  K+   DE ++S S+K    GKV+LT DN TSK+K
Sbjct  521  GWEVSYGAEFVPDAKDSYAVIIQKPTKMTAKDEPVVSQSFKVGELGKVLLTVDNPTSKKK  580

Query  331  KLLYRSKTK  305
            KLLYR K K
Sbjct  581  KLLYRFKVK  589



>ref|XP_006390693.1| hypothetical protein EUTSA_v10018429mg [Eutrema salsugineum]
 gb|ESQ27979.1| hypothetical protein EUTSA_v10018429mg [Eutrema salsugineum]
Length=505

 Score =   145 bits (367),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 68/128 (53%), Positives = 96/128 (75%), Gaps = 3/128 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSREG---DYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIG  509
            +PEQVPVQYGGLS +    + +F+  DPA+E T+KP +K T+E  + EKC +VWE RVIG
Sbjct  376  SPEQVPVQYGGLSVDPCDCNPDFSLDDPASEVTVKPGTKQTVEIIIYEKCEIVWEIRVIG  435

Query  508  WDVAYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKK  329
            W+V+Y +EFVP  + AYT++V+K RK+ PADE +++ ++K +  GKV+LT DN TSK+KK
Sbjct  436  WEVSYKAEFVPEEKDAYTVVVQKPRKMKPADEPVLTQNFKVNELGKVLLTVDNPTSKKKK  495

Query  328  LLYRSKTK  305
            L+YR   K
Sbjct  496  LVYRFNVK  503



>ref|XP_007049994.1| SEC14 cytosolic factor family protein / phosphoglyceride transfer 
family protein [Theobroma cacao]
 gb|EOX94151.1| SEC14 cytosolic factor family protein / phosphoglyceride transfer 
family protein [Theobroma cacao]
Length=612

 Score =   146 bits (368),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 88/113 (78%), Gaps = 2/113 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            A EQVPV+YGGLS++G  EF   D  TE T+KP++KHT+EFPVTE C L WE RV+GWDV
Sbjct  486  AAEQVPVKYGGLSKDG--EFANTDAVTEITVKPSAKHTVEFPVTETCLLTWEVRVVGWDV  543

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTS  341
            +YG+EFVP+AE +YT+I++K+RK+   +E ++ N++K    GKV+LT DN TS
Sbjct  544  SYGAEFVPSAEDSYTVIIQKARKVASTEEPVVCNNFKIGEPGKVILTIDNPTS  596



>gb|EPS65571.1| hypothetical protein M569_09207, partial [Genlisea aurea]
Length=400

 Score =   144 bits (363),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 92/127 (72%), Gaps = 3/127 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSR---EGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIG  509
            +PEQVP  YGGLS    E + +F+  DPATE  IKP++K T+E  V EKCT+VWE RV+G
Sbjct  271  SPEQVPTMYGGLSVDLCECNPDFSMDDPATELAIKPSTKQTVEIIVNEKCTIVWELRVVG  330

Query  508  WDVAYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKK  329
            W+V Y +EF+P +E  YT+I+EK+R++ P+DE ++SN +  +  GK++L  +N T KRK+
Sbjct  331  WEVGYSAEFLPESERGYTVIIEKARRMSPSDEPVVSNRFVVNEVGKILLIVNNPTPKRKQ  390

Query  328  LLYRSKT  308
            LLYR K 
Sbjct  391  LLYRFKV  397



>dbj|BAH57191.1| AT1G22530 [Arabidopsis thaliana]
Length=545

 Score =   145 bits (367),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 94/126 (75%), Gaps = 2/126 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APE VPV+YGGLS+  D  FT  D  TE  +K TSK+TI+ P TE  TL WE RV+G DV
Sbjct  422  APEVVPVKYGGLSK--DSPFTVEDGVTEAVVKSTSKYTIDLPATEGSTLSWELRVLGADV  479

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
            +YG++F P+ E +YT+IV K+RK+G  DE +I++S+K   AGKVV+T DNQT K+KK+LY
Sbjct  480  SYGAQFEPSNEASYTVIVSKNRKVGLTDEPVITDSFKASEAGKVVITIDNQTFKKKKVLY  539

Query  319  RSKTKG  302
            RSKT+ 
Sbjct  540  RSKTQA  545



>emb|CDY03655.1| BnaA02g15820D [Brassica napus]
Length=565

 Score =   145 bits (367),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 90/125 (72%), Gaps = 5/125 (4%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APEQVPV+YGGLS E       GD  TE  +KP +K+TIE P +E CTL WE RV+G DV
Sbjct  441  APEQVPVKYGGLSNE-----IGGDSVTEAIVKPAAKYTIELPASEACTLSWELRVLGADV  495

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
             YG++F P  EG+Y +IV K+RKIG  DE +I+ S+K    GK+V+T DNQTSK+KK+LY
Sbjct  496  TYGAQFEPTTEGSYDVIVSKNRKIGLTDEPVITGSFKAGEPGKIVITIDNQTSKKKKVLY  555

Query  319  RSKTK  305
            R KT+
Sbjct  556  RFKTQ  560



>ref|NP_173669.1| patellin 2 [Arabidopsis thaliana]
 sp|Q56ZI2.2|PATL2_ARATH RecName: Full=Patellin-2 [Arabidopsis thaliana]
 gb|AAF18525.1|AC006551_11 Unknown protein [Arabidopsis thaliana]
 gb|AAM14094.1| unknown protein [Arabidopsis thaliana]
 gb|AAM91744.1| unknown protein [Arabidopsis thaliana]
 gb|AEE30253.1| patellin 2 [Arabidopsis thaliana]
Length=683

 Score =   146 bits (369),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 94/126 (75%), Gaps = 2/126 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APE VPV+YGGLS+  D  FT  D  TE  +K TSK+TI+ P TE  TL WE RV+G DV
Sbjct  560  APEVVPVKYGGLSK--DSPFTVEDGVTEAVVKSTSKYTIDLPATEGSTLSWELRVLGADV  617

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
            +YG++F P+ E +YT+IV K+RK+G  DE +I++S+K   AGKVV+T DNQT K+KK+LY
Sbjct  618  SYGAQFEPSNEASYTVIVSKNRKVGLTDEPVITDSFKASEAGKVVITIDNQTFKKKKVLY  677

Query  319  RSKTKG  302
            RSKT+ 
Sbjct  678  RSKTQA  683



>ref|XP_007159915.1| hypothetical protein PHAVU_002G278300g [Phaseolus vulgaris]
 gb|ESW31909.1| hypothetical protein PHAVU_002G278300g [Phaseolus vulgaris]
Length=583

 Score =   145 bits (366),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 89/113 (79%), Gaps = 2/113 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APEQ+PV+YGGLS++G  EF   D  TE T++P +KHT+EF VTEKC L WE RVIGW+V
Sbjct  456  APEQLPVKYGGLSKDG--EFGNTDAVTEITVRPAAKHTVEFSVTEKCLLSWELRVIGWEV  513

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTS  341
            +YG+EFVP +EG+YT+IV+K+RK+  ++E ++ NS+K    GKVVLT DN +S
Sbjct  514  SYGAEFVPDSEGSYTVIVQKARKVASSEEPVVCNSFKVGEPGKVVLTIDNTSS  566



>ref|XP_010428078.1| PREDICTED: patellin-1 [Camelina sativa]
Length=575

 Score =   145 bits (366),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 92/125 (74%), Gaps = 2/125 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APEQVPV+YGGLS+E     TT +  TE  +KP   +TIE P +E CTL WE RV+G DV
Sbjct  450  APEQVPVKYGGLSKE--VAATTVETVTEAIVKPAGNYTIELPASEACTLSWELRVLGADV  507

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
            +YG++F P  EG+Y +IV K+RKIG  DE +I++S+K    GK+V+T DNQTSK+KK+LY
Sbjct  508  SYGAQFEPTTEGSYAVIVSKTRKIGSTDEPVITDSFKVGEPGKIVITIDNQTSKKKKVLY  567

Query  319  RSKTK  305
            R KT+
Sbjct  568  RFKTQ  572



>ref|XP_003522462.1| PREDICTED: patellin-3-like [Glycine max]
 gb|KHN31218.1| Patellin-5 [Glycine soja]
Length=557

 Score =   145 bits (365),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 88/113 (78%), Gaps = 2/113 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            A EQ+PV+YGGLS++G  EF   D  TE T++P +KHT+EFPVTE   L WE RVIGWDV
Sbjct  431  AAEQLPVKYGGLSKDG--EFGISDAVTEITVRPAAKHTVEFPVTENSLLSWELRVIGWDV  488

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTS  341
            +YG+EFVP +EG+YT+I++K+RK+  ++E ++ N+YK    GKVVLT DNQ+S
Sbjct  489  SYGAEFVPTSEGSYTVIIQKARKVASSEEPVLCNNYKIGEPGKVVLTIDNQSS  541



>ref|XP_008219012.1| PREDICTED: patellin-3 [Prunus mume]
Length=538

 Score =   144 bits (364),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 91/133 (68%), Gaps = 7/133 (5%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDY-----EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARV  515
            +PE VP+QYGGLS   DY     EFT  DP  + T+K  +K T+E  + EKCT+VWE RV
Sbjct  407  SPEHVPIQYGGLS--VDYCDCNPEFTIADPVADVTVKAGTKQTVEIIIYEKCTIVWELRV  464

Query  514  IGWDVAYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKR  335
            +GWDV+YG+EFVP  E  Y II++KS K+ P DE ++ NS+K    GK++L  DN TSK+
Sbjct  465  VGWDVSYGTEFVPDTENGYIIIIQKSTKMSPTDEPVVQNSFKVGELGKILLKIDNPTSKK  524

Query  334  KKLLYRSKTKGSD  296
            K+LLYR K +  D
Sbjct  525  KRLLYRFKIEPFD  537



>ref|XP_009127905.1| PREDICTED: patellin-1-like [Brassica rapa]
Length=562

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 90/125 (72%), Gaps = 5/125 (4%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APEQVPV+YGGLS E       GD  TE  +KP +K+TIE P +E CTL WE RV+G DV
Sbjct  438  APEQVPVKYGGLSNE-----IGGDSVTEAIVKPAAKYTIELPASEACTLSWELRVLGADV  492

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
             YG++F P  EG+Y +IV K+RKIG  DE +I+ S+K    GK+V+T DNQTSK+KK+LY
Sbjct  493  TYGAQFEPTTEGSYDVIVFKNRKIGLTDEPVITGSFKVGEPGKIVITIDNQTSKKKKVLY  552

Query  319  RSKTK  305
            R KT+
Sbjct  553  RFKTQ  557



>ref|XP_006384383.1| hypothetical protein POPTR_0004s14530g [Populus trichocarpa]
 gb|ERP62180.1| hypothetical protein POPTR_0004s14530g [Populus trichocarpa]
Length=583

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 86/113 (76%), Gaps = 2/113 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            A EQ+PV+YGGLS++G  EF + D  TE T+KP +KHT+EFPVTE C L WE RV GWDV
Sbjct  455  AAEQIPVKYGGLSKDG--EFGSADAVTEITVKPAAKHTVEFPVTETCLLTWEVRVAGWDV  512

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTS  341
            +Y +EFVP+AE +YT+I++K+RK+   +E ++ NS+K    GKVVLT DN TS
Sbjct  513  SYSAEFVPSAEDSYTVIIQKARKVAATEEPVVCNSFKIGEPGKVVLTIDNSTS  565



>ref|XP_010471233.1| PREDICTED: patellin-1-like [Camelina sativa]
Length=562

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 92/125 (74%), Gaps = 2/125 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APEQVPV+YGGLS+E     TT +  TE  +KP   +TIE P +E CTL WE RV+G DV
Sbjct  437  APEQVPVKYGGLSKE--VPATTVETVTEAIVKPAGNYTIELPASEACTLSWELRVLGADV  494

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
            +YG++F P  EG+Y +IV K+RKIG  DE +I++S+K    GK+V+T DNQTSK+KK+LY
Sbjct  495  SYGAQFEPTIEGSYAVIVSKTRKIGSTDEPVITDSFKMGEPGKIVITIDNQTSKKKKVLY  554

Query  319  RSKTK  305
            R KT+
Sbjct  555  RFKTQ  559



>ref|XP_006339368.1| PREDICTED: patellin-3-like [Solanum tuberosum]
Length=491

 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 91/127 (72%), Gaps = 3/127 (2%)
 Frame = -2

Query  676  PEQVPVQYGGLSR---EGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGW  506
            PEQVPVQYGGLS    E + EFT+ DP TE  +KP +K T+E  V EKC +VWE RV+GW
Sbjct  361  PEQVPVQYGGLSVDYCECNPEFTSNDPVTEIIVKPATKQTVEIIVNEKCIIVWELRVLGW  420

Query  505  DVAYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKL  326
            +V Y +E+VP  +  YT+ ++K RK+  ADE ++S+S+K    GK++LT DN TSK+KKL
Sbjct  421  EVTYSAEYVPNTDSGYTVNIQKPRKMTTADEPVVSSSFKIVELGKILLTIDNPTSKKKKL  480

Query  325  LYRSKTK  305
            LYR K K
Sbjct  481  LYRFKDK  487



>ref|XP_004250635.1| PREDICTED: patellin-3 [Solanum lycopersicum]
Length=490

 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 91/127 (72%), Gaps = 3/127 (2%)
 Frame = -2

Query  676  PEQVPVQYGGLSR---EGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGW  506
            PEQVPVQYGGLS    E + EFT+ DP TE  +KP +K T+E  V EKC +VWE RV+GW
Sbjct  360  PEQVPVQYGGLSVDYCECNPEFTSNDPVTEIIVKPATKQTVEIIVNEKCIIVWELRVLGW  419

Query  505  DVAYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKL  326
            +V Y +E+VP  +  YT+ ++K RK+  ADE ++S+S+K    GK++LT DN TSK+KKL
Sbjct  420  EVTYSAEYVPNTDSGYTVNIQKPRKMTTADEPVVSSSFKIVELGKILLTIDNPTSKKKKL  479

Query  325  LYRSKTK  305
            LYR K K
Sbjct  480  LYRFKDK  486



>ref|XP_006302079.1| hypothetical protein CARUB_v10020065mg [Capsella rubella]
 gb|EOA34977.1| hypothetical protein CARUB_v10020065mg [Capsella rubella]
Length=567

 Score =   144 bits (362),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 92/125 (74%), Gaps = 2/125 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APEQVPV+YGGLS+E      T +  TE  +KP + +TIE P +E CTL WE RV+G DV
Sbjct  440  APEQVPVKYGGLSKE--VPAATVETVTEAIVKPAANYTIELPASEACTLSWELRVLGADV  497

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
            +YG++F P  EG+Y +IV K+RKI  ADE +I++S+K    GK+V+T DNQTSK+KK+LY
Sbjct  498  SYGAQFEPTTEGSYAVIVSKTRKIASADEPVITDSFKVGEPGKIVITIDNQTSKKKKVLY  557

Query  319  RSKTK  305
            R KT+
Sbjct  558  RFKTQ  562



>gb|KEH35657.1| patellin-3 protein [Medicago truncatula]
Length=573

 Score =   144 bits (362),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 88/113 (78%), Gaps = 2/113 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APEQ+ V+YGGLS++G  EF   D  TE T++P +KH +EFPVTE C L WE RVIGWD+
Sbjct  446  APEQLSVKYGGLSKDG--EFGITDAVTEITVRPAAKHIVEFPVTENCLLSWELRVIGWDI  503

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTS  341
            +YG+EFVP++EG+YT+I++K+RKI  ++E ++ N+YK    GKVVLT DN +S
Sbjct  504  SYGAEFVPSSEGSYTVIIQKTRKIASSEEPVLCNNYKIGEPGKVVLTIDNSSS  556



>ref|XP_002325736.2| hypothetical protein POPTR_0019s00780g [Populus trichocarpa]
 gb|EEF00118.2| hypothetical protein POPTR_0019s00780g [Populus trichocarpa]
Length=605

 Score =   144 bits (362),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 85/108 (79%), Gaps = 2/108 (2%)
 Frame = -2

Query  673  EQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAY  494
            EQ+PV+YGGLS++G  EF T D  TE T+K ++KHT+EFPVTE C L WE RV+GWDV+Y
Sbjct  480  EQIPVKYGGLSKDG--EFCTADAVTEITVKASAKHTVEFPVTETCLLTWEMRVVGWDVSY  537

Query  493  GSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDN  350
            G+EFVP AE +YT+I++K+RK+   +E ++SNS+K    GKVVLT DN
Sbjct  538  GAEFVPNAEDSYTVIIQKARKVAITEEPVVSNSFKVGEPGKVVLTIDN  585



>ref|XP_008781561.1| PREDICTED: patellin-3-like isoform X1 [Phoenix dactylifera]
Length=558

 Score =   144 bits (362),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 86/125 (69%), Gaps = 12/125 (10%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTE------------KCT  536
            APEQVPVQYGGLS+E D +FT  D  TE  IKP++K  IE PV E            KC 
Sbjct  416  APEQVPVQYGGLSKEKDPDFTAADAVTEIAIKPSTKQVIEIPVNEVRSLFLSPIHQMKCL  475

Query  535  LVWEARVIGWDVAYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTF  356
            LVWE RV+GWDV +G+EFVP++E  YT+IV+K+RK+  ADE +  NS+K   AGKVVLT 
Sbjct  476  LVWELRVLGWDVTFGAEFVPSSEDGYTVIVQKARKLVAADEPVEKNSFKIGEAGKVVLTV  535

Query  355  DNQTS  341
            DN TS
Sbjct  536  DNTTS  540



>gb|KHN32467.1| Patellin-3 [Glycine soja]
Length=424

 Score =   142 bits (359),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 92/128 (72%), Gaps = 3/128 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSRE---GDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIG  509
            +PEQVPVQYGGLS +    + +FT   P TE  IKPT+K T+E  + EKC +VWE RV+G
Sbjct  293  SPEQVPVQYGGLSVDFCDCNPDFTMSYPVTEIPIKPTTKQTVEIAIYEKCIIVWELRVVG  352

Query  508  WDVAYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKK  329
            W+V+Y +EF P  E AYT+I++K+ K+ P DE +++NS+K    GK++LT DN T K+K+
Sbjct  353  WEVSYNAEFKPDVEDAYTVIIQKATKMSPTDEPVVTNSFKVVELGKLLLTIDNPTLKKKR  412

Query  328  LLYRSKTK  305
            LLYR K K
Sbjct  413  LLYRFKIK  420



>ref|XP_002893236.1| hypothetical protein ARALYDRAFT_472493 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69495.1| hypothetical protein ARALYDRAFT_472493 [Arabidopsis lyrata subsp. 
lyrata]
Length=676

 Score =   144 bits (364),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 93/126 (74%), Gaps = 2/126 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APE VPV+YGGLS+E    FT  D  TE  +K TSK+TI+ P TE  TL WE RV+G DV
Sbjct  553  APEVVPVKYGGLSKESP--FTVEDGVTEAVVKSTSKYTIDLPATEGSTLSWELRVLGADV  610

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
            +YG++F P+ E +YT+IV K+RK+G  DE +I++S+K    GKVV+T DNQT K+KK+LY
Sbjct  611  SYGAQFEPSNEASYTVIVSKNRKVGLTDEPVITDSFKASEPGKVVITIDNQTFKKKKVLY  670

Query  319  RSKTKG  302
            RSKT+ 
Sbjct  671  RSKTQA  676



>ref|XP_002888860.1| SEC14 cytosolic factor family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65119.1| SEC14 cytosolic factor family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=497

 Score =   143 bits (360),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 96/128 (75%), Gaps = 3/128 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSREG---DYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIG  509
            +PEQVPVQYGGLS +    + +F+  D A+E T+KP +K T+E  + EKC LVWE RVIG
Sbjct  368  SPEQVPVQYGGLSVDPCDCNPDFSLEDSASEITVKPGTKQTVEIIIYEKCELVWEIRVIG  427

Query  508  WDVAYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKK  329
            W+V+Y +EFVP  + AYT++++K RK+ P+DE ++++S+K +  GKV+LT DN TSK+KK
Sbjct  428  WEVSYKAEFVPEEKDAYTVVIQKPRKMRPSDEPVLTHSFKVNELGKVLLTVDNPTSKKKK  487

Query  328  LLYRSKTK  305
            L+YR   K
Sbjct  488  LVYRFNVK  495



>ref|XP_006387528.1| hypothetical protein POPTR_0895s00200g [Populus trichocarpa]
 gb|ERP46442.1| hypothetical protein POPTR_0895s00200g [Populus trichocarpa]
Length=605

 Score =   144 bits (362),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 86/108 (80%), Gaps = 2/108 (2%)
 Frame = -2

Query  673  EQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAY  494
            EQ+PV+YGGLS++G  EF T D  TE T+K ++KHT+EFPVTE C L WE RV+GWDV+Y
Sbjct  480  EQIPVKYGGLSKDG--EFCTADAVTEITVKASAKHTVEFPVTETCLLTWEMRVVGWDVSY  537

Query  493  GSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDN  350
            G+EFVP+A+ +YT+I++K+RK+   +E ++SNS+K    GKVVLT DN
Sbjct  538  GAEFVPSADDSYTVIIQKARKVATTEEPVVSNSFKVGEPGKVVLTIDN  585



>ref|XP_010428080.1| PREDICTED: patellin-3-like isoform X1 [Camelina sativa]
 ref|XP_010428081.1| PREDICTED: patellin-3-like isoform X2 [Camelina sativa]
Length=493

 Score =   143 bits (360),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 96/128 (75%), Gaps = 3/128 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSREG---DYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIG  509
            +PEQVPVQYGGLS +    + +F+  D A+E T+KP +K T+E  + EKC LVWE RVIG
Sbjct  364  SPEQVPVQYGGLSVDPCDCNPDFSLEDAASEITVKPGTKQTVEIIIYEKCELVWEIRVIG  423

Query  508  WDVAYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKK  329
            W+V+Y +EFVP  + AYT++++K RK+ P+DE ++++S+K +  GKV+LT DN TSK+KK
Sbjct  424  WEVSYKAEFVPEEKDAYTVVIQKPRKMRPSDEPVLTHSFKVNELGKVLLTVDNPTSKKKK  483

Query  328  LLYRSKTK  305
            L+YR   K
Sbjct  484  LVYRFNVK  491



>ref|XP_010414837.1| PREDICTED: patellin-3-like [Camelina sativa]
Length=492

 Score =   143 bits (360),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 96/128 (75%), Gaps = 3/128 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSREG---DYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIG  509
            +PEQVPVQYGGLS +    + +F+  D A+E T+KP +K T+E  + EKC LVWE RVIG
Sbjct  363  SPEQVPVQYGGLSVDPCDCNPDFSLEDAASEITVKPGTKQTVEIIIYEKCELVWEIRVIG  422

Query  508  WDVAYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKK  329
            W+V+Y +EFVP  + AYT++++K RK+ P+DE ++++S+K +  GKV+LT DN TSK+KK
Sbjct  423  WEVSYKAEFVPEEKDAYTVVIQKPRKMRPSDEPVLTHSFKVNELGKVLLTVDNPTSKKKK  482

Query  328  LLYRSKTK  305
            L+YR   K
Sbjct  483  LVYRFNVK  490



>ref|XP_006302172.1| hypothetical protein CARUB_v10020182mg [Capsella rubella]
 gb|EOA35070.1| hypothetical protein CARUB_v10020182mg [Capsella rubella]
Length=496

 Score =   143 bits (360),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 96/128 (75%), Gaps = 3/128 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSREG---DYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIG  509
            +PEQVPVQYGGLS +    + +F+  D A+E T+KP +K T+E  + EKC LVWE RVIG
Sbjct  367  SPEQVPVQYGGLSVDPCDCNPDFSLEDAASEITVKPGTKQTVEIIIYEKCELVWEIRVIG  426

Query  508  WDVAYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKK  329
            W+V+Y +EFVP  + AYT++++K RK+ P+DE ++++S+K +  GKV+LT DN TSK+KK
Sbjct  427  WEVSYKAEFVPEEKDAYTVVIQKPRKMRPSDEPVLTHSFKVNELGKVLLTVDNPTSKKKK  486

Query  328  LLYRSKTK  305
            L+YR   K
Sbjct  487  LVYRFNVK  494



>ref|XP_010414836.1| PREDICTED: patellin-1-like [Camelina sativa]
Length=565

 Score =   143 bits (361),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 91/125 (73%), Gaps = 2/125 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APEQVPV+YGGLS+E      T +  TE  +KP   +TIE P +E CTL WE RV+G DV
Sbjct  440  APEQVPVKYGGLSKE--VPANTVETVTEAIVKPAGNYTIELPASEACTLSWELRVLGADV  497

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
            +YG++F P  EG+Y +IV K+RKIG  DE +I++S+K    GK+V+T DNQTSK+KK+LY
Sbjct  498  SYGAQFEPTTEGSYAVIVSKTRKIGSTDEPVITDSFKVGEPGKIVITIDNQTSKKKKVLY  557

Query  319  RSKTK  305
            R KT+
Sbjct  558  RFKTQ  562



>ref|XP_010471234.1| PREDICTED: patellin-3 [Camelina sativa]
Length=524

 Score =   143 bits (360),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 96/128 (75%), Gaps = 3/128 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSREG---DYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIG  509
            +PEQVPVQYGGLS +    + +F+  D A+E T+KP +K T+E  + EKC LVWE RVIG
Sbjct  395  SPEQVPVQYGGLSVDPCDCNPDFSLEDAASEITVKPGTKQTVEIIIYEKCELVWEIRVIG  454

Query  508  WDVAYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKK  329
            W+V+Y +EFVP  + AYT++++K RK+ P+DE ++++S+K +  GKV+LT DN TSK+KK
Sbjct  455  WEVSYKAEFVPEEKDAYTVVIQKPRKMRPSDEPVLTHSFKVNELGKVLLTVDNPTSKKKK  514

Query  328  LLYRSKTK  305
            L+YR   K
Sbjct  515  LVYRFNVK  522



>ref|XP_009416925.1| PREDICTED: patellin-3-like [Musa acuminata subsp. malaccensis]
Length=590

 Score =   143 bits (360),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 97/127 (76%), Gaps = 0/127 (0%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APEQVPVQ+GGLS+E D +F+T D ATE TIKP+ K  IE  VTE C LVWE RV+GWDV
Sbjct  460  APEQVPVQFGGLSKENDPDFSTSDAATEITIKPSMKQAIEILVTEPCLLVWELRVLGWDV  519

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
            +YG+EF P AE  YT+IV+K+RK+   ++ ++ +S+K   AGKVVLT  N +SK+KKLLY
Sbjct  520  SYGAEFAPTAEDGYTVIVQKARKLVAINDPVVKDSFKIGDAGKVVLTVGNTSSKKKKLLY  579

Query  319  RSKTKGS  299
            R KTK S
Sbjct  580  RYKTKSS  586



>ref|XP_002887418.1| hypothetical protein ARALYDRAFT_895064 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63677.1| hypothetical protein ARALYDRAFT_895064 [Arabidopsis lyrata subsp. 
lyrata]
Length=554

 Score =   143 bits (360),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 92/125 (74%), Gaps = 3/125 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APEQVPV+YGGLS++      T +  TE  +KP + +TIE P +E CTL WE RV+G DV
Sbjct  428  APEQVPVKYGGLSKDTPL---TQETITEAIVKPAANYTIELPASEACTLSWELRVLGADV  484

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
            +YG++F P  EG+Y +IV K+RKIG  DE +I++S+K    GK+V+T DNQTSK+KK+LY
Sbjct  485  SYGAQFEPTTEGSYAVIVSKTRKIGSTDEPVITDSFKVGEPGKIVITIDNQTSKKKKVLY  544

Query  319  RSKTK  305
            R KT+
Sbjct  545  RFKTQ  549



>emb|CDX82182.1| BnaC02g21080D [Brassica napus]
Length=575

 Score =   143 bits (360),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 89/125 (71%), Gaps = 5/125 (4%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APEQVPV+YGGLS E       GD  TE  +KP +++TIE P +E C L WE RV+G DV
Sbjct  451  APEQVPVKYGGLSNE-----IGGDSVTEAIVKPAAQYTIELPASEACALSWELRVLGADV  505

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
             YG++F P  EG+Y +IV K+RKIG  DE +I+ S+K    GK+V+T DNQTSK+KK+LY
Sbjct  506  TYGAQFEPTTEGSYDVIVSKNRKIGLTDEPVITGSFKVGEPGKIVITIDNQTSKKKKVLY  565

Query  319  RSKTK  305
            R KT+
Sbjct  566  RFKTQ  570



>ref|NP_177360.1| patellin-1 [Arabidopsis thaliana]
 sp|Q56WK6.2|PATL1_ARATH RecName: Full=Patellin-1 [Arabidopsis thaliana]
 gb|AAG51793.1|AC067754_9 cytosolic factor, putative; 12503-14597 [Arabidopsis thaliana]
 gb|AAK76587.1| putative cytosolic factor [Arabidopsis thaliana]
 gb|AAM44913.1| putative cytosolic factor protein [Arabidopsis thaliana]
 gb|AEE35282.1| patellin-1 [Arabidopsis thaliana]
Length=573

 Score =   143 bits (360),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 92/125 (74%), Gaps = 3/125 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APEQVPV+YGGLS++      T +  TE  +KP + +TIE P +E CTL WE RV+G DV
Sbjct  452  APEQVPVKYGGLSKDTPL---TEETITEAIVKPAANYTIELPASEACTLSWELRVLGADV  508

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
            +YG++F P  EG+Y +IV K+RKIG  DE +I++S+K    GK+V+T DNQTSK+KK+LY
Sbjct  509  SYGAQFEPTTEGSYAVIVSKTRKIGSTDEPVITDSFKVGEPGKIVITIDNQTSKKKKVLY  568

Query  319  RSKTK  305
            R KT+
Sbjct  569  RFKTQ  573



>ref|XP_003532213.1| PREDICTED: patellin-3-like [Glycine max]
 gb|KHN16910.1| Patellin-5 [Glycine soja]
Length=575

 Score =   142 bits (359),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 88/113 (78%), Gaps = 2/113 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APEQ+PV+YGGL ++G  EF   D  TE T++P +KHT+EF VTE C L WE RVIGW+V
Sbjct  448  APEQLPVKYGGLGKDG--EFGNTDAVTEITVRPAAKHTVEFSVTENCLLSWELRVIGWEV  505

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTS  341
            +YG+EFVP++EG+YT+IV+K+RK+  ++E ++ NS+K    GKVVLT DN +S
Sbjct  506  SYGAEFVPSSEGSYTVIVQKARKVASSEEPVLCNSFKVGEPGKVVLTIDNTSS  558



>emb|CDX90715.1| BnaA03g23950D [Brassica napus]
Length=310

 Score =   139 bits (351),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 65/128 (51%), Positives = 91/128 (71%), Gaps = 3/128 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSREG---DYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIG  509
            +PE VPVQYGGLS +    + +FT  D ATE T+KPT+K T+E  + E+CT+VWE RV+G
Sbjct  178  SPEHVPVQYGGLSVDNCDCNSDFTHEDTATEITVKPTTKQTVEIIIYERCTIVWEIRVVG  237

Query  508  WDVAYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKK  329
            W+V YG+EFVP  +  YT+I++K RK+   DE ++S S+K    GK++L+ DN TS +K 
Sbjct  238  WEVMYGAEFVPENKEGYTVIIQKPRKMASGDEPVVSQSFKVGEVGKILLSVDNPTSNKKI  297

Query  328  LLYRSKTK  305
            L+YR K K
Sbjct  298  LIYRFKVK  305



>ref|XP_004169713.1| PREDICTED: patellin-3-like [Cucumis sativus]
Length=349

 Score =   140 bits (353),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 93/130 (72%), Gaps = 7/130 (5%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDY-----EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARV  515
            +PEQVP++YGGLS   DY     +F   D ATE +IKP++K T+E  + EKC + WE RV
Sbjct  218  SPEQVPIEYGGLS--VDYCDCNPDFDASDQATEVSIKPSTKQTVEIIIYEKCIIAWELRV  275

Query  514  IGWDVAYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKR  335
            +GW+V+Y +EFVP  E AYT+I++K+RK+   DE +IS+S++    GKV+ T DN TSK+
Sbjct  276  VGWEVSYSAEFVPNNEEAYTVIIQKARKMAATDEPVISHSFQVFELGKVLFTIDNPTSKK  335

Query  334  KKLLYRSKTK  305
            KKL+YR K K
Sbjct  336  KKLMYRFKVK  345



>gb|KFK41635.1| hypothetical protein AALP_AA2G153200 [Arabis alpina]
Length=564

 Score =   142 bits (359),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 93/125 (74%), Gaps = 3/125 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APE+VPV+YGGLS+  D    T D  TE  +KP +KHTIE P +E CTL WE RV+G DV
Sbjct  438  APEEVPVKYGGLSK--DTPLAT-DSITEAIVKPAAKHTIELPASEACTLSWELRVLGADV  494

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
            +YG++F P +E +Y +IV K+RKIG  D+ +I++S+K    GK+V+T DNQTSK+KK+LY
Sbjct  495  SYGAQFEPTSEESYAVIVSKNRKIGLTDDQVITDSFKVGEPGKIVITIDNQTSKKKKVLY  554

Query  319  RSKTK  305
            R KT+
Sbjct  555  RFKTQ  559



>ref|XP_003525154.1| PREDICTED: patellin-3-like [Glycine max]
 gb|KHN17431.1| Patellin-3 [Glycine soja]
Length=539

 Score =   142 bits (358),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 88/113 (78%), Gaps = 2/113 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APEQ+PV+YGGLS++G  EF   D  TE T++P +KH++EF VTE C L WE RVIGW+V
Sbjct  412  APEQLPVKYGGLSKDG--EFGNIDAVTEITVRPAAKHSVEFSVTENCLLSWELRVIGWEV  469

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTS  341
             YG+EFVP++EG+YT+IV+K+RK+  ++E ++ NS+K    GKVVLT DN +S
Sbjct  470  TYGAEFVPSSEGSYTVIVQKARKVASSEEPVLCNSFKVGEPGKVVLTIDNTSS  522



>emb|CDY03654.1| BnaA02g15830D [Brassica napus]
Length=489

 Score =   142 bits (358),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 94/128 (73%), Gaps = 3/128 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSREG---DYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIG  509
            +PEQVPVQYGGLS +    + +F+  DPA+E  +KP +K T+E  + EKC +VWE RVIG
Sbjct  360  SPEQVPVQYGGLSVDPCDCNPDFSLDDPASEVIVKPGTKQTVEIIIYEKCEIVWEIRVIG  419

Query  508  WDVAYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKK  329
            W+V+Y +EFVP  + AYT++V+K RK+ P DE +++ S+K +  GKV+LT DN TSK+KK
Sbjct  420  WEVSYKAEFVPEEKDAYTVVVQKPRKMKPFDEPVLTQSFKVNELGKVLLTVDNPTSKKKK  479

Query  328  LLYRSKTK  305
            L+YR   K
Sbjct  480  LVYRFSVK  487



>ref|XP_010415948.1| PREDICTED: patellin-1-like isoform X1 [Camelina sativa]
Length=562

 Score =   142 bits (359),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 91/125 (73%), Gaps = 2/125 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APEQVPV+YGGLS+E      T +  TE  +KP   +TIE P +E CTL WE RV+G DV
Sbjct  437  APEQVPVKYGGLSKE--VPANTVETVTEVIVKPAGNYTIELPASEACTLSWELRVLGADV  494

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
            +YG++F P  EG+Y +IV K+RKIG  DE +I++S+K    GK+V+T DNQTSK+KK+LY
Sbjct  495  SYGAQFEPTIEGSYAVIVSKTRKIGSTDEPVITDSFKVGEPGKIVITIDNQTSKKKKVLY  554

Query  319  RSKTK  305
            R KT+
Sbjct  555  RFKTQ  559



>ref|XP_010415949.1| PREDICTED: patellin-1-like isoform X2 [Camelina sativa]
Length=567

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 91/125 (73%), Gaps = 2/125 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APEQVPV+YGGLS+E      T +  TE  +KP   +TIE P +E CTL WE RV+G DV
Sbjct  442  APEQVPVKYGGLSKE--VPANTVETVTEVIVKPAGNYTIELPASEACTLSWELRVLGADV  499

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
            +YG++F P  EG+Y +IV K+RKIG  DE +I++S+K    GK+V+T DNQTSK+KK+LY
Sbjct  500  SYGAQFEPTIEGSYAVIVSKTRKIGSTDEPVITDSFKVGEPGKIVITIDNQTSKKKKVLY  559

Query  319  RSKTK  305
            R KT+
Sbjct  560  RFKTQ  564



>ref|XP_009127906.1| PREDICTED: patellin-3-like [Brassica rapa]
Length=496

 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 94/128 (73%), Gaps = 3/128 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSREG---DYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIG  509
            +PEQVPVQYGGLS +    + +F+  DPA+E  +KP +K T+E  + EKC +VWE RVIG
Sbjct  367  SPEQVPVQYGGLSVDPCDCNPDFSLDDPASEVIVKPGTKQTVEIIIYEKCEIVWEIRVIG  426

Query  508  WDVAYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKK  329
            W+V+Y +EFVP  + AYT++V+K RK+ P DE +++ S+K +  GKV+LT DN TSK+KK
Sbjct  427  WEVSYKAEFVPEEKDAYTVVVQKPRKMKPFDEPVLTQSFKVNELGKVLLTVDNPTSKKKK  486

Query  328  LLYRSKTK  305
            L+YR   K
Sbjct  487  LVYRFSVK  494



>ref|XP_007222319.1| hypothetical protein PRUPE_ppa003964mg [Prunus persica]
 gb|EMJ23518.1| hypothetical protein PRUPE_ppa003964mg [Prunus persica]
Length=537

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 89/128 (70%), Gaps = 7/128 (5%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDY-----EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARV  515
            +PE VP+QYGGLS   DY     EFT  DP  + T+K  +K T+E  + EKCT+VWE RV
Sbjct  406  SPEHVPIQYGGLS--VDYCDCNPEFTIADPVADVTVKAGTKQTVEIIIYEKCTIVWELRV  463

Query  514  IGWDVAYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKR  335
            +GWDV+YG+EFVP  E  Y II++K+ K+ P DE ++ NS+K    GK++L  DN TSK+
Sbjct  464  VGWDVSYGTEFVPDTENGYIIIIQKATKMSPTDEPVVQNSFKVGELGKILLKIDNPTSKK  523

Query  334  KKLLYRSK  311
            K+LLYR K
Sbjct  524  KRLLYRFK  531



>gb|AAK82462.1| At1g72160/T9N14_8 [Arabidopsis thaliana]
 gb|AAM91383.1| At1g72160/T9N14_8 [Arabidopsis thaliana]
Length=390

 Score =   140 bits (353),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/128 (52%), Positives = 95/128 (74%), Gaps = 3/128 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSRE---GDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIG  509
            +PEQVPVQYGGLS +    + +F+  D A+E T+KP +K T+E  + EKC LVWE RV G
Sbjct  261  SPEQVPVQYGGLSVDPCDCNPDFSLEDSASEITVKPGTKQTVEIIIYEKCELVWEIRVTG  320

Query  508  WDVAYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKK  329
            W+V+Y +EFVP  + AYT++++K RK+ P+DE ++++S+K +  GKV+LT DN TSK+KK
Sbjct  321  WEVSYKAEFVPEEKDAYTVVIQKPRKMRPSDEPVLTHSFKVNELGKVLLTVDNPTSKKKK  380

Query  328  LLYRSKTK  305
            L+YR   K
Sbjct  381  LVYRFNVK  388



>emb|CDX82180.1| BnaC02g21100D [Brassica napus]
Length=489

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 93/128 (73%), Gaps = 3/128 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSREG---DYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIG  509
            +PEQVPVQYGGLS +    + +F+  DPA+E  +KP +K T+E  + EKC +VWE RVIG
Sbjct  360  SPEQVPVQYGGLSVDPCDCNPDFSLEDPASEVIVKPGTKQTVEIIIYEKCEIVWEIRVIG  419

Query  508  WDVAYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKK  329
            W+V Y +EFVP  + AYT++V+K RK+ P DE +++ S+K +  GKV+LT DN TSK+KK
Sbjct  420  WEVRYKAEFVPEEKDAYTVVVQKPRKMKPFDEPVLTQSFKVNELGKVLLTVDNPTSKKKK  479

Query  328  LLYRSKTK  305
            L+YR   K
Sbjct  480  LVYRFNVK  487



>gb|KFK32084.1| hypothetical protein AALP_AA6G197400 [Arabis alpina]
Length=607

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 91/128 (71%), Gaps = 3/128 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSREG---DYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIG  509
            +PE VPVQYGGLS +    + +FT  D ATE TIKP++K T+E  + EKCT+VWE RV+G
Sbjct  475  SPEHVPVQYGGLSVDNCDCNSDFTHDDTATEITIKPSTKQTVEIIIYEKCTIVWEIRVVG  534

Query  508  WDVAYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKK  329
            W+V YG+EFVP  +  YT+I++K RK+   DE ++S S+K    GK++LT DN TS +K 
Sbjct  535  WEVLYGAEFVPENKEGYTVIIQKPRKMAAKDEPVVSQSFKVGEVGKILLTVDNPTSSKKM  594

Query  328  LLYRSKTK  305
            L+YR K K
Sbjct  595  LIYRFKVK  602



>ref|XP_010498725.1| PREDICTED: patellin-2 [Camelina sativa]
Length=705

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 92/126 (73%), Gaps = 2/126 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APE VPV+YGGLS+E    F   D  TE  +K TS +TI+FP TE  TL WE RV+G DV
Sbjct  582  APEVVPVKYGGLSKESP--FAVEDGVTEAVVKSTSNYTIDFPATEGSTLSWELRVLGADV  639

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
            +YG++F P+ E +YT+IV K+RKIG  DE +I++S+K    GKVV+T DNQTSK+KK+LY
Sbjct  640  SYGAQFEPSNETSYTVIVSKNRKIGLTDEPVITDSFKASEPGKVVITIDNQTSKKKKVLY  699

Query  319  RSKTKG  302
            R KT+ 
Sbjct  700  RFKTQA  705



>emb|CBI21668.3| unnamed protein product [Vitis vinifera]
Length=398

 Score =   140 bits (352),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 85/113 (75%), Gaps = 2/113 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            A EQVPV+YGGLS+EG  EF T D  TE T+KP +K T+EFPV E C L WE RV+GW+V
Sbjct  272  AAEQVPVKYGGLSKEG--EFGTADAVTEITVKPATKQTVEFPVNETCLLTWEVRVVGWEV  329

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTS  341
            +YG+EFVP+AE  YT+I++K+RK+   +E ++ NS+K    GKVV+T DN TS
Sbjct  330  SYGAEFVPSAEEGYTVIIQKARKMAGNEEPVVCNSFKIGEPGKVVITIDNPTS  382



>ref|NP_177361.1| patellin-3 [Arabidopsis thaliana]
 sp|Q56Z59.2|PATL3_ARATH RecName: Full=Patellin-3 [Arabidopsis thaliana]
 gb|AAG51796.1|AC067754_12 cytosolic factor, putative; 19554-17768 [Arabidopsis thaliana]
 gb|AEE35283.1| patellin-3 [Arabidopsis thaliana]
Length=490

 Score =   140 bits (354),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 66/128 (52%), Positives = 95/128 (74%), Gaps = 3/128 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSREG---DYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIG  509
            +PEQVPVQYGGLS +    + +F+  D A+E T+KP +K T+E  + EKC LVWE RV G
Sbjct  361  SPEQVPVQYGGLSVDPCDCNPDFSLEDSASEITVKPGTKQTVEIIIYEKCELVWEIRVTG  420

Query  508  WDVAYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKK  329
            W+V+Y +EFVP  + AYT++++K RK+ P+DE ++++S+K +  GKV+LT DN TSK+KK
Sbjct  421  WEVSYKAEFVPEEKDAYTVVIQKPRKMRPSDEPVLTHSFKVNELGKVLLTVDNPTSKKKK  480

Query  328  LLYRSKTK  305
            L+YR   K
Sbjct  481  LVYRFNVK  488



>ref|XP_003526897.2| PREDICTED: patellin-1-like [Glycine max]
Length=606

 Score =   141 bits (355),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 87/113 (77%), Gaps = 2/113 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            A EQ+PV+YGGLS++G  EF   D  TE T++  +KHT+EFPVTE   L WE RVIGWDV
Sbjct  480  AAEQLPVKYGGLSKDG--EFGISDAVTEITVRSAAKHTVEFPVTENSLLSWELRVIGWDV  537

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTS  341
            +YG+EFVP +EG+YT+I++K+RK+  ++E ++ N+YK    GKVVLT DNQ+S
Sbjct  538  SYGAEFVPTSEGSYTVIIQKARKVASSEEPVLCNNYKIGEPGKVVLTIDNQSS  590



>ref|XP_010477513.1| PREDICTED: patellin-2-like [Camelina sativa]
Length=712

 Score =   142 bits (358),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 92/126 (73%), Gaps = 2/126 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APE VPV+YGGLS+E    F   D  TE  +K TSK+TI+ P TE  TL WE RV+G DV
Sbjct  589  APEVVPVKYGGLSKESP--FAVEDGVTEAVVKSTSKYTIDLPATEGSTLSWELRVLGADV  646

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
            +YG++F P+ E +YT+IV K+RKIG  DE +I++S+K    GKVV+T DNQTSK+KK+LY
Sbjct  647  SYGAQFEPSNETSYTVIVSKNRKIGLTDEPVITDSFKASEPGKVVITIDNQTSKKKKVLY  706

Query  319  RSKTKG  302
            R KT+ 
Sbjct  707  RFKTQA  712



>gb|KHN09674.1| Patellin-3 [Glycine soja]
Length=557

 Score =   140 bits (354),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 87/113 (77%), Gaps = 2/113 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            A EQ+PV+YGGLS++G  EF   D  TE T++  +KHT+EFPVTE   L WE RVIGWDV
Sbjct  431  AAEQLPVKYGGLSKDG--EFGISDAVTEITVRSAAKHTVEFPVTENSLLSWELRVIGWDV  488

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTS  341
            +YG+EFVP +EG+YT+I++K+RK+  ++E ++ N+YK    GKVVLT DNQ+S
Sbjct  489  SYGAEFVPTSEGSYTVIIQKARKVASSEEPVLCNNYKIGEPGKVVLTIDNQSS  541



>ref|XP_010460011.1| PREDICTED: patellin-2-like [Camelina sativa]
Length=714

 Score =   142 bits (358),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 92/125 (74%), Gaps = 2/125 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APE VPV+YGGLS+E    F   D  TE  +K TSK+TI+ P TE  TL WE RV+G DV
Sbjct  591  APEVVPVKYGGLSKESP--FAVEDGVTEAVVKSTSKYTIDLPATEGSTLSWELRVLGADV  648

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
            +YG++F P+ E +YT+IV K+RKIG  DE +I++S+K    GKVV+T DNQTSK+KK+LY
Sbjct  649  SYGAQFEPSNETSYTVIVSKNRKIGLTDEPVITDSFKASEPGKVVITIDNQTSKKKKVLY  708

Query  319  RSKTK  305
            R KT+
Sbjct  709  RFKTQ  713



>ref|NP_192655.2| patellin-5 [Arabidopsis thaliana]
 sp|Q9M0R2.2|PATL5_ARATH RecName: Full=Patellin-5 [Arabidopsis thaliana]
 dbj|BAF01050.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE82730.1| patellin-5 [Arabidopsis thaliana]
Length=668

 Score =   141 bits (356),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 93/128 (73%), Gaps = 3/128 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSR---EGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIG  509
            +PE VPVQYGGLS    E + +FT  D ATE T+KPT+K T+E  V EKCT+VWE RV+G
Sbjct  536  SPEHVPVQYGGLSVDNCECNSDFTHDDIATEITVKPTTKQTVEIIVYEKCTIVWEIRVVG  595

Query  508  WDVAYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKK  329
            W+V+YG+EFVP  +  YT+I++K RK+   +E ++S+S+K    G+++LT DN TS +K 
Sbjct  596  WEVSYGAEFVPENKEGYTVIIQKPRKMTAKNELVVSHSFKVGEVGRILLTVDNPTSTKKM  655

Query  328  LLYRSKTK  305
            L+YR K K
Sbjct  656  LIYRFKVK  663



>ref|XP_002271899.2| PREDICTED: patellin-3-like [Vitis vinifera]
Length=576

 Score =   140 bits (354),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 85/113 (75%), Gaps = 2/113 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            A EQVPV+YGGLS+EG  EF T D  TE T+KP +K T+EFPV E C L WE RV+GW+V
Sbjct  450  AAEQVPVKYGGLSKEG--EFGTADAVTEITVKPATKQTVEFPVNETCLLTWEVRVVGWEV  507

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTS  341
            +YG+EFVP+AE  YT+I++K+RK+   +E ++ NS+K    GKVV+T DN TS
Sbjct  508  SYGAEFVPSAEEGYTVIIQKARKMAGNEEPVVCNSFKIGEPGKVVITIDNPTS  560



>gb|AFW81858.1| putative patellin family protein [Zea mays]
Length=539

 Score =   140 bits (353),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 89/127 (70%), Gaps = 0/127 (0%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APEQVPVQ+G L +E D EF+  +   +  +KP+SK T+E P TE  T+VWE RV+GW+V
Sbjct  407  APEQVPVQFGDLYKEDDTEFSASNAVIKLIVKPSSKETVEVPATEGSTVVWELRVLGWEV  466

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
            +Y +EF P AEG YT+IV+K+RK+   +E I+  S+K    GKVVL  DN+ SK+K LLY
Sbjct  467  SYDAEFTPDAEGGYTVIVQKTRKVPAHEEPIMKGSFKAAGPGKVVLAVDNRASKKKMLLY  526

Query  319  RSKTKGS  299
            R + K +
Sbjct  527  RFRVKST  533



>ref|XP_010534141.1| PREDICTED: patellin-2-like [Tarenaya hassleriana]
Length=838

 Score =   142 bits (359),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 69/126 (55%), Positives = 94/126 (75%), Gaps = 2/126 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYE--FTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGW  506
            APEQVPV+YGGLS+E   +  F+     TE  +K  +K+TI+ P +E CTL WE RV+G 
Sbjct  708  APEQVPVKYGGLSKESLTKRIFSAEVTVTETIVKSAAKYTIDLPASEACTLTWELRVLGS  767

Query  505  DVAYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKL  326
            DV+YG++F P+ EG+YT+IV K+RK+G  DE +I++S+K    GKVV+T DNQ+SK+KKL
Sbjct  768  DVSYGAQFEPSTEGSYTVIVSKNRKLGLTDEPVITDSFKVGEPGKVVITIDNQSSKKKKL  827

Query  325  LYRSKT  308
            LYR KT
Sbjct  828  LYRFKT  833



>ref|XP_004138674.1| PREDICTED: patellin-3-like [Cucumis sativus]
 gb|KGN63050.1| hypothetical protein Csa_2G386180 [Cucumis sativus]
Length=530

 Score =   140 bits (353),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 93/130 (72%), Gaps = 7/130 (5%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDY-----EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARV  515
            +PEQVP++YGGLS   DY     +F   D ATE +IKP++K T+E  + EKC + WE RV
Sbjct  399  SPEQVPIEYGGLS--VDYCDCNPDFDASDQATEVSIKPSTKQTVEIIIYEKCIIAWELRV  456

Query  514  IGWDVAYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKR  335
            +GW+V+Y +EFVP  E AYT+I++K+RK+   DE +IS+S++    GKV+ T DN TSK+
Sbjct  457  VGWEVSYSAEFVPNNEEAYTVIIQKARKMAATDEPVISHSFQVFELGKVLFTIDNPTSKK  516

Query  334  KKLLYRSKTK  305
            KKL+YR K K
Sbjct  517  KKLMYRFKVK  526



>gb|KFK41636.1| hypothetical protein AALP_AA2G153300 [Arabis alpina]
Length=485

 Score =   140 bits (352),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 65/128 (51%), Positives = 94/128 (73%), Gaps = 3/128 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSREG---DYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIG  509
            +PEQVPVQYGGLS +    + +F+  D A+E T+KP +K T+E  + EKC +VWE RVIG
Sbjct  356  SPEQVPVQYGGLSVDPCDCNPDFSLDDEASEVTVKPGTKQTVEIIIYEKCEIVWEIRVIG  415

Query  508  WDVAYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKK  329
            W+V+Y +EF P  + AYT++++K RK+ P+DE +++ S+K +  GKV+LT DN TSK+KK
Sbjct  416  WEVSYKAEFAPEEKDAYTVVIQKPRKMKPSDEPVLTQSFKVNELGKVLLTVDNPTSKKKK  475

Query  328  LLYRSKTK  305
            L+YR   K
Sbjct  476  LVYRFNVK  483



>ref|XP_002872438.1| SEC14 cytosolic factor family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48697.1| SEC14 cytosolic factor family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=669

 Score =   141 bits (356),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 93/128 (73%), Gaps = 3/128 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSREG---DYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIG  509
            +PE VPVQYGGLS +    + +FT  D ATE TIKPT+K T+E  V EKCT+VWE RV+G
Sbjct  537  SPEHVPVQYGGLSVDNCDCNSDFTHDDIATEITIKPTTKQTVEIIVYEKCTIVWEIRVVG  596

Query  508  WDVAYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKK  329
            W+V+YG+EFVP  +  YT+I++K RK+   +E ++S+S+K    G+++LT DN TS +K 
Sbjct  597  WEVSYGAEFVPENKEGYTVIIQKPRKMTAKNEPVVSHSFKVGEVGRILLTVDNPTSTKKM  656

Query  328  LLYRSKTK  305
            L+YR K K
Sbjct  657  LIYRFKVK  664



>ref|XP_004506378.1| PREDICTED: patellin-3-like [Cicer arietinum]
Length=473

 Score =   140 bits (352),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 64/128 (50%), Positives = 92/128 (72%), Gaps = 3/128 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSRE---GDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIG  509
            +PEQVPVQYGGLS +    + +F+  DP TE  +KPT+K T+E  + EKC +VWE RV+G
Sbjct  342  SPEQVPVQYGGLSVDFCDCNPDFSMSDPITEIPVKPTTKQTVEIAIYEKCIIVWELRVVG  401

Query  508  WDVAYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKK  329
            W+V+Y +EF P A+  Y +I++K+ K+ P+DE ++S+S+K    GK+ LT DN T K+K+
Sbjct  402  WEVSYSAEFKPDAKDGYAVIIQKATKMSPSDEPVVSSSFKVSELGKLFLTVDNPTLKKKR  461

Query  328  LLYRSKTK  305
            LLYR K K
Sbjct  462  LLYRFKIK  469



>ref|XP_009134136.1| PREDICTED: patellin-5 [Brassica rapa]
Length=698

 Score =   141 bits (356),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 91/128 (71%), Gaps = 3/128 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSREG---DYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIG  509
            +PE VPVQYGGLS +    + +FT  D ATE T+KPT+K T+E  V E+CT+VWE RV+G
Sbjct  566  SPEHVPVQYGGLSVDNCDCNSDFTHEDTATEITVKPTTKQTVEIIVYERCTIVWEIRVVG  625

Query  508  WDVAYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKK  329
            W+V YG+EFVP  +  YT+I++K RK+   DE ++S S+K    GK++LT DN TS +K 
Sbjct  626  WEVMYGAEFVPENKEGYTVIIQKPRKVASGDEPVVSQSFKVGEVGKILLTVDNPTSNKKI  685

Query  328  LLYRSKTK  305
            L+YR K K
Sbjct  686  LIYRFKVK  693



>gb|KDP31746.1| hypothetical protein JCGZ_14978 [Jatropha curcas]
Length=603

 Score =   140 bits (353),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 84/113 (74%), Gaps = 2/113 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            A EQ+PV+YGGLS++G  EF T D  TE  +KP  KHT+EFPV+E C L WE RV+GWDV
Sbjct  477  AAEQIPVKYGGLSKDG--EFGTADAVTEIILKPAGKHTVEFPVSETCLLTWEVRVVGWDV  534

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTS  341
            +Y +EFVP+ E +YT+I++K+RK+   +E ++ NS+K    GKVVLT DN TS
Sbjct  535  SYEAEFVPSGEESYTVIIQKARKVAANEEPVVCNSFKIGEPGKVVLTIDNPTS  587



>emb|CDY05051.1| BnaC03g28490D [Brassica napus]
Length=694

 Score =   141 bits (355),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 66/128 (52%), Positives = 91/128 (71%), Gaps = 3/128 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSREG---DYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIG  509
            +PE VPVQYGGLS +    + +FT  D ATE T+KPT+K T+E  + E+CT+VWE RV+G
Sbjct  562  SPEHVPVQYGGLSVDNCDCNSDFTHEDTATEITVKPTTKQTVEIIIYERCTIVWEIRVVG  621

Query  508  WDVAYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKK  329
            W+V YG+EFVP  +  YT+I++K RK+   DE ++S S+K    GK++LT DN TS +K 
Sbjct  622  WEVMYGAEFVPENKEGYTVIIQKPRKMASGDEPVVSQSFKVGEVGKILLTVDNPTSNKKI  681

Query  328  LLYRSKTK  305
            L+YR K K
Sbjct  682  LIYRFKVK  689



>ref|XP_007137815.1| hypothetical protein PHAVU_009G157900g [Phaseolus vulgaris]
 gb|ESW09809.1| hypothetical protein PHAVU_009G157900g [Phaseolus vulgaris]
Length=558

 Score =   139 bits (350),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 86/113 (76%), Gaps = 2/113 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            A EQ+PV+YGGLS++G  EF   D  TE T++P +KHT+EFPV E   L WE RVIGWDV
Sbjct  431  AAEQLPVKYGGLSKDG--EFGISDAVTEITVRPAAKHTVEFPVAENSLLSWEIRVIGWDV  488

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTS  341
            +YG+EFVP +EG+YT+I++K+ K+  ++E ++ N+YK    GKVVLT DNQ+S
Sbjct  489  SYGAEFVPCSEGSYTVIIQKAIKVASSEEPVLCNNYKIGEPGKVVLTIDNQSS  541



>gb|KCW69562.1| hypothetical protein EUGRSUZ_F029921, partial [Eucalyptus grandis]
Length=244

 Score =   134 bits (338),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 91/126 (72%), Gaps = 4/126 (3%)
 Frame = -2

Query  679  APEQVPVQYGGLSREG---DYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIG  509
            +PEQV VQYGGLS +    + +FT  DPATE T+KP +K  +E  + EKC +VWE RV+G
Sbjct  114  SPEQVAVQYGGLSVDNCDCNPDFTVSDPATEMTVKPGTKQIVEIIIYEKCVIVWELRVVG  173

Query  508  WDVAYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKK  329
            W+V+YG+EFVP + G +++ ++K +K+ P DE ++  ++K    GKV+LT DN TSK+KK
Sbjct  174  WEVSYGAEFVPDS-GEFSVNIQKPKKMSPLDEPVVHGTFKVSELGKVLLTVDNPTSKKKK  232

Query  328  LLYRSK  311
            LLYR K
Sbjct  233  LLYRFK  238



>ref|XP_010064859.1| PREDICTED: patellin-3 [Eucalyptus grandis]
Length=274

 Score =   134 bits (338),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 91/126 (72%), Gaps = 4/126 (3%)
 Frame = -2

Query  679  APEQVPVQYGGLSREG---DYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIG  509
            +PEQV VQYGGLS +    + +FT  DPATE T+KP +K  +E  + EKC +VWE RV+G
Sbjct  144  SPEQVAVQYGGLSVDNCDCNPDFTVSDPATEMTVKPGTKQIVEIIIYEKCVIVWELRVVG  203

Query  508  WDVAYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKK  329
            W+V+YG+EFVP + G +++ ++K +K+ P DE ++  ++K    GKV+LT DN TSK+KK
Sbjct  204  WEVSYGAEFVPDS-GEFSVNIQKPKKMSPLDEPVVHGTFKVSELGKVLLTVDNPTSKKKK  262

Query  328  LLYRSK  311
            LLYR K
Sbjct  263  LLYRFK  268



>ref|XP_008441140.1| PREDICTED: patellin-3-like [Cucumis melo]
Length=530

 Score =   138 bits (347),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 92/130 (71%), Gaps = 7/130 (5%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDY-----EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARV  515
            +PEQVP++YGGL    DY     +F   D ATE +IKP++K T+E  + EKC + WE RV
Sbjct  399  SPEQVPIEYGGLG--VDYCDCNPDFDASDQATEVSIKPSTKQTVEIIIYEKCIIAWELRV  456

Query  514  IGWDVAYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKR  335
            +GW+V+Y +EFVP  E AYT+I++K+RK+   DE +IS+S++    GKV+ T DN TSK+
Sbjct  457  VGWEVSYSAEFVPNNEEAYTVIIQKTRKMAATDEPVISHSFQVFELGKVLFTIDNPTSKK  516

Query  334  KKLLYRSKTK  305
            KKL+YR K K
Sbjct  517  KKLMYRFKVK  526



>ref|XP_003568396.1| PREDICTED: patellin-3-like [Brachypodium distachyon]
Length=601

 Score =   138 bits (348),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 83/113 (73%), Gaps = 0/113 (0%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APEQVPVQ+GGL +E D EF+T D  TE T+KP+SK TIE P TE  T+VWE RV+GW+V
Sbjct  471  APEQVPVQFGGLFKEDDTEFSTSDAVTELTVKPSSKETIEIPATENSTVVWELRVLGWEV  530

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTS  341
            +YG EF P AEG YT+IV+K+RK+   +E I+  ++K    GKVVL  +N TS
Sbjct  531  SYGVEFTPDAEGGYTVIVQKTRKVPANEEPIMKGNFKVTEPGKVVLAVNNPTS  583



>emb|CDX68279.1| BnaA07g23190D [Brassica napus]
Length=531

 Score =   137 bits (346),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 88/124 (71%), Gaps = 2/124 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            +PEQVPV+YGGLS+  D    T D  TE  +KP +K+TI+ P ++ C L WE RV+G DV
Sbjct  404  SPEQVPVKYGGLSK--DIPIATEDTVTEAIVKPAAKYTIDLPASDACMLSWELRVLGADV  461

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
            +YG++F P  EG Y +IV K+R+I   DE +I+ S+K    GK+V+T DNQTSK+KK+LY
Sbjct  462  SYGAQFEPTTEGNYAVIVSKNRRIESTDEPVITESFKVGEPGKIVITIDNQTSKKKKVLY  521

Query  319  RSKT  308
            R KT
Sbjct  522  RFKT  525



>gb|EPS60309.1| hypothetical protein M569_14496, partial [Genlisea aurea]
Length=302

 Score =   134 bits (338),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 63/128 (49%), Positives = 90/128 (70%), Gaps = 4/128 (3%)
 Frame = -2

Query  679  APEQVPVQYGGL---SREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIG  509
            APEQVP++YGGL   + E + +F+  DPATE  IKP++K  +E  V E CT+VWE RV+G
Sbjct  175  APEQVPIRYGGLYLDTCECNPDFSVDDPATELIIKPSTKQIVEIIVNEICTIVWELRVVG  234

Query  508  WDVAYGSEFVPAAEGAYTIIVEKSRKIGP-ADETIISNSYKTDCAGKVVLTFDNQTSKRK  332
            WDV Y +EFVP ++  YT+I++K RK+ P  DE ++SN +  +  GK++L  +N T K+K
Sbjct  235  WDVGYSAEFVPESDQGYTVIIQKGRKMVPTTDEPVLSNRFNINEVGKILLIINNPTPKKK  294

Query  331  KLLYRSKT  308
            +LLYR K 
Sbjct  295  QLLYRFKV  302



>ref|XP_006397198.1| hypothetical protein EUTSA_v10028522mg [Eutrema salsugineum]
 gb|ESQ38651.1| hypothetical protein EUTSA_v10028522mg [Eutrema salsugineum]
Length=604

 Score =   138 bits (347),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 90/128 (70%), Gaps = 3/128 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSREG---DYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIG  509
            +PE VPVQYGGLS +      +FT  D ATE TIKPT+K T+E  V EKCT+VWE RV+G
Sbjct  472  SPEHVPVQYGGLSVDNCDCISDFTHDDTATEITIKPTTKQTVEIIVYEKCTIVWEIRVVG  531

Query  508  WDVAYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKK  329
            W+V YG+EFVP  +G YT+I++K RK+    E ++S S+K    GK++LT DN ++ +K 
Sbjct  532  WEVLYGAEFVPENKGGYTVIIQKPRKMAAKVEPLVSQSFKVGEVGKILLTVDNPSTAKKM  591

Query  328  LLYRSKTK  305
            L+YR K K
Sbjct  592  LIYRFKVK  599



>gb|ACJ85524.1| unknown [Medicago truncatula]
 gb|AFK44639.1| unknown [Medicago truncatula]
Length=465

 Score =   137 bits (344),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 90/127 (71%), Gaps = 3/127 (2%)
 Frame = -2

Query  676  PEQVPVQYGGLSRE---GDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGW  506
            PEQVPVQYGGLS +    + +F+  DP TE  +KP++K T+E  + EKC +VWE RV+GW
Sbjct  335  PEQVPVQYGGLSVDFCDCNPDFSINDPTTEIPVKPSTKQTVEIAIYEKCIIVWELRVVGW  394

Query  505  DVAYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKL  326
            +V+Y +EF P  + AY +I++K+ K+ P DE ++SNS+K    GK+ LT DN T K+K+L
Sbjct  395  EVSYSAEFKPDDKDAYGVIIQKATKMTPTDEPVVSNSFKVAELGKLFLTVDNPTVKKKRL  454

Query  325  LYRSKTK  305
            LYR K K
Sbjct  455  LYRFKIK  461



>ref|XP_010455330.1| PREDICTED: patellin-5-like [Camelina sativa]
Length=618

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/128 (51%), Positives = 89/128 (70%), Gaps = 3/128 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSREG---DYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIG  509
            +PE VPVQYGGLS +    + +FT  D ATE TIKP +K T+E  V EKCT+VWE RV+G
Sbjct  486  SPEHVPVQYGGLSVDNCDCNSDFTHDDVATEITIKPATKQTVEIIVYEKCTIVWEIRVVG  545

Query  508  WDVAYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKK  329
            W+V+Y +EFVP     YT+I++K RK+   +E ++S S+K    G+++LT DN TS +K 
Sbjct  546  WEVSYAAEFVPENNEGYTVIIQKPRKMATKNEPVVSQSFKVGEVGRILLTVDNPTSTKKM  605

Query  328  LLYRSKTK  305
            L+YR K K
Sbjct  606  LIYRFKVK  613



>ref|XP_010685643.1| PREDICTED: patellin-3 [Beta vulgaris subsp. vulgaris]
Length=505

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/126 (52%), Positives = 86/126 (68%), Gaps = 3/126 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSRE---GDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIG  509
            +PEQVP+ YGGLS +    D EFT  DPAT   +K  +K  +E   +EKC +VWE RV+G
Sbjct  374  SPEQVPIHYGGLSTDYCDCDSEFTVDDPATVLNLKTATKQFVEIICSEKCIIVWEVRVVG  433

Query  508  WDVAYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKK  329
            WDV Y +EFVP+A   YT++++K+ K+   D+ +IS S+K    GK+VLT DN T KRKK
Sbjct  434  WDVTYSAEFVPSANDKYTVVMQKATKMTSNDDPVISGSFKVSEVGKIVLTVDNPTFKRKK  493

Query  328  LLYRSK  311
            LLYR K
Sbjct  494  LLYRYK  499



>gb|KJB71407.1| hypothetical protein B456_011G121700 [Gossypium raimondii]
Length=576

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 85/113 (75%), Gaps = 2/113 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            A EQVPV+YGGLS++G  EF   D  TE T+KP +KHT+EFPVTE C L WE RV+GW+V
Sbjct  450  AAEQVPVRYGGLSKDG--EFGNTDAVTEITVKPAAKHTVEFPVTEACLLTWEVRVVGWEV  507

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTS  341
             YG+EFVP+ E +YTII++KS+K+G ++  ++ +++K    GKVVLT  N TS
Sbjct  508  NYGAEFVPSGEDSYTIIIQKSKKVGCSEGEVVCDNFKVGEPGKVVLTIHNPTS  560



>gb|KHG30248.1| Patellin-3 -like protein [Gossypium arboreum]
Length=574

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 85/113 (75%), Gaps = 2/113 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            A EQVPV+YGGLS++G  EF   D  TE T+KP +KHT+EFPVTE C L WE RV+GW+V
Sbjct  448  AAEQVPVRYGGLSKDG--EFGNTDAVTEITVKPAAKHTVEFPVTEACLLTWEVRVVGWEV  505

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTS  341
             YG+EFVP+ E +YTII++KS+K+G ++  ++ +++K    GKVVLT  N TS
Sbjct  506  NYGAEFVPSGEDSYTIIIQKSKKVGCSEGEVVCDNFKVGEPGKVVLTIHNPTS  558



>gb|KHG11540.1| Patellin-5 -like protein [Gossypium arboreum]
Length=544

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 94/123 (76%), Gaps = 3/123 (2%)
 Frame = -2

Query  673  EQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAY  494
            EQVPV+YGGLS+  D EF T +  TE T+KP +KHT+EFPVTE C + WE RVIGW V+Y
Sbjct  418  EQVPVKYGGLSK--DSEFATTETVTEITVKPAAKHTVEFPVTEACLVRWEVRVIGWGVSY  475

Query  493  GSEFVPAAEGAYTIIVEKSRKIGPA-DETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYR  317
            G+EFVP+ E +Y +I++K+RK+  + +E ++ +++K   AGKVVLT  N +SK+KKLLYR
Sbjct  476  GAEFVPSGENSYAVIIQKARKVAASTEEPVVCDNFKVGEAGKVVLTIHNPSSKKKKLLYR  535

Query  316  SKT  308
             K+
Sbjct  536  FKS  538



>ref|XP_006426421.1| hypothetical protein CICLE_v10025217mg [Citrus clementina]
 gb|ESR39661.1| hypothetical protein CICLE_v10025217mg [Citrus clementina]
Length=596

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 88/114 (77%), Gaps = 3/114 (3%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            A EQ+PV+YGGLS+ G  EF   D  TE T+KP +KHT+EFPVTE+C L WE RV+GW+V
Sbjct  458  AAEQLPVKYGGLSKVG--EFAATDAVTEITVKPAAKHTVEFPVTEECNLTWEVRVVGWEV  515

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGP-ADETIISNSYKTDCAGKVVLTFDNQTS  341
            +YG+EFVP+ EG+YT+I++K++K+   A++ ++ +S+K    GKVVLT DN TS
Sbjct  516  SYGAEFVPSTEGSYTVIIQKAKKLASNAEQPVVCDSFKIVEPGKVVLTIDNPTS  569



>ref|XP_010435861.1| PREDICTED: patellin-5-like [Camelina sativa]
Length=619

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/128 (50%), Positives = 90/128 (70%), Gaps = 3/128 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSREG---DYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIG  509
            +PE VPVQYGGLS +    + +FT  D ATE TIKP +K T+E  V EKCT+VWE RV+G
Sbjct  487  SPEHVPVQYGGLSVDNCDCNSDFTHDDVATEITIKPATKQTVEIIVYEKCTIVWEIRVVG  546

Query  508  WDVAYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKK  329
            W+V+Y +EFVP  +  YT+I++K RK+   +E ++S S+K    G+++L+ DN TS +K 
Sbjct  547  WEVSYAAEFVPENKEGYTVIIQKPRKMAAKNEPVVSQSFKVGEVGRILLSVDNPTSTKKM  606

Query  328  LLYRSKTK  305
            L+YR K K
Sbjct  607  LIYRFKVK  614



>gb|KDO58730.1| hypothetical protein CISIN_1g007602mg [Citrus sinensis]
Length=596

 Score =   135 bits (340),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 88/114 (77%), Gaps = 3/114 (3%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            A EQ+PV+YGGLS+ G  EF   D  TE T+KP +KHT+EFPVTE+C L WE RV+GW+V
Sbjct  458  AAEQLPVKYGGLSKVG--EFAATDAVTEITVKPAAKHTVEFPVTEECHLTWEVRVVGWEV  515

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGP-ADETIISNSYKTDCAGKVVLTFDNQTS  341
            +YG+EFVP+ EG+YT+I++K++K+   A++ ++ +S+K    GKVVLT DN TS
Sbjct  516  SYGAEFVPSTEGSYTVIIQKAKKLASNAEQPVVCDSFKIVEPGKVVLTIDNPTS  569



>ref|XP_010421836.1| PREDICTED: patellin-5 [Camelina sativa]
Length=622

 Score =   135 bits (340),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 64/128 (50%), Positives = 89/128 (70%), Gaps = 3/128 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSREG---DYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIG  509
            +PE VPVQYGGLS +    + +FT  D ATE  IKP +K T+E  V EKCT+VWE RV+G
Sbjct  490  SPEHVPVQYGGLSVDNCDCNSDFTHDDVATEIAIKPATKQTVEIIVYEKCTIVWEIRVVG  549

Query  508  WDVAYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKK  329
            W+V+Y +EFVP  +  YT+I++K RK+   +E ++S S+K    G+++LT DN TS +K 
Sbjct  550  WEVSYAAEFVPENKEGYTVIIQKPRKMATKNEPVVSQSFKVGEVGRILLTVDNPTSTKKM  609

Query  328  LLYRSKTK  305
            L+YR K K
Sbjct  610  LIYRFKVK  617



>gb|KFK44348.1| hypothetical protein AALP_AA1G246000 [Arabis alpina]
Length=609

 Score =   135 bits (339),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 67/125 (54%), Positives = 89/125 (71%), Gaps = 2/125 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APE VPV+YGGLS+E    F   D  TE  +K ++K TI+ P +E  TL WE RV+G DV
Sbjct  486  APEVVPVKYGGLSKESP--FAVEDGVTEAVVKSSAKFTIDLPASEGSTLSWELRVLGVDV  543

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
            +YG+ F P+ E +YT+IV K+RKIG  DE +I++S+K    GKVV+T DNQT K+KKL+Y
Sbjct  544  SYGAHFEPSNEASYTVIVSKNRKIGLTDEPVITDSFKASEPGKVVITIDNQTFKKKKLIY  603

Query  319  RSKTK  305
            R KT+
Sbjct  604  RFKTQ  608



>ref|XP_009123116.1| PREDICTED: patellin-2 [Brassica rapa]
Length=706

 Score =   134 bits (337),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/126 (52%), Positives = 88/126 (70%), Gaps = 2/126 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APE VPV+YGGLS+E    F   D  TE  +K ++KH IE P +E  TL WE RV+G DV
Sbjct  583  APEVVPVKYGGLSKESP--FAVEDGVTEAVVKSSAKHIIELPASEGSTLSWELRVLGADV  640

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLY  320
            +YG++F P  E +YT+IV K+RKIG  DE +I++S+K    GK+V+T DN T K+KK++Y
Sbjct  641  SYGAQFEPTNEASYTVIVSKNRKIGLTDEPVITDSFKAGEPGKIVITIDNNTFKKKKVIY  700

Query  319  RSKTKG  302
            R KT+ 
Sbjct  701  RFKTQA  706



>ref|XP_009393444.1| PREDICTED: patellin-3-like [Musa acuminata subsp. malaccensis]
Length=582

 Score =   132 bits (331),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 80/113 (71%), Gaps = 0/113 (0%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDV  500
            APEQVPV +GGLSR+ D +FT+ +   + TI P+SK +IE P TE C LVWE RV+GW+V
Sbjct  455  APEQVPVAFGGLSRDNDPDFTSAEAVVDITIGPSSKESIEIPATETCLLVWELRVLGWEV  514

Query  499  AYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTS  341
             YG+EF P AE  YT+IV+K+RK+   DE +I +S+K    GKVVL   N TS
Sbjct  515  GYGAEFRPNAENGYTVIVQKTRKLVADDEPVIRSSFKISEPGKVVLDIGNLTS  567



>gb|ABR18053.1| unknown [Picea sitchensis]
 gb|ABR18173.1| unknown [Picea sitchensis]
Length=592

 Score =   132 bits (331),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 89/127 (70%), Gaps = 3/127 (2%)
 Frame = -2

Query  679  APEQVPVQYGGLSREGDYEFTTGDPA-TEDTIKPTSKHTIEFPVTEKCT-LVWEARVIGW  506
            +PE VPVQYGGL+RE D EF+  D   TE  IK  +K  I+ P TE  T LVW+  V+GW
Sbjct  464  SPEYVPVQYGGLNRENDQEFSGADGGVTELIIKAGTKQIIDIPATEVGTSLVWDLTVVGW  523

Query  505  DVAYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKL  326
            +V+Y  EF+P+AEG YT+I++K +K+  A E  + NS+K    GKVVLT DN +S++KKL
Sbjct  524  EVSYKEEFIPSAEGCYTVIIQKEKKMA-AQEEAVRNSFKIGEVGKVVLTIDNLSSRKKKL  582

Query  325  LYRSKTK  305
            +YRSK K
Sbjct  583  IYRSKVK  589



>ref|XP_009617343.1| PREDICTED: patellin-3 [Nicotiana tomentosiformis]
Length=523

 Score =   130 bits (328),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 82/116 (71%), Gaps = 3/116 (3%)
 Frame = -2

Query  679  APEQVPVQYGGLSR---EGDYEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIG  509
            +PEQVPVQYGGLS    E + EFT  DPATE  +KP +K T+E  V EKC +VWE RV+G
Sbjct  392  SPEQVPVQYGGLSVDYCECNPEFTVNDPATEIIVKPATKQTVEIIVNEKCIIVWELRVLG  451

Query  508  WDVAYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTS  341
            W+V Y +E+VP  +  YT+ ++K RK+ P DE ++S+S+K    GK++LT DN TS
Sbjct  452  WEVTYSAEYVPNTDSGYTVNIQKPRKMTPTDEPVVSSSFKIVELGKILLTIDNPTS  507



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1104504643240