BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF027L02

Length=717
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KDO75234.1|  hypothetical protein CISIN_1g015465mg                   396   1e-134   Citrus sinensis [apfelsine]
ref|XP_006448884.1|  hypothetical protein CICLE_v10015175mg             396   2e-134   
ref|XP_006468322.1|  PREDICTED: obg-like ATPase 1-like                  396   3e-134   Citrus sinensis [apfelsine]
ref|XP_006448885.1|  hypothetical protein CICLE_v10015175mg             397   1e-133   
gb|KDP34925.1|  hypothetical protein JCGZ_09213                         392   5e-133   Jatropha curcas
gb|EYU43227.1|  hypothetical protein MIMGU_mgv1a007827mg                391   2e-132   Erythranthe guttata [common monkey flower]
ref|XP_003546267.1|  PREDICTED: obg-like ATPase 1-like                  391   2e-132   Glycine max [soybeans]
ref|XP_011085197.1|  PREDICTED: obg-like ATPase 1                       391   3e-132   Sesamum indicum [beniseed]
ref|NP_001242520.1|  uncharacterized protein LOC100793501               391   3e-132   Glycine max [soybeans]
emb|CDP17295.1|  unnamed protein product                                389   1e-131   Coffea canephora [robusta coffee]
gb|AAF65513.1|  GTP-binding protein                                     389   1e-131   Capsicum annuum
ref|XP_004231561.1|  PREDICTED: obg-like ATPase 1                       389   2e-131   Solanum lycopersicum
ref|XP_006360314.1|  PREDICTED: obg-like ATPase 1-like                  389   2e-131   Solanum tuberosum [potatoes]
ref|XP_004293982.1|  PREDICTED: obg-like ATPase 1                       388   4e-131   Fragaria vesca subsp. vesca
ref|XP_007211399.1|  hypothetical protein PRUPE_ppa006821mg             387   7e-131   Prunus persica
ref|XP_002263885.1|  PREDICTED: obg-like ATPase 1                       387   1e-130   Vitis vinifera
ref|XP_008225608.1|  PREDICTED: obg-like ATPase 1                       386   2e-130   Prunus mume [ume]
ref|XP_010478480.1|  PREDICTED: obg-like ATPase 1                       386   2e-130   Camelina sativa [gold-of-pleasure]
ref|XP_010499597.1|  PREDICTED: obg-like ATPase 1                       386   2e-130   Camelina sativa [gold-of-pleasure]
ref|XP_010051911.1|  PREDICTED: obg-like ATPase 1                       386   2e-130   Eucalyptus grandis [rose gum]
ref|XP_010460862.1|  PREDICTED: obg-like ATPase 1                       386   2e-130   Camelina sativa [gold-of-pleasure]
ref|XP_009362223.1|  PREDICTED: obg-like ATPase 1                       385   4e-130   Pyrus x bretschneideri [bai li]
ref|XP_010098556.1|  Obg-like ATPase 1                                  385   5e-130   Morus notabilis
ref|XP_006305006.1|  hypothetical protein CARUB_v10009370mg             384   8e-130   Capsella rubella
ref|XP_010245345.1|  PREDICTED: obg-like ATPase 1                       384   9e-130   Nelumbo nucifera [Indian lotus]
ref|XP_007147477.1|  hypothetical protein PHAVU_006G127800g             384   1e-129   Phaseolus vulgaris [French bean]
ref|XP_002893634.1|  GTP binding protein                                383   2e-129   Arabidopsis lyrata subsp. lyrata
ref|XP_008372236.1|  PREDICTED: obg-like ATPase 1                       383   4e-129   Malus domestica [apple tree]
ref|NP_174346.1|  GTP-binding protein                                   382   6e-129   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006377958.1|  hypothetical protein POPTR_0011s16690g             382   6e-129   Populus trichocarpa [western balsam poplar]
ref|XP_009803590.1|  PREDICTED: obg-like ATPase 1                       382   6e-129   Nicotiana sylvestris
ref|XP_008383389.1|  PREDICTED: obg-like ATPase 1                       382   6e-129   Malus domestica [apple tree]
ref|XP_009603694.1|  PREDICTED: obg-like ATPase 1 {ECO:0000255|HA...    382   1e-128   Nicotiana tomentosiformis
gb|KFK44867.1|  hypothetical protein AALP_AA1G312800                    382   1e-128   Arabis alpina [alpine rockcress]
ref|XP_011037748.1|  PREDICTED: obg-like ATPase 1                       381   1e-128   Populus euphratica
emb|CDY12460.1|  BnaC08g09490D                                          381   2e-128   Brassica napus [oilseed rape]
ref|XP_010519060.1|  PREDICTED: obg-like ATPase 1                       381   2e-128   Tarenaya hassleriana [spider flower]
gb|AAM63059.1|  putative GTP-binding protein                            380   4e-128   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009412029.1|  PREDICTED: obg-like ATPase 1                       380   4e-128   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011039799.1|  PREDICTED: obg-like ATPase 1                       379   8e-128   Populus euphratica
ref|XP_002523184.1|  GTP-dependent nucleic acid-binding protein e...    379   9e-128   Ricinus communis
ref|XP_010926935.1|  PREDICTED: obg-like ATPase 1                       379   1e-127   Elaeis guineensis
ref|XP_002300568.1|  hypothetical protein POPTR_0001s47010g             379   1e-127   Populus trichocarpa [western balsam poplar]
gb|KJB69090.1|  hypothetical protein B456_011G005000                    377   1e-127   Gossypium raimondii
ref|XP_008445378.1|  PREDICTED: obg-like ATPase 1                       379   1e-127   Cucumis melo [Oriental melon]
ref|XP_006415450.1|  hypothetical protein EUTSA_v10007733mg             379   2e-127   
ref|XP_009107765.1|  PREDICTED: obg-like ATPase 1                       378   2e-127   Brassica rapa
gb|KJB69089.1|  hypothetical protein B456_011G005000                    378   2e-127   Gossypium raimondii
ref|NP_001061206.2|  Os08g0199300                                       378   3e-127   
gb|KHF97630.1|  Obg-like ATPase 1                                       377   5e-127   Gossypium arboreum [tree cotton]
emb|CDX77584.1|  BnaA07g07220D                                          377   6e-127   
ref|XP_009144765.1|  PREDICTED: obg-like ATPase 1                       377   6e-127   Brassica rapa
emb|CDX98216.1|  BnaC07g08820D                                          377   6e-127   
ref|XP_004486463.1|  PREDICTED: obg-like ATPase 1-like                  376   1e-126   Cicer arietinum [garbanzo]
gb|AFK48623.1|  unknown                                                 376   2e-126   Lotus japonicus
ref|XP_007022926.1|  GTP binding                                        376   2e-126   Theobroma cacao [chocolate]
ref|XP_010687083.1|  PREDICTED: obg-like ATPase 1                       376   2e-126   Beta vulgaris subsp. vulgaris [field beet]
gb|EEC83063.1|  hypothetical protein OsI_28170                          376   2e-126   Oryza sativa Indica Group [Indian rice]
ref|XP_010538270.1|  PREDICTED: obg-like ATPase 1                       375   5e-126   Tarenaya hassleriana [spider flower]
ref|XP_004135546.1|  PREDICTED: obg-like ATPase 1-like                  375   5e-126   Cucumis sativus [cucumbers]
ref|XP_008799072.1|  PREDICTED: obg-like ATPase 1                       374   7e-126   Phoenix dactylifera
ref|XP_006659204.1|  PREDICTED: obg-like ATPase 1-like                  373   3e-125   Oryza brachyantha
ref|XP_003594539.1|  Obg-like ATPase                                    373   3e-125   Medicago truncatula
ref|XP_003573525.1|  PREDICTED: obg-like ATPase 1                       372   4e-125   Brachypodium distachyon [annual false brome]
gb|ACJ85184.1|  unknown                                                 372   4e-125   Medicago truncatula
ref|XP_010941555.1|  PREDICTED: obg-like ATPase 1                       372   9e-125   
ref|XP_002445191.1|  hypothetical protein SORBIDRAFT_07g005700          370   4e-124   Sorghum bicolor [broomcorn]
gb|AFK49195.1|  unknown                                                 370   5e-124   Medicago truncatula
ref|NP_001150211.1|  GTP-binding protein PTD004                         369   5e-124   Zea mays [maize]
gb|ABK25108.1|  unknown                                                 369   6e-124   Picea sitchensis
ref|XP_004972629.1|  PREDICTED: obg-like ATPase 1-like                  367   5e-123   Setaria italica
emb|CDY02308.1|  BnaA09g25940D                                          363   1e-121   
ref|XP_009115125.1|  PREDICTED: obg-like ATPase 1                       363   3e-121   Brassica rapa
emb|CDY09558.1|  BnaC05g23610D                                          362   6e-121   Brassica napus [oilseed rape]
emb|CDM85617.1|  unnamed protein product                                360   3e-120   Triticum aestivum [Canadian hard winter wheat]
gb|EMS48297.1|  Obg-like ATPase 1                                       357   7e-119   Triticum urartu
gb|EMT28525.1|  Obg-like ATPase 1                                       355   3e-118   
ref|XP_001776504.1|  predicted protein                                  345   2e-114   
ref|XP_011015196.1|  PREDICTED: obg-like ATPase 1                       337   3e-111   Populus euphratica
gb|KDO75236.1|  hypothetical protein CISIN_1g015465mg                   335   3e-110   Citrus sinensis [apfelsine]
ref|XP_002985543.1|  hypothetical protein SELMODRAFT_234816             328   1e-107   Selaginella moellendorffii
ref|XP_008812127.1|  PREDICTED: obg-like ATPase 1                       318   2e-103   
gb|AAP43929.1|  GTP-binding protein                                     306   1e-101   Triticum aestivum [Canadian hard winter wheat]
gb|AFW56959.1|  hypothetical protein ZEAMMB73_810066                    303   3e-101   
gb|AFW56960.1|  hypothetical protein ZEAMMB73_810066                    308   4e-100   
gb|KDO75237.1|  hypothetical protein CISIN_1g015465mg                   306   1e-99    Citrus sinensis [apfelsine]
ref|XP_001699763.1|  flagellar associated protein                       302   2e-97    Chlamydomonas reinhardtii
ref|XP_002953429.1|  hypothetical protein VOLCADRAFT_105955             301   5e-97    Volvox carteri f. nagariensis
gb|KDD75506.1|  DUF933 hypothetical protein                             294   2e-94    Helicosporidium sp. ATCC 50920
ref|XP_005847323.1|  hypothetical protein CHLNCDRAFT_56178              293   3e-94    Chlorella variabilis
ref|XP_005650863.1|  flagellar associated protein                       290   8e-93    Coccomyxa subellipsoidea C-169
gb|KJB69091.1|  hypothetical protein B456_011G005000                    288   2e-92    Gossypium raimondii
ref|XP_011395756.1|  Obg-like ATPase 1                                  284   3e-91    Auxenochlorella protothecoides
ref|XP_003064009.1|  predicted protein                                  285   6e-91    Micromonas pusilla CCMP1545
gb|EMS48298.1|  Obg-like ATPase 1                                       281   3e-90    Triticum urartu
ref|XP_006845996.1|  hypothetical protein AMTR_s00155p00052120          275   3e-90    
ref|XP_001421839.1|  predicted protein                                  283   3e-90    Ostreococcus lucimarinus CCE9901
ref|XP_002502254.1|  predicted protein                                  275   9e-87    Micromonas commoda
emb|CEG00523.1|  P-loop containing nucleoside triphosphate hydrolase    271   2e-85    Ostreococcus tauri
ref|XP_003388006.1|  PREDICTED: obg-like ATPase 1                       271   4e-85    Amphimedon queenslandica
gb|EPY26360.1|  GTP binding protein                                     263   5e-85    Angomonas deanei
ref|XP_005703761.1|  GTP-binding protein                                264   1e-82    Galdieria sulphuraria
gb|EPY25232.1|  GTP binding protein                                     257   2e-82    Angomonas deanei
gb|EPS62769.1|  hypothetical protein M569_12020                         254   4e-82    Genlisea aurea
gb|EPY39657.1|  GTP binding protein                                     262   5e-82    Angomonas deanei
ref|XP_003083821.1|  GTP-binding protein (ISS)                          272   7e-82    
ref|XP_010736093.1|  PREDICTED: obg-like ATPase 1 isoform X2            254   5e-81    
ref|XP_004220982.1|  GTP-binding protein                                258   1e-80    Plasmodium cynomolgi strain B
gb|EPY23726.1|  GTP binding protein                                     254   2e-80    Strigomonas culicis
ref|XP_011488091.1|  PREDICTED: obg-like ATPase 1                       253   3e-80    
ref|XP_008818190.1|  GTP-binding protein YchF                           257   5e-80    Plasmodium inui San Antonio 1
ref|XP_005452977.1|  PREDICTED: obg-like ATPase 1-like isoform X8       252   5e-80    Oreochromis niloticus
gb|EPY30421.1|  GTP binding protein                                     256   8e-80    Angomonas deanei
ref|XP_001466463.1|  putative GTP binding protein                       256   1e-79    Leishmania infantum JPCM5
ref|XP_005452976.1|  PREDICTED: obg-like ATPase 1-like isoform X7       252   2e-79    Oreochromis niloticus
ref|XP_010192575.1|  PREDICTED: obg-like ATPase 1                       249   2e-79    Mesitornis unicolor
ref|XP_005019763.1|  PREDICTED: obg-like ATPase 1                       249   3e-79    
emb|CEG70465.1|  Putative Obg-like ATPase 1                             255   3e-79    Rhizopus microsporus
ref|XP_003722043.1|  putative GTP binding protein                       255   3e-79    Leishmania major strain Friedlin
ref|XP_003876812.1|  putative GTP binding protein                       254   4e-79    Leishmania mexicana MHOM/GT/2001/U1103
ref|XP_009490257.1|  PREDICTED: obg-like ATPase 1                       249   5e-79    Pelecanus crispus
ref|XP_005519867.1|  PREDICTED: obg-like ATPase 1 isoform X4            250   7e-79    
ref|XP_008116321.1|  PREDICTED: obg-like ATPase 1 isoform X3            249   7e-79    Anolis carolinensis [Carolina anole]
ref|XP_004601224.1|  PREDICTED: obg-like ATPase 1 isoform X3            249   8e-79    Sorex araneus [Eurasian shrew]
ref|XP_009581765.1|  PREDICTED: obg-like ATPase 1                       250   8e-79    Fulmarus glacialis
emb|CCC89543.1|  putative GTP binding protein                           254   9e-79    Trypanosoma congolense IL3000
ref|XP_008533775.1|  PREDICTED: obg-like ATPase 1                       248   1e-78    Equus przewalskii [Przewalski horse]
ref|XP_004703789.1|  PREDICTED: obg-like ATPase 1 isoform X3            248   1e-78    Echinops telfairi [lesser hedgehog tenrec]
ref|XP_008929287.1|  PREDICTED: obg-like ATPase 1                       249   1e-78    
ref|XP_005452975.1|  PREDICTED: obg-like ATPase 1-like isoform X6       251   1e-78    
ref|XP_010116935.1|  PREDICTED: obg-like ATPase 1                       249   1e-78    Chlamydotis macqueenii
gb|ETW50152.1|  GTP-binding protein YchF                                253   1e-78    Plasmodium falciparum MaliPS096_E11
ref|XP_009086253.1|  PREDICTED: obg-like ATPase 1 isoform X2            249   1e-78    
ref|XP_010162756.1|  PREDICTED: obg-like ATPase 1                       249   1e-78    Antrostomus carolinensis
ref|XP_010073941.1|  PREDICTED: obg-like ATPase 1                       249   1e-78    Pterocles gutturalis
gb|ETW37410.1|  GTP-binding protein YchF                                253   1e-78    Plasmodium falciparum Tanzania (2000708)
ref|XP_005442958.1|  PREDICTED: obg-like ATPase 1                       249   1e-78    
gb|AAY14876.1|  unknown                                                 247   1e-78    Homo sapiens [man]
gb|EWC89308.1|  GTP-binding protein YchF                                252   1e-78    Plasmodium falciparum NF54
gb|KFP49878.1|  Obg-like ATPase 1                                       249   1e-78    Cathartes aura
gb|ETW39419.1|  GTP-binding protein YchF                                252   1e-78    Plasmodium falciparum NF135/5.C10
ref|XP_668381.1|  GTP-binding protein                                   253   2e-78    Cryptosporidium hominis TU502
gb|ETW28438.1|  GTP-binding protein YchF                                253   2e-78    Plasmodium falciparum FCH/4
ref|XP_003961956.1|  PREDICTED: obg-like ATPase 1-like                  253   2e-78    Takifugu rubripes [tiger puffer]
gb|KFV04274.1|  Obg-like ATPase 1                                       249   2e-78    Tauraco erythrolophus
ref|XP_007431000.1|  PREDICTED: obg-like ATPase 1-like isoform X3       251   2e-78    
ref|XP_009276861.1|  PREDICTED: obg-like ATPase 1                       249   2e-78    Aptenodytes forsteri
emb|CEI96573.1|  Putative Obg-like ATPase 1                             253   2e-78    Rhizopus microsporus
ref|XP_628099.1|  yyaF/YCHF TRANSFAC/OBG family small GTpase plus...    253   2e-78    Cryptosporidium parvum Iowa II
ref|XP_004092018.1|  PREDICTED: obg-like ATPase 1 isoform 2             248   2e-78    Nomascus leucogenys [White-cheeked Gibbon]
gb|EPY37092.1|  GTP binding protein                                     253   3e-78    Strigomonas culicis
ref|XP_009977093.1|  PREDICTED: obg-like ATPase 1                       249   3e-78    Tauraco erythrolophus
ref|XP_004426695.1|  PREDICTED: obg-like ATPase 1 isoform 3             247   3e-78    
emb|CCW63611.1|  unnamed protein product                                252   3e-78    Phytomonas sp. isolate EM1
ref|XP_002261143.1|  GTP-binding protein                                252   3e-78    Plasmodium knowlesi strain H
emb|CAG09966.1|  unnamed protein product                                251   3e-78    Tetraodon nigroviridis
ref|XP_004878683.1|  PREDICTED: obg-like ATPase 1-like                  247   3e-78    
ref|XP_010736092.1|  PREDICTED: obg-like ATPase 1 isoform X1            252   4e-78    Larimichthys crocea [croceine croaker]
ref|NP_001011708.1|  obg-like ATPase 1 isoform 2                        247   4e-78    Homo sapiens [man]
ref|XP_005921550.1|  PREDICTED: obg-like ATPase 1-like isoform X4       248   4e-78    Haplochromis burtoni
gb|ACO12256.1|  Obg-like ATPase 1                                       252   4e-78    Lepeophtheirus salmonis
ref|XP_001612801.1|  GTP-binding protein                                252   4e-78    Plasmodium vivax
gb|AAF71123.1|AF116721_103  PRO2455                                     247   4e-78    Homo sapiens [man]
ref|XP_001349125.1|  conserved GTP-binding protein, putative            252   5e-78    Plasmodium falciparum 3D7
ref|XP_007527278.1|  PREDICTED: obg-like ATPase 1 isoform X2            247   5e-78    Erinaceus europaeus [common hedgehog]
gb|ADD38665.1|  GTP-binding protein CG1354                              252   5e-78    Lepeophtheirus salmonis
gb|KFH65596.1|  GTP-binding protein YchF                                252   5e-78    Mortierella verticillata NRRL 6337
ref|XP_001515633.1|  PREDICTED: obg-like ATPase 1 isoform X1            252   5e-78    Ornithorhynchus anatinus [duck-billed platypus]
ref|XP_007938961.1|  PREDICTED: obg-like ATPase 1 isoform X2            247   5e-78    Orycteropus afer afer
ref|XP_004267373.1|  PREDICTED: obg-like ATPase 1 isoform 2             246   6e-78    Orcinus orca [Orca]
ref|XP_005484131.1|  PREDICTED: obg-like ATPase 1                       248   8e-78    
gb|KFZ54967.1|  Obg-like ATPase 1                                       249   8e-78    Antrostomus carolinensis
ref|XP_007451127.1|  PREDICTED: obg-like ATPase 1 isoform X2            246   8e-78    Lipotes vexillifer [baiji]
ref|XP_005452974.1|  PREDICTED: obg-like ATPase 1-like isoform X5       250   9e-78    Oreochromis niloticus
gb|EHA99193.1|  Obg-like ATPase 1                                       247   9e-78    Heterocephalus glaber [naked mole rat]
gb|ESL11226.1|  GTP-binding protein                                     247   1e-77    Trypanosoma rangeli SC58
ref|XP_007430998.1|  PREDICTED: obg-like ATPase 1-like isoform X1       251   1e-77    Python bivittatus
ref|XP_001368232.1|  PREDICTED: Obg-like ATPase 1                       251   1e-77    Monodelphis domestica
ref|XP_007430999.1|  PREDICTED: obg-like ATPase 1-like isoform X2       251   1e-77    Python bivittatus
ref|XP_009330922.1|  PREDICTED: obg-like ATPase 1 isoform X1            247   2e-77    Pygoscelis adeliae
ref|XP_008136766.1|  PREDICTED: obg-like ATPase 1 isoform X2            245   2e-77    Eptesicus fuscus
emb|CDO63681.1|  GTP-binding protein, putative                          250   2e-77    Plasmodium reichenowi
ref|XP_009236113.1|  PREDICTED: obg-like ATPase 1 isoform X2            245   2e-77    
ref|XP_003764019.1|  PREDICTED: obg-like ATPase 1                       251   2e-77    Sarcophilus harrisii
ref|XP_009932339.1|  PREDICTED: obg-like ATPase 1                       246   2e-77    Opisthocomus hoazin [hoatzin]
ref|XP_010605332.1|  PREDICTED: obg-like ATPase 1 isoform X2            247   2e-77    Fukomys damarensis [Damara mole rat]
gb|KFH07802.1|  putative GTP-binding protein                            243   2e-77    Toxoplasma gondii VAND
ref|XP_005510535.1|  PREDICTED: obg-like ATPase 1-like                  249   2e-77    
gb|AEB61109.1|  obg-like ATPase 1-like protein                          247   2e-77    Equus caballus [domestic horse]
ref|XP_010878192.1|  PREDICTED: obg-like ATPase 1 isoform X4            250   3e-77    
ref|XP_010878191.1|  PREDICTED: obg-like ATPase 1 isoform X3            250   3e-77    Esox lucius
ref|NP_001026425.1|  obg-like ATPase 1                                  250   3e-77    Gallus gallus [bantam]
emb|CBK21211.2|  unnamed protein product                                251   3e-77    Blastocystis hominis
ref|XP_010878190.1|  PREDICTED: obg-like ATPase 1 isoform X2            251   3e-77    Esox lucius
ref|XP_010878189.1|  PREDICTED: obg-like ATPase 1 isoform X1            251   3e-77    Esox lucius
ref|XP_006866714.1|  PREDICTED: obg-like ATPase 1 isoform X2            244   3e-77    Chrysochloris asiatica
ref|XP_009952424.1|  PREDICTED: obg-like ATPase 1                       246   3e-77    Leptosomus discolor
emb|CCW70456.1|  unnamed protein product                                249   4e-77    Phytomonas sp. isolate Hart1
ref|XP_003447358.1|  PREDICTED: obg-like ATPase 1-like isoform X1       249   4e-77    
ref|XP_005452973.1|  PREDICTED: obg-like ATPase 1-like isoform X4       249   4e-77    Oreochromis niloticus
ref|XP_008297045.1|  PREDICTED: obg-like ATPase 1                       249   5e-77    Stegastes partitus
gb|KFH16391.1|  putative GTP-binding protein                            243   6e-77    Toxoplasma gondii MAS
ref|XP_005452972.1|  PREDICTED: obg-like ATPase 1-like isoform X3       250   6e-77    
gb|KFO14346.1|  Obg-like ATPase 1                                       248   6e-77    Balearica regulorum gibbericeps
gb|EFN78354.1|  Obg-like ATPase 1                                       246   7e-77    Harpegnathos saltator
ref|XP_006744648.1|  PREDICTED: obg-like ATPase 1 isoform X2            246   7e-77    Leptonychotes weddellii
gb|KFW10028.1|  Obg-like ATPase 1                                       248   8e-77    Fulmarus glacialis
ref|XP_004341541.1|  GTP binding protein                                249   8e-77    Acanthamoeba castellanii str. Neff
ref|XP_003695060.1|  PREDICTED: GTP-binding protein CG1354-like         249   9e-77    Apis florea [dwarf honeybee]
ref|XP_008275154.1|  PREDICTED: obg-like ATPase 1                       249   9e-77    Stegastes partitus
ref|XP_003442972.1|  PREDICTED: obg-like ATPase 1-like                  249   9e-77    Oreochromis niloticus
ref|XP_006788528.1|  PREDICTED: obg-like ATPase 1-like                  249   1e-76    Neolamprologus brichardi [lyretail cichlid]
gb|KFP41102.1|  Obg-like ATPase 1                                       248   1e-76    Chlamydotis macqueenii
gb|KFM07037.1|  Obg-like ATPase 1                                       248   1e-76    Aptenodytes forsteri
ref|XP_006636567.1|  PREDICTED: obg-like ATPase 1-like isoform X2       247   1e-76    
gb|KFV08740.1|  Obg-like ATPase 1                                       247   1e-76    Pterocles gutturalis
ref|XP_005723778.1|  PREDICTED: obg-like ATPase 1-like                  248   1e-76    Pundamilia nyererei
gb|AGG11697.1|  hypothetical protein                                    248   1e-76    Leptomonas pyrrhocoris
ref|XP_006003588.1|  PREDICTED: obg-like ATPase 1 isoform X2            248   1e-76    Latimeria chalumnae
ref|XP_005798398.1|  PREDICTED: obg-like ATPase 1-like                  248   2e-76    Xiphophorus maculatus
ref|XP_005723547.1|  PREDICTED: obg-like ATPase 1-like isoform X4       246   2e-76    
gb|KFW86891.1|  Obg-like ATPase 1                                       247   2e-76    Manacus vitellinus
ref|XP_008116320.1|  PREDICTED: obg-like ATPase 1 isoform X2            248   2e-76    Anolis carolinensis [Carolina anole]
ref|XP_005799467.1|  PREDICTED: obg-like ATPase 1-like                  248   2e-76    
gb|ETN73871.1|  GTP-binding protein YchF                                248   2e-76    Necator americanus
ref|XP_004557802.1|  PREDICTED: obg-like ATPase 1-like isoform X2       246   2e-76    Maylandia zebra
gb|EYC24730.1|  hypothetical protein Y032_0013g2079                     248   2e-76    Ancylostoma ceylanicum
ref|XP_005723546.1|  PREDICTED: obg-like ATPase 1-like isoform X3       246   2e-76    Pundamilia nyererei
ref|XP_006798459.1|  PREDICTED: obg-like ATPase 1-like                  248   2e-76    Neolamprologus brichardi [lyretail cichlid]
ref|XP_006003587.1|  PREDICTED: obg-like ATPase 1 isoform X1            248   2e-76    Latimeria chalumnae
emb|CDQ57167.1|  unnamed protein product                                248   2e-76    Oncorhynchus mykiss
ref|XP_007576845.1|  PREDICTED: obg-like ATPase 1                       248   2e-76    Poecilia formosa
gb|EDL27121.1|  RIKEN cDNA 2810409H07, isoform CRA_a                    245   2e-76    Mus musculus [mouse]
ref|XP_005237197.1|  PREDICTED: obg-like ATPase 1                       248   2e-76    
ref|XP_005452971.1|  PREDICTED: obg-like ATPase 1-like isoform X2       250   2e-76    
ref|XP_396711.3|  PREDICTED: obg-like ATPase 1-like isoformX1           248   3e-76    
emb|CDJ43406.1|  GTP binding protein, putative                          247   3e-76    Eimeria tenella
ref|NP_001268915.1|  obg-like ATPase 1 isoform 2                        246   3e-76    Danio rerio [leopard danio]
ref|XP_009070315.1|  PREDICTED: obg-like ATPase 1                       247   3e-76    Acanthisitta chloris
ref|XP_002198993.1|  PREDICTED: obg-like ATPase 1 isoform 1             247   3e-76    Taeniopygia guttata
ref|XP_007546548.1|  PREDICTED: obg-like ATPase 1                       247   3e-76    Poecilia formosa
emb|CDJ65501.1|  GTP binding protein, putative                          246   3e-76    Eimeria necatrix
gb|ESL05473.1|  GTP-binding protein                                     246   3e-76    Trypanosoma rangeli SC58
ref|XP_003400207.1|  PREDICTED: GTP-binding protein CG1354-like         247   3e-76    
gb|EGI59771.1|  GTP-binding protein                                     246   4e-76    Acromyrmex echinatior
ref|XP_005049114.1|  PREDICTED: obg-like ATPase 1                       247   4e-76    Ficedula albicollis
ref|XP_005519864.1|  PREDICTED: obg-like ATPase 1 isoform X1            247   4e-76    
ref|XP_008397950.1|  PREDICTED: obg-like ATPase 1                       247   4e-76    Poecilia reticulata
ref|XP_010700320.1|  GTP binding protein, putative                      247   5e-76    Leishmania panamensis
ref|XP_003704224.1|  PREDICTED: GTP-binding protein CG1354-like         247   5e-76    Megachile rotundata
ref|XP_004774421.1|  PREDICTED: obg-like ATPase 1-like isoform X2       246   5e-76    Mustela putorius furo [black ferret]
gb|EIE82570.1|  GTP-binding protein YchF                                247   5e-76    Rhizopus delemar RA 99-880
ref|XP_001566005.1|  putative GTP binding protein                       246   6e-76    Leishmania braziliensis MHOM/BR/75/M2904
ref|XP_005152654.1|  PREDICTED: obg-like ATPase 1                       247   6e-76    Melopsittacus undulatus
ref|XP_008933239.1|  PREDICTED: obg-like ATPase 1                       247   6e-76    Merops nubicus
ref|XP_009680050.1|  PREDICTED: obg-like ATPase 1                       246   6e-76    Struthio camelus australis
ref|XP_009639084.1|  PREDICTED: obg-like ATPase 1                       246   6e-76    Egretta garzetta
ref|XP_010564826.1|  PREDICTED: obg-like ATPase 1                       246   6e-76    Haliaeetus leucocephalus
ref|XP_003225685.1|  PREDICTED: obg-like ATPase 1 isoform X1            246   6e-76    Anolis carolinensis [Carolina anole]
ref|XP_006636566.1|  PREDICTED: obg-like ATPase 1-like isoform X1       247   6e-76    Lepisosteus oculatus
gb|EFN60681.1|  Obg-like ATPase 1                                       244   7e-76    Camponotus floridanus
ref|XP_009311370.1|  GTP-binding protein                                246   8e-76    Trypanosoma grayi
emb|CBH09562.1|  GTP binding protein, putative                          246   8e-76    Trypanosoma brucei gambiense DAL972
ref|XP_005723545.1|  PREDICTED: obg-like ATPase 1-like isoform X2       246   8e-76    
ref|XP_005723544.1|  PREDICTED: obg-like ATPase 1-like isoform X1       246   8e-76    Pundamilia nyererei
ref|XP_004601222.1|  PREDICTED: obg-like ATPase 1 isoform X1            246   9e-76    Sorex araneus [Eurasian shrew]
ref|XP_008326509.1|  PREDICTED: obg-like ATPase 1 isoform X1            246   1e-75    
ref|XP_004557801.1|  PREDICTED: obg-like ATPase 1-like isoform X1       246   1e-75    Maylandia zebra
ref|XP_004703787.1|  PREDICTED: obg-like ATPase 1 isoform X1            246   1e-75    Echinops telfairi [lesser hedgehog tenrec]
ref|XP_008326510.1|  PREDICTED: obg-like ATPase 1 isoform X2            246   1e-75    Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_001635003.1|  predicted protein                                  246   1e-75    Nematostella vectensis
ref|NP_999865.1|  obg-like ATPase 1 isoform 1                           246   1e-75    Danio rerio [leopard danio]
ref|XP_951682.1|  GTP binding protein                                   246   1e-75    Trypanosoma brucei brucei TREU927
ref|XP_011329428.1|  PREDICTED: obg-like ATPase 1                       246   1e-75    
ref|XP_006275601.1|  PREDICTED: obg-like ATPase 1-like isoform X1       246   1e-75    
ref|XP_007060593.1|  PREDICTED: obg-like ATPase 1                       246   1e-75    
ref|XP_005300476.1|  PREDICTED: obg-like ATPase 1 isoform X3            246   1e-75    Chrysemys picta bellii
ref|XP_003494408.1|  PREDICTED: GTP-binding protein CG1354-like         246   1e-75    Bombus impatiens
ref|XP_005300475.1|  PREDICTED: obg-like ATPase 1 isoform X2            246   2e-75    Chrysemys picta bellii
ref|XP_008565607.1|  PREDICTED: obg-like ATPase 1                       244   2e-75    
gb|KFR10255.1|  Obg-like ATPase 1                                       244   2e-75    
ref|XP_006275602.1|  PREDICTED: obg-like ATPase 1-like isoform X2       245   2e-75    
ref|XP_004757606.1|  PREDICTED: obg-like ATPase 1-like                  240   2e-75    
emb|CDH52754.1|  gtp-binding protein                                    245   2e-75    
ref|XP_006878885.1|  PREDICTED: obg-like ATPase 1-like                  245   2e-75    
ref|XP_003253776.1|  PREDICTED: obg-like ATPase 1 isoform 1             245   2e-75    
ref|XP_005300474.1|  PREDICTED: obg-like ATPase 1 isoform X1            245   2e-75    
emb|CDS09858.1|  Putative GTP-binding protein YchF                      245   2e-75    
ref|XP_004476855.1|  PREDICTED: obg-like ATPase 1 isoform 1             245   2e-75    
ref|XP_004476856.1|  PREDICTED: obg-like ATPase 1 isoform 2             245   2e-75    
ref|XP_004426693.1|  PREDICTED: obg-like ATPase 1 isoform 1             245   2e-75    
ref|XP_005573571.1|  PREDICTED: uncharacterized LOC101926459 isof...    245   2e-75    
gb|AIC56285.1|  OLA1                                                    245   3e-75    
ref|XP_005907299.1|  PREDICTED: obg-like ATPase 1                       245   3e-75    
ref|XP_004674578.1|  PREDICTED: obg-like ATPase 1 isoform X1            245   3e-75    
ref|XP_001499403.1|  PREDICTED: Obg-like ATPase 1 isoformX1             245   3e-75    
ref|XP_004092019.1|  PREDICTED: obg-like ATPase 1 isoform 3             245   3e-75    
ref|XP_010988428.1|  PREDICTED: obg-like ATPase 1                       245   3e-75    
ref|XP_005676004.1|  PREDICTED: obg-like ATPase 1                       245   3e-75    
ref|NP_001039510.1|  obg-like ATPase 1                                  245   3e-75    
ref|XP_010356768.1|  PREDICTED: obg-like ATPase 1 isoform X1            245   3e-75    
gb|KFO22378.1|  Obg-like ATPase 1                                       245   3e-75    
ref|XP_004857751.1|  PREDICTED: obg-like ATPase 1-like                  245   3e-75    
ref|XP_004634805.1|  PREDICTED: obg-like ATPase 1 isoform X1            244   3e-75    
ref|XP_004032861.1|  PREDICTED: obg-like ATPase 1-like isoform 1        244   3e-75    
ref|NP_037473.3|  obg-like ATPase 1 isoform 1                           244   3e-75    
ref|XP_002646525.1|  C. briggsae CBR-TAG-210 protein                    244   3e-75    
ref|XP_008685352.1|  PREDICTED: obg-like ATPase 1                       244   3e-75    
ref|XP_006972493.1|  PREDICTED: obg-like ATPase 1                       244   3e-75    
gb|AAD44500.1|  homologous yeast-44.2 protein                           244   3e-75    
dbj|BAB55174.1|  unnamed protein product                                244   3e-75    
ref|XP_011355667.1|  PREDICTED: obg-like ATPase 1 isoform X1            244   3e-75    
ref|XP_010605331.1|  PREDICTED: obg-like ATPase 1 isoform X1            244   3e-75    
ref|XP_008853504.1|  PREDICTED: obg-like ATPase 1                       244   4e-75    
ref|XP_007527277.1|  PREDICTED: obg-like ATPase 1 isoform X1            244   4e-75    
ref|NP_001040339.1|  GTP binding protein                                244   4e-75    
ref|XP_008216612.1|  PREDICTED: obg-like ATPase 1                       244   4e-75    
ref|XP_006116547.1|  PREDICTED: obg-like ATPase 1 isoform X2            245   4e-75    
gb|EPQ02313.1|  Obg-like ATPase 1                                       244   4e-75    
ref|XP_011063638.1|  PREDICTED: obg-like ATPase 1 isoform X1            244   4e-75    
ref|XP_003406265.1|  PREDICTED: obg-like ATPase 1                       244   4e-75    
ref|XP_008996931.1|  PREDICTED: obg-like ATPase 1 isoform X1            244   5e-75    
ref|XP_007183357.1|  PREDICTED: obg-like ATPase 1                       244   5e-75    
ref|XP_010884736.1|  PREDICTED: obg-like ATPase 1                       244   5e-75    
ref|XP_004267372.1|  PREDICTED: obg-like ATPase 1 isoform 1             244   5e-75    
ref|XP_004032863.1|  PREDICTED: obg-like ATPase 1-like isoform 3        245   5e-75    
ref|XP_003474516.1|  PREDICTED: obg-like ATPase 1-like                  244   5e-75    
ref|XP_011148752.1|  PREDICTED: obg-like ATPase 1                       244   5e-75    
ref|XP_007963584.1|  PREDICTED: obg-like ATPase 1 isoform X1            245   5e-75    
ref|XP_007451126.1|  PREDICTED: obg-like ATPase 1 isoform X1            244   5e-75    
ref|XP_011063639.1|  PREDICTED: obg-like ATPase 1 isoform X2            244   6e-75    
ref|XP_008503320.1|  PREDICTED: obg-like ATPase 1                       244   6e-75    
ref|XP_004004627.1|  PREDICTED: obg-like ATPase 1                       245   6e-75    
ref|XP_003478641.1|  PREDICTED: obg-like ATPase 1                       244   6e-75    
ref|XP_001748154.1|  hypothetical protein                               244   8e-75    
ref|XP_004786306.1|  PREDICTED: obg-like ATPase 1-like                  239   8e-75    
gb|EDL79133.1|  similar to RIKEN cDNA 2810409H07, isoform CRA_a         243   8e-75    
gb|KFQ13404.1|  Obg-like ATPase 1                                       239   8e-75    
ref|XP_011162955.1|  PREDICTED: obg-like ATPase 1                       244   9e-75    
gb|AGG11505.1|  hypothetical protein                                    243   9e-75    
gb|EHH54959.1|  hypothetical protein EGM_04072                          244   9e-75    
ref|XP_003884761.1|  putative GTP binding protein                       243   9e-75    
ref|XP_008397269.1|  PREDICTED: obg-like ATPase 1 isoform X1            244   9e-75    
gb|ACO09273.1|  GTP-binding protein PTD004                              243   9e-75    
gb|ETE71660.1|  Obg-like ATPase 1                                       243   1e-74    
ref|XP_005346631.1|  PREDICTED: obg-like ATPase 1                       243   1e-74    
ref|NP_080218.1|  obg-like ATPase 1 isoform a                           243   1e-74    
dbj|BAE39543.1|  unnamed protein product                                243   1e-74    
ref|XP_007248906.1|  PREDICTED: obg-like ATPase 1-like                  243   1e-74    
ref|NP_001029099.1|  obg-like ATPase 1                                  243   1e-74    
gb|EFX64851.1|  hypothetical protein DAPPUDRAFT_333762                  243   1e-74    
dbj|BAE35446.1|  unnamed protein product                                243   1e-74    
ref|XP_005857658.1|  PREDICTED: obg-like ATPase 1                       243   1e-74    
ref|XP_009351070.1|  PREDICTED: obg-like ATPase 1                       243   1e-74    
gb|ELW64153.1|  Obg-like ATPase 1                                       246   1e-74    
gb|ELK32737.1|  Obg-like ATPase 1                                       243   1e-74    
ref|XP_008136765.1|  PREDICTED: obg-like ATPase 1 isoform X1            243   1e-74    
ref|NP_001127505.1|  obg-like ATPase 1                                  243   2e-74    
emb|CAB66481.1|  hypothetical protein                                   243   2e-74    
tpg|DAA13236.1|  TPA: Obg-like ATPase 1-like                            243   2e-74    
gb|AEH16630.1|  GTPase                                                  243   2e-74    
ref|XP_006866713.1|  PREDICTED: obg-like ATPase 1 isoform X1            243   2e-74    
ref|XP_008549165.1|  PREDICTED: obg-like ATPase 1                       240   2e-74    
gb|AAY18927.1|  DKFZp761C10121                                          243   2e-74    
gb|ERG79748.1|  gtp-binding protein                                     243   2e-74    
emb|CDU17077.1|  GTP-binding protein, putative                          241   3e-74    
ref|XP_515918.2|  PREDICTED: obg-like ATPase 1 isoform X1               244   3e-74    
ref|XP_004375552.1|  PREDICTED: obg-like ATPase 1                       242   3e-74    
ref|NP_001254006.1|  Protein OLA-1, isoform a                           242   3e-74    
gb|EGT58351.1|  hypothetical protein CAEBREN_10889                      242   3e-74    
ref|XP_002370768.1|  GTP binding protein, putative                      242   3e-74    
ref|XP_003824289.1|  PREDICTED: obg-like ATPase 1 isoform X1            244   3e-74    
ref|XP_011267424.1|  PREDICTED: obg-like ATPase 1                       242   3e-74    
ref|XP_850320.2|  PREDICTED: LOW QUALITY PROTEIN: Obg-like ATPase...    242   4e-74    
gb|EKF26595.1|  GTP-binding protein, putative                           242   5e-74    
ref|XP_008310339.1|  PREDICTED: obg-like ATPase 1                       241   5e-74    
gb|EUD71003.1|  GTP-binding protein YchF                                241   6e-74    
gb|ETB58464.1|  GTP-binding protein YchF                                241   7e-74    
ref|XP_011498533.1|  PREDICTED: obg-like ATPase 1                       241   7e-74    
ref|XP_008625563.1|  GTP-binding protein YchF                           241   7e-74    
emb|CDR11783.1|  GTP-binding protein, putative                          241   7e-74    
gb|EFX64850.1|  hypothetical protein DAPPUDRAFT_219469                  241   7e-74    
emb|CDJ59407.1|  GTP binding protein, putative                          243   8e-74    
dbj|BAB27201.1|  unnamed protein product                                241   9e-74    
gb|EFA09583.1|  hypothetical protein TcasGA2_TC011700                   239   9e-74    
ref|NP_001158828.1|  obg-like ATPase 1                                  241   9e-74    
ref|XP_008885365.1|  GTP-binding protein, putative                      241   9e-74    
ref|XP_010831175.1|  PREDICTED: obg-like ATPase 1                       241   1e-73    
ref|XP_817773.1|  GTP-binding protein                                   241   1e-73    
ref|XP_003115069.1|  CRE-TAG-210 protein                                241   1e-73    
gb|ETN66120.1|  GTP-binding protein                                     238   1e-73    
ref|XP_007512524.1|  predicted protein                                  241   1e-73    
ref|XP_004521628.1|  PREDICTED: obg-like ATPase 1-like isoform X1       240   2e-73    
ref|XP_730137.1|  hypothetical protein                                  242   2e-73    
ref|XP_002407922.1|  GTP-binding protein, putative                      240   2e-73    
ref|XP_009236111.1|  PREDICTED: obg-like ATPase 1 isoform X1            243   2e-73    
gb|KFW61884.1|  Obg-like ATPase 1                                       239   2e-73    
ref|XP_676964.1|  GTP-binding protein                                   240   2e-73    
ref|XP_003745114.1|  PREDICTED: GTP-binding protein CG1354-like         240   2e-73    
gb|KHN83895.1|  Obg-like ATPase 1                                       241   3e-73    
ref|XP_009553897.1|  PREDICTED: obg-like ATPase 1                       239   3e-73    
ref|NP_001270427.1|  uncharacterized protein LOC101926459               240   3e-73    
emb|CDQ81805.1|  unnamed protein product                                242   4e-73    
gb|ESS62262.1|  GTP-binding protein                                     239   4e-73    
gb|AAO26205.1|  GTP-binding protein                                     239   4e-73    
ref|XP_010747153.1|  PREDICTED: obg-like ATPase 1                       239   4e-73    
ref|XP_007888200.1|  PREDICTED: obg-like ATPase 1                       239   6e-73    
ref|XP_813495.1|  GTP-binding protein                                   239   6e-73    
ref|XP_002163078.2|  PREDICTED: obg-like ATPase 1-like                  239   6e-73    
dbj|BAM19435.1|  GTP-binding protein                                    239   6e-73    
ref|XP_010350251.1|  PREDICTED: LOW QUALITY PROTEIN: obg-like ATP...    241   7e-73    
ref|NP_001079680.1|  obg-like ATPase 1                                  239   7e-73    
ref|XP_002142230.1|  GTP-binding protein                                238   8e-73    
emb|CCD81858.1|  GTP-binding protein-related                            238   9e-73    
emb|CAJ83205.1|  novel protein similar to GTP-binding protein PTD004    238   1e-72    
ref|XP_011213430.1|  PREDICTED: obg-like ATPase 1                       238   1e-72    
emb|CCC46753.1|  putative GTP binding protein                           238   1e-72    
ref|XP_011307687.1|  PREDICTED: obg-like ATPase 1                       238   1e-72    
gb|KCW75747.1|  hypothetical protein EUGRSUZ_D00127                     235   2e-72    
ref|XP_311198.2|  AGAP000672-PA                                         238   2e-72    
ref|XP_011185359.1|  PREDICTED: obg-like ATPase 1                       237   2e-72    
gb|EKG08395.1|  hypothetical protein TCSYLVIO_000468                    237   2e-72    
ref|XP_006174828.1|  PREDICTED: obg-like ATPase 1 isoform X1            237   3e-72    
ref|XP_743834.1|  GTP-binding protein                                   236   3e-72    
gb|KGB37524.1|  Obg-like ATPase 1                                       237   3e-72    
ref|XP_969865.2|  PREDICTED: obg-like ATPase 1                          237   3e-72    
gb|ELR47977.1|  Obg-like ATPase 1                                       237   4e-72    
ref|XP_006020859.1|  PREDICTED: obg-like ATPase 1                       236   5e-72    
ref|XP_002116391.1|  hypothetical protein TRIADDRAFT_30808              236   6e-72    
gb|EUB60715.1|  GTP-binding protein                                     235   7e-72    
ref|XP_001654823.1|  AAEL002160-PA                                      236   7e-72    
ref|XP_010793747.1|  PREDICTED: LOW QUALITY PROTEIN: obg-like ATP...    236   8e-72    
ref|NP_001008044.1|  obg-like ATPase 1                                  236   9e-72    
ref|XP_008472914.1|  PREDICTED: obg-like ATPase 1 isoform X3            236   1e-71    
gb|EPY31725.1|  GTP binding protein                                     235   1e-71    
emb|CDS18927.1|  GTP binding protein CG1354                             236   1e-71    
gb|EHJ68331.1|  GTP binding protein                                     250   1e-71    
gb|ERE71973.1|  obg-like ATPase 1-like protein                          246   1e-71    
gb|EZA60180.1|  GTP-binding protein                                     246   2e-71    
ref|XP_008472913.1|  PREDICTED: obg-like ATPase 1 isoform X2            236   2e-71    
ref|XP_008472912.1|  PREDICTED: obg-like ATPase 1 isoform X1            236   2e-71    
ref|XP_010793340.1|  PREDICTED: obg-like ATPase 1                       234   3e-71    
gb|KFB40079.1|  AGAP000672-PA-like protein                              234   4e-71    
ref|XP_797209.1|  PREDICTED: obg-like ATPase 1-like                     234   4e-71    
ref|XP_002010541.1|  GI15984                                            234   4e-71    
ref|XP_006683298.1|  hypothetical protein BATDEDRAFT_33861              234   4e-71    
ref|XP_001846950.1|  GTP-binding protein                                232   4e-71    
ref|NP_001153863.1|  Obg-like ATPase 1                                  233   9e-71    
ref|XP_004347436.1|  GTP-binding protein                                233   1e-70    
dbj|GAN04407.1|  GTP-binding protein                                    233   1e-70    
gb|EJY78341.1|  putative GTPase, probable translation factor            233   1e-70    
ref|XP_010959009.1|  PREDICTED: obg-like ATPase 1                       233   1e-70    
emb|CDJ01997.1|  GTP binding protein CG1354                             233   2e-70    
ref|XP_001454300.1|  hypothetical protein                               232   2e-70    
gb|EPB88277.1|  obg-like ATPase 1                                       233   2e-70    
ref|XP_001462345.1|  hypothetical protein                               232   2e-70    
emb|CDW82130.1|  gtp-binding protein                                    232   3e-70    
ref|XP_001991915.1|  GH11803                                            232   3e-70    
ref|XP_007370743.1|  cytoplasmic protein                                232   3e-70    
ref|XP_001846949.1|  ras-related protein Rab-10                         231   3e-70    
ref|XP_005182762.2|  PREDICTED: obg-like ATPase 1                       232   3e-70    
ref|XP_006616484.1|  PREDICTED: LOW QUALITY PROTEIN: obg-like ATP...    231   8e-70    
ref|XP_007393236.1|  hypothetical protein PHACADRAFT_251809             230   1e-69    
ref|XP_002055571.1|  GJ18714                                            230   1e-69    
ref|XP_002774229.1|  GTP-binding protein, putative                      230   1e-69    
ref|XP_002772113.1|  GTP-binding protein, putative                      230   1e-69    
ref|XP_008472916.1|  PREDICTED: obg-like ATPase 1                       224   2e-69    
ref|XP_009024324.1|  hypothetical protein HELRODRAFT_187336             230   2e-69    
ref|XP_003962811.1|  PREDICTED: obg-like ATPase 1-like                  230   2e-69    
emb|CEF67024.1|  Obg-like ATPase 1                                      230   2e-69    
ref|XP_005416153.1|  PREDICTED: obg-like ATPase 1                       237   2e-69    
gb|ENN79155.1|  hypothetical protein YQE_04341                          229   2e-69    
ref|XP_002605213.1|  hypothetical protein BRAFLDRAFT_114616             229   2e-69    
ref|XP_005716907.1|  GTP-binding protein of Obg family                  229   3e-69    
ref|XP_002071025.1|  GK25358                                            229   3e-69    
gb|ACX32983.1|  SD24341p                                                228   3e-69    
ref|NP_727364.1|  CG1354, isoform B                                     228   3e-69    
ref|XP_001836147.2|  cytoplasmic protein                                229   4e-69    
ref|XP_002787114.1|  GTP-binding protein, putative                      229   4e-69    
ref|XP_002767889.1|  GTP-binding protein, putative                      228   6e-69    
emb|CDW53501.1|  GTP binding protein CG1354                             228   6e-69    
ref|XP_002124995.1|  PREDICTED: obg-like ATPase 1                       228   7e-69    
gb|EFA85891.1|  GTP-binding protein                                     228   8e-69    
ref|XP_001956259.1|  GF25119                                            228   8e-69    
ref|XP_001977300.1|  GG18324                                            228   9e-69    
ref|XP_002041803.1|  GM11387                                            228   1e-68    
ref|NP_572580.1|  CG1354, isoform A                                     228   2e-68    
gb|ESA10852.1|  hypothetical protein GLOINDRAFT_348023                  227   2e-68    
emb|CDS05214.1|  hypothetical protein LRAMOSA07743                      228   2e-68    
ref|XP_010858116.1|  PREDICTED: obg-like ATPase 1 isoform X2            227   2e-68    
ref|XP_009497559.1|  GTP-binding protein YchF                           226   2e-68    
gb|AEE61569.1|  unknown                                                 227   3e-68    
ref|XP_002101766.1|  GE17809                                            228   3e-68    
ref|XP_008397279.1|  PREDICTED: obg-like ATPase 1 isoform X2            226   4e-68    
gb|KFD67365.1|  hypothetical protein M514_20401                         227   5e-68    
ref|XP_007387865.1|  cytoplasmic protein                                226   6e-68    
emb|CDR96464.1|  GTP-binding protein YchF domain containing prote...    226   7e-68    
ref|XP_005535678.1|  GTP-binding protein of Obg family                  226   8e-68    
ref|XP_007342239.1|  cytoplasmic protein                                225   9e-68    
gb|EJU04665.1|  GTP-dependent nucleic acid-binding protein engD         225   1e-67    



>gb|KDO75234.1| hypothetical protein CISIN_1g015465mg [Citrus sinensis]
Length=374

 Score =   396 bits (1017),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 189/204 (93%), Positives = 195/204 (96%), Gaps = 0/204 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            VK  L +GKD RLG+WKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW
Sbjct  171  VKAWLQDGKDVRLGDWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  230

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            VQEHGGE IIPFS ALER+LADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA
Sbjct  231  VQEHGGEQIIPFSCALERNLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  290

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  176
            GPDEVKCWQIRRQTKAPQAAG IHTD ERGFICAEVMKF+DLKELGSEPAVKA GKY+QE
Sbjct  291  GPDEVKCWQIRRQTKAPQAAGTIHTDFERGFICAEVMKFDDLKELGSEPAVKAAGKYKQE  350

Query  175  GKTYVVQDGDVIFFKFNVSGGGKK  104
            GKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  351  GKTYVVQDGDIIFFKFNVSGGGKK  374



>ref|XP_006448884.1| hypothetical protein CICLE_v10015175mg [Citrus clementina]
 gb|ESR62124.1| hypothetical protein CICLE_v10015175mg [Citrus clementina]
Length=394

 Score =   396 bits (1017),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 189/204 (93%), Positives = 195/204 (96%), Gaps = 0/204 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            VK  L +GKD RLG+WKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW
Sbjct  191  VKAWLQDGKDVRLGDWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  250

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            VQEHGGE IIPFS ALER+LADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA
Sbjct  251  VQEHGGEQIIPFSCALERNLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  310

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  176
            GPDEVKCWQIRRQTKAPQAAG IHTD ERGFICAEVMKF+DLKELGSEPAVKA GKY+QE
Sbjct  311  GPDEVKCWQIRRQTKAPQAAGTIHTDFERGFICAEVMKFDDLKELGSEPAVKAAGKYKQE  370

Query  175  GKTYVVQDGDVIFFKFNVSGGGKK  104
            GKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  371  GKTYVVQDGDIIFFKFNVSGGGKK  394



>ref|XP_006468322.1| PREDICTED: obg-like ATPase 1-like [Citrus sinensis]
 gb|KDO75235.1| hypothetical protein CISIN_1g015465mg [Citrus sinensis]
Length=394

 Score =   396 bits (1017),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 189/204 (93%), Positives = 195/204 (96%), Gaps = 0/204 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            VK  L +GKD RLG+WKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW
Sbjct  191  VKAWLQDGKDVRLGDWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  250

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            VQEHGGE IIPFS ALER+LADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA
Sbjct  251  VQEHGGEQIIPFSCALERNLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  310

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  176
            GPDEVKCWQIRRQTKAPQAAG IHTD ERGFICAEVMKF+DLKELGSEPAVKA GKY+QE
Sbjct  311  GPDEVKCWQIRRQTKAPQAAGTIHTDFERGFICAEVMKFDDLKELGSEPAVKAAGKYKQE  370

Query  175  GKTYVVQDGDVIFFKFNVSGGGKK  104
            GKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  371  GKTYVVQDGDIIFFKFNVSGGGKK  394



>ref|XP_006448885.1| hypothetical protein CICLE_v10015175mg [Citrus clementina]
 gb|ESR62125.1| hypothetical protein CICLE_v10015175mg [Citrus clementina]
Length=460

 Score =   397 bits (1019),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 189/204 (93%), Positives = 195/204 (96%), Gaps = 0/204 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            VK  L +GKD RLG+WKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW
Sbjct  257  VKAWLQDGKDVRLGDWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  316

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            VQEHGGE IIPFS ALER+LADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA
Sbjct  317  VQEHGGEQIIPFSCALERNLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  376

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  176
            GPDEVKCWQIRRQTKAPQAAG IHTD ERGFICAEVMKF+DLKELGSEPAVKA GKY+QE
Sbjct  377  GPDEVKCWQIRRQTKAPQAAGTIHTDFERGFICAEVMKFDDLKELGSEPAVKAAGKYKQE  436

Query  175  GKTYVVQDGDVIFFKFNVSGGGKK  104
            GKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  437  GKTYVVQDGDIIFFKFNVSGGGKK  460



>gb|KDP34925.1| hypothetical protein JCGZ_09213 [Jatropha curcas]
Length=394

 Score =   392 bits (1008),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 187/204 (92%), Positives = 195/204 (96%), Gaps = 0/204 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            VK  L++GKD RLG+WKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW
Sbjct  191  VKAWLEDGKDVRLGDWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  250

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            VQEHGGE IIPFSAA ER+LADM PDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA
Sbjct  251  VQEHGGETIIPFSAAFERNLADMTPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  310

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  176
            GPDEVKCWQIRRQ+KAPQAAG IH+D ERGFICAEVMKFEDLKELGSE AVKAGG+YRQE
Sbjct  311  GPDEVKCWQIRRQSKAPQAAGTIHSDFERGFICAEVMKFEDLKELGSESAVKAGGRYRQE  370

Query  175  GKTYVVQDGDVIFFKFNVSGGGKK  104
            GKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  371  GKTYVVQDGDIIFFKFNVSGGGKK  394



>gb|EYU43227.1| hypothetical protein MIMGU_mgv1a007827mg [Erythranthe guttata]
Length=394

 Score =   391 bits (1005),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 185/204 (91%), Positives = 195/204 (96%), Gaps = 0/204 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            VK SL+EGKDARL +WKAAD+EILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW
Sbjct  191  VKASLEEGKDARLVDWKAADVEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  250

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            VQEHGGE +IPFS +LER+L D+ PDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA
Sbjct  251  VQEHGGETMIPFSCSLERNLTDLSPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  310

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  176
            GPDEVKCWQIRR TKAPQAAGAIHTD E+GFICAEVMKFEDLKELGSEPAVKA GKYRQE
Sbjct  311  GPDEVKCWQIRRLTKAPQAAGAIHTDFEKGFICAEVMKFEDLKELGSEPAVKASGKYRQE  370

Query  175  GKTYVVQDGDVIFFKFNVSGGGKK  104
            GKTY+VQDGD+IFFKFNVSGGGKK
Sbjct  371  GKTYIVQDGDIIFFKFNVSGGGKK  394



>ref|XP_003546267.1| PREDICTED: obg-like ATPase 1-like [Glycine max]
 gb|KHN14324.1| Obg-like ATPase 1 [Glycine soja]
Length=394

 Score =   391 bits (1004),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 187/204 (92%), Positives = 193/204 (95%), Gaps = 0/204 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            VK  L+EGKD RLG+WKAADIEILN+FQLLTAKPVVYLVNM EKDYQRKKNKFLPKIHAW
Sbjct  191  VKALLEEGKDIRLGDWKAADIEILNSFQLLTAKPVVYLVNMTEKDYQRKKNKFLPKIHAW  250

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            VQEHGGE IIPFS ALER+LADMPPDEAAKYCEENK QSAL KIIKTGFSAINLIYFFTA
Sbjct  251  VQEHGGETIIPFSCALERNLADMPPDEAAKYCEENKTQSALTKIIKTGFSAINLIYFFTA  310

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  176
            GPDEVKCWQIRRQTKAPQAAGAIHTD ERGFICAEVMKFEDLKELGSE AVKA GKY+QE
Sbjct  311  GPDEVKCWQIRRQTKAPQAAGAIHTDFERGFICAEVMKFEDLKELGSESAVKAAGKYKQE  370

Query  175  GKTYVVQDGDVIFFKFNVSGGGKK  104
            GKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  371  GKTYVVQDGDIIFFKFNVSGGGKK  394



>ref|XP_011085197.1| PREDICTED: obg-like ATPase 1 [Sesamum indicum]
Length=394

 Score =   391 bits (1004),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 187/204 (92%), Positives = 193/204 (95%), Gaps = 0/204 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            VK SL+EGKDARL EWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW
Sbjct  191  VKASLEEGKDARLVEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  250

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            VQEHGGE IIPFS  LER+LAD+ PDEAAKYCEENKVQSALPKIIKTGF+AINLIYFFTA
Sbjct  251  VQEHGGETIIPFSCVLERNLADISPDEAAKYCEENKVQSALPKIIKTGFAAINLIYFFTA  310

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  176
            GPDEVKCWQIRRQTKAPQAAG IHTD E+GFICAEVMKFEDLKELGSE AVKA GKYRQE
Sbjct  311  GPDEVKCWQIRRQTKAPQAAGTIHTDFEKGFICAEVMKFEDLKELGSESAVKAAGKYRQE  370

Query  175  GKTYVVQDGDVIFFKFNVSGGGKK  104
            GKTYVVQDGD+IFFKFNVS GGKK
Sbjct  371  GKTYVVQDGDIIFFKFNVSSGGKK  394



>ref|NP_001242520.1| uncharacterized protein LOC100793501 [Glycine max]
 gb|ACU21485.1| unknown [Glycine max]
Length=394

 Score =   391 bits (1004),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 187/204 (92%), Positives = 193/204 (95%), Gaps = 0/204 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            VK  L+EGKD RLG+WKAADIEILN+FQLLTAKPVVYLVNM EKDYQRKKNKFLPKIHAW
Sbjct  191  VKALLEEGKDIRLGDWKAADIEILNSFQLLTAKPVVYLVNMTEKDYQRKKNKFLPKIHAW  250

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            VQEHGGE IIPFS ALER+LADMPPDEAAKYCEENK QSAL KIIKTGFSAINLIYFFTA
Sbjct  251  VQEHGGETIIPFSCALERNLADMPPDEAAKYCEENKTQSALTKIIKTGFSAINLIYFFTA  310

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  176
            GPDEVKCWQIRRQTKAPQAAGAIHTD ERGFICAEVMKFEDLKELGSE AVKA GKY+QE
Sbjct  311  GPDEVKCWQIRRQTKAPQAAGAIHTDFERGFICAEVMKFEDLKELGSESAVKAAGKYKQE  370

Query  175  GKTYVVQDGDVIFFKFNVSGGGKK  104
            GKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  371  GKTYVVQDGDIIFFKFNVSGGGKK  394



>emb|CDP17295.1| unnamed protein product [Coffea canephora]
Length=394

 Score =   389 bits (1000),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 187/204 (92%), Positives = 191/204 (94%), Gaps = 0/204 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            VK  L +GKDARLG+WKAADIEILNT QLLTAKPVVYLVNM EKDYQRKKNKFLPKIHAW
Sbjct  191  VKAWLTDGKDARLGDWKAADIEILNTLQLLTAKPVVYLVNMTEKDYQRKKNKFLPKIHAW  250

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            VQEHGGE IIPFS ALER L D+PP+EAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA
Sbjct  251  VQEHGGETIIPFSGALERDLTDLPPEEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  310

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  176
            GPDEVKCWQIRRQTKAPQAAG IHTD ERGFICAEVMKFEDLKELGSE AVKA GKYRQE
Sbjct  311  GPDEVKCWQIRRQTKAPQAAGTIHTDFERGFICAEVMKFEDLKELGSESAVKAAGKYRQE  370

Query  175  GKTYVVQDGDVIFFKFNVSGGGKK  104
            GKTYVVQDGDVIFFKFNVSGGGKK
Sbjct  371  GKTYVVQDGDVIFFKFNVSGGGKK  394



>gb|AAF65513.1| GTP-binding protein [Capsicum annuum]
Length=394

 Score =   389 bits (999),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 183/204 (90%), Positives = 195/204 (96%), Gaps = 0/204 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            VK SL+EGKD RLG+WKAADIE+LNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW
Sbjct  191  VKASLEEGKDVRLGDWKAADIELLNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  250

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            VQEHGG++IIPFSAA+ER+LADMPPDEA+KYCEENK+QS LPKIIKTGFSAINLIYFFTA
Sbjct  251  VQEHGGDIIIPFSAAVERNLADMPPDEASKYCEENKLQSCLPKIIKTGFSAINLIYFFTA  310

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  176
            GPDEVKCWQIRR  KAPQAAG IHTD ERGFICAEVMKF+DLKELGSE AVKA GKY+QE
Sbjct  311  GPDEVKCWQIRRLMKAPQAAGTIHTDFERGFICAEVMKFDDLKELGSEAAVKAAGKYKQE  370

Query  175  GKTYVVQDGDVIFFKFNVSGGGKK  104
            GKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  371  GKTYVVQDGDIIFFKFNVSGGGKK  394



>ref|XP_004231561.1| PREDICTED: obg-like ATPase 1 [Solanum lycopersicum]
Length=394

 Score =   389 bits (999),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 183/204 (90%), Positives = 193/204 (95%), Gaps = 0/204 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            VK SL EGKD RLG+WKAAD+E LNTFQLLTAKP+VYLVNMNEKDYQRKKNKFLPKIHAW
Sbjct  191  VKASLQEGKDVRLGDWKAADVEFLNTFQLLTAKPIVYLVNMNEKDYQRKKNKFLPKIHAW  250

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            VQEHGGE+IIPFSAA+ER+LADMPPDEAAKYCEENK+QS LPKIIKTGF+AINLIYFFTA
Sbjct  251  VQEHGGEIIIPFSAAVERNLADMPPDEAAKYCEENKLQSCLPKIIKTGFAAINLIYFFTA  310

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  176
            GPDEVKCWQIRR  KAPQAAG IHTD ERGFICAEVMKFEDLKELGSE AVKA GKY+QE
Sbjct  311  GPDEVKCWQIRRLMKAPQAAGTIHTDFERGFICAEVMKFEDLKELGSESAVKAAGKYKQE  370

Query  175  GKTYVVQDGDVIFFKFNVSGGGKK  104
            GKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  371  GKTYVVQDGDIIFFKFNVSGGGKK  394



>ref|XP_006360314.1| PREDICTED: obg-like ATPase 1-like [Solanum tuberosum]
Length=394

 Score =   389 bits (998),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 184/204 (90%), Positives = 193/204 (95%), Gaps = 0/204 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            VK SL+EGKD RLGEWKAADIE LNTFQLLTAKP+VYLVNMNEKDYQRKKNKFLPKIHAW
Sbjct  191  VKASLEEGKDVRLGEWKAADIEFLNTFQLLTAKPIVYLVNMNEKDYQRKKNKFLPKIHAW  250

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            VQEHGGE+IIPFSAA+ER+LADMPPDEAAKYCEENK+ S LPKIIKTGF+AINLIYFFTA
Sbjct  251  VQEHGGEIIIPFSAAVERNLADMPPDEAAKYCEENKLISCLPKIIKTGFAAINLIYFFTA  310

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  176
            GPDEVKCWQIRR  KAPQAAG IHTD ERGFICAEVMKFEDLKELGSE AVKA GKY+QE
Sbjct  311  GPDEVKCWQIRRLMKAPQAAGTIHTDFERGFICAEVMKFEDLKELGSESAVKAAGKYKQE  370

Query  175  GKTYVVQDGDVIFFKFNVSGGGKK  104
            GKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  371  GKTYVVQDGDIIFFKFNVSGGGKK  394



>ref|XP_004293982.1| PREDICTED: obg-like ATPase 1 [Fragaria vesca subsp. vesca]
Length=394

 Score =   388 bits (996),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 183/204 (90%), Positives = 195/204 (96%), Gaps = 0/204 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            +K  L++GKD RLG+WKAAD+EILNTFQLLTAKPVVYLVNMNE+DYQRKKNKFLPKIHAW
Sbjct  191  LKAWLEDGKDIRLGDWKAADVEILNTFQLLTAKPVVYLVNMNERDYQRKKNKFLPKIHAW  250

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            VQEHGGE IIPFS ALER+LAD+PPDEAAKYCEENKV+SALPKIIKTGF+AINLIYFFTA
Sbjct  251  VQEHGGEKIIPFSCALERNLADLPPDEAAKYCEENKVESALPKIIKTGFAAINLIYFFTA  310

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  176
            GPDEVKCWQIRR +KAPQAAG IHTD ERGFICAEVMKFEDLKELGSEPAVKA GKYRQE
Sbjct  311  GPDEVKCWQIRRLSKAPQAAGTIHTDFERGFICAEVMKFEDLKELGSEPAVKAAGKYRQE  370

Query  175  GKTYVVQDGDVIFFKFNVSGGGKK  104
            GKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  371  GKTYVVQDGDIIFFKFNVSGGGKK  394



>ref|XP_007211399.1| hypothetical protein PRUPE_ppa006821mg [Prunus persica]
 gb|EMJ12598.1| hypothetical protein PRUPE_ppa006821mg [Prunus persica]
Length=394

 Score =   387 bits (994),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 184/204 (90%), Positives = 194/204 (95%), Gaps = 0/204 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            +K  L++GKD RLGEWKAA++EILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW
Sbjct  191  IKAWLEDGKDVRLGEWKAAEVEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  250

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            VQEHGGE IIPFS ALER+LAD+PP+EAAKYCE+N VQSAL KIIKTGFSAINLIYFFTA
Sbjct  251  VQEHGGEPIIPFSCALERNLADLPPEEAAKYCEQNNVQSALTKIIKTGFSAINLIYFFTA  310

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  176
            GPDEVKCWQIRRQTKAPQAAGAIHTD E+GFICAEVMKFEDLKELGSEPAVKA GKYRQE
Sbjct  311  GPDEVKCWQIRRQTKAPQAAGAIHTDFEKGFICAEVMKFEDLKELGSEPAVKAAGKYRQE  370

Query  175  GKTYVVQDGDVIFFKFNVSGGGKK  104
            GKTYVVQD DVIFFKFNVSGGGKK
Sbjct  371  GKTYVVQDADVIFFKFNVSGGGKK  394



>ref|XP_002263885.1| PREDICTED: obg-like ATPase 1 [Vitis vinifera]
 emb|CBI31027.3| unnamed protein product [Vitis vinifera]
Length=394

 Score =   387 bits (993),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 184/204 (90%), Positives = 193/204 (95%), Gaps = 0/204 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            VK  L++GKD RLG+WKAAD+EILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW
Sbjct  191  VKAFLEDGKDIRLGDWKAADVEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  250

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            VQ+HGGE IIPFS ALER+LADMP DEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA
Sbjct  251  VQDHGGETIIPFSCALERNLADMPEDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  310

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  176
            GPDEVKCWQIRRQTKAPQAAG IH+D ERGFICAEVMKF+DLKELGSE AVKA GKYRQE
Sbjct  311  GPDEVKCWQIRRQTKAPQAAGTIHSDFERGFICAEVMKFDDLKELGSEGAVKAAGKYRQE  370

Query  175  GKTYVVQDGDVIFFKFNVSGGGKK  104
            GKTYVVQD D+IFFKFNVSGGGKK
Sbjct  371  GKTYVVQDADIIFFKFNVSGGGKK  394



>ref|XP_008225608.1| PREDICTED: obg-like ATPase 1 [Prunus mume]
Length=394

 Score =   386 bits (992),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 183/204 (90%), Positives = 194/204 (95%), Gaps = 0/204 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            +K  L++GKD RLGEWKAA++EILNTFQLLTAKPVVYLVNMNE+DYQRKKNKFLPKIHAW
Sbjct  191  IKAWLEDGKDVRLGEWKAAEVEILNTFQLLTAKPVVYLVNMNERDYQRKKNKFLPKIHAW  250

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            VQEHGGE IIPFS ALER+LAD+PP+EAAKYCE+N VQSAL KIIKTGFSAINLIYFFTA
Sbjct  251  VQEHGGEPIIPFSCALERNLADLPPEEAAKYCEQNNVQSALTKIIKTGFSAINLIYFFTA  310

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  176
            GPDEVKCWQIRRQTKAPQAAGAIHTD E+GFICAEVMKFEDLKELGSEPAVKA GKYRQE
Sbjct  311  GPDEVKCWQIRRQTKAPQAAGAIHTDFEKGFICAEVMKFEDLKELGSEPAVKAAGKYRQE  370

Query  175  GKTYVVQDGDVIFFKFNVSGGGKK  104
            GKTYVVQD DVIFFKFNVSGGGKK
Sbjct  371  GKTYVVQDADVIFFKFNVSGGGKK  394



>ref|XP_010478480.1| PREDICTED: obg-like ATPase 1 [Camelina sativa]
Length=394

 Score =   386 bits (991),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 179/204 (88%), Positives = 193/204 (95%), Gaps = 0/204 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            VK  L++GKD R G+WK ADIEILNTFQLL+AKPVVYL+NMNE+DYQRKKNKFLPKIHAW
Sbjct  191  VKAWLEDGKDVRFGDWKTADIEILNTFQLLSAKPVVYLINMNERDYQRKKNKFLPKIHAW  250

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            VQEHGG+ +IPFS   ER+LADMPPDEAAKYCEENK+QSALP+IIKTGFSAINLIYFFTA
Sbjct  251  VQEHGGDTMIPFSGVFERTLADMPPDEAAKYCEENKLQSALPRIIKTGFSAINLIYFFTA  310

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  176
            GPDEVKCWQIRRQ+KAPQAAGAIHTD ERGFICAEVMKFEDLKELG+EPAVKA GKYRQE
Sbjct  311  GPDEVKCWQIRRQSKAPQAAGAIHTDFERGFICAEVMKFEDLKELGNEPAVKAAGKYRQE  370

Query  175  GKTYVVQDGDVIFFKFNVSGGGKK  104
            GKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  371  GKTYVVQDGDIIFFKFNVSGGGKK  394



>ref|XP_010499597.1| PREDICTED: obg-like ATPase 1 [Camelina sativa]
Length=394

 Score =   386 bits (991),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 179/204 (88%), Positives = 193/204 (95%), Gaps = 0/204 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            VK  L++GKD R G+WK ADIEILNTFQLL+AKPVVYL+NMNE+DYQRKKNKFLPKIHAW
Sbjct  191  VKAWLEDGKDVRFGDWKTADIEILNTFQLLSAKPVVYLINMNERDYQRKKNKFLPKIHAW  250

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            VQEHGG+ +IPFS   ER+LADMPPDEAAKYCEENK+QSALP+IIKTGFSAINLIYFFTA
Sbjct  251  VQEHGGDTMIPFSGVFERTLADMPPDEAAKYCEENKLQSALPRIIKTGFSAINLIYFFTA  310

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  176
            GPDEVKCWQIRRQ+KAPQAAGAIHTD ERGFICAEVMKFEDLKELG+EPAVKA GKYRQE
Sbjct  311  GPDEVKCWQIRRQSKAPQAAGAIHTDFERGFICAEVMKFEDLKELGNEPAVKAAGKYRQE  370

Query  175  GKTYVVQDGDVIFFKFNVSGGGKK  104
            GKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  371  GKTYVVQDGDIIFFKFNVSGGGKK  394



>ref|XP_010051911.1| PREDICTED: obg-like ATPase 1 [Eucalyptus grandis]
 gb|KCW75746.1| hypothetical protein EUGRSUZ_D00127 [Eucalyptus grandis]
Length=394

 Score =   386 bits (991),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 185/204 (91%), Positives = 192/204 (94%), Gaps = 0/204 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            VK  L++GKD RLGEWKAAD+EILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW
Sbjct  191  VKAWLEDGKDVRLGEWKAADVEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  250

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            VQEHGGE IIPFS ALER+LAD+  DEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA
Sbjct  251  VQEHGGETIIPFSCALERNLADISADEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  310

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  176
            GPDEVKCWQIRR TKAPQAAG IHTD ERGFICAEVMKFEDLKELGSE AVKA GKY+QE
Sbjct  311  GPDEVKCWQIRRHTKAPQAAGTIHTDFERGFICAEVMKFEDLKELGSESAVKAAGKYKQE  370

Query  175  GKTYVVQDGDVIFFKFNVSGGGKK  104
            GKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  371  GKTYVVQDGDIIFFKFNVSGGGKK  394



>ref|XP_010460862.1| PREDICTED: obg-like ATPase 1 [Camelina sativa]
Length=394

 Score =   386 bits (991),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 179/204 (88%), Positives = 193/204 (95%), Gaps = 0/204 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            VK  L++GKD R G+WK ADIEILNTFQLL+AKPVVYL+NMNE+DYQRKKNKFLPKIHAW
Sbjct  191  VKAWLEDGKDVRFGDWKTADIEILNTFQLLSAKPVVYLINMNERDYQRKKNKFLPKIHAW  250

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            VQEHGG+ +IPFS   ER+LADMPPDEAAKYCEENK+QSALP+IIKTGFSAINLIYFFTA
Sbjct  251  VQEHGGDTMIPFSGVFERTLADMPPDEAAKYCEENKLQSALPRIIKTGFSAINLIYFFTA  310

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  176
            GPDEVKCWQIRRQ+KAPQAAGAIHTD ERGFICAEVMKFEDLKELG+EPAVKA GKYRQE
Sbjct  311  GPDEVKCWQIRRQSKAPQAAGAIHTDFERGFICAEVMKFEDLKELGNEPAVKAAGKYRQE  370

Query  175  GKTYVVQDGDVIFFKFNVSGGGKK  104
            GKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  371  GKTYVVQDGDIIFFKFNVSGGGKK  394



>ref|XP_009362223.1| PREDICTED: obg-like ATPase 1 [Pyrus x bretschneideri]
Length=394

 Score =   385 bits (989),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 183/204 (90%), Positives = 193/204 (95%), Gaps = 0/204 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            +K  L++GKD RLGEWKAA++EILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW
Sbjct  191  IKAWLEDGKDVRLGEWKAAEVEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  250

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            VQEHG E IIPFS ALER+LAD+PP+EAAKYCE+N VQSAL KIIKTGFSAINLIYFFTA
Sbjct  251  VQEHGAEPIIPFSCALERNLADLPPEEAAKYCEQNNVQSALTKIIKTGFSAINLIYFFTA  310

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  176
            GPDEVKCWQIRRQTKAPQAAGAIHTD ERGFICAEVMKF+DLKELGSEPAVKA GKYRQE
Sbjct  311  GPDEVKCWQIRRQTKAPQAAGAIHTDFERGFICAEVMKFDDLKELGSEPAVKAAGKYRQE  370

Query  175  GKTYVVQDGDVIFFKFNVSGGGKK  104
            GKTYVVQD DVIFFKFNVSGGGKK
Sbjct  371  GKTYVVQDADVIFFKFNVSGGGKK  394



>ref|XP_010098556.1| Obg-like ATPase 1 [Morus notabilis]
 gb|EXB75216.1| Obg-like ATPase 1 [Morus notabilis]
Length=394

 Score =   385 bits (989),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 183/204 (90%), Positives = 191/204 (94%), Gaps = 0/204 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            VK  L++GKD RLG+WKAAD+EILN FQLLTAKPVVYLVNMNE+DYQRKKNKFLPKIHAW
Sbjct  191  VKAWLEDGKDVRLGDWKAADVEILNAFQLLTAKPVVYLVNMNERDYQRKKNKFLPKIHAW  250

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            VQEHGGE IIPFS  LER+LADMPPDEAA YCEENKVQSALPKIIKTGFSAINLIYFFTA
Sbjct  251  VQEHGGEQIIPFSCVLERNLADMPPDEAANYCEENKVQSALPKIIKTGFSAINLIYFFTA  310

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  176
            GPDEVKCWQIRRQTKAPQAAG IHTD ERGFICAEVMKFEDLKE GSE AVKA GKY+QE
Sbjct  311  GPDEVKCWQIRRQTKAPQAAGTIHTDFERGFICAEVMKFEDLKEHGSEAAVKAAGKYKQE  370

Query  175  GKTYVVQDGDVIFFKFNVSGGGKK  104
            GKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  371  GKTYVVQDGDIIFFKFNVSGGGKK  394



>ref|XP_006305006.1| hypothetical protein CARUB_v10009370mg [Capsella rubella]
 gb|EOA37904.1| hypothetical protein CARUB_v10009370mg [Capsella rubella]
Length=394

 Score =   384 bits (987),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 179/204 (88%), Positives = 193/204 (95%), Gaps = 0/204 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            VK  L++GKD R G+WKAADIEILNTFQLL+AKPVVYL+NMNE+DYQRKKNKFLPKIHAW
Sbjct  191  VKAWLEDGKDVRFGDWKAADIEILNTFQLLSAKPVVYLINMNERDYQRKKNKFLPKIHAW  250

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            VQEHGG+ +IPFS   ER+LADM PDEAAKYCEENK+QSALP+IIKTGFSAINLIYFFTA
Sbjct  251  VQEHGGDTMIPFSGVFERTLADMAPDEAAKYCEENKLQSALPRIIKTGFSAINLIYFFTA  310

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  176
            GPDEVKCWQIRRQ+KAPQAAGAIHTD ERGFICAEVMKFEDLKELG+EPAVKA GKYRQE
Sbjct  311  GPDEVKCWQIRRQSKAPQAAGAIHTDFERGFICAEVMKFEDLKELGNEPAVKAAGKYRQE  370

Query  175  GKTYVVQDGDVIFFKFNVSGGGKK  104
            GKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  371  GKTYVVQDGDIIFFKFNVSGGGKK  394



>ref|XP_010245345.1| PREDICTED: obg-like ATPase 1 [Nelumbo nucifera]
Length=394

 Score =   384 bits (987),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 184/204 (90%), Positives = 190/204 (93%), Gaps = 0/204 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            VK  L+EGKD RLG+WKAADIEI+NT QLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW
Sbjct  191  VKAWLEEGKDIRLGDWKAADIEIMNTLQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  250

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            VQEHGGE IIPFSA LE++L DMP DEAAKYC ENKVQSALPKIIK GFSAINLIYFFTA
Sbjct  251  VQEHGGETIIPFSAVLEKNLTDMPEDEAAKYCAENKVQSALPKIIKIGFSAINLIYFFTA  310

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  176
            GPDEVKCWQIRRQTKAPQAAG IHTD ERGFICAEVMKFEDLKELGSE AVKA GKYRQE
Sbjct  311  GPDEVKCWQIRRQTKAPQAAGVIHTDFERGFICAEVMKFEDLKELGSESAVKAAGKYRQE  370

Query  175  GKTYVVQDGDVIFFKFNVSGGGKK  104
            GKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  371  GKTYVVQDGDIIFFKFNVSGGGKK  394



>ref|XP_007147477.1| hypothetical protein PHAVU_006G127800g [Phaseolus vulgaris]
 gb|ESW19471.1| hypothetical protein PHAVU_006G127800g [Phaseolus vulgaris]
Length=394

 Score =   384 bits (986),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 183/204 (90%), Positives = 191/204 (94%), Gaps = 0/204 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            VK  L EGKD RLG+WKAADIEILN+FQLLTAKPVVYLVNM EKDYQRKKNKFLPKIHAW
Sbjct  191  VKALLLEGKDVRLGDWKAADIEILNSFQLLTAKPVVYLVNMTEKDYQRKKNKFLPKIHAW  250

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            VQEHGGE IIPFS A ER+L+D+PPDEAAKYCEENK+QSALPKIIKTGFSAINLIYFFTA
Sbjct  251  VQEHGGEQIIPFSCAFERNLSDLPPDEAAKYCEENKIQSALPKIIKTGFSAINLIYFFTA  310

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  176
            GPDEVKCWQIRRQTKAPQAAGAIHTD ERGFICAEVMKFEDLKE  SE AVKA GKY+QE
Sbjct  311  GPDEVKCWQIRRQTKAPQAAGAIHTDFERGFICAEVMKFEDLKEHSSESAVKAAGKYKQE  370

Query  175  GKTYVVQDGDVIFFKFNVSGGGKK  104
            GKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  371  GKTYVVQDGDIIFFKFNVSGGGKK  394



>ref|XP_002893634.1| GTP binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69893.1| GTP binding protein [Arabidopsis lyrata subsp. lyrata]
Length=394

 Score =   383 bits (984),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 179/204 (88%), Positives = 192/204 (94%), Gaps = 0/204 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            VK  L++GKD R G+WK ADIEILNTFQLL+AKPVVYL+NMNE+DYQRKKNKFLPKIHAW
Sbjct  191  VKAWLEDGKDVRFGDWKTADIEILNTFQLLSAKPVVYLINMNERDYQRKKNKFLPKIHAW  250

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            VQEHGG+ +IPFS   ERSLADM PDEAAKYCEENK+QSALP+IIKTGFSAINLIYFFTA
Sbjct  251  VQEHGGDTMIPFSGVFERSLADMAPDEAAKYCEENKLQSALPRIIKTGFSAINLIYFFTA  310

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  176
            GPDEVKCWQIRRQ+KAPQAAGAIHTD ERGFICAEVMKFEDLKELG+EPAVKA GKYRQE
Sbjct  311  GPDEVKCWQIRRQSKAPQAAGAIHTDFERGFICAEVMKFEDLKELGNEPAVKAAGKYRQE  370

Query  175  GKTYVVQDGDVIFFKFNVSGGGKK  104
            GKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  371  GKTYVVQDGDIIFFKFNVSGGGKK  394



>ref|XP_008372236.1| PREDICTED: obg-like ATPase 1 [Malus domestica]
Length=394

 Score =   383 bits (983),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 182/204 (89%), Positives = 192/204 (94%), Gaps = 0/204 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            +K  L++GKD RLGEWKAA++EILN FQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW
Sbjct  191  IKAWLEDGKDVRLGEWKAAEVEILNPFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  250

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            VQEHG E IIPFS ALER+LAD+PP+EAAKYCE+N VQSAL KIIKTGFSAINLIYFFTA
Sbjct  251  VQEHGAEPIIPFSCALERNLADLPPEEAAKYCEQNNVQSALTKIIKTGFSAINLIYFFTA  310

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  176
            GPDEVKCWQIRRQTKAPQAAGAIHTD ERGFICAEVMKF+DLKELGSEPAVKA GKYRQE
Sbjct  311  GPDEVKCWQIRRQTKAPQAAGAIHTDFERGFICAEVMKFDDLKELGSEPAVKAAGKYRQE  370

Query  175  GKTYVVQDGDVIFFKFNVSGGGKK  104
            GKTYVVQD DVIFFKFNVSGGGKK
Sbjct  371  GKTYVVQDADVIFFKFNVSGGGKK  394



>ref|NP_174346.1| GTP-binding protein [Arabidopsis thaliana]
 gb|AAD25745.1|AC007060_3 Similar to WO8E3.3 gi|3880615 putative GTP-binding protein from 
C. elegans cosmid gb|Z92773. EST gb|AA597331 comes from this 
gene [Arabidopsis thaliana]
 gb|ABG25054.1| At1g30580 [Arabidopsis thaliana]
 gb|AEE31246.1| GTP-binding protein [Arabidopsis thaliana]
Length=394

 Score =   382 bits (982),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 178/204 (87%), Positives = 192/204 (94%), Gaps = 0/204 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            VK  L++GKD R G+WK ADIEILNTFQLL+AKPVVYL+N+NE+DYQRKKNKFLPKIHAW
Sbjct  191  VKAWLEDGKDVRFGDWKTADIEILNTFQLLSAKPVVYLINLNERDYQRKKNKFLPKIHAW  250

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            VQEHGG+ +IPFS   ERSLADM PDEAAKYCEENK+QSALP+IIKTGFSAINLIYFFTA
Sbjct  251  VQEHGGDTMIPFSGVFERSLADMAPDEAAKYCEENKLQSALPRIIKTGFSAINLIYFFTA  310

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  176
            GPDEVKCWQIRRQ+KAPQAAGAIHTD ERGFICAEVMKFEDLKELG+EPAVKA GKYRQE
Sbjct  311  GPDEVKCWQIRRQSKAPQAAGAIHTDFERGFICAEVMKFEDLKELGNEPAVKAAGKYRQE  370

Query  175  GKTYVVQDGDVIFFKFNVSGGGKK  104
            GKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  371  GKTYVVQDGDIIFFKFNVSGGGKK  394



>ref|XP_006377958.1| hypothetical protein POPTR_0011s16690g [Populus trichocarpa]
 gb|ERP55755.1| hypothetical protein POPTR_0011s16690g [Populus trichocarpa]
Length=394

 Score =   382 bits (981),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 182/204 (89%), Positives = 190/204 (93%), Gaps = 0/204 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            VK  L+E KD RLGEWKAADIEILNTFQLLTAKPVVYL+NMNEKDYQRKKNKFLPKIHAW
Sbjct  191  VKAWLEEEKDVRLGEWKAADIEILNTFQLLTAKPVVYLINMNEKDYQRKKNKFLPKIHAW  250

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            VQEHGGE IIPFS  LER+LADM PDEAAKYCEENK+QS LPKI+K GFSAINLIYFFTA
Sbjct  251  VQEHGGETIIPFSCILERTLADMLPDEAAKYCEENKLQSCLPKILKIGFSAINLIYFFTA  310

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  176
            GPDEVKCWQIRRQTKAPQAAG IHTD ERGFICAEVMKF+DLKELGSE AVKA GKY+QE
Sbjct  311  GPDEVKCWQIRRQTKAPQAAGTIHTDFERGFICAEVMKFDDLKELGSESAVKAAGKYKQE  370

Query  175  GKTYVVQDGDVIFFKFNVSGGGKK  104
            GKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  371  GKTYVVQDGDIIFFKFNVSGGGKK  394



>ref|XP_009803590.1| PREDICTED: obg-like ATPase 1 [Nicotiana sylvestris]
Length=394

 Score =   382 bits (981),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 180/204 (88%), Positives = 191/204 (94%), Gaps = 0/204 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            V  SL EGKD RLG+WKAAD+E LNTFQLLTAKPVVYLVNMNEKDY RKKNKFLPKIHAW
Sbjct  191  VMASLKEGKDIRLGDWKAADVEFLNTFQLLTAKPVVYLVNMNEKDYARKKNKFLPKIHAW  250

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            VQEHGGE+IIPFSAA+ER+LADMPPDEA+KYCEENK+QS LPKIIKTGF+AINLIYFFTA
Sbjct  251  VQEHGGEIIIPFSAAVERNLADMPPDEASKYCEENKLQSCLPKIIKTGFAAINLIYFFTA  310

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  176
            GPDEVKCWQIRR  KAPQAAG IHTD ERGFICAEVMKF+DLKELGSE AVKA GKY+QE
Sbjct  311  GPDEVKCWQIRRLMKAPQAAGTIHTDFERGFICAEVMKFDDLKELGSEAAVKAAGKYKQE  370

Query  175  GKTYVVQDGDVIFFKFNVSGGGKK  104
            GKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  371  GKTYVVQDGDIIFFKFNVSGGGKK  394



>ref|XP_008383389.1| PREDICTED: obg-like ATPase 1 [Malus domestica]
Length=394

 Score =   382 bits (981),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 182/204 (89%), Positives = 192/204 (94%), Gaps = 0/204 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            +K  L+ GKD RLG+WKAA++EILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW
Sbjct  191  IKAWLEGGKDVRLGDWKAAEVEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  250

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            VQEHG E IIPFS ALER+LAD+PP+EAAKYCE+N VQSAL KIIKTGFSAINLIYFFTA
Sbjct  251  VQEHGAEPIIPFSCALERNLADLPPEEAAKYCEQNNVQSALTKIIKTGFSAINLIYFFTA  310

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  176
            GPDEVKCWQIRRQTKAPQAAGAIHTD ERGFICAEVMKF+DLKELGSEPAVKA GKYRQE
Sbjct  311  GPDEVKCWQIRRQTKAPQAAGAIHTDFERGFICAEVMKFDDLKELGSEPAVKAAGKYRQE  370

Query  175  GKTYVVQDGDVIFFKFNVSGGGKK  104
            GKTYVVQD DVIFFKFNVSGGGKK
Sbjct  371  GKTYVVQDADVIFFKFNVSGGGKK  394



>ref|XP_009603694.1| PREDICTED: obg-like ATPase 1 {ECO:0000255|HAMAP-Rule:MF_03167} 
[Nicotiana tomentosiformis]
Length=394

 Score =   382 bits (980),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 180/204 (88%), Positives = 191/204 (94%), Gaps = 0/204 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            V  SL EGKD RLG+WKAADIE LNTFQLLTAKPVVYLVNMNEKDY RKKNKFLPKIHAW
Sbjct  191  VMASLKEGKDIRLGDWKAADIEFLNTFQLLTAKPVVYLVNMNEKDYARKKNKFLPKIHAW  250

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            VQEHGGE+IIPFSAA+ER+LADMPPDEA++YCEENK+QS LPKIIKTGF+AINLIYFFTA
Sbjct  251  VQEHGGEIIIPFSAAVERNLADMPPDEASQYCEENKLQSCLPKIIKTGFAAINLIYFFTA  310

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  176
            GPDEVKCWQIRR  KAPQAAG IHTD ERGFICAEVMKF+DLKELGSE AVKA GKY+QE
Sbjct  311  GPDEVKCWQIRRLMKAPQAAGTIHTDFERGFICAEVMKFDDLKELGSEAAVKAAGKYKQE  370

Query  175  GKTYVVQDGDVIFFKFNVSGGGKK  104
            GKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  371  GKTYVVQDGDIIFFKFNVSGGGKK  394



>gb|KFK44867.1| hypothetical protein AALP_AA1G312800 [Arabis alpina]
Length=394

 Score =   382 bits (980),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 178/204 (87%), Positives = 192/204 (94%), Gaps = 0/204 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            VK  L+EGKD R G+WKAADIEILNTFQLL+AKPVVYL+NMNE+DYQRKKNKFLPKIHAW
Sbjct  191  VKAWLEEGKDVRFGDWKAADIEILNTFQLLSAKPVVYLINMNERDYQRKKNKFLPKIHAW  250

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            VQEHGG+ +IPFS   ER++ADM PDEAAKYCEENK+QSALP+IIKTGFSAINLIYFFTA
Sbjct  251  VQEHGGDTMIPFSGVFERTIADMAPDEAAKYCEENKLQSALPRIIKTGFSAINLIYFFTA  310

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  176
            GPDEVKCWQIRRQ+KAPQAAGAIHTD ERGFICAEVMKFEDLKELG+E AVKA GKYRQE
Sbjct  311  GPDEVKCWQIRRQSKAPQAAGAIHTDFERGFICAEVMKFEDLKELGNETAVKAAGKYRQE  370

Query  175  GKTYVVQDGDVIFFKFNVSGGGKK  104
            GKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  371  GKTYVVQDGDIIFFKFNVSGGGKK  394



>ref|XP_011037748.1| PREDICTED: obg-like ATPase 1 [Populus euphratica]
Length=394

 Score =   381 bits (979),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 182/204 (89%), Positives = 189/204 (93%), Gaps = 0/204 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            V   L+E KD RLGEWKAADIEILNTFQLLTAKPVVYL+NMNEKDYQRKKNKFLPKIHAW
Sbjct  191  VNAWLEEEKDVRLGEWKAADIEILNTFQLLTAKPVVYLINMNEKDYQRKKNKFLPKIHAW  250

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            VQEHGGE IIPFS  LER+LADM PDEAAKYCEENK+QS LPKIIK GFSAINLIYFFTA
Sbjct  251  VQEHGGETIIPFSCILERTLADMLPDEAAKYCEENKLQSCLPKIIKIGFSAINLIYFFTA  310

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  176
            GPDEVKCWQIRRQTKAPQAAG IHTD ERGFICAEVMKF+DLKELGSE AVKA GKY+QE
Sbjct  311  GPDEVKCWQIRRQTKAPQAAGTIHTDFERGFICAEVMKFDDLKELGSESAVKAAGKYKQE  370

Query  175  GKTYVVQDGDVIFFKFNVSGGGKK  104
            GKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  371  GKTYVVQDGDIIFFKFNVSGGGKK  394



>emb|CDY12460.1| BnaC08g09490D [Brassica napus]
Length=394

 Score =   381 bits (978),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 179/204 (88%), Positives = 191/204 (94%), Gaps = 0/204 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            VK  L+EGKD R G+WKAADIEILNTFQLL+AKPVVYL+NMNE+DYQRKKNKFLPKIHAW
Sbjct  191  VKAWLEEGKDVRFGDWKAADIEILNTFQLLSAKPVVYLINMNERDYQRKKNKFLPKIHAW  250

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            VQEHGG+ +IPFS   ERSLADM PDEAAKYCEENK+QSALP+IIKTGFSAINLIYFFTA
Sbjct  251  VQEHGGDTMIPFSGVFERSLADMLPDEAAKYCEENKLQSALPRIIKTGFSAINLIYFFTA  310

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  176
            GPDEVKCWQIRRQ+KAPQAAGAIHTD ERGFICAEVMKFEDLKELG+E AVK  GKYRQE
Sbjct  311  GPDEVKCWQIRRQSKAPQAAGAIHTDFERGFICAEVMKFEDLKELGNETAVKGAGKYRQE  370

Query  175  GKTYVVQDGDVIFFKFNVSGGGKK  104
            GKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  371  GKTYVVQDGDIIFFKFNVSGGGKK  394



>ref|XP_010519060.1| PREDICTED: obg-like ATPase 1 [Tarenaya hassleriana]
Length=395

 Score =   381 bits (978),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 183/204 (90%), Positives = 191/204 (94%), Gaps = 0/204 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            VK  L++GKD RLGEWKAADIEILNTFQLL+AKPVVYLVNM E+DYQRKKNKFLPKIHAW
Sbjct  192  VKAWLEDGKDIRLGEWKAADIEILNTFQLLSAKPVVYLVNMTERDYQRKKNKFLPKIHAW  251

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            VQEHGGE IIPFS  LER+LADM PDEAAKYCEENKVQSAL KIIKTGFSAINLIYFFTA
Sbjct  252  VQEHGGEQIIPFSGVLERNLADMLPDEAAKYCEENKVQSALSKIIKTGFSAINLIYFFTA  311

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  176
            GPDEVKCWQIRRQTKAPQAAG IHTD E+GFICAEVMKFEDLKELG+E AVKA GKYRQE
Sbjct  312  GPDEVKCWQIRRQTKAPQAAGTIHTDFEKGFICAEVMKFEDLKELGNEGAVKAAGKYRQE  371

Query  175  GKTYVVQDGDVIFFKFNVSGGGKK  104
            GKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  372  GKTYVVQDGDIIFFKFNVSGGGKK  395



>gb|AAM63059.1| putative GTP-binding protein [Arabidopsis thaliana]
Length=394

 Score =   380 bits (976),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 177/204 (87%), Positives = 191/204 (94%), Gaps = 0/204 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            VK  L++GKD R G+WK ADIEILNTFQLL+AKPVVYL+N+NE+DYQRKKNKFLPKIHAW
Sbjct  191  VKAWLEDGKDVRFGDWKTADIEILNTFQLLSAKPVVYLINLNERDYQRKKNKFLPKIHAW  250

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            VQEHGG+ +IPFS   ERSLADM PDEAAKYCEENK+QSALP+IIKTGFSAINLIYFFTA
Sbjct  251  VQEHGGDTMIPFSGVFERSLADMAPDEAAKYCEENKLQSALPRIIKTGFSAINLIYFFTA  310

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  176
            GPDEVKCWQIRRQ+KAPQAAGAIHTD ERGFICAEVMKFEDLKELG+EPAVKA GKYRQE
Sbjct  311  GPDEVKCWQIRRQSKAPQAAGAIHTDFERGFICAEVMKFEDLKELGNEPAVKAAGKYRQE  370

Query  175  GKTYVVQDGDVIFFKFNVSGGGKK  104
            GKTY VQDGD+IFFKFNVSGGGKK
Sbjct  371  GKTYFVQDGDIIFFKFNVSGGGKK  394



>ref|XP_009412029.1| PREDICTED: obg-like ATPase 1 [Musa acuminata subsp. malaccensis]
Length=394

 Score =   380 bits (976),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 180/204 (88%), Positives = 190/204 (93%), Gaps = 0/204 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            +K  L++GKD RLG+WKAAD+EILN+FQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW
Sbjct  191  IKAWLNDGKDVRLGDWKAADVEILNSFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  250

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            VQEHGGE IIP S  LE+ L DMP DEAAKYCEENKVQS LPKIIKTGF+AINLIYFFTA
Sbjct  251  VQEHGGEPIIPVSCVLEKKLVDMPEDEAAKYCEENKVQSVLPKIIKTGFAAINLIYFFTA  310

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  176
            GPDEVKCWQIRRQTKAPQAAGAIHTD ERGFICAEVMKF+DLKELGSE AVKA GKYRQE
Sbjct  311  GPDEVKCWQIRRQTKAPQAAGAIHTDFERGFICAEVMKFDDLKELGSESAVKAAGKYRQE  370

Query  175  GKTYVVQDGDVIFFKFNVSGGGKK  104
            GKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  371  GKTYVVQDGDIIFFKFNVSGGGKK  394



>ref|XP_011039799.1| PREDICTED: obg-like ATPase 1 [Populus euphratica]
Length=394

 Score =   379 bits (974),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 181/204 (89%), Positives = 188/204 (92%), Gaps = 0/204 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            VK  L+E KD RLG+WKAADIEILNTFQLLTAKPVVYLVNMNE+DYQRKKNKFLPKIH W
Sbjct  191  VKAWLEEEKDVRLGDWKAADIEILNTFQLLTAKPVVYLVNMNERDYQRKKNKFLPKIHTW  250

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            VQEHGGE IIPFS  LER+LADM P E AKYCEENKVQSALPKIIKTGFSAINLIYFFTA
Sbjct  251  VQEHGGETIIPFSCVLERNLADMLPHEGAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  310

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  176
            GPDEVKCWQIRRQTK PQAAG IHTD ERGFICAEVMKF+DLKELGSE AVKA GKY+QE
Sbjct  311  GPDEVKCWQIRRQTKTPQAAGTIHTDFERGFICAEVMKFDDLKELGSESAVKAAGKYKQE  370

Query  175  GKTYVVQDGDVIFFKFNVSGGGKK  104
            GKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  371  GKTYVVQDGDIIFFKFNVSGGGKK  394



>ref|XP_002523184.1| GTP-dependent nucleic acid-binding protein engD, putative [Ricinus 
communis]
 gb|EEF39215.1| GTP-dependent nucleic acid-binding protein engD, putative [Ricinus 
communis]
Length=394

 Score =   379 bits (974),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 180/204 (88%), Positives = 192/204 (94%), Gaps = 0/204 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            VK  L++ KD RLG+WKAA+IEI+NTFQLLTAKPVVYLVNMNE+DYQRKKNKFLPKIHAW
Sbjct  191  VKAWLEDEKDVRLGDWKAAEIEIMNTFQLLTAKPVVYLVNMNERDYQRKKNKFLPKIHAW  250

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            +QEHGGE IIPFS  LE++LAD+ PDEA KYCEENKVQSALPKIIKTGFSAINLIYFFTA
Sbjct  251  LQEHGGETIIPFSCVLEQNLADISPDEATKYCEENKVQSALPKIIKTGFSAINLIYFFTA  310

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  176
            GPDEVKCWQIRRQTKAPQAAGAIHTD E+GFICAEVMKFEDLKELGSE AVKA GKYRQE
Sbjct  311  GPDEVKCWQIRRQTKAPQAAGAIHTDFEKGFICAEVMKFEDLKELGSEAAVKAAGKYRQE  370

Query  175  GKTYVVQDGDVIFFKFNVSGGGKK  104
            GKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  371  GKTYVVQDGDIIFFKFNVSGGGKK  394



>ref|XP_010926935.1| PREDICTED: obg-like ATPase 1 [Elaeis guineensis]
 ref|XP_010926936.1| PREDICTED: obg-like ATPase 1 [Elaeis guineensis]
 ref|XP_010926937.1| PREDICTED: obg-like ATPase 1 [Elaeis guineensis]
Length=394

 Score =   379 bits (973),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 180/204 (88%), Positives = 191/204 (94%), Gaps = 0/204 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            V   L +GKD RLG+WKAAD+EILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW
Sbjct  191  VTAWLKDGKDVRLGDWKAADVEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  250

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            VQ+HGGE IIPFS  LE++L DMP DEAAKYCEENKVQSA+PKIIKTGF+AINLIYFFTA
Sbjct  251  VQDHGGEPIIPFSCVLEKNLVDMPEDEAAKYCEENKVQSAIPKIIKTGFAAINLIYFFTA  310

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  176
            GPDEVKCWQIRRQTKAPQAAGAIHTD E+GFICAEVMKFE+LKELGSE AVKA GKYRQE
Sbjct  311  GPDEVKCWQIRRQTKAPQAAGAIHTDFEKGFICAEVMKFEELKELGSEAAVKAAGKYRQE  370

Query  175  GKTYVVQDGDVIFFKFNVSGGGKK  104
            GKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  371  GKTYVVQDGDIIFFKFNVSGGGKK  394



>ref|XP_002300568.1| hypothetical protein POPTR_0001s47010g [Populus trichocarpa]
 gb|EEE85373.1| hypothetical protein POPTR_0001s47010g [Populus trichocarpa]
Length=394

 Score =   379 bits (973),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 182/204 (89%), Positives = 189/204 (93%), Gaps = 0/204 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            VK  L+E KD RLG+WKAADIEILNTFQLLTAKPVVYLVNMNE+DYQRKKNKFLPKIH W
Sbjct  191  VKAWLEEEKDVRLGDWKAADIEILNTFQLLTAKPVVYLVNMNERDYQRKKNKFLPKIHTW  250

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            VQEHGGE IIPFS  LER+LADM P EA KYCEENKVQSAL KIIKTGFSAINLIYFFTA
Sbjct  251  VQEHGGETIIPFSCILERNLADMLPHEADKYCEENKVQSALSKIIKTGFSAINLIYFFTA  310

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  176
            GPDEVKCWQIRRQTKAPQAAG IHTD ERGFICAEVMKF+DLKELGSE AVKAGGKY+QE
Sbjct  311  GPDEVKCWQIRRQTKAPQAAGTIHTDFERGFICAEVMKFDDLKELGSESAVKAGGKYKQE  370

Query  175  GKTYVVQDGDVIFFKFNVSGGGKK  104
            GKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  371  GKTYVVQDGDIIFFKFNVSGGGKK  394



>gb|KJB69090.1| hypothetical protein B456_011G005000 [Gossypium raimondii]
Length=361

 Score =   377 bits (969),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 182/204 (89%), Positives = 189/204 (93%), Gaps = 0/204 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            VK  L + KD RLG+WKAADIEILNTFQLL+AKPVVYLVNM EKDYQRKKNKFLPKIHAW
Sbjct  158  VKAWLADEKDVRLGDWKAADIEILNTFQLLSAKPVVYLVNMTEKDYQRKKNKFLPKIHAW  217

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            VQEHGGE IIPFS   ER+LADM P +AAKYCEENKVQSALPKIIKTGFSAINLIYFFTA
Sbjct  218  VQEHGGEPIIPFSGVFERNLADMEPADAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  277

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  176
            GPDEVKCWQIRRQ+KAPQAAGAIHTD ERGFICAEVMKFEDLKELGSE AVKA GKYRQE
Sbjct  278  GPDEVKCWQIRRQSKAPQAAGAIHTDFERGFICAEVMKFEDLKELGSESAVKAAGKYRQE  337

Query  175  GKTYVVQDGDVIFFKFNVSGGGKK  104
            GKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  338  GKTYVVQDGDIIFFKFNVSGGGKK  361



>ref|XP_008445378.1| PREDICTED: obg-like ATPase 1 [Cucumis melo]
Length=395

 Score =   379 bits (972),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 181/205 (88%), Positives = 190/205 (93%), Gaps = 1/205 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            VK SL+EGKD RLG+WKAAD+EILNTFQLLTAKPVVYLVNM EKDYQRKKNKFLPKIHAW
Sbjct  191  VKASLEEGKDVRLGDWKAADVEILNTFQLLTAKPVVYLVNMTEKDYQRKKNKFLPKIHAW  250

Query  535  VQEHGGELIIPFSAALERSLADMP-PDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFT  359
            VQEHGGE IIPFS  LER+LADM  P +  KYCEENK+QSALPKIIKTGFSAINLIYFFT
Sbjct  251  VQEHGGETIIPFSGVLERNLADMSSPADVEKYCEENKIQSALPKIIKTGFSAINLIYFFT  310

Query  358  AGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQ  179
            AGPDEVKCWQIRRQTKAPQAAG IHTD E+GFICAEVMKFEDLKELGSE AVKA GKY+Q
Sbjct  311  AGPDEVKCWQIRRQTKAPQAAGTIHTDFEKGFICAEVMKFEDLKELGSETAVKAAGKYKQ  370

Query  178  EGKTYVVQDGDVIFFKFNVSGGGKK  104
            EGKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  371  EGKTYVVQDGDIIFFKFNVSGGGKK  395



>ref|XP_006415450.1| hypothetical protein EUTSA_v10007733mg [Eutrema salsugineum]
 gb|ESQ33803.1| hypothetical protein EUTSA_v10007733mg [Eutrema salsugineum]
Length=419

 Score =   379 bits (974),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 176/200 (88%), Positives = 189/200 (95%), Gaps = 0/200 (0%)
 Frame = -3

Query  703  LDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEH  524
            L+EGKD R G+WKAADIEILNTFQLL+AKPVVYL+NMNE+DYQRKKNKFLPKIHAWVQEH
Sbjct  220  LEEGKDVRFGDWKAADIEILNTFQLLSAKPVVYLINMNERDYQRKKNKFLPKIHAWVQEH  279

Query  523  GGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDE  344
            GG+ +IPFS   ERSLADMPPDEAAKYCEENK+QSALP+IIKTGFSAINLIYFFTAGPDE
Sbjct  280  GGDTMIPFSGVFERSLADMPPDEAAKYCEENKLQSALPRIIKTGFSAINLIYFFTAGPDE  339

Query  343  VKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTY  164
            VKCWQIRR +KAPQAAGAIHTD ERGFICAEVMKFEDLKELG+E AVK  GKYRQEGKTY
Sbjct  340  VKCWQIRRLSKAPQAAGAIHTDFERGFICAEVMKFEDLKELGNETAVKGAGKYRQEGKTY  399

Query  163  VVQDGDVIFFKFNVSGGGKK  104
            +VQDGD+IFFKFNVSGGGKK
Sbjct  400  IVQDGDIIFFKFNVSGGGKK  419



>ref|XP_009107765.1| PREDICTED: obg-like ATPase 1 [Brassica rapa]
 emb|CDY47157.1| BnaA08g05260D [Brassica napus]
Length=394

 Score =   378 bits (971),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 177/200 (89%), Positives = 189/200 (95%), Gaps = 0/200 (0%)
 Frame = -3

Query  703  LDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEH  524
            L+EGKD R G+WKAADIEILNTFQLL+AKPVVYL+NMNE+DYQRKKNKFLPKIHAWVQEH
Sbjct  195  LEEGKDVRFGDWKAADIEILNTFQLLSAKPVVYLINMNERDYQRKKNKFLPKIHAWVQEH  254

Query  523  GGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDE  344
            GG+ +IPFS   ERSLADM PDEAAKYCEENK+QSALP+IIKTGFSAINLIYFFTAGPDE
Sbjct  255  GGDTMIPFSGVFERSLADMLPDEAAKYCEENKLQSALPRIIKTGFSAINLIYFFTAGPDE  314

Query  343  VKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTY  164
            VKCWQIRRQ+KAPQAAGAIHTD ERGFICAEVMKFEDLKELG+E AVK  GKYRQEGKTY
Sbjct  315  VKCWQIRRQSKAPQAAGAIHTDFERGFICAEVMKFEDLKELGNETAVKGAGKYRQEGKTY  374

Query  163  VVQDGDVIFFKFNVSGGGKK  104
            VVQDGD+IFFKFNVSGGGKK
Sbjct  375  VVQDGDIIFFKFNVSGGGKK  394



>gb|KJB69089.1| hypothetical protein B456_011G005000 [Gossypium raimondii]
Length=394

 Score =   378 bits (971),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 182/204 (89%), Positives = 189/204 (93%), Gaps = 0/204 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            VK  L + KD RLG+WKAADIEILNTFQLL+AKPVVYLVNM EKDYQRKKNKFLPKIHAW
Sbjct  191  VKAWLADEKDVRLGDWKAADIEILNTFQLLSAKPVVYLVNMTEKDYQRKKNKFLPKIHAW  250

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            VQEHGGE IIPFS   ER+LADM P +AAKYCEENKVQSALPKIIKTGFSAINLIYFFTA
Sbjct  251  VQEHGGEPIIPFSGVFERNLADMEPADAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  310

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  176
            GPDEVKCWQIRRQ+KAPQAAGAIHTD ERGFICAEVMKFEDLKELGSE AVKA GKYRQE
Sbjct  311  GPDEVKCWQIRRQSKAPQAAGAIHTDFERGFICAEVMKFEDLKELGSESAVKAAGKYRQE  370

Query  175  GKTYVVQDGDVIFFKFNVSGGGKK  104
            GKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  371  GKTYVVQDGDIIFFKFNVSGGGKK  394



>ref|NP_001061206.2| Os08g0199300 [Oryza sativa Japonica Group]
 dbj|BAD03576.1| putative GTP-binding protein [Oryza sativa Japonica Group]
 dbj|BAG88257.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93810.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE68206.1| hypothetical protein OsJ_26368 [Oryza sativa Japonica Group]
 dbj|BAF23120.2| Os08g0199300 [Oryza sativa Japonica Group]
Length=394

 Score =   378 bits (970),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 177/204 (87%), Positives = 189/204 (93%), Gaps = 0/204 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            VK  L++GKD R G+WK+ADIEILNTFQLLTAKPVVYLVNM+EKDYQRKKNKFLPKIHAW
Sbjct  191  VKAHLEDGKDVRFGDWKSADIEILNTFQLLTAKPVVYLVNMSEKDYQRKKNKFLPKIHAW  250

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            VQEHGGE IIPFS A ER LADMPPDEAAKYC EN++ S +PKIIKTGF+AI+LIYFFTA
Sbjct  251  VQEHGGETIIPFSCAFERLLADMPPDEAAKYCAENQIASVIPKIIKTGFAAIHLIYFFTA  310

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  176
            GPDEVKCWQIRRQTKAPQAAG IHTD ERGFICAEVMKF+DLKELGSE AVKA GKYRQE
Sbjct  311  GPDEVKCWQIRRQTKAPQAAGTIHTDFERGFICAEVMKFDDLKELGSESAVKAAGKYRQE  370

Query  175  GKTYVVQDGDVIFFKFNVSGGGKK  104
            GKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  371  GKTYVVQDGDIIFFKFNVSGGGKK  394



>gb|KHF97630.1| Obg-like ATPase 1 [Gossypium arboreum]
Length=394

 Score =   377 bits (968),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 181/204 (89%), Positives = 189/204 (93%), Gaps = 0/204 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            VK  L + KD RLG+WKAADIEILNTFQLL+AKPVVYLVNM E+DYQRKKNKFLPKIHAW
Sbjct  191  VKAWLADEKDVRLGDWKAADIEILNTFQLLSAKPVVYLVNMTERDYQRKKNKFLPKIHAW  250

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            VQEHGGE IIPFS   ER+LADM P +AAKYCEENKVQSALPKIIKTGFSAINLIYFFTA
Sbjct  251  VQEHGGEPIIPFSGVFERNLADMEPADAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  310

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  176
            GPDEVKCWQIRRQ+KAPQAAGAIHTD ERGFICAEVMKFEDLKELGSE AVKA GKYRQE
Sbjct  311  GPDEVKCWQIRRQSKAPQAAGAIHTDFERGFICAEVMKFEDLKELGSESAVKAAGKYRQE  370

Query  175  GKTYVVQDGDVIFFKFNVSGGGKK  104
            GKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  371  GKTYVVQDGDIIFFKFNVSGGGKK  394



>emb|CDX77584.1| BnaA07g07220D [Brassica napus]
Length=394

 Score =   377 bits (968),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 176/200 (88%), Positives = 189/200 (95%), Gaps = 0/200 (0%)
 Frame = -3

Query  703  LDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEH  524
            L+EGKD R G+WKAADIEILNTFQLL+AKPVVYL+NMNE+DYQRKKNKFLPKIHAWVQEH
Sbjct  195  LEEGKDVRFGDWKAADIEILNTFQLLSAKPVVYLINMNERDYQRKKNKFLPKIHAWVQEH  254

Query  523  GGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDE  344
            GG+ +IPFS   ER+LADM PDEAAKYCEENK+QSALP+IIKTGFSAINLIYFFTAGPDE
Sbjct  255  GGDTMIPFSGVFERTLADMLPDEAAKYCEENKLQSALPRIIKTGFSAINLIYFFTAGPDE  314

Query  343  VKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTY  164
            VKCWQIRRQ+KAPQAAGAIHTD ERGFICAEVMKFEDLKELG+E AVK  GKYRQEGKTY
Sbjct  315  VKCWQIRRQSKAPQAAGAIHTDFERGFICAEVMKFEDLKELGNETAVKGAGKYRQEGKTY  374

Query  163  VVQDGDVIFFKFNVSGGGKK  104
            VVQDGD+IFFKFNVSGGGKK
Sbjct  375  VVQDGDIIFFKFNVSGGGKK  394



>ref|XP_009144765.1| PREDICTED: obg-like ATPase 1 [Brassica rapa]
Length=394

 Score =   377 bits (968),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 176/200 (88%), Positives = 189/200 (95%), Gaps = 0/200 (0%)
 Frame = -3

Query  703  LDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEH  524
            L+EGKD R G+WKAADIEILNTFQLL+AKPVVYL+NMNE+DYQRKKNKFLPKIHAWVQEH
Sbjct  195  LEEGKDVRFGDWKAADIEILNTFQLLSAKPVVYLINMNERDYQRKKNKFLPKIHAWVQEH  254

Query  523  GGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDE  344
            GG+ +IPFS   ER+LADM PDEAAKYCEENK+QSALP+IIKTGFSAINLIYFFTAGPDE
Sbjct  255  GGDTMIPFSGVFERTLADMLPDEAAKYCEENKLQSALPRIIKTGFSAINLIYFFTAGPDE  314

Query  343  VKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTY  164
            VKCWQIRRQ+KAPQAAGAIHTD ERGFICAEVMKFEDLKELG+E AVK  GKYRQEGKTY
Sbjct  315  VKCWQIRRQSKAPQAAGAIHTDFERGFICAEVMKFEDLKELGNETAVKGAGKYRQEGKTY  374

Query  163  VVQDGDVIFFKFNVSGGGKK  104
            VVQDGD+IFFKFNVSGGGKK
Sbjct  375  VVQDGDIIFFKFNVSGGGKK  394



>emb|CDX98216.1| BnaC07g08820D [Brassica napus]
Length=394

 Score =   377 bits (968),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 176/200 (88%), Positives = 189/200 (95%), Gaps = 0/200 (0%)
 Frame = -3

Query  703  LDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEH  524
            L+EGKD R G+WKAADIEILNTFQLL+AKPVVYL+NMNE+DYQRKKNKFLPKIHAWVQEH
Sbjct  195  LEEGKDVRFGDWKAADIEILNTFQLLSAKPVVYLINMNERDYQRKKNKFLPKIHAWVQEH  254

Query  523  GGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDE  344
            GG+ +IPFS   ER+LADM PDEAAKYCEENK+QSALP+IIKTGFSAINLIYFFTAGPDE
Sbjct  255  GGDTMIPFSGVFERTLADMLPDEAAKYCEENKLQSALPRIIKTGFSAINLIYFFTAGPDE  314

Query  343  VKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTY  164
            VKCWQIRRQ+KAPQAAGAIHTD ERGFICAEVMKFEDLKELG+E AVK  GKYRQEGKTY
Sbjct  315  VKCWQIRRQSKAPQAAGAIHTDFERGFICAEVMKFEDLKELGNETAVKGAGKYRQEGKTY  374

Query  163  VVQDGDVIFFKFNVSGGGKK  104
            VVQDGD+IFFKFNVSGGGKK
Sbjct  375  VVQDGDIIFFKFNVSGGGKK  394



>ref|XP_004486463.1| PREDICTED: obg-like ATPase 1-like [Cicer arietinum]
Length=394

 Score =   376 bits (966),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 177/204 (87%), Positives = 190/204 (93%), Gaps = 0/204 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            VK  L+EGKD RLG+WKAA++EILN+FQLLTAKPVVYLVNM EKDYQRKKNKFLPKIHAW
Sbjct  191  VKAHLEEGKDVRLGDWKAAEVEILNSFQLLTAKPVVYLVNMTEKDYQRKKNKFLPKIHAW  250

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            VQEHGG  +IPFS  LE++L+DMPPDEAAKYCE N VQSALPKIIKTGFSAINLIYFFTA
Sbjct  251  VQEHGGGQMIPFSCVLEKNLSDMPPDEAAKYCEANNVQSALPKIIKTGFSAINLIYFFTA  310

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  176
            GPDEVKCWQIRR TKAPQAAGAIHTD E+GFICAEVMKFEDLKELG+E AVKA GKY+QE
Sbjct  311  GPDEVKCWQIRRLTKAPQAAGAIHTDFEKGFICAEVMKFEDLKELGTESAVKAAGKYKQE  370

Query  175  GKTYVVQDGDVIFFKFNVSGGGKK  104
            GKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  371  GKTYVVQDGDIIFFKFNVSGGGKK  394



>gb|AFK48623.1| unknown [Lotus japonicus]
Length=394

 Score =   376 bits (965),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 177/204 (87%), Positives = 189/204 (93%), Gaps = 0/204 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            VK  ++EGKD RLGEWKAAD +ILN+FQLLTAKPVVYLVNM EKDYQRKKNKFLPKIHAW
Sbjct  191  VKAYIEEGKDVRLGEWKAADTDILNSFQLLTAKPVVYLVNMTEKDYQRKKNKFLPKIHAW  250

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            VQEHGG  IIPFS  LER+LAD+P DE AKYCEENKVQSALP+IIKTGF+AINLIYFFTA
Sbjct  251  VQEHGGGSIIPFSGVLERNLADLPSDEVAKYCEENKVQSALPEIIKTGFAAINLIYFFTA  310

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  176
            GPDEVKCWQIRRQTKAPQAAG IHTD ERGFICAEVMKF+DLKELG+E AVKA GKY+QE
Sbjct  311  GPDEVKCWQIRRQTKAPQAAGTIHTDFERGFICAEVMKFDDLKELGTESAVKAAGKYKQE  370

Query  175  GKTYVVQDGDVIFFKFNVSGGGKK  104
            GKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  371  GKTYVVQDGDIIFFKFNVSGGGKK  394



>ref|XP_007022926.1| GTP binding [Theobroma cacao]
 gb|EOY25548.1| GTP binding [Theobroma cacao]
Length=394

 Score =   376 bits (965),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 180/204 (88%), Positives = 190/204 (93%), Gaps = 0/204 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            VK+ L++GKD RLG+WKAADIEILNTFQLL+AKPVVYLVNM EKDYQRKKNKFLPKIHAW
Sbjct  191  VKSWLEDGKDIRLGDWKAADIEILNTFQLLSAKPVVYLVNMTEKDYQRKKNKFLPKIHAW  250

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            VQEHGGE IIPFS   ER+L DM  +EAAKYCEENK+QSALPKIIKTGFSAINLIYFFTA
Sbjct  251  VQEHGGEPIIPFSGVFERNLVDMESEEAAKYCEENKLQSALPKIIKTGFSAINLIYFFTA  310

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  176
            G DEVKCWQIRRQTKAPQAAGAIHTD ERGFICAEVMKFEDLKELG+E AVKA GKYRQE
Sbjct  311  GADEVKCWQIRRQTKAPQAAGAIHTDFERGFICAEVMKFEDLKELGNESAVKAAGKYRQE  370

Query  175  GKTYVVQDGDVIFFKFNVSGGGKK  104
            GKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  371  GKTYVVQDGDIIFFKFNVSGGGKK  394



>ref|XP_010687083.1| PREDICTED: obg-like ATPase 1 [Beta vulgaris subsp. vulgaris]
Length=394

 Score =   376 bits (965),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 178/204 (87%), Positives = 189/204 (93%), Gaps = 0/204 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            VKT L+EGKD RLG+WKAAD+E+LNTFQLLTAKPVVYLVNM E+DYQRKKNKFLPKIHAW
Sbjct  191  VKTWLEEGKDIRLGDWKAADVEVLNTFQLLTAKPVVYLVNMTERDYQRKKNKFLPKIHAW  250

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            VQEHG E IIPFS   ER+ ADMP DEAAKYC+ENKVQSA+PKIIKTGFSAINLIYFFTA
Sbjct  251  VQEHGAEPIIPFSGVFERNYADMPEDEAAKYCDENKVQSAIPKIIKTGFSAINLIYFFTA  310

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  176
            GPDEVKCWQIRRQTKAPQAAG IHTD ERGFICAEVMK+EDLKE G+E AVKA GKYRQE
Sbjct  311  GPDEVKCWQIRRQTKAPQAAGTIHTDFERGFICAEVMKYEDLKEHGNEGAVKAAGKYRQE  370

Query  175  GKTYVVQDGDVIFFKFNVSGGGKK  104
            GKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  371  GKTYVVQDGDIIFFKFNVSGGGKK  394



>gb|EEC83063.1| hypothetical protein OsI_28170 [Oryza sativa Indica Group]
Length=394

 Score =   376 bits (965),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 176/204 (86%), Positives = 188/204 (92%), Gaps = 0/204 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            VK  L++GKD R G+WK+ADIEILNTFQLLTAKPVVYLVNM+EKDYQRKKNKFLPKIHAW
Sbjct  191  VKAHLEDGKDVRFGDWKSADIEILNTFQLLTAKPVVYLVNMSEKDYQRKKNKFLPKIHAW  250

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            VQEHGGE IIPFS A ER LADMPPDEAAKYC EN++ S +PKIIKTGF+AI+LIYFFTA
Sbjct  251  VQEHGGETIIPFSCAFERLLADMPPDEAAKYCAENQIASVIPKIIKTGFAAIHLIYFFTA  310

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  176
            GPDEVKCWQIRRQTKAPQAAG IHTD ERGFICAEVMKF+DLKELGSE AVKA GKYRQE
Sbjct  311  GPDEVKCWQIRRQTKAPQAAGTIHTDFERGFICAEVMKFDDLKELGSESAVKAAGKYRQE  370

Query  175  GKTYVVQDGDVIFFKFNVSGGGKK  104
            GKTYVVQD D+IFFKFNVSGGGKK
Sbjct  371  GKTYVVQDADIIFFKFNVSGGGKK  394



>ref|XP_010538270.1| PREDICTED: obg-like ATPase 1 [Tarenaya hassleriana]
Length=395

 Score =   375 bits (962),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 179/204 (88%), Positives = 188/204 (92%), Gaps = 0/204 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            VK  L++GKD RLG+WK ADIEI+NTFQLLTAKPVVYLVNM E+DYQRKKNKFLPKIHAW
Sbjct  192  VKAWLEDGKDIRLGDWKTADIEIMNTFQLLTAKPVVYLVNMTERDYQRKKNKFLPKIHAW  251

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            VQEHGGE IIPFS ALER+LADM PDEAAKYCEEN VQS LPKIIKTGFSAINLIYFFTA
Sbjct  252  VQEHGGEPIIPFSGALERNLADMLPDEAAKYCEENTVQSVLPKIIKTGFSAINLIYFFTA  311

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  176
            GPDEVKCWQIRRQTKAPQAAG IH+D E+GFICAEVMKFEDL ELGSE AVKA GKY+QE
Sbjct  312  GPDEVKCWQIRRQTKAPQAAGTIHSDFEKGFICAEVMKFEDLMELGSEGAVKAAGKYKQE  371

Query  175  GKTYVVQDGDVIFFKFNVSGGGKK  104
            GKTYVV DGDVIFFKFNVSGGGKK
Sbjct  372  GKTYVVHDGDVIFFKFNVSGGGKK  395



>ref|XP_004135546.1| PREDICTED: obg-like ATPase 1-like [Cucumis sativus]
 ref|XP_004158075.1| PREDICTED: obg-like ATPase 1-like [Cucumis sativus]
 gb|KGN65918.1| hypothetical protein Csa_1G538160 [Cucumis sativus]
Length=395

 Score =   375 bits (962),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 179/205 (87%), Positives = 189/205 (92%), Gaps = 1/205 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            VK SL+EGKD RLG+WKA+D+EILNTFQLLTAKPVVYLVNM EKDYQRKKNKFLPKIHAW
Sbjct  191  VKASLEEGKDIRLGDWKASDVEILNTFQLLTAKPVVYLVNMTEKDYQRKKNKFLPKIHAW  250

Query  535  VQEHGGELIIPFSAALERSLADMP-PDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFT  359
            VQEHGGE IIPFS  LER+LADM  P +  KYCEENK+QSALPKIIKTGFSAINLIYFFT
Sbjct  251  VQEHGGETIIPFSGVLERNLADMSSPADVEKYCEENKIQSALPKIIKTGFSAINLIYFFT  310

Query  358  AGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQ  179
            AGPDEVKCWQIRRQTKAPQAAG IHTD E+GFICAEVMKFEDLKE GSE AVKA GKY+Q
Sbjct  311  AGPDEVKCWQIRRQTKAPQAAGTIHTDFEKGFICAEVMKFEDLKEHGSETAVKAAGKYKQ  370

Query  178  EGKTYVVQDGDVIFFKFNVSGGGKK  104
            EGKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  371  EGKTYVVQDGDIIFFKFNVSGGGKK  395



>ref|XP_008799072.1| PREDICTED: obg-like ATPase 1 [Phoenix dactylifera]
 ref|XP_008799073.1| PREDICTED: obg-like ATPase 1 [Phoenix dactylifera]
 ref|XP_008799075.1| PREDICTED: obg-like ATPase 1 [Phoenix dactylifera]
 ref|XP_008799076.1| PREDICTED: obg-like ATPase 1 [Phoenix dactylifera]
 ref|XP_008799077.1| PREDICTED: obg-like ATPase 1 [Phoenix dactylifera]
Length=394

 Score =   374 bits (961),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 178/204 (87%), Positives = 190/204 (93%), Gaps = 0/204 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            VK  L +GKDAR G+WKAAD+EILNT QLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW
Sbjct  191  VKAWLKDGKDARGGDWKAADVEILNTLQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  250

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            VQ+HGGE IIPFS  LE++L DMP DEAAKYCEENKVQSA+PKIIKTGF+AINLIYFFTA
Sbjct  251  VQDHGGEPIIPFSCVLEKNLVDMPEDEAAKYCEENKVQSAIPKIIKTGFAAINLIYFFTA  310

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  176
            GPDEVKCWQIRRQTKAPQAAG IH+D E+GFICAEVMKFE+LKELGSE AVKA GKYRQE
Sbjct  311  GPDEVKCWQIRRQTKAPQAAGTIHSDFEKGFICAEVMKFEELKELGSEAAVKAAGKYRQE  370

Query  175  GKTYVVQDGDVIFFKFNVSGGGKK  104
            GKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  371  GKTYVVQDGDIIFFKFNVSGGGKK  394



>ref|XP_006659204.1| PREDICTED: obg-like ATPase 1-like [Oryza brachyantha]
Length=394

 Score =   373 bits (957),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 175/204 (86%), Positives = 188/204 (92%), Gaps = 0/204 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            VK  L++GKD R G+WK+ADIEILNTFQLLTAKPVVYLVNM+EKDYQRKKNKFLPKIHAW
Sbjct  191  VKAHLEDGKDVRFGDWKSADIEILNTFQLLTAKPVVYLVNMSEKDYQRKKNKFLPKIHAW  250

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            VQEHGGE IIPFS A ER+LADMP DEAAKYC EN++ S + KIIKTGF+AI+LIYFFTA
Sbjct  251  VQEHGGETIIPFSCAFERNLADMPQDEAAKYCAENQITSVISKIIKTGFAAIHLIYFFTA  310

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  176
            GPDEV+CWQIRRQTKAPQAAG IHTD ERGFICAEVMKFEDLKELGSE AVKA GKYRQE
Sbjct  311  GPDEVRCWQIRRQTKAPQAAGTIHTDFERGFICAEVMKFEDLKELGSESAVKAAGKYRQE  370

Query  175  GKTYVVQDGDVIFFKFNVSGGGKK  104
            GKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  371  GKTYVVQDGDIIFFKFNVSGGGKK  394



>ref|XP_003594539.1| Obg-like ATPase [Medicago truncatula]
 gb|AES64790.1| GTP-binding protein [Medicago truncatula]
Length=394

 Score =   373 bits (957),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 174/204 (85%), Positives = 189/204 (93%), Gaps = 0/204 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            VK  ++EGKD RLG+WKAA++EILN+FQLLTAKPVVYL+NM E+DYQRKKNKFLPKIH W
Sbjct  191  VKAFIEEGKDVRLGDWKAAEVEILNSFQLLTAKPVVYLINMTERDYQRKKNKFLPKIHTW  250

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            VQEHGG  +IPFS  LE++L+DMPPDEAAKYCE N VQSALPKIIKTGFSAINLIYFFTA
Sbjct  251  VQEHGGGQMIPFSCVLEKNLSDMPPDEAAKYCEANNVQSALPKIIKTGFSAINLIYFFTA  310

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  176
            GPDEVKCWQIRR TKAPQAAGAIHTD ERGFICAEVMKF+DLKELGSE AVKA GKY+QE
Sbjct  311  GPDEVKCWQIRRLTKAPQAAGAIHTDFERGFICAEVMKFDDLKELGSESAVKAAGKYKQE  370

Query  175  GKTYVVQDGDVIFFKFNVSGGGKK  104
            GKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  371  GKTYVVQDGDIIFFKFNVSGGGKK  394



>ref|XP_003573525.1| PREDICTED: obg-like ATPase 1 [Brachypodium distachyon]
Length=394

 Score =   372 bits (956),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 176/204 (86%), Positives = 186/204 (91%), Gaps = 0/204 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            V   L EGKD RLGEWK+A+IEILNTFQLLTAKPVVYLVNM+EKDYQRKKNKFLPKIHAW
Sbjct  191  VMAHLREGKDVRLGEWKSAEIEILNTFQLLTAKPVVYLVNMSEKDYQRKKNKFLPKIHAW  250

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            VQEHGGE IIPFS A E+ L DMP DEAAKYC EN++ S +PKIIKTGF+AI+LIYFFTA
Sbjct  251  VQEHGGETIIPFSCAFEQKLVDMPADEAAKYCAENQITSLIPKIIKTGFAAIHLIYFFTA  310

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  176
            GPDEVKCWQIRRQTKAPQAAG IHTD ERGFICAEVMKFEDLKELGSE AVKA GKYRQE
Sbjct  311  GPDEVKCWQIRRQTKAPQAAGTIHTDFERGFICAEVMKFEDLKELGSESAVKAAGKYRQE  370

Query  175  GKTYVVQDGDVIFFKFNVSGGGKK  104
            GKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  371  GKTYVVQDGDIIFFKFNVSGGGKK  394



>gb|ACJ85184.1| unknown [Medicago truncatula]
Length=394

 Score =   372 bits (956),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 174/204 (85%), Positives = 189/204 (93%), Gaps = 0/204 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            VK  ++EGKD RLG+WKAA++EILN+FQLLTAKPVVYL+NM E+DYQRKKNKFLPKIH W
Sbjct  191  VKAFIEEGKDVRLGDWKAAEVEILNSFQLLTAKPVVYLINMTERDYQRKKNKFLPKIHTW  250

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            VQEHGG  +IPFS  LE++L+DMPPDEAAKYCE N VQSALPKIIKTGFSAINLIYFFTA
Sbjct  251  VQEHGGGQMIPFSCVLEKNLSDMPPDEAAKYCEANNVQSALPKIIKTGFSAINLIYFFTA  310

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  176
            GPDEVKCWQIRR TKAPQAAGAIHTD ERGFICAEVMKF+DLKELGSE AVKA GKY+QE
Sbjct  311  GPDEVKCWQIRRLTKAPQAAGAIHTDFERGFICAEVMKFDDLKELGSESAVKAAGKYKQE  370

Query  175  GKTYVVQDGDVIFFKFNVSGGGKK  104
            GKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  371  GKTYVVQDGDIIFFKFNVSGGGKK  394



>ref|XP_010941555.1| PREDICTED: obg-like ATPase 1 [Elaeis guineensis]
Length=394

 Score =   372 bits (954),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 175/204 (86%), Positives = 188/204 (92%), Gaps = 0/204 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            +K  L +GKD RLG+WKAAD+EILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW
Sbjct  191  IKAWLKDGKDVRLGDWKAADVEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  250

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            VQ+HGGE IIPFS   E++L DMP  EA KYCE NK+QSA+PKIIKTGF+AINLIYFFTA
Sbjct  251  VQDHGGEPIIPFSCVFEKNLVDMPEGEAPKYCEANKIQSAIPKIIKTGFAAINLIYFFTA  310

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  176
            GPDEVKCWQIRRQTKAPQAAGAIH+D E+GFICAEVMKFEDLKELGSE AVKA GKYRQE
Sbjct  311  GPDEVKCWQIRRQTKAPQAAGAIHSDFEKGFICAEVMKFEDLKELGSEAAVKAAGKYRQE  370

Query  175  GKTYVVQDGDVIFFKFNVSGGGKK  104
            GKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  371  GKTYVVQDGDIIFFKFNVSGGGKK  394



>ref|XP_002445191.1| hypothetical protein SORBIDRAFT_07g005700 [Sorghum bicolor]
 gb|EES14686.1| hypothetical protein SORBIDRAFT_07g005700 [Sorghum bicolor]
Length=393

 Score =   370 bits (949),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 174/204 (85%), Positives = 188/204 (92%), Gaps = 0/204 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            V   L+EGKD RLG+WKAADIEILNTFQLL+AKPVVYLVNM+EKD+QRKKNKFLPKIHAW
Sbjct  190  VVAHLEEGKDVRLGDWKAADIEILNTFQLLSAKPVVYLVNMSEKDFQRKKNKFLPKIHAW  249

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            VQEHGGE I+PFS A E+ L DMP DEAAKYC EN++ S +PKIIKTGF+AI+LIYFFTA
Sbjct  250  VQEHGGETILPFSCAFEQKLVDMPEDEAAKYCAENQITSMIPKIIKTGFAAIHLIYFFTA  309

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  176
            GPDEVKCWQIRRQTKAPQAAGAIHTD ERGFICAEVMKFEDLKELGSE AVKA GKY+QE
Sbjct  310  GPDEVKCWQIRRQTKAPQAAGAIHTDFERGFICAEVMKFEDLKELGSESAVKAAGKYKQE  369

Query  175  GKTYVVQDGDVIFFKFNVSGGGKK  104
            GKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  370  GKTYVVQDGDIIFFKFNVSGGGKK  393



>gb|AFK49195.1| unknown [Medicago truncatula]
Length=401

 Score =   370 bits (949),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 172/204 (84%), Positives = 189/204 (93%), Gaps = 0/204 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            VK  ++EGKD RLG+WKAA++EILN+FQLLTAKPVVYL+NM E+DYQRKKNKFLPKIH W
Sbjct  191  VKAFIEEGKDVRLGDWKAAEVEILNSFQLLTAKPVVYLINMTERDYQRKKNKFLPKIHTW  250

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            VQEHGG  +IPFS  LE++L+DMPPDEAAKYCE N VQSALPKIIKTGFSAINLIYFFTA
Sbjct  251  VQEHGGGQMIPFSCVLEKNLSDMPPDEAAKYCEANNVQSALPKIIKTGFSAINLIYFFTA  310

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  176
            GPDEVKCWQIRR TKAPQAAGAIHTD ERGFICAEVMKF+DLKELGSE AVKA GKY+QE
Sbjct  311  GPDEVKCWQIRRLTKAPQAAGAIHTDFERGFICAEVMKFDDLKELGSESAVKAAGKYKQE  370

Query  175  GKTYVVQDGDVIFFKFNVSGGGKK  104
            GKTYVVQDGD+IFFKFNVSGGG++
Sbjct  371  GKTYVVQDGDIIFFKFNVSGGGEE  394



>ref|NP_001150211.1| GTP-binding protein PTD004 [Zea mays]
 gb|ACF85733.1| unknown [Zea mays]
 gb|ACG38260.1| GTP-binding protein PTD004 [Zea mays]
 gb|AFW56961.1| GTP-binding protein PTD004 [Zea mays]
Length=393

 Score =   369 bits (948),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 173/200 (87%), Positives = 187/200 (94%), Gaps = 0/200 (0%)
 Frame = -3

Query  703  LDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEH  524
            L+EGKD RLG+WKAADIEILNTFQLL+AKPVVYLVNM+EKD+QRKKNKFLPKIHAWVQEH
Sbjct  194  LEEGKDVRLGDWKAADIEILNTFQLLSAKPVVYLVNMSEKDFQRKKNKFLPKIHAWVQEH  253

Query  523  GGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDE  344
            GGE I+PFS A E+ L DMP DEAAKYC EN++ S +PKIIKTGF+AI+LIYFFTAGPDE
Sbjct  254  GGETILPFSCAFEQKLVDMPEDEAAKYCAENQITSMIPKIIKTGFAAIHLIYFFTAGPDE  313

Query  343  VKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTY  164
            VKCWQIRRQTKAPQAAGAIHTD ERGFICAEVMKFEDLKELGSE AVKA GKY+QEGKTY
Sbjct  314  VKCWQIRRQTKAPQAAGAIHTDFERGFICAEVMKFEDLKELGSESAVKAAGKYKQEGKTY  373

Query  163  VVQDGDVIFFKFNVSGGGKK  104
            VVQDGD+IFFKFNVSGGGKK
Sbjct  374  VVQDGDIIFFKFNVSGGGKK  393



>gb|ABK25108.1| unknown [Picea sitchensis]
Length=392

 Score =   369 bits (948),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 176/203 (87%), Positives = 187/203 (92%), Gaps = 0/203 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            VK  L+EGKD RLG+WKAA++EILNTFQLL+AKPVVYLVNM EKDYQRKKNK+LPKIH+W
Sbjct  190  VKAWLEEGKDVRLGDWKAAEVEILNTFQLLSAKPVVYLVNMTEKDYQRKKNKYLPKIHSW  249

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            VQ HGGE IIPFS ALE+ LADMPPDEAAKYCEENK QSAL KIIKTGFSAINLIYFFTA
Sbjct  250  VQGHGGEPIIPFSGALEQKLADMPPDEAAKYCEENKTQSALTKIIKTGFSAINLIYFFTA  309

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  176
            GPDEVKCWQ+R+Q KAPQAAGAIHTD ERGFICAEVMK EDLKELGSE AVKAGGKYRQE
Sbjct  310  GPDEVKCWQVRKQIKAPQAAGAIHTDFERGFICAEVMKVEDLKELGSESAVKAGGKYRQE  369

Query  175  GKTYVVQDGDVIFFKFNVSGGGK  107
            GKTYVVQDGD+I FKFNVSGG K
Sbjct  370  GKTYVVQDGDIILFKFNVSGGKK  392



>ref|XP_004972629.1| PREDICTED: obg-like ATPase 1-like [Setaria italica]
Length=393

 Score =   367 bits (942),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 173/204 (85%), Positives = 187/204 (92%), Gaps = 0/204 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            V   L +GKD RLG+WKAADIEILNTFQLLTAKPVVYLVNM+EKD+QRKKNKFLPKIHAW
Sbjct  190  VIKHLQDGKDIRLGDWKAADIEILNTFQLLTAKPVVYLVNMSEKDFQRKKNKFLPKIHAW  249

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            VQEHGGE I+PFS A E+ L DMP DEAAKYC EN++ S +PKIIKTGF+AI+LIYFFTA
Sbjct  250  VQEHGGETILPFSCAFEQKLVDMPEDEAAKYCAENQITSMIPKIIKTGFAAIHLIYFFTA  309

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  176
            GPDEVKCWQIRRQTKAPQAAGAIHTD ERGFICAEVMKF++LKELGSE AVKA GKYRQE
Sbjct  310  GPDEVKCWQIRRQTKAPQAAGAIHTDFERGFICAEVMKFDELKELGSESAVKAAGKYRQE  369

Query  175  GKTYVVQDGDVIFFKFNVSGGGKK  104
            GKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  370  GKTYVVQDGDIIFFKFNVSGGGKK  393



>emb|CDY02308.1| BnaA09g25940D [Brassica napus]
Length=394

 Score =   363 bits (933),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 171/204 (84%), Positives = 186/204 (91%), Gaps = 0/204 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            VK  L+EGKD RLG+WKAADIEILNTFQLL+AKPVVYL+NMNE+DYQRKKNKFLPKIHAW
Sbjct  191  VKAWLEEGKDVRLGDWKAADIEILNTFQLLSAKPVVYLINMNERDYQRKKNKFLPKIHAW  250

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            VQEHGG+ +IPFS   ERSLADM PDEAAKYCEENK+QSALP+IIKTGFSAINLIYFFT 
Sbjct  251  VQEHGGDTMIPFSGVFERSLADMLPDEAAKYCEENKLQSALPRIIKTGFSAINLIYFFTV  310

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  176
            G  EV+CWQIRRQ+KAPQAAGAIH+D ERGFICAEVMKFED+KE G+E AVK  GKYRQE
Sbjct  311  GHGEVRCWQIRRQSKAPQAAGAIHSDFERGFICAEVMKFEDIKEYGNETAVKGAGKYRQE  370

Query  175  GKTYVVQDGDVIFFKFNVSGGGKK  104
            GKTYVV DGD+I FKFNVSGGGKK
Sbjct  371  GKTYVVLDGDIIHFKFNVSGGGKK  394



>ref|XP_009115125.1| PREDICTED: obg-like ATPase 1 [Brassica rapa]
Length=395

 Score =   363 bits (931),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 169/200 (85%), Positives = 185/200 (93%), Gaps = 0/200 (0%)
 Frame = -3

Query  703  LDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEH  524
            L+EGKD RLG+WKAADIEILNTFQLL+AKPVVYL+NMNE+DYQRKKNKFLPKIHAWVQEH
Sbjct  196  LEEGKDVRLGDWKAADIEILNTFQLLSAKPVVYLINMNERDYQRKKNKFLPKIHAWVQEH  255

Query  523  GGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDE  344
            GG+ +IPFS   ERSLADM PDEAAKYCEENK+QSALP+IIKTGFSAINLIYFFT G  E
Sbjct  256  GGDTMIPFSGVFERSLADMLPDEAAKYCEENKLQSALPRIIKTGFSAINLIYFFTVGHGE  315

Query  343  VKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTY  164
            V+CWQIRRQ+KAPQAAGAIH+D ERGFICAEVMKFED+KE G+E AVK  GKYRQEGKTY
Sbjct  316  VRCWQIRRQSKAPQAAGAIHSDFERGFICAEVMKFEDIKEYGNETAVKGAGKYRQEGKTY  375

Query  163  VVQDGDVIFFKFNVSGGGKK  104
            VV DGD+I+FKFNVSGGGKK
Sbjct  376  VVLDGDIIYFKFNVSGGGKK  395



>emb|CDY09558.1| BnaC05g23610D [Brassica napus]
Length=397

 Score =   362 bits (929),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 169/204 (83%), Positives = 186/204 (91%), Gaps = 0/204 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            VK  L+EGKD R G+WKAADIEILNTFQLL+AKPVVYL+NMNE+DYQRKKNKFLPKIHAW
Sbjct  194  VKAWLEEGKDVRFGDWKAADIEILNTFQLLSAKPVVYLINMNERDYQRKKNKFLPKIHAW  253

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            VQEHGG+ +IPFS   ERSLAD+ PDEAAKYCEENK+QSALP+IIKTGFSAINLIYFFT 
Sbjct  254  VQEHGGDTMIPFSGVFERSLADILPDEAAKYCEENKLQSALPRIIKTGFSAINLIYFFTV  313

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  176
            G  EV+CWQIRRQ+KAPQAAGAIH+D ERGFICAEVMKFED+KE G+E AVK  GKYRQE
Sbjct  314  GHGEVRCWQIRRQSKAPQAAGAIHSDFERGFICAEVMKFEDIKEFGNETAVKGAGKYRQE  373

Query  175  GKTYVVQDGDVIFFKFNVSGGGKK  104
            GKTYVV DGD+I+FKFNVSGGGKK
Sbjct  374  GKTYVVLDGDIIYFKFNVSGGGKK  397



>emb|CDM85617.1| unnamed protein product [Triticum aestivum]
Length=394

 Score =   360 bits (924),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 171/204 (84%), Positives = 183/204 (90%), Gaps = 0/204 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            V   L +GKD RLGEWKAA+IEILN FQLLTAKPVVYLVNM++KDY RKKNKFLPKIHAW
Sbjct  191  VMAHLQDGKDVRLGEWKAAEIEILNAFQLLTAKPVVYLVNMSKKDYLRKKNKFLPKIHAW  250

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            V+EHGGE IIPFS A E+ L DMP DEAAKYC EN+  S +PKIIKTGF+AI+LIYFFTA
Sbjct  251  VKEHGGETIIPFSCAFEQKLVDMPEDEAAKYCAENQTASLIPKIIKTGFAAIHLIYFFTA  310

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  176
            G DEVKCWQIRRQ+KAPQAAGAIHTD ERGFICAEVMKFEDLKELGSE AVKA GKYRQE
Sbjct  311  GHDEVKCWQIRRQSKAPQAAGAIHTDFERGFICAEVMKFEDLKELGSESAVKAAGKYRQE  370

Query  175  GKTYVVQDGDVIFFKFNVSGGGKK  104
            GKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  371  GKTYVVQDGDIIFFKFNVSGGGKK  394



>gb|EMS48297.1| Obg-like ATPase 1 [Triticum urartu]
Length=397

 Score =   357 bits (915),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 172/207 (83%), Positives = 183/207 (88%), Gaps = 3/207 (1%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            V T L +GKD RLGEWKAA+IEILN FQLLTAKPVVYLVNM+EKDY RKKNKFLPKIHAW
Sbjct  191  VMTHLQDGKDVRLGEWKAAEIEILNAFQLLTAKPVVYLVNMSEKDYLRKKNKFLPKIHAW  250

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSA---LPKIIKTGFSAINLIYF  365
            V+EHGGE IIPFS A E+ L DMP DEAAKYC EN+       +PKIIKTGF+AI+LIYF
Sbjct  251  VKEHGGETIIPFSCAFEQKLVDMPEDEAAKYCAENQTARQVILIPKIIKTGFAAIHLIYF  310

Query  364  FTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKY  185
            FTAG DEVKCWQIRRQ+KAPQAAGAIHTD ERGFICAEVMKFEDLKELGSE AVKA GKY
Sbjct  311  FTAGHDEVKCWQIRRQSKAPQAAGAIHTDFERGFICAEVMKFEDLKELGSESAVKAAGKY  370

Query  184  RQEGKTYVVQDGDVIFFKFNVSGGGKK  104
            RQEGKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  371  RQEGKTYVVQDGDIIFFKFNVSGGGKK  397



>gb|EMT28525.1| Obg-like ATPase 1 [Aegilops tauschii]
Length=397

 Score =   355 bits (911),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 171/207 (83%), Positives = 183/207 (88%), Gaps = 3/207 (1%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            V T L +GKD RLGEWKAA+IEILN FQLLTAKPVVYLVNM+EKDY RKKNKFLPKIHAW
Sbjct  191  VMTHLQDGKDVRLGEWKAAEIEILNAFQLLTAKPVVYLVNMSEKDYLRKKNKFLPKIHAW  250

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSA---LPKIIKTGFSAINLIYF  365
            V++HGGE IIPFS A E+ L DMP DEAAKYC EN+       +PKIIKTGF+AI+LIYF
Sbjct  251  VKDHGGETIIPFSCAFEQKLVDMPEDEAAKYCAENQTARQVILIPKIIKTGFAAIHLIYF  310

Query  364  FTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKY  185
            FTAG DEVKCWQIRRQ+KAPQAAGAIHTD ERGFICAEVMKFEDLKELGSE AVKA GKY
Sbjct  311  FTAGHDEVKCWQIRRQSKAPQAAGAIHTDFERGFICAEVMKFEDLKELGSESAVKAAGKY  370

Query  184  RQEGKTYVVQDGDVIFFKFNVSGGGKK  104
            RQEGKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  371  RQEGKTYVVQDGDIIFFKFNVSGGGKK  397



>ref|XP_001776504.1| predicted protein [Physcomitrella patens]
 gb|EDQ58637.1| predicted protein [Physcomitrella patens]
Length=394

 Score =   345 bits (885),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 162/200 (81%), Positives = 180/200 (90%), Gaps = 0/200 (0%)
 Frame = -3

Query  703  LDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEH  524
            L + KD RLG+WK A+IEILNTFQLL+AKPVVYL+NM EKDYQRKKNK+L KIHAWVQEH
Sbjct  195  LKQEKDVRLGDWKTAEIEILNTFQLLSAKPVVYLINMTEKDYQRKKNKWLAKIHAWVQEH  254

Query  523  GGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDE  344
            GG ++IPFS  LE+ LADMP DEAA YC+EN + SALPKIIKTGF+AINLIYFFTAGPDE
Sbjct  255  GGGVLIPFSGVLEQKLADMPADEAAVYCKENDLVSALPKIIKTGFAAINLIYFFTAGPDE  314

Query  343  VKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTY  164
            VKCWQIR+Q+KAPQAAGAIHTD ERGFICAEVMKF+DLKELGSE AVKA GKY+QEGK Y
Sbjct  315  VKCWQIRKQSKAPQAAGAIHTDFERGFICAEVMKFDDLKELGSESAVKAAGKYKQEGKNY  374

Query  163  VVQDGDVIFFKFNVSGGGKK  104
            VVQDGD+IFFKFNV+  GKK
Sbjct  375  VVQDGDIIFFKFNVTASGKK  394



>ref|XP_011015196.1| PREDICTED: obg-like ATPase 1 [Populus euphratica]
Length=392

 Score =   337 bits (864),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 163/204 (80%), Positives = 177/204 (87%), Gaps = 2/204 (1%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            VK  L+E KD RLGEWKAADIEILNTFQLLTAKPVVYL+NMNEKDYQRKKNKFLPKIHAW
Sbjct  191  VKAWLEEEKDVRLGEWKAADIEILNTFQLLTAKPVVYLINMNEKDYQRKKNKFLPKIHAW  250

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            VQEHGGE IIPFS  LER+LADM PDEAAKYCEENK+Q  + +        I+ ++FF +
Sbjct  251  VQEHGGETIIPFSCILERTLADMLPDEAAKYCEENKLQRLVLR--SQWLVNISQVFFFFS  308

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  176
              D+VKCWQIRRQTKAPQAAG IHTD ERGFICAEVMKF+DLKELGSE AVKA GKY+QE
Sbjct  309  FEDQVKCWQIRRQTKAPQAAGTIHTDFERGFICAEVMKFDDLKELGSESAVKAAGKYKQE  368

Query  175  GKTYVVQDGDVIFFKFNVSGGGKK  104
            GKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  369  GKTYVVQDGDIIFFKFNVSGGGKK  392



>gb|KDO75236.1| hypothetical protein CISIN_1g015465mg [Citrus sinensis]
Length=406

 Score =   335 bits (859),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 160/174 (92%), Positives = 164/174 (94%), Gaps = 0/174 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            VK  L +GKD RLG+WKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW
Sbjct  191  VKAWLQDGKDVRLGDWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  250

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            VQEHGGE IIPFS ALER+LADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA
Sbjct  251  VQEHGGEQIIPFSCALERNLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  310

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAG  194
            GPDEVKCWQIRRQTKAPQAAG IHTD ERGFICAEVMKF+DLKELGSEPAVK  
Sbjct  311  GPDEVKCWQIRRQTKAPQAAGTIHTDFERGFICAEVMKFDDLKELGSEPAVKVN  364



>ref|XP_002985543.1| hypothetical protein SELMODRAFT_234816 [Selaginella moellendorffii]
 ref|XP_002987026.1| hypothetical protein SELMODRAFT_158442 [Selaginella moellendorffii]
 gb|EFJ11869.1| hypothetical protein SELMODRAFT_158442 [Selaginella moellendorffii]
 gb|EFJ13417.1| hypothetical protein SELMODRAFT_234816 [Selaginella moellendorffii]
Length=389

 Score =   328 bits (840),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 159/203 (78%), Positives = 173/203 (85%), Gaps = 7/203 (3%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            V  SL +GKD RL EWK ++IE LNTFQLL+AKPVVYLVNM EKDY RKKNK+LPKIHAW
Sbjct  194  VHESLKQGKDVRLVEWKQSEIEFLNTFQLLSAKPVVYLVNMTEKDYLRKKNKWLPKIHAW  253

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            VQEHGG+ +IPFS  LE+ LAD P DEAA       VQSALPKIIKTGF+AINLIYFFTA
Sbjct  254  VQEHGGDPLIPFSGVLEQRLADAPSDEAA-------VQSALPKIIKTGFAAINLIYFFTA  306

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  176
            GPDEVKCWQIR+ +KAPQAAGAIHTD ERGFICAEVMKFEDLKELGSE AVKA GKY+QE
Sbjct  307  GPDEVKCWQIRKHSKAPQAAGAIHTDFERGFICAEVMKFEDLKELGSEAAVKAAGKYKQE  366

Query  175  GKTYVVQDGDVIFFKFNVSGGGK  107
            GK YVVQDGD+IFFKFNV+   K
Sbjct  367  GKNYVVQDGDIIFFKFNVTAAKK  389



>ref|XP_008812127.1| PREDICTED: obg-like ATPase 1 [Phoenix dactylifera]
Length=412

 Score =   318 bits (814),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 158/222 (71%), Positives = 176/222 (79%), Gaps = 18/222 (8%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            VK  L +GKD RLG+WKAAD+EILNTFQLLTAKPVVYLVNMNE+DYQRKKNKFLPKIHAW
Sbjct  191  VKAWLKDGKDVRLGDWKAADVEILNTFQLLTAKPVVYLVNMNERDYQRKKNKFLPKIHAW  250

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            VQ HGGE IIPFS  LE++L DMP DEAAKYCEENKVQSA+PKIIKTGF+AINL+YFFTA
Sbjct  251  VQNHGGETIIPFSCVLEKNLVDMPEDEAAKYCEENKVQSAIPKIIKTGFAAINLVYFFTA  310

Query  355  GPDEVKCWQ-----IRRQTKAPQAAGAIHTDLERGFI-------------CAEVMKFEDL  230
            GPDEVKC        R +  A     + + ++ R ++             C +VMKFEDL
Sbjct  311  GPDEVKCCYNSFVLHRIRCLADMLLESKYLEISRSYVFAFHEMVFYLELYCLQVMKFEDL  370

Query  229  KELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  104
            KELGSE AVKA GKYRQEGKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  371  KELGSEAAVKAAGKYRQEGKTYVVQDGDIIFFKFNVSGGGKK  412



>gb|AAP43929.1| GTP-binding protein [Triticum aestivum]
Length=232

 Score =   306 bits (785),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 146/178 (82%), Positives = 156/178 (88%), Gaps = 0/178 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            V   L + KD RLGEWKAA+IEILN FQLLTAKPVVYLVNM+EKDY RKKNKFLPKIHAW
Sbjct  19   VMAHLQDRKDVRLGEWKAAEIEILNAFQLLTAKPVVYLVNMSEKDYLRKKNKFLPKIHAW  78

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            V+EHGGE IIPFS A E+ L DMP DEAAKYC EN+  S +PKIIKTGF+AI+LIYFFTA
Sbjct  79   VKEHGGETIIPFSCAFEQKLVDMPEDEAAKYCAENQTASLIPKIIKTGFAAIHLIYFFTA  138

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYR  182
            G DEVKCWQIRRQ+KAPQAAGAIHTD ERGFICAEVMKFEDLKELGSE AVKA GKYR
Sbjct  139  GHDEVKCWQIRRQSKAPQAAGAIHTDFERGFICAEVMKFEDLKELGSESAVKAAGKYR  196



>gb|AFW56959.1| hypothetical protein ZEAMMB73_810066 [Zea mays]
Length=164

 Score =   303 bits (776),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 141/164 (86%), Positives = 152/164 (93%), Gaps = 0/164 (0%)
 Frame = -3

Query  595  MNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSA  416
            M+EKD+QRKKNKFLPKIHAWVQEHGGE I+PFS A E+ L DMP DEAAKYC EN++ S 
Sbjct  1    MSEKDFQRKKNKFLPKIHAWVQEHGGETILPFSCAFEQKLVDMPEDEAAKYCAENQITSM  60

Query  415  LPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFE  236
            +PKIIKTGF+AI+LIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTD ERGFICAEVMKFE
Sbjct  61   IPKIIKTGFAAIHLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDFERGFICAEVMKFE  120

Query  235  DLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  104
            DLKELGSE AVKA GKY+QEGKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  121  DLKELGSESAVKAAGKYKQEGKTYVVQDGDIIFFKFNVSGGGKK  164



>gb|AFW56960.1| hypothetical protein ZEAMMB73_810066 [Zea mays]
Length=369

 Score =   308 bits (788),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 151/200 (76%), Positives = 163/200 (82%), Gaps = 24/200 (12%)
 Frame = -3

Query  703  LDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEH  524
            L+EGKD RLG+WKAADIEILNTFQLL+AKPVVYL                        EH
Sbjct  194  LEEGKDVRLGDWKAADIEILNTFQLLSAKPVVYL------------------------EH  229

Query  523  GGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDE  344
            GGE I+PFS A E+ L DMP DEAAKYC EN++ S +PKIIKTGF+AI+LIYFFTAGPDE
Sbjct  230  GGETILPFSCAFEQKLVDMPEDEAAKYCAENQITSMIPKIIKTGFAAIHLIYFFTAGPDE  289

Query  343  VKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTY  164
            VKCWQIRRQTKAPQAAGAIHTD ERGFICAEVMKFEDLKELGSE AVKA GKY+QEGKTY
Sbjct  290  VKCWQIRRQTKAPQAAGAIHTDFERGFICAEVMKFEDLKELGSESAVKAAGKYKQEGKTY  349

Query  163  VVQDGDVIFFKFNVSGGGKK  104
            VVQDGD+IFFKFNVSGGGKK
Sbjct  350  VVQDGDIIFFKFNVSGGGKK  369



>gb|KDO75237.1| hypothetical protein CISIN_1g015465mg [Citrus sinensis]
Length=350

 Score =   306 bits (783),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 145/157 (92%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            VK  L +GKD RLG+WKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW
Sbjct  191  VKAWLQDGKDVRLGDWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  250

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            VQEHGGE IIPFS ALER+LADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA
Sbjct  251  VQEHGGEQIIPFSCALERNLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  310

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVM  245
            GPDEVKCWQIRRQTKAPQAAG IHTD ERGFICAEV+
Sbjct  311  GPDEVKCWQIRRQTKAPQAAGTIHTDFERGFICAEVV  347



>ref|XP_001699763.1| flagellar associated protein [Chlamydomonas reinhardtii]
 gb|EDP07459.1| flagellar associated protein [Chlamydomonas reinhardtii]
Length=391

 Score =   302 bits (773),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 144/200 (72%), Positives = 161/200 (81%), Gaps = 0/200 (0%)
 Frame = -3

Query  703  LDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEH  524
            L++  D R G+W A D+E LN +QLLTAKP VYLVNM+E D+ RKKNKFLPKIH WVQ H
Sbjct  192  LNKEIDVRFGDWSAKDVEWLNEYQLLTAKPAVYLVNMSENDFARKKNKFLPKIHEWVQAH  251

Query  523  GGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDE  344
            GGE IIPFSA+ E  + DMP DE  KYC+E  V   LPKII TGF AI+LIYFFTAG DE
Sbjct  252  GGEPIIPFSASFENKINDMPDDEKDKYCKELGVVCQLPKIITTGFRAIHLIYFFTAGEDE  311

Query  343  VKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTY  164
            VKCWQIR+  KAPQAAG IHTD ERGFICAEVMKFE+LKELG+E AVKA GKYRQ+GK Y
Sbjct  312  VKCWQIRQGAKAPQAAGTIHTDFERGFICAEVMKFEELKELGTESAVKAAGKYRQQGKEY  371

Query  163  VVQDGDVIFFKFNVSGGGKK  104
            VV DGD+IFFKFNV+  GKK
Sbjct  372  VVTDGDIIFFKFNVTSSGKK  391



>ref|XP_002953429.1| hypothetical protein VOLCADRAFT_105955 [Volvox carteri f. nagariensis]
 gb|EFJ45402.1| hypothetical protein VOLCADRAFT_105955 [Volvox carteri f. nagariensis]
Length=391

 Score =   301 bits (770),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 144/200 (72%), Positives = 162/200 (81%), Gaps = 0/200 (0%)
 Frame = -3

Query  703  LDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEH  524
            L++  D R GEW A D+E LN +QLLTAKP VYLVNM+E D+ RKKNKFLPKIH WVQ H
Sbjct  192  LNKEVDVRFGEWGAKDVEWLNEYQLLTAKPAVYLVNMSETDFARKKNKFLPKIHEWVQAH  251

Query  523  GGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDE  344
            GGE IIPFSAA E  + +MP DE  KYC+E  V S LPKII TGF AI+LIYFFTAG DE
Sbjct  252  GGEPIIPFSAAFENKIFEMPDDEKDKYCKEAGVISMLPKIITTGFKAIHLIYFFTAGDDE  311

Query  343  VKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTY  164
            VKCWQIR+ TKAPQAAG IHTD ERGFICAEVMK+++LKELGSE AVKA GKYRQ+GK Y
Sbjct  312  VKCWQIRQGTKAPQAAGTIHTDFERGFICAEVMKYDELKELGSEGAVKAAGKYRQQGKEY  371

Query  163  VVQDGDVIFFKFNVSGGGKK  104
            VV DGD+I+FKFNV+   KK
Sbjct  372  VVTDGDIIYFKFNVTSSAKK  391



>gb|KDD75506.1| DUF933 hypothetical protein [Helicosporidium sp. ATCC 50920]
Length=398

 Score =   294 bits (753),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 135/204 (66%), Positives = 165/204 (81%), Gaps = 0/204 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            V   L+EGKD RLG+W A ++E LN  Q +TAKPV+YL N++EKDY RKKNK+L K+HAW
Sbjct  195  VANWLEEGKDIRLGDWTAIEVEFLNANQFITAKPVIYLANLSEKDYIRKKNKWLVKLHAW  254

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            V+ HGG  IIPFS  LE  L DMP DE A YC+EN+  SA+PKII +GF A+NLIYFFT 
Sbjct  255  VEAHGGGQIIPFSGQLEGKLLDMPEDERAVYCKENECVSAIPKIITSGFRAVNLIYFFTC  314

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  176
            GP+EV+CWQIR+ +KAPQAAGAIH+D ERGFICAEVM++ DL E+G+E AVKA GKY+QE
Sbjct  315  GPEEVRCWQIRKYSKAPQAAGAIHSDFERGFICAEVMRYSDLHEIGNEQAVKAAGKYKQE  374

Query  175  GKTYVVQDGDVIFFKFNVSGGGKK  104
            GK YVV+DGD+I+FKFNV+   KK
Sbjct  375  GKNYVVEDGDIIYFKFNVTADKKK  398



>ref|XP_005847323.1| hypothetical protein CHLNCDRAFT_56178 [Chlorella variabilis]
 gb|EFN55221.1| hypothetical protein CHLNCDRAFT_56178 [Chlorella variabilis]
Length=390

 Score =   293 bits (751),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 137/200 (69%), Positives = 161/200 (81%), Gaps = 0/200 (0%)
 Frame = -3

Query  703  LDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEH  524
            L+EGKD R GEW   D++ LNT Q LTAKPVVYLVN++E+DYQRKKNK+L K+  WV+ H
Sbjct  191  LEEGKDIRFGEWTQKDVDWLNTVQFLTAKPVVYLVNLSERDYQRKKNKWLVKLFEWVKAH  250

Query  523  GGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDE  344
            GG+ IIPFS ALE  L DMP DE   YC+E++VQSALPKI+  GF A+ LIY+FTAG  E
Sbjct  251  GGDPIIPFSGALEAKLLDMPEDEREVYCQEHEVQSALPKIVTAGFKAVRLIYYFTAGVQE  310

Query  343  VKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTY  164
            V+CWQIR  TKAPQAAGAIH+D ERGFICAEVM F D+KE GSE AVK+ G +RQEGKTY
Sbjct  311  VRCWQIREHTKAPQAAGAIHSDFERGFICAEVMAFADMKEHGSEAAVKSAGNWRQEGKTY  370

Query  163  VVQDGDVIFFKFNVSGGGKK  104
             VQDGD+I +KFNV+ GGKK
Sbjct  371  EVQDGDIIHWKFNVTSGGKK  390



>ref|XP_005650863.1| flagellar associated protein [Coccomyxa subellipsoidea C-169]
 gb|EIE26319.1| flagellar associated protein [Coccomyxa subellipsoidea C-169]
Length=392

 Score =   290 bits (742),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 138/204 (68%), Positives = 160/204 (78%), Gaps = 0/204 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            VK  ++ G D R GEW   +++ LNT QL+TAKPVVYLVN+ EK Y +KK+K+LPKI  W
Sbjct  189  VKDFVETGVDVRFGEWNLKEVDFLNTVQLITAKPVVYLVNLTEKAYIKKKSKWLPKIFEW  248

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            V+EHGGE IIPFS  LE  L DMP DE A Y +EN+   ALPKII TGF +I LIYFFTA
Sbjct  249  VKEHGGEPIIPFSGVLESKLFDMPDDEKATYLKENEAMCALPKIITTGFKSIQLIYFFTA  308

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  176
            G DEVKCWQIR+ TKAPQAAGAIHTD ERGFICAEVM +++L ELG+E A +A GKYRQE
Sbjct  309  GEDEVKCWQIRKGTKAPQAAGAIHTDFERGFICAEVMHYDELHELGTESAARAAGKYRQE  368

Query  175  GKTYVVQDGDVIFFKFNVSGGGKK  104
            GK YVV DGDVI+FKFNV+  GKK
Sbjct  369  GKNYVVLDGDVIYFKFNVTASGKK  392



>gb|KJB69091.1| hypothetical protein B456_011G005000 [Gossypium raimondii]
Length=357

 Score =   288 bits (737),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 137/156 (88%), Positives = 143/156 (92%), Gaps = 0/156 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            VK  L + KD RLG+WKAADIEILNTFQLL+AKPVVYLVNM EKDYQRKKNKFLPKIHAW
Sbjct  191  VKAWLADEKDVRLGDWKAADIEILNTFQLLSAKPVVYLVNMTEKDYQRKKNKFLPKIHAW  250

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            VQEHGGE IIPFS   ER+LADM P +AAKYCEENKVQSALPKIIKTGFSAINLIYFFTA
Sbjct  251  VQEHGGEPIIPFSGVFERNLADMEPADAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  310

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEV  248
            GPDEVKCWQIRRQ+KAPQAAGAIHTD ERGFICAEV
Sbjct  311  GPDEVKCWQIRRQSKAPQAAGAIHTDFERGFICAEV  346



>ref|XP_011395756.1| Obg-like ATPase 1 [Auxenochlorella protothecoides]
 gb|KFM22890.1| Obg-like ATPase 1 [Auxenochlorella protothecoides]
Length=348

 Score =   284 bits (727),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 131/200 (66%), Positives = 159/200 (80%), Gaps = 0/200 (0%)
 Frame = -3

Query  703  LDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEH  524
            + EGKD R G+W A ++E LN  Q ++AKPV+YLVN++EKDY RKKNK+LPK+  W+Q H
Sbjct  149  VQEGKDIRSGDWTAIEVEFLNNHQFISAKPVIYLVNLSEKDYIRKKNKWLPKLFEWIQAH  208

Query  523  GGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDE  344
            GG  +IPFS ALE  L DMP DE   YC+E+   SALPKII  GF A++LIYFFT GP E
Sbjct  209  GGAQLIPFSGALEAKLFDMPDDEKEAYCKEHGCTSALPKIIVAGFKAVHLIYFFTCGPGE  268

Query  343  VKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTY  164
            V+CWQIR+ +KAPQAAGAIH+D ERGFICAEVM +++LKELG+E AVKA GKYRQEGKTY
Sbjct  269  VRCWQIRKNSKAPQAAGAIHSDFERGFICAEVMHYDELKELGNENAVKAAGKYRQEGKTY  328

Query  163  VVQDGDVIFFKFNVSGGGKK  104
            V+QDGD+  FKFNV+   KK
Sbjct  329  VMQDGDICHFKFNVTAEKKK  348



>ref|XP_003064009.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH51631.1| predicted protein [Micromonas pusilla CCMP1545]
Length=400

 Score =   285 bits (730),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 138/202 (68%), Positives = 162/202 (80%), Gaps = 2/202 (1%)
 Frame = -3

Query  703  LDEGKDARLG--EWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQ  530
            L++GK+ R G  +W   D++ LNT+QLLT+KPV+YLVN+ EKDY RKKNK+L KIHAWV 
Sbjct  199  LEDGKEIRNGMEQWSTTDVDFLNTYQLLTSKPVIYLVNLTEKDYARKKNKWLAKIHAWVM  258

Query  529  EHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  350
            EHGG  IIPFS A E  L D+P DE A++ ++ ++ + LPKIIKT FS I+LIYFFTAGP
Sbjct  259  EHGGGTIIPFSGAFECELQDVPEDEKAQFQKDKEMTTILPKIIKTAFSTIHLIYFFTAGP  318

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEVK W IR+  KAPQAAGAIHTD ERGFICAEVM FE LKELGSE  VKA GKY+QEGK
Sbjct  319  DEVKAWCIRKGFKAPQAAGAIHTDFERGFICAEVMAFETLKELGSEQEVKAKGKYKQEGK  378

Query  169  TYVVQDGDVIFFKFNVSGGGKK  104
            TY+V DGDVIFFKFNV+  GKK
Sbjct  379  TYLVNDGDVIFFKFNVTAKGKK  400



>gb|EMS48298.1| Obg-like ATPase 1 [Triticum urartu]
Length=347

 Score =   281 bits (720),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 144/204 (71%), Positives = 154/204 (75%), Gaps = 39/204 (19%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            + T L +GKD RLGEWKAA+IEILNTFQLLTAKPVVYLVNM+EKDY RKKNKFLPKIHA 
Sbjct  183  IMTHLQDGKDLRLGEWKAAEIEILNTFQLLTAKPVVYLVNMSEKDYLRKKNKFLPKIHAC  242

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            +                                       +PKIIKTGF+AI+LIYFFTA
Sbjct  243  L---------------------------------------IPKIIKTGFAAIHLIYFFTA  263

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  176
            G  EVKCWQIRRQ+KAPQAAGAIHTD ERGFICAEVMKFEDLKELGSE AVKA GKYRQE
Sbjct  264  GHGEVKCWQIRRQSKAPQAAGAIHTDFERGFICAEVMKFEDLKELGSESAVKAAGKYRQE  323

Query  175  GKTYVVQDGDVIFFKFNVSGGGKK  104
            GKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  324  GKTYVVQDGDIIFFKFNVSGGGKK  347



>ref|XP_006845996.1| hypothetical protein AMTR_s00155p00052120 [Amborella trichopoda]
 gb|ERN07671.1| hypothetical protein AMTR_s00155p00052120 [Amborella trichopoda]
Length=146

 Score =   275 bits (702),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 130/144 (90%), Positives = 136/144 (94%), Gaps = 0/144 (0%)
 Frame = -3

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            VQEHGGE IIPFS  LE+SL DMP DEAAKYC+ENK+QSA+PKIIKTGFSAINLIYFFTA
Sbjct  3    VQEHGGEPIIPFSCVLEKSLVDMPEDEAAKYCDENKIQSAIPKIIKTGFSAINLIYFFTA  62

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  176
            GPDEVKCWQIRRQTKAPQAAGAIHTD ERGFICAEVMKFEDLKELGSE A+KA GKYRQE
Sbjct  63   GPDEVKCWQIRRQTKAPQAAGAIHTDFERGFICAEVMKFEDLKELGSEAALKAAGKYRQE  122

Query  175  GKTYVVQDGDVIFFKFNVSGGGKK  104
            GKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  123  GKTYVVQDGDIIFFKFNVSGGGKK  146



>ref|XP_001421839.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABP00133.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=400

 Score =   283 bits (725),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 135/202 (67%), Positives = 159/202 (79%), Gaps = 2/202 (1%)
 Frame = -3

Query  703  LDEGKDARLG--EWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQ  530
            L+ GK+ R G  +W + D+  LN +QLLTAKPV+YLVN++ KD++RKKNKFL KIH WVQ
Sbjct  198  LESGKEVRHGMEQWTSNDVMYLNKYQLLTAKPVIYLVNLSRKDFERKKNKFLVKIHEWVQ  257

Query  529  EHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  350
             HGG  IIPFSA +E  L  +  ++ A++C++  VQ+ LPKII T FS ++LIYFFTAGP
Sbjct  258  AHGGGTIIPFSAEVESELQHVAEEDKAQWCKDRGVQTMLPKIITTAFSTVHLIYFFTAGP  317

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEVK W IR+  KAPQAAGAIHTD ERGFICAEVM F+DLKELGSE AVK  GKYRQEGK
Sbjct  318  DEVKAWCIRKGYKAPQAAGAIHTDFERGFICAEVMAFDDLKELGSEQAVKTAGKYRQEGK  377

Query  169  TYVVQDGDVIFFKFNVSGGGKK  104
            TY VQD DVIFFKFNVSG  KK
Sbjct  378  TYTVQDADVIFFKFNVSGAAKK  399



>ref|XP_002502254.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO63512.1| predicted protein [Micromonas sp. RCC299]
Length=400

 Score =   275 bits (702),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 134/202 (66%), Positives = 157/202 (78%), Gaps = 2/202 (1%)
 Frame = -3

Query  703  LDEGKDARLG--EWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQ  530
            L++GK+ R G  EW   DI+ LN +QLLTAKPV+Y+VN+ +KDY RK NK+L KIH WV 
Sbjct  199  LEDGKEVRNGMDEWSTTDIDFLNKYQLLTAKPVIYVVNLTKKDYARKANKWLKKIHEWVM  258

Query  529  EHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  350
             HGG +IIPFS A E  L D+P +  A+Y +E  + S LPKIIKTGFS I+LIYFFTAGP
Sbjct  259  GHGGGVIIPFSGAFEAELQDVPEEGKAEYEKEQGMTSVLPKIIKTGFSTIHLIYFFTAGP  318

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEVK W IR+  KAPQAAGAIHTD ERGFICAEVM F+ LKELG+E  VKA GKYRQEGK
Sbjct  319  DEVKAWCIRKGFKAPQAAGAIHTDFERGFICAEVMGFDTLKELGTEAEVKAKGKYRQEGK  378

Query  169  TYVVQDGDVIFFKFNVSGGGKK  104
            TY V+DGD+IFFKFNV+   KK
Sbjct  379  TYTVEDGDIIFFKFNVTAAKKK  400



>emb|CEG00523.1| P-loop containing nucleoside triphosphate hydrolase [Ostreococcus 
tauri]
Length=398

 Score =   271 bits (693),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 130/201 (65%), Positives = 154/201 (77%), Gaps = 2/201 (1%)
 Frame = -3

Query  703  LDEGKDARLG--EWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQ  530
            L EG + R G  +W   D+  LN +QLLTAKPV+YLVN++ KD++RKKNKFL KIH WV+
Sbjct  198  LQEGNEVRNGMEKWNTNDVMYLNKYQLLTAKPVIYLVNLSRKDFERKKNKFLVKIHEWVK  257

Query  529  EHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  350
             HGG  IIP SA +E  L  +P +E  ++C++  V S LPKIIKT FS I+LIYFFTAGP
Sbjct  258  SHGGGTIIPVSAEVEGELQHVPAEEKEQWCKDQGVTSCLPKIIKTAFSTIHLIYFFTAGP  317

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEVK W IR+  KAPQAAGAIHTD ERGFICAEVM F+DLKELG+E AVK  GKYRQEGK
Sbjct  318  DEVKAWCIRKGFKAPQAAGAIHTDFERGFICAEVMAFDDLKELGTESAVKTAGKYRQEGK  377

Query  169  TYVVQDGDVIFFKFNVSGGGK  107
             Y+VQDGD+ FFKFNV+   K
Sbjct  378  NYLVQDGDICFFKFNVTSSKK  398



>ref|XP_003388006.1| PREDICTED: obg-like ATPase 1 [Amphimedon queenslandica]
Length=434

 Score =   271 bits (694),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 128/204 (63%), Positives = 155/204 (76%), Gaps = 4/204 (2%)
 Frame = -3

Query  703  LDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEH  524
            +D+ K  R G W AADIE+LN    LTAKPVVYL+N++EKDY RKKNK+L  I  W+  H
Sbjct  230  VDDKKSVRFGTWNAADIELLNKHLFLTAKPVVYLINLSEKDYTRKKNKWLKDIKEWIDAH  289

Query  523  -GGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPD  347
              G ++IPFS   E+ L DMP DEAA+YC ENKV S+LPKII  G+ A+NL YFFT+GPD
Sbjct  290  DAGAIVIPFSGVFEQKLLDMPEDEAARYCTENKVTSSLPKIIVNGYKALNLQYFFTSGPD  349

Query  346  EVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKT  167
            EV+ W +++ TKAPQAAG IHTD E+GFI AEVMK+ED KELGSE AVKA GKYRQ+G+ 
Sbjct  350  EVRAWTVQKGTKAPQAAGRIHTDFEKGFIMAEVMKYEDYKELGSESAVKAAGKYRQQGRN  409

Query  166  YVVQDGDVIFFKFNVSGG---GKK  104
            Y+V+DGD+I FKFN   G   GKK
Sbjct  410  YIVEDGDIILFKFNAGAGLTAGKK  433



>gb|EPY26360.1| GTP binding protein [Angomonas deanei]
Length=208

 Score =   263 bits (673),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 118/204 (58%), Positives = 154/204 (75%), Gaps = 0/204 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            +K  L+E K  R G+W A +I+ LNT QL+TAKP ++LVNM+E DY R++NK+L K+  W
Sbjct  5    IKEHLEENKQVRCGQWNAKEIDFLNTLQLITAKPAMFLVNMSENDYTRQRNKWLKKLKDW  64

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            + E  GE +IPFSA LE +  +M P+E AKYCEENK +S + KII T +  INLI++FTA
Sbjct  65   IDEQTGEPMIPFSAELESNFVNMSPEEVAKYCEENKTKSQIHKIITTAYGIINLIHYFTA  124

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  176
            GPDEVKCW I+R TKAPQAAG IHTD+E+GFICAEV+++ED   L SE A +  GK  Q+
Sbjct  125  GPDEVKCWTIQRHTKAPQAAGRIHTDMEKGFICAEVIEWEDFDRLESEAACRDEGKQHQQ  184

Query  175  GKTYVVQDGDVIFFKFNVSGGGKK  104
            G+ Y V+DGD+I+FKFN + GGKK
Sbjct  185  GRNYEVKDGDIIYFKFNAAKGGKK  208



>ref|XP_005703761.1| GTP-binding protein [Galdieria sulphuraria]
 gb|EME27241.1| GTP-binding protein [Galdieria sulphuraria]
Length=398

 Score =   264 bits (674),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 130/208 (63%), Positives = 159/208 (76%), Gaps = 4/208 (2%)
 Frame = -3

Query  715  VKTSLDEG-KDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHA  539
            VK+ L+E  K  R GEW  ++IE+LN    LTAKP V+LVN++EKDY RKKNK+LPKI  
Sbjct  191  VKSFLEETRKPIRSGEWSNSEIEVLNRHLFLTAKPQVFLVNLSEKDYIRKKNKWLPKIKE  250

Query  538  WVQEHGGELIIPFSAALERSLADMP---PDEAAKYCEENKVQSALPKIIKTGFSAINLIY  368
            WV    GE+IIPFSA LE  L D+    P+ A +Y EENK  SALPKIIK G+ A++LIY
Sbjct  251  WVDSRTGEMIIPFSADLESKLLDLESQGPELAQQYLEENKTTSALPKIIKAGYQALHLIY  310

Query  367  FFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGK  188
            FFTAG DEVKCW I++ T APQAAG IH+D E+GFICAEVMK+++LKE GSE A+KA GK
Sbjct  311  FFTAGEDEVKCWTIQKGTLAPQAAGTIHSDFEKGFICAEVMKYDELKEYGSESALKAAGK  370

Query  187  YRQEGKTYVVQDGDVIFFKFNVSGGGKK  104
            YRQ+GK Y+V+DGD+I FKFNV+   KK
Sbjct  371  YRQQGKNYMVEDGDIILFKFNVTSSKKK  398



>gb|EPY25232.1| GTP binding protein [Angomonas deanei]
Length=208

 Score =   257 bits (657),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 114/204 (56%), Positives = 153/204 (75%), Gaps = 0/204 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            +K  L+E K  R G+W A +I+ LNT QL+TAKP ++LVNM+E DY R++NK+L K+  W
Sbjct  5    IKEHLEENKQVRCGQWNAKEIDFLNTLQLITAKPAMFLVNMSENDYTRQRNKWLKKLKDW  64

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            + E  GE +IPFSA LE +  +M P+E AKYCEENK +S + KII T +  INLI++FTA
Sbjct  65   IDEQTGEPMIPFSAELESNFVNMSPEEVAKYCEENKTKSQIHKIITTAYGIINLIHYFTA  124

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  176
            GP EV+CW I+R TKAPQAAG IH+D+E+GFICA+V+++ED   L SE A +  GK  Q+
Sbjct  125  GPGEVRCWTIQRHTKAPQAAGCIHSDMEKGFICADVIEWEDFDRLESEAACRDEGKQHQQ  184

Query  175  GKTYVVQDGDVIFFKFNVSGGGKK  104
            G+ Y V+DGD+I+FKFN + GGKK
Sbjct  185  GRNYEVKDGDIIYFKFNAAKGGKK  208



>gb|EPS62769.1| hypothetical protein M569_12020, partial [Genlisea aurea]
Length=146

 Score =   254 bits (648),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 123/146 (84%), Positives = 130/146 (89%), Gaps = 2/146 (1%)
 Frame = -3

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            VQEHGGE IIP S ALE  LADM P+EAAKYCEEN+VQSAL K+IKTGFSAINLIYFFTA
Sbjct  1    VQEHGGETIIPVSCALENKLADMSPEEAAKYCEENQVQSALSKVIKTGFSAINLIYFFTA  60

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  176
            GPDEVKCWQIRR +KAPQAAG IH+D ERGFICAEVMKFEDLKELGSE AVKA GKY+QE
Sbjct  61   GPDEVKCWQIRRLSKAPQAAGTIHSDFERGFICAEVMKFEDLKELGSEAAVKACGKYKQE  120

Query  175  GKTYVVQDGDVIFFKFNV--SGGGKK  104
            GK YVVQDGD+IFFKFNV  SGG KK
Sbjct  121  GKGYVVQDGDIIFFKFNVSSSGGAKK  146



>gb|EPY39657.1| GTP binding protein [Angomonas deanei]
 gb|EPY42446.1| GTP binding protein [Angomonas deanei]
Length=392

 Score =   262 bits (670),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 119/204 (58%), Positives = 154/204 (75%), Gaps = 0/204 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            +K  L+E K  R G+W A +I+ LNT QL+TAKP ++LVNM+E DY R++NK+L K+  W
Sbjct  189  IKEHLEENKQVRCGQWNAKEIDFLNTLQLITAKPAMFLVNMSENDYTRQRNKWLKKLKDW  248

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            + E  GE +IPFSA LE +  +M P+E AKYCEENK +S + KII T +  INLI++FTA
Sbjct  249  IDEQTGEPMIPFSAELESNFVNMSPEEVAKYCEENKTKSQIHKIITTAYGIINLIHYFTA  308

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  176
            GPDEVKCW I+R TKAPQAAG IHTD+E+GFICAEV+++ED   L SE A +  GK  Q+
Sbjct  309  GPDEVKCWTIQRHTKAPQAAGRIHTDMEKGFICAEVIEWEDFDRLESEAACRDEGKQHQQ  368

Query  175  GKTYVVQDGDVIFFKFNVSGGGKK  104
            G+ Y V+DGD+IFFKFN + GGKK
Sbjct  369  GRNYEVKDGDIIFFKFNAAKGGKK  392



>ref|XP_003083821.1| GTP-binding protein (ISS) [Ostreococcus tauri]
Length=817

 Score =   272 bits (696),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 130/201 (65%), Positives = 154/201 (77%), Gaps = 2/201 (1%)
 Frame = -3

Query  703  LDEGKDARLG--EWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQ  530
            L EG + R G  +W   D+  LN +QLLTAKPV+YLVN++ KD++RKKNKFL KIH WV+
Sbjct  617  LQEGNEVRNGMEKWNTNDVMYLNKYQLLTAKPVIYLVNLSRKDFERKKNKFLVKIHEWVK  676

Query  529  EHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  350
             HGG  IIP SA +E  L  +P +E  ++C++  V S LPKIIKT FS I+LIYFFTAGP
Sbjct  677  SHGGGTIIPVSAEVEGELQHVPAEEKEQWCKDQGVTSCLPKIIKTAFSTIHLIYFFTAGP  736

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEVK W IR+  KAPQAAGAIHTD ERGFICAEVM F+DLKELG+E AVK  GKYRQEGK
Sbjct  737  DEVKAWCIRKGFKAPQAAGAIHTDFERGFICAEVMAFDDLKELGTESAVKTAGKYRQEGK  796

Query  169  TYVVQDGDVIFFKFNVSGGGK  107
             Y+VQDGD+ FFKFNV+   K
Sbjct  797  NYLVQDGDICFFKFNVTSSKK  817



>ref|XP_010736093.1| PREDICTED: obg-like ATPase 1 isoform X2 [Larimichthys crocea]
Length=238

 Score =   254 bits (650),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 150/202 (74%), Gaps = 2/202 (1%)
 Frame = -3

Query  703  LDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQE  527
            LDE K  R   +W   +IE+LN +  LT+KP++YL+N++EKDY R+KNK+L KI  WV  
Sbjct  36   LDEKKHVRYYHDWNDKEIEVLNKYLFLTSKPMIYLINLSEKDYIRRKNKWLVKIKEWVDS  95

Query  526  HG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  350
            H  G L+IPFS  LE  L D   +E  KYC E+K QSAL KIIKTG++A+ L YFFTAGP
Sbjct  96   HDPGALVIPFSGGLENKLQDKSEEETQKYCTEHKTQSALSKIIKTGYAALQLEYFFTAGP  155

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMKF+D KE GSE AVKA GKYRQ+G+
Sbjct  156  DEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKFQDFKEEGSENAVKAAGKYRQQGR  215

Query  169  TYVVQDGDVIFFKFNVSGGGKK  104
             Y+V+DGD+IFFKFN     KK
Sbjct  216  NYIVEDGDIIFFKFNAPNAPKK  237



>ref|XP_004220982.1| GTP-binding protein [Plasmodium cynomolgi strain B]
 dbj|GAB64851.1| GTP-binding protein [Plasmodium cynomolgi strain B]
Length=392

 Score =   258 bits (660),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 125/205 (61%), Positives = 151/205 (74%), Gaps = 1/205 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            V + L E K  + G WK++++E++N F  LTAKPVVYLVNM+E D+ R+KNK+L KI+ W
Sbjct  188  VLSYLKEHKWIKDGNWKSSEVEVINEFNFLTAKPVVYLVNMSESDFIRQKNKYLAKIYNW  247

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKV-QSALPKIIKTGFSAINLIYFFT  359
            VQE     IIP+ A +E  L  M  DE  KY EEN + QS L KI+KTG+  INLI+FFT
Sbjct  248  VQEKNKGTIIPYCADMELKLLSMSEDEKKKYFEENNIKQSMLSKIVKTGYYEINLIHFFT  307

Query  358  AGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQ  179
             GPDEVKCW IR+ TKAPQAAG IHTD E+GFICAEV K+ DL E  SE  VKA GKY Q
Sbjct  308  CGPDEVKCWTIRKGTKAPQAAGVIHTDFEKGFICAEVYKYTDLVEFKSEGEVKANGKYLQ  367

Query  178  EGKTYVVQDGDVIFFKFNVSGGGKK  104
            +GK YVV+DGD++FFKFNVS  GKK
Sbjct  368  KGKDYVVEDGDIVFFKFNVSSSGKK  392



>gb|EPY23726.1| GTP binding protein [Strigomonas culicis]
Length=270

 Score =   254 bits (649),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 116/204 (57%), Positives = 152/204 (75%), Gaps = 0/204 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            VK  L+EGK  R   W   +I+ LNT QLLTAKP ++L+NM+E D+ R++NK+L K+  W
Sbjct  67   VKEHLEEGKQIRCCHWNGKEIDYLNTIQLLTAKPAMFLINMSENDFCRQRNKWLKKLKDW  126

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            + E  GE +IPFSA LE S  +M P+E   YCEE+K +S + KII T ++ INLI++FTA
Sbjct  127  IDEQTGEPMIPFSAELESSFLNMSPEEVHAYCEEHKTKSQIHKIINTAYNVINLIHYFTA  186

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  176
            GPDEVKCW I+R TKAPQAAG IH+D+E+GFICAEV+++ED + L SE A +  GK  Q 
Sbjct  187  GPDEVKCWTIQRGTKAPQAAGRIHSDMEKGFICAEVIEWEDFERLKSESACRDEGKQHQH  246

Query  175  GKTYVVQDGDVIFFKFNVSGGGKK  104
            G+TY V+DGD+IFFKFN + GGKK
Sbjct  247  GRTYEVKDGDIIFFKFNAAKGGKK  270



>ref|XP_011488091.1| PREDICTED: obg-like ATPase 1 [Oryzias latipes]
Length=245

 Score =   253 bits (645),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 149/202 (74%), Gaps = 2/202 (1%)
 Frame = -3

Query  703  LDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQE  527
            +DE K  R   +W   +IE+LN F  LT+KP++YLVN++E+DY R+KNK+L KI  WV  
Sbjct  43   VDEKKHVRYYPDWNDKEIEVLNKFLFLTSKPMIYLVNLSERDYIRRKNKWLVKIKEWVDS  102

Query  526  HG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  350
            H  G L+IPFS  LE  L DM  +E  KYC E K QSAL KIIKTG++A+ L YFFT GP
Sbjct  103  HDPGALVIPFSGNLESKLQDMSEEERHKYCTEQKTQSALNKIIKTGYAALQLEYFFTTGP  162

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMKF+D KE GSE AVKA GKYRQ+G+
Sbjct  163  DEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKFQDFKEEGSESAVKAAGKYRQQGR  222

Query  169  TYVVQDGDVIFFKFNVSGGGKK  104
             Y+V+DGD+IFFKFN     KK
Sbjct  223  NYIVEDGDIIFFKFNAPNAPKK  244



>ref|XP_008818190.1| GTP-binding protein YchF [Plasmodium inui San Antonio 1]
 gb|EUD65256.1| GTP-binding protein YchF [Plasmodium inui San Antonio 1]
Length=392

 Score =   257 bits (656),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 127/205 (62%), Positives = 150/205 (73%), Gaps = 1/205 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            V + L E K  + G WK+++IE++N F  LTAKPVVYLVNM+E D+ R+KNK L KI+ W
Sbjct  188  VLSFLKEHKWIKDGNWKSSEIEVINEFNFLTAKPVVYLVNMSESDFIRQKNKHLAKIYNW  247

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKV-QSALPKIIKTGFSAINLIYFFT  359
            VQE     IIP+ A LE  L  M  DE   Y EENK+ QS L KI+KTG+  INLI+FFT
Sbjct  248  VQEKNKGTIIPYCADLELKLLSMSEDEKKTYFEENKIKQSMLNKIVKTGYYEINLIHFFT  307

Query  358  AGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQ  179
             GPDEVKCW IR+ TKAPQAAG IHTD E+GFICAEV K+ DL E  SE  VKA GKY Q
Sbjct  308  CGPDEVKCWTIRKGTKAPQAAGVIHTDFEKGFICAEVYKYTDLVEFKSEGEVKANGKYLQ  367

Query  178  EGKTYVVQDGDVIFFKFNVSGGGKK  104
            +GK YVV+DGD++FFKFNVS  GKK
Sbjct  368  KGKDYVVEDGDIVFFKFNVSSSGKK  392



>ref|XP_005452977.1| PREDICTED: obg-like ATPase 1-like isoform X8 [Oreochromis niloticus]
Length=252

 Score =   252 bits (644),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 149/202 (74%), Gaps = 2/202 (1%)
 Frame = -3

Query  703  LDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQE  527
            +DE K  R   +W   +IE+LN +  LT+KP++YLVN++EKDY R+KNK+L KI  WV  
Sbjct  50   VDEKKHIRYYHDWNDKEIEVLNKYLFLTSKPMIYLVNLSEKDYIRRKNKWLVKIKEWVDS  109

Query  526  HG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  350
            H  G L+IPFS  LE  L D   +E  KYC E+K QSAL KIIK G++A+ L YFFTAGP
Sbjct  110  HDPGALVIPFSGGLESLLQDKSEEERQKYCTEHKTQSALSKIIKAGYAALQLEYFFTAGP  169

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEV+ W IR+ TKAPQAAG IHTD ERGFI AEVMKF+D KE GSE AVKA GKYRQ+G+
Sbjct  170  DEVRAWTIRKGTKAPQAAGKIHTDFERGFIMAEVMKFQDFKEEGSESAVKAAGKYRQQGR  229

Query  169  TYVVQDGDVIFFKFNVSGGGKK  104
             Y+V+DGD+IFFKFN     KK
Sbjct  230  NYIVEDGDIIFFKFNAPNAPKK  251



>gb|EPY30421.1| GTP binding protein [Angomonas deanei]
Length=392

 Score =   256 bits (655),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 115/204 (56%), Positives = 154/204 (75%), Gaps = 0/204 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            VK  L+EGK  R G+W   +I++LNT QL+TAKP ++LVNM+E DY R++NK+L K+  W
Sbjct  189  VKEHLEEGKQVRCGQWSGKEIDLLNTIQLITAKPAMFLVNMSENDYARQRNKWLKKLKDW  248

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            + E  GE +IPFSA LE +  +M P+E AKYCEENK +S + KII T +  INLI++FTA
Sbjct  249  IDEQTGEPMIPFSAELETNFLNMSPEEVAKYCEENKTKSQIHKIITTAYGIINLIHYFTA  308

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  176
            GP EV+CW I+R TKAPQAAG IH+D+E+GFICA+V+++ED   L SE A +  GK  Q+
Sbjct  309  GPGEVRCWTIQRHTKAPQAAGCIHSDMEKGFICADVIEWEDFDRLESEAACRDEGKQHQQ  368

Query  175  GKTYVVQDGDVIFFKFNVSGGGKK  104
            G+ Y V+DGD+I+FKFN + GGKK
Sbjct  369  GRNYEVKDGDIIYFKFNAAKGGKK  392



>ref|XP_001466463.1| putative GTP binding protein [Leishmania infantum JPCM5]
 ref|XP_003862077.1| GTP binding protein, putative [Leishmania donovani]
 emb|CAM69183.1| putative GTP binding protein [Leishmania infantum JPCM5]
 emb|CBZ35383.1| GTP binding protein, putative [Leishmania donovani]
Length=392

 Score =   256 bits (654),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 119/204 (58%), Positives = 151/204 (74%), Gaps = 0/204 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            VK  L+EGK  R  +W   +I+ LNT QLLTAKP ++LVNM+E DY R++NK+L K+  W
Sbjct  189  VKGVLEEGKQVRCCQWNGKEIDFLNTIQLLTAKPAMFLVNMSEDDYMRQRNKWLKKLKDW  248

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            + EH GE +IPFSA LE +   M PDE  KYCEE K +S + KI+KT +S INLI++FTA
Sbjct  249  IDEHTGEPMIPFSAELETTFVAMSPDEVDKYCEEKKTRSQIHKIVKTAYSIINLIHYFTA  308

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  176
            G DEVKCW I+R TKAPQAAG IHTD+E+GFICA+V+++ D   L SE A +  GK  Q+
Sbjct  309  GADEVKCWTIQRGTKAPQAAGKIHTDMEKGFICADVIEWADFDRLESEAACRDEGKQHQQ  368

Query  175  GKTYVVQDGDVIFFKFNVSGGGKK  104
            G+ Y VQDGD+IFFKFN + GGKK
Sbjct  369  GRNYEVQDGDIIFFKFNAAKGGKK  392



>ref|XP_005452976.1| PREDICTED: obg-like ATPase 1-like isoform X7 [Oreochromis niloticus]
Length=283

 Score =   252 bits (643),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 149/202 (74%), Gaps = 2/202 (1%)
 Frame = -3

Query  703  LDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQE  527
            +DE K  R   +W   +IE+LN +  LT+KP++YLVN++EKDY R+KNK+L KI  WV  
Sbjct  81   VDEKKHIRYYHDWNDKEIEVLNKYLFLTSKPMIYLVNLSEKDYIRRKNKWLVKIKEWVDS  140

Query  526  HG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  350
            H  G L+IPFS  LE  L D   +E  KYC E+K QSAL KIIK G++A+ L YFFTAGP
Sbjct  141  HDPGALVIPFSGGLESLLQDKSEEERQKYCTEHKTQSALSKIIKAGYAALQLEYFFTAGP  200

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEV+ W IR+ TKAPQAAG IHTD ERGFI AEVMKF+D KE GSE AVKA GKYRQ+G+
Sbjct  201  DEVRAWTIRKGTKAPQAAGKIHTDFERGFIMAEVMKFQDFKEEGSESAVKAAGKYRQQGR  260

Query  169  TYVVQDGDVIFFKFNVSGGGKK  104
             Y+V+DGD+IFFKFN     KK
Sbjct  261  NYIVEDGDIIFFKFNAPNAPKK  282



>ref|XP_010192575.1| PREDICTED: obg-like ATPase 1, partial [Mesitornis unicolor]
 gb|KFQ29053.1| Obg-like ATPase 1, partial [Mesitornis unicolor]
 gb|KFZ56885.1| Obg-like ATPase 1, partial [Podiceps cristatus]
Length=213

 Score =   249 bits (636),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 149/202 (74%), Gaps = 2/202 (1%)
 Frame = -3

Query  703  LDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQE  527
            +DE K  R   +W   +I++LN     T+KP++YLVN++EKDY RKKNK+L KI  WV +
Sbjct  11   IDEKKAVRFYHDWNDKEIDVLNKHLFFTSKPMIYLVNLSEKDYIRKKNKWLIKIKEWVDK  70

Query  526  HG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  350
            H  G L+IPFS ALE  L DM  +E  KY EEN  QSAL KIIK G++A+ L YFFTAGP
Sbjct  71   HDPGALVIPFSGALELKLQDMSAEEKQKYLEENMTQSALAKIIKAGYAALQLEYFFTAGP  130

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+
Sbjct  131  DEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEGGSEAAVKAAGKYRQQGR  190

Query  169  TYVVQDGDVIFFKFNVSGGGKK  104
             Y+V+DGD+IFFKFN     KK
Sbjct  191  NYIVEDGDIIFFKFNTPQQPKK  212



>ref|XP_005019763.1| PREDICTED: obg-like ATPase 1 [Anas platyrhynchos]
Length=236

 Score =   249 bits (637),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 124/202 (61%), Positives = 149/202 (74%), Gaps = 2/202 (1%)
 Frame = -3

Query  703  LDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQE  527
            +DE K  R   +W   +I++LN     T+KP++YLVN++EKDY RKKNK+L KI  WV +
Sbjct  34   IDEKKAVRFYHDWNDKEIDVLNKHLFFTSKPMIYLVNLSEKDYIRKKNKWLIKIKEWVDK  93

Query  526  HG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  350
            H  G L+IPFS ALE  L DM  +E  KY EEN  QSAL KIIK G++A+ L YFFTAGP
Sbjct  94   HDPGALVIPFSGALELKLQDMSAEEKQKYLEENMTQSALAKIIKAGYAALQLEYFFTAGP  153

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+
Sbjct  154  DEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEGGSEAAVKAAGKYRQQGR  213

Query  169  TYVVQDGDVIFFKFNVSGGGKK  104
             YVV+DGD+IFFKFN     KK
Sbjct  214  NYVVEDGDIIFFKFNTPQQPKK  235



>emb|CEG70465.1| Putative Obg-like ATPase 1 [Rhizopus microsporus]
 emb|CEI95966.1| Putative Obg-like ATPase 1 [Rhizopus microsporus]
Length=398

 Score =   255 bits (651),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 121/201 (60%), Positives = 150/201 (75%), Gaps = 1/201 (0%)
 Frame = -3

Query  703  LDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEH  524
            + +GKD R G W   + E++N   LLTAKPV+YL N++EKDY RKKNK+LPKI AW+ E+
Sbjct  197  VQQGKDVRHGNWSNKEAEVINGLHLLTAKPVIYLANLSEKDYLRKKNKWLPKIKAWIDEN  256

Query  523  G-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPD  347
              G+++IP+S A E  L     +E  +  +EN   S LPKII  G++A+ LIYFFT GPD
Sbjct  257  SPGDMMIPYSGAYEYRLTLASAEEKEQIQKENNAPSVLPKIIVNGYAALQLIYFFTGGPD  316

Query  346  EVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKT  167
            EV+ W IR+ TKAPQAAG IHTD ERGFI AEVMK+EDLKELGSE AVKA GKY Q+GK 
Sbjct  317  EVRAWTIRKNTKAPQAAGVIHTDFERGFIMAEVMKYEDLKELGSESAVKAAGKYMQKGKE  376

Query  166  YVVQDGDVIFFKFNVSGGGKK  104
            YVV+DGD+I+FKFNV+   KK
Sbjct  377  YVVEDGDIIYFKFNVTAPAKK  397



>ref|XP_003722043.1| putative GTP binding protein [Leishmania major strain Friedlin]
 emb|CBZ12304.1| putative GTP binding protein [Leishmania major strain Friedlin]
Length=392

 Score =   255 bits (651),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 119/204 (58%), Positives = 150/204 (74%), Gaps = 0/204 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            VK  L+EGK  R  +W   +I+ LNT QLLTAKP ++LVNM+E DY R++NK+L K+  W
Sbjct  189  VKGVLEEGKQVRCCQWNGKEIDFLNTIQLLTAKPAMFLVNMSEDDYIRQRNKWLKKLKDW  248

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            + EH GE +IPFSA LE +   M PDE  KYCEE K +S + KI+KT +S IN I++FTA
Sbjct  249  IDEHTGEPMIPFSAELETAFVAMSPDEVDKYCEEKKTRSQIHKIVKTAYSIINFIHYFTA  308

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  176
            G DEVKCW I+R TKAPQAAG IHTD+E+GFICAEV+++ D   L SE A +  GK  Q+
Sbjct  309  GADEVKCWTIQRGTKAPQAAGKIHTDMEKGFICAEVIEWADFDRLESEAACRDEGKQHQQ  368

Query  175  GKTYVVQDGDVIFFKFNVSGGGKK  104
            G+ Y VQDGD+IFFKFN + GGKK
Sbjct  369  GRNYEVQDGDIIFFKFNAAKGGKK  392



>ref|XP_003876812.1| putative GTP binding protein [Leishmania mexicana MHOM/GT/2001/U1103]
 emb|CBZ28340.1| putative GTP binding protein [Leishmania mexicana MHOM/GT/2001/U1103]
Length=392

 Score =   254 bits (650),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 118/204 (58%), Positives = 151/204 (74%), Gaps = 0/204 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            VK  L+EGK  R  +W   +I+ LNT QLLTAKP ++LVNM+E DY R++NK+L K+  W
Sbjct  189  VKGVLEEGKQVRCCQWNGKEIDFLNTIQLLTAKPAMFLVNMSEDDYMRQRNKWLKKLKDW  248

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            + EH GE +IPFSA +E +   M P+E  KYCEE K +S + KI+KT +S INLI++FTA
Sbjct  249  IDEHTGEPMIPFSAEVETTFVAMSPEEVDKYCEEKKTKSQIQKIVKTAYSIINLIHYFTA  308

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  176
            G DEVKCW I+R TKAPQAAG IHTD+E+GFICAEV+++ D   L SE A +  GK  Q+
Sbjct  309  GADEVKCWTIQRGTKAPQAAGKIHTDMEKGFICAEVIEWADFDRLESEAACRDEGKQHQQ  368

Query  175  GKTYVVQDGDVIFFKFNVSGGGKK  104
            G+ Y VQDGD+IFFKFN + GGKK
Sbjct  369  GRNYEVQDGDIIFFKFNAAKGGKK  392



>ref|XP_009490257.1| PREDICTED: obg-like ATPase 1 [Pelecanus crispus]
 ref|XP_009966012.1| PREDICTED: obg-like ATPase 1 [Tyto alba]
Length=236

 Score =   249 bits (636),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 149/202 (74%), Gaps = 2/202 (1%)
 Frame = -3

Query  703  LDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQE  527
            +DE K  R   +W   +I++LN     T+KP++YLVN++EKDY RKKNK+L KI  WV +
Sbjct  34   IDEKKAVRFYHDWNDKEIDVLNKHLFFTSKPMIYLVNLSEKDYIRKKNKWLIKIKEWVDK  93

Query  526  HG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  350
            H  G L+IPFS ALE  L DM  +E  KY EEN  QSAL KIIK G++A+ L YFFTAGP
Sbjct  94   HDPGALVIPFSGALELKLQDMSAEEKQKYLEENMTQSALAKIIKAGYAALQLEYFFTAGP  153

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+
Sbjct  154  DEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEGGSEAAVKAAGKYRQQGR  213

Query  169  TYVVQDGDVIFFKFNVSGGGKK  104
             Y+V+DGD+IFFKFN     KK
Sbjct  214  NYIVEDGDIIFFKFNTPQQPKK  235



>ref|XP_005519867.1| PREDICTED: obg-like ATPase 1 isoform X4 [Pseudopodoces humilis]
 ref|XP_008632972.1| PREDICTED: obg-like ATPase 1 isoform X2 [Corvus brachyrhynchos]
 ref|XP_010307801.1| PREDICTED: obg-like ATPase 1 [Balearica regulorum gibbericeps]
 ref|XP_010405059.1| PREDICTED: obg-like ATPase 1 [Corvus cornix cornix]
Length=273

 Score =   250 bits (639),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 124/202 (61%), Positives = 149/202 (74%), Gaps = 2/202 (1%)
 Frame = -3

Query  703  LDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQE  527
            +DE K  R   +W   +I++LN     T+KP++YLVN++EKDY RKKNK+L KI  WV +
Sbjct  71   IDEKKAVRFYHDWNDKEIDVLNKHLFFTSKPMIYLVNLSEKDYIRKKNKWLIKIKEWVDK  130

Query  526  HG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  350
            H  G L+IPFS ALE  L DM  +E  KY EEN  QSAL KIIK G++A+ L YFFTAGP
Sbjct  131  HDPGALVIPFSGALELKLQDMSAEEKQKYLEENMTQSALAKIIKAGYAALQLEYFFTAGP  190

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+
Sbjct  191  DEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEGGSEAAVKAAGKYRQQGR  250

Query  169  TYVVQDGDVIFFKFNVSGGGKK  104
             YVV+DGD+IFFKFN     KK
Sbjct  251  NYVVEDGDIIFFKFNTPQQPKK  272



>ref|XP_008116321.1| PREDICTED: obg-like ATPase 1 isoform X3 [Anolis carolinensis]
Length=238

 Score =   249 bits (635),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 118/191 (62%), Positives = 147/191 (77%), Gaps = 1/191 (1%)
 Frame = -3

Query  673  EWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFS  497
            +W   +I++LN +  LT+KP++YLVN++EKDY RKKN++L KI  WV +H  G L+IPFS
Sbjct  47   DWNDKEIDVLNKYLFLTSKPMIYLVNLSEKDYIRKKNRWLIKIKEWVDKHDPGALVIPFS  106

Query  496  AALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQ  317
             ALE  L +M  +E  KY EEN  QSALPKIIK G++A+ L YFFTAGPDEV+ W IR+ 
Sbjct  107  GALELKLQEMSAEEKQKYLEENMTQSALPKIIKAGYAALQLEYFFTAGPDEVRAWTIRKG  166

Query  316  TKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIF  137
            TKAPQAAG IH+D E+GFI AEVMKFED KE G+E AVKA GKYRQ+G+ Y+V+DGD+IF
Sbjct  167  TKAPQAAGKIHSDFEKGFIMAEVMKFEDFKEGGTEAAVKAAGKYRQQGRNYIVEDGDIIF  226

Query  136  FKFNVSGGGKK  104
            FKFN     KK
Sbjct  227  FKFNTPQQPKK  237



>ref|XP_004601224.1| PREDICTED: obg-like ATPase 1 isoform X3 [Sorex araneus]
 ref|XP_007105933.1| PREDICTED: obg-like ATPase 1-like [Physeter catodon]
Length=238

 Score =   249 bits (635),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 151/202 (75%), Gaps = 2/202 (1%)
 Frame = -3

Query  703  LDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQE  527
            +D+ K  R   +W   +IE+LN +  LT+KP+VYLVN++EKDY RKKNK+L KI  WV +
Sbjct  36   IDQKKPVRFYHDWNDKEIEVLNKYLFLTSKPMVYLVNLSEKDYIRKKNKWLIKIKEWVDK  95

Query  526  HG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  350
            +  G L+IPFS ALE  L ++  +E  KY E N  QSALPKIIK GF+A+ L YFFTAGP
Sbjct  96   YDPGALVIPFSGALELKLQELSAEERQKYLEANMTQSALPKIIKAGFAALQLEYFFTAGP  155

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+
Sbjct  156  DEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEEGSENAVKAAGKYRQQGR  215

Query  169  TYVVQDGDVIFFKFNVSGGGKK  104
             Y+V+DGD+IFFKFN     KK
Sbjct  216  NYIVEDGDIIFFKFNTPQQPKK  237



>ref|XP_009581765.1| PREDICTED: obg-like ATPase 1 [Fulmarus glacialis]
Length=273

 Score =   250 bits (638),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 149/202 (74%), Gaps = 2/202 (1%)
 Frame = -3

Query  703  LDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQE  527
            +DE K  R   +W   +I++LN     T+KP++YLVN++EKDY RKKNK+L KI  WV +
Sbjct  71   IDEKKAVRFYHDWNDKEIDVLNKHLFFTSKPMIYLVNLSEKDYVRKKNKWLIKIKEWVDK  130

Query  526  HG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  350
            H  G L+IPFS ALE  L DM  +E  KY EEN  QSAL KIIK G++A+ L YFFTAGP
Sbjct  131  HDPGALVIPFSGALELKLQDMSAEEKQKYLEENMTQSALAKIIKAGYAALQLEYFFTAGP  190

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+
Sbjct  191  DEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEGGSEAAVKAAGKYRQQGR  250

Query  169  TYVVQDGDVIFFKFNVSGGGKK  104
             Y+V+DGD+IFFKFN     KK
Sbjct  251  NYIVEDGDIIFFKFNTPQQPKK  272



>emb|CCC89543.1| putative GTP binding protein [Trypanosoma congolense IL3000]
Length=394

 Score =   254 bits (648),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 116/204 (57%), Positives = 155/204 (76%), Gaps = 0/204 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            VK+ L+EG   R  +W   +I+ LNT QLLTAKP ++L NM+E+D+ R+++K+LPK+  W
Sbjct  191  VKSHLEEGNQIRCFQWNNKEIDFLNTLQLLTAKPAIFLANMSERDFIRQRSKWLPKLKEW  250

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            V +H GEL+IP SA LE +L +M   EA  Y +ENK +S +PKII + + AINLI++FTA
Sbjct  251  VDQHTGELLIPVSAELEANLLNMTAQEAEDYLKENKTKSQVPKIITSAYHAINLIHYFTA  310

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  176
            GPDEVKCW I+R TKAPQAAG IH+D+E+GFICAEV+ +ED ++L SE A +  GK  QE
Sbjct  311  GPDEVKCWTIQRGTKAPQAAGRIHSDMEKGFICAEVIHWEDYEKLESESACRDAGKQHQE  370

Query  175  GKTYVVQDGDVIFFKFNVSGGGKK  104
            G+ Y V+DGD+IFFKFN + GGKK
Sbjct  371  GRNYEVKDGDIIFFKFNAAKGGKK  394



>ref|XP_008533775.1| PREDICTED: obg-like ATPase 1, partial [Equus przewalskii]
Length=213

 Score =   248 bits (632),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 150/202 (74%), Gaps = 2/202 (1%)
 Frame = -3

Query  703  LDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQE  527
            +D+ K  R   +W   +IE+LN    LT+KP+VYLVN++EKDY RKKNK+L KI  WV +
Sbjct  11   MDQKKPVRFYHDWNDKEIEVLNKHLFLTSKPMVYLVNLSEKDYIRKKNKWLIKIKEWVDK  70

Query  526  HG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  350
            +  G L+IPFS ALE  L ++  +E  KY E N  QSALPKIIK GF+A+ L YFFTAGP
Sbjct  71   YDPGALVIPFSGALELKLQELSAEERQKYLEANMTQSALPKIIKAGFAALQLEYFFTAGP  130

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+
Sbjct  131  DEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEEGSENAVKAAGKYRQQGR  190

Query  169  TYVVQDGDVIFFKFNVSGGGKK  104
             Y+V+DGD+IFFKFN     KK
Sbjct  191  NYIVEDGDIIFFKFNTPQQPKK  212



>ref|XP_004703789.1| PREDICTED: obg-like ATPase 1 isoform X3 [Echinops telfairi]
Length=238

 Score =   248 bits (634),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 125/202 (62%), Positives = 150/202 (74%), Gaps = 2/202 (1%)
 Frame = -3

Query  703  LDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQE  527
            +D+ K  R   +W   +IE+LN    LT+KP+VYLVN++EKDY RKKNK+L KI  WV +
Sbjct  36   VDQKKPVRFYHDWNDKEIEVLNKHLFLTSKPMVYLVNLSEKDYIRKKNKWLIKIKEWVDK  95

Query  526  HG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  350
            +  G L+IPFS ALE  L ++  +E  KY E N  QSALPKIIK GFSA+ L YFFTAGP
Sbjct  96   YDPGALVIPFSGALELKLQELSAEERQKYLEANMTQSALPKIIKAGFSALQLEYFFTAGP  155

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEV+ W +R+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+
Sbjct  156  DEVRAWTVRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEEGSENAVKAAGKYRQQGR  215

Query  169  TYVVQDGDVIFFKFNVSGGGKK  104
             YVV+DGDVIFFKFN     KK
Sbjct  216  NYVVEDGDVIFFKFNTPQQPKK  237



>ref|XP_008929287.1| PREDICTED: obg-like ATPase 1 [Manacus vitellinus]
Length=273

 Score =   249 bits (637),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 149/202 (74%), Gaps = 2/202 (1%)
 Frame = -3

Query  703  LDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQE  527
            +DE K  R   +W   +I++LN     T+KP++YLVN++EKDY RKKNK+L KI  WV +
Sbjct  71   IDEKKAVRFYHDWNDKEIDVLNKHLFFTSKPMIYLVNLSEKDYIRKKNKWLIKIKEWVDK  130

Query  526  HG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  350
            H  G L+IPFS ALE  L DM  +E  KY EEN  QSAL KIIK G++A+ L YFFTAGP
Sbjct  131  HDPGALVIPFSGALELKLQDMSAEEKQKYLEENMTQSALAKIIKAGYAALQLEYFFTAGP  190

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+
Sbjct  191  DEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEGGSEAAVKAAGKYRQQGR  250

Query  169  TYVVQDGDVIFFKFNVSGGGKK  104
             Y+V+DGD+IFFKFN     KK
Sbjct  251  NYIVEDGDIIFFKFNTPQQPKK  272



>ref|XP_005452975.1| PREDICTED: obg-like ATPase 1-like isoform X6 [Oreochromis niloticus]
Length=332

 Score =   251 bits (642),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 149/202 (74%), Gaps = 2/202 (1%)
 Frame = -3

Query  703  LDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQE  527
            +DE K  R   +W   +IE+LN +  LT+KP++YLVN++EKDY R+KNK+L KI  WV  
Sbjct  130  VDEKKHIRYYHDWNDKEIEVLNKYLFLTSKPMIYLVNLSEKDYIRRKNKWLVKIKEWVDS  189

Query  526  HG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  350
            H  G L+IPFS  LE  L D   +E  KYC E+K QSAL KIIK G++A+ L YFFTAGP
Sbjct  190  HDPGALVIPFSGGLESLLQDKSEEERQKYCTEHKTQSALSKIIKAGYAALQLEYFFTAGP  249

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEV+ W IR+ TKAPQAAG IHTD ERGFI AEVMKF+D KE GSE AVKA GKYRQ+G+
Sbjct  250  DEVRAWTIRKGTKAPQAAGKIHTDFERGFIMAEVMKFQDFKEEGSESAVKAAGKYRQQGR  309

Query  169  TYVVQDGDVIFFKFNVSGGGKK  104
             Y+V+DGD+IFFKFN     KK
Sbjct  310  NYIVEDGDIIFFKFNAPNAPKK  331



>ref|XP_010116935.1| PREDICTED: obg-like ATPase 1 [Chlamydotis macqueenii]
Length=273

 Score =   249 bits (637),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 149/202 (74%), Gaps = 2/202 (1%)
 Frame = -3

Query  703  LDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQE  527
            +DE K  R   +W   +I++LN     T+KP++YLVN++EKDY RKKNK+L KI  WV +
Sbjct  71   IDEKKAVRFYHDWNDKEIDVLNKHLFFTSKPMIYLVNLSEKDYIRKKNKWLIKIKEWVDK  130

Query  526  HG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  350
            H  G L+IPFS ALE  L DM  +E  KY EEN  QSAL KIIK G++A+ L YFFTAGP
Sbjct  131  HDPGALVIPFSGALELKLQDMSAEEKQKYLEENMTQSALAKIIKAGYAALQLEYFFTAGP  190

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+
Sbjct  191  DEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEGGSEAAVKAAGKYRQQGR  250

Query  169  TYVVQDGDVIFFKFNVSGGGKK  104
             Y+V+DGD+IFFKFN     KK
Sbjct  251  NYIVEDGDIIFFKFNTPQQPKK  272



>gb|ETW50152.1| GTP-binding protein YchF [Plasmodium falciparum MaliPS096_E11]
Length=368

 Score =   253 bits (645),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 125/205 (61%), Positives = 150/205 (73%), Gaps = 1/205 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            V   L E K  + G WK+ +IE+LN +  LTAKPVVYLVNM+E D+ R+KNK+L KI+ W
Sbjct  164  VLNYLKEHKWIKDGTWKSNEIEVLNEYNFLTAKPVVYLVNMSEADFIRQKNKYLAKIYNW  223

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKV-QSALPKIIKTGFSAINLIYFFT  359
            VQE     IIP+SA +E+ +  M  +E  +Y E N + QS L KIIKTG+  INLI+FFT
Sbjct  224  VQEKNKGTIIPYSAEVEQKILSMDEEEKKQYFETNNIKQSMLNKIIKTGYYEINLIHFFT  283

Query  358  AGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQ  179
             G DEVKCW IR+ TKAPQAAG IHTD E+GFICAEV K+ DL E  SE  VKA GKY Q
Sbjct  284  CGHDEVKCWTIRKGTKAPQAAGVIHTDFEKGFICAEVYKYTDLVEYKSEGEVKANGKYLQ  343

Query  178  EGKTYVVQDGDVIFFKFNVSGGGKK  104
            +GK YVV+DGD+IFFKFNVS GGKK
Sbjct  344  KGKDYVVEDGDIIFFKFNVSSGGKK  368



>ref|XP_009086253.1| PREDICTED: obg-like ATPase 1 isoform X2 [Serinus canaria]
 ref|XP_009806156.1| PREDICTED: obg-like ATPase 1 [Gavia stellata]
 ref|XP_009892842.1| PREDICTED: obg-like ATPase 1 [Charadrius vociferus]
 ref|XP_010015190.1| PREDICTED: obg-like ATPase 1 [Nestor notabilis]
Length=273

 Score =   249 bits (637),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 149/202 (74%), Gaps = 2/202 (1%)
 Frame = -3

Query  703  LDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQE  527
            +DE K  R   +W   +I++LN     T+KP++YLVN++EKDY RKKNK+L KI  WV +
Sbjct  71   IDEKKAVRFYHDWNDKEIDVLNKHLFFTSKPMIYLVNLSEKDYIRKKNKWLIKIKEWVDK  130

Query  526  HG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  350
            H  G L+IPFS ALE  L DM  +E  KY EEN  QSAL KIIK G++A+ L YFFTAGP
Sbjct  131  HDPGALVIPFSGALELKLQDMSAEEKQKYLEENMTQSALAKIIKAGYAALQLEYFFTAGP  190

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+
Sbjct  191  DEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEGGSEAAVKAAGKYRQQGR  250

Query  169  TYVVQDGDVIFFKFNVSGGGKK  104
             Y+V+DGD+IFFKFN     KK
Sbjct  251  NYIVEDGDIIFFKFNTPQQPKK  272



>ref|XP_010162756.1| PREDICTED: obg-like ATPase 1 [Caprimulgus carolinensis]
Length=273

 Score =   249 bits (637),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 149/202 (74%), Gaps = 2/202 (1%)
 Frame = -3

Query  703  LDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQE  527
            +DE K  R   +W   +I++LN     T+KP++YLVN++EKDY RKKNK+L KI  WV +
Sbjct  71   IDEKKAVRFYHDWNDKEIDVLNKHLFFTSKPMIYLVNLSEKDYIRKKNKWLIKIKEWVDK  130

Query  526  HG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  350
            H  G L+IPFS ALE  L DM  +E  KY EEN  QSAL KIIK G++A+ L YFFTAGP
Sbjct  131  HDPGALVIPFSGALELKLQDMSAEEKQKYLEENMTQSALAKIIKAGYAALQLEYFFTAGP  190

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+
Sbjct  191  DEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEGGSEAAVKAAGKYRQQGR  250

Query  169  TYVVQDGDVIFFKFNVSGGGKK  104
             Y+V+DGD+IFFKFN     KK
Sbjct  251  NYIVEDGDIIFFKFNTPQQPKK  272



>ref|XP_010073941.1| PREDICTED: obg-like ATPase 1 [Pterocles gutturalis]
Length=273

 Score =   249 bits (637),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 149/202 (74%), Gaps = 2/202 (1%)
 Frame = -3

Query  703  LDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQE  527
            +DE K  R   +W   +I++LN     T+KP++YLVN++EKDY RKKNK+L KI  WV +
Sbjct  71   IDEKKAVRFYHDWNDKEIDVLNKHLFFTSKPMIYLVNLSEKDYIRKKNKWLIKIKEWVDK  130

Query  526  HG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  350
            H  G L+IPFS ALE  L DM  +E  KY EEN  QSAL KIIK G++A+ L YFFTAGP
Sbjct  131  HDPGALVIPFSGALELKLQDMSAEEKQKYLEENMTQSALAKIIKAGYAALQLEYFFTAGP  190

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+
Sbjct  191  DEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEGGSEAAVKAAGKYRQQGR  250

Query  169  TYVVQDGDVIFFKFNVSGGGKK  104
             Y+V+DGD+IFFKFN     KK
Sbjct  251  NYIVEDGDIIFFKFNTPQQPKK  272



>gb|ETW37410.1| GTP-binding protein YchF [Plasmodium falciparum Tanzania (2000708)]
Length=364

 Score =   253 bits (645),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 125/205 (61%), Positives = 150/205 (73%), Gaps = 1/205 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            V   L E K  + G WK+ +IE+LN +  LTAKPVVYLVNM+E D+ R+KNK+L KI+ W
Sbjct  160  VLNYLKEHKWIKDGTWKSNEIEVLNEYNFLTAKPVVYLVNMSEADFIRQKNKYLAKIYNW  219

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKV-QSALPKIIKTGFSAINLIYFFT  359
            VQE     IIP+SA +E+ +  M  +E  +Y E N + QS L KIIKTG+  INLI+FFT
Sbjct  220  VQEKNKGTIIPYSAEVEQKILSMDEEEKKQYFETNNIKQSMLNKIIKTGYYEINLIHFFT  279

Query  358  AGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQ  179
             G DEVKCW IR+ TKAPQAAG IHTD E+GFICAEV K+ DL E  SE  VKA GKY Q
Sbjct  280  CGHDEVKCWTIRKGTKAPQAAGVIHTDFEKGFICAEVYKYTDLVEYKSEGEVKANGKYLQ  339

Query  178  EGKTYVVQDGDVIFFKFNVSGGGKK  104
            +GK YVV+DGD+IFFKFNVS GGKK
Sbjct  340  KGKDYVVEDGDIIFFKFNVSSGGKK  364



>ref|XP_005442958.1| PREDICTED: obg-like ATPase 1 [Falco cherrug]
Length=273

 Score =   249 bits (637),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 149/202 (74%), Gaps = 2/202 (1%)
 Frame = -3

Query  703  LDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQE  527
            +DE K  R   +W   +I++LN     T+KP++YLVN++EKDY RKKNK+L KI  WV +
Sbjct  71   IDEKKAVRFYHDWNDKEIDVLNKHLFFTSKPMIYLVNLSEKDYIRKKNKWLIKIKEWVDK  130

Query  526  HG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  350
            H  G L+IPFS ALE  L DM  +E  KY EEN  QSAL KIIK G++A+ L YFFTAGP
Sbjct  131  HDPGALVIPFSGALELKLQDMSAEEKQKYLEENMTQSALAKIIKAGYAALQLEYFFTAGP  190

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+
Sbjct  191  DEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEGGSEAAVKAAGKYRQQGR  250

Query  169  TYVVQDGDVIFFKFNVSGGGKK  104
             Y+V+DGD+IFFKFN     KK
Sbjct  251  NYIVEDGDIIFFKFNTPQQPKK  272



>gb|AAY14876.1| unknown [Homo sapiens]
Length=213

 Score =   247 bits (631),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 150/202 (74%), Gaps = 2/202 (1%)
 Frame = -3

Query  703  LDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQE  527
            +D+ K  R   +W   +IE+LN    LT+KP+VYLVN++EKDY RKKNK+L KI  WV +
Sbjct  11   IDQKKPVRFYHDWNDKEIEVLNKHLFLTSKPMVYLVNLSEKDYIRKKNKWLIKIKEWVDK  70

Query  526  HG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  350
            +  G L+IPFS ALE  L ++  +E  KY E N  QSALPKIIK GF+A+ L YFFTAGP
Sbjct  71   YDPGALVIPFSGALELKLQELSAEERQKYLEANMTQSALPKIIKAGFAALQLEYFFTAGP  130

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+
Sbjct  131  DEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEEGSENAVKAAGKYRQQGR  190

Query  169  TYVVQDGDVIFFKFNVSGGGKK  104
             Y+V+DGD+IFFKFN     KK
Sbjct  191  NYIVEDGDIIFFKFNTPQQPKK  212



>gb|EWC89308.1| GTP-binding protein YchF [Plasmodium falciparum NF54]
Length=363

 Score =   252 bits (644),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 125/205 (61%), Positives = 150/205 (73%), Gaps = 1/205 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            V   L E K  + G WK+ +IE+LN +  LTAKPVVYLVNM+E D+ R+KNK+L KI+ W
Sbjct  159  VLNYLKEHKWIKDGTWKSNEIEVLNEYNFLTAKPVVYLVNMSEADFIRQKNKYLAKIYNW  218

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKV-QSALPKIIKTGFSAINLIYFFT  359
            VQE     IIP+SA +E+ +  M  +E  +Y E N + QS L KIIKTG+  INLI+FFT
Sbjct  219  VQEKNKGTIIPYSAEVEQKILSMDEEEKKQYFETNNIKQSMLNKIIKTGYYEINLIHFFT  278

Query  358  AGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQ  179
             G DEVKCW IR+ TKAPQAAG IHTD E+GFICAEV K+ DL E  SE  VKA GKY Q
Sbjct  279  CGHDEVKCWTIRKGTKAPQAAGVIHTDFEKGFICAEVYKYTDLVEYKSEGEVKANGKYLQ  338

Query  178  EGKTYVVQDGDVIFFKFNVSGGGKK  104
            +GK YVV+DGD+IFFKFNVS GGKK
Sbjct  339  KGKDYVVEDGDIIFFKFNVSSGGKK  363



>gb|KFP49878.1| Obg-like ATPase 1, partial [Cathartes aura]
 gb|KFQ57717.1| Obg-like ATPase 1, partial [Pelecanus crispus]
 gb|KFV51903.1| Obg-like ATPase 1, partial [Tyto alba]
Length=274

 Score =   249 bits (637),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 149/202 (74%), Gaps = 2/202 (1%)
 Frame = -3

Query  703  LDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQE  527
            +DE K  R   +W   +I++LN     T+KP++YLVN++EKDY RKKNK+L KI  WV +
Sbjct  72   IDEKKAVRFYHDWNDKEIDVLNKHLFFTSKPMIYLVNLSEKDYIRKKNKWLIKIKEWVDK  131

Query  526  HG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  350
            H  G L+IPFS ALE  L DM  +E  KY EEN  QSAL KIIK G++A+ L YFFTAGP
Sbjct  132  HDPGALVIPFSGALELKLQDMSAEEKQKYLEENMTQSALAKIIKAGYAALQLEYFFTAGP  191

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+
Sbjct  192  DEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEGGSEAAVKAAGKYRQQGR  251

Query  169  TYVVQDGDVIFFKFNVSGGGKK  104
             Y+V+DGD+IFFKFN     KK
Sbjct  252  NYIVEDGDIIFFKFNTPQQPKK  273



>gb|ETW39419.1| GTP-binding protein YchF, partial [Plasmodium falciparum NF135/5.C10]
Length=364

 Score =   252 bits (644),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 125/205 (61%), Positives = 150/205 (73%), Gaps = 1/205 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            V   L E K  + G WK+ +IE+LN +  LTAKPVVYLVNM+E D+ R+KNK+L KI+ W
Sbjct  160  VLNYLKEHKWIKDGTWKSNEIEVLNEYNFLTAKPVVYLVNMSEADFIRQKNKYLAKIYNW  219

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKV-QSALPKIIKTGFSAINLIYFFT  359
            VQE     IIP+SA +E+ +  M  +E  +Y E N + QS L KIIKTG+  INLI+FFT
Sbjct  220  VQEKNKGTIIPYSAEVEQKILSMDEEEKKQYFETNNIKQSMLNKIIKTGYYEINLIHFFT  279

Query  358  AGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQ  179
             G DEVKCW IR+ TKAPQAAG IHTD E+GFICAEV K+ DL E  SE  VKA GKY Q
Sbjct  280  CGHDEVKCWTIRKGTKAPQAAGVIHTDFEKGFICAEVYKYTDLVEYKSEGEVKANGKYLQ  339

Query  178  EGKTYVVQDGDVIFFKFNVSGGGKK  104
            +GK YVV+DGD+IFFKFNVS GGKK
Sbjct  340  KGKDYVVEDGDIIFFKFNVSSGGKK  364



>ref|XP_668381.1| GTP-binding protein [Cryptosporidium hominis TU502]
Length=397

 Score =   253 bits (647),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 122/192 (64%), Positives = 151/192 (79%), Gaps = 2/192 (1%)
 Frame = -3

Query  673  EWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSA  494
            +WK++++E+LN  Q LTAKPVVYLVN++EKDY R+KNKFLPKI  WV+EH   +IIP+SA
Sbjct  206  DWKSSEVELLNEHQFLTAKPVVYLVNLSEKDYIRQKNKFLPKIAEWVKEHIDGVIIPYSA  265

Query  493  ALERSLADMPPDE--AAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRR  320
              E +LA++  +E   A   E+   +S + KII TG+SA+NL+++FTAG DEVKCW IR 
Sbjct  266  EFETALAELHTEEEKMAYIKEKGASKSMIDKIINTGYSALNLLHYFTAGEDEVKCWTIRS  325

Query  319  QTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVI  140
             TKAPQAAG IHTD ERGFICAEV KF DL ELGSE A+KA GKY Q+GK YVV+DGD+I
Sbjct  326  GTKAPQAAGIIHTDFERGFICAEVYKFTDLMELGSEAAIKAAGKYLQKGKDYVVEDGDII  385

Query  139  FFKFNVSGGGKK  104
            FFKFNV+  GKK
Sbjct  386  FFKFNVTNSGKK  397



>gb|ETW28438.1| GTP-binding protein YchF [Plasmodium falciparum FCH/4]
Length=391

 Score =   253 bits (646),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 125/205 (61%), Positives = 150/205 (73%), Gaps = 1/205 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            V   L E K  + G WK+ +IE+LN +  LTAKPVVYLVNM+E D+ R+KNK+L KI+ W
Sbjct  187  VLNYLKEHKWIKDGTWKSNEIEVLNEYNFLTAKPVVYLVNMSEADFIRQKNKYLAKIYNW  246

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKV-QSALPKIIKTGFSAINLIYFFT  359
            VQE     IIP+SA +E+ +  M  +E  +Y E N + QS L KIIKTG+  INLI+FFT
Sbjct  247  VQEKNKGTIIPYSAEVEQKILSMDEEEKKQYFETNNIKQSMLNKIIKTGYYEINLIHFFT  306

Query  358  AGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQ  179
             G DEVKCW IR+ TKAPQAAG IHTD E+GFICAEV K+ DL E  SE  VKA GKY Q
Sbjct  307  CGHDEVKCWTIRKGTKAPQAAGVIHTDFEKGFICAEVYKYTDLVEYKSEGEVKANGKYLQ  366

Query  178  EGKTYVVQDGDVIFFKFNVSGGGKK  104
            +GK YVV+DGD+IFFKFNVS GGKK
Sbjct  367  KGKDYVVEDGDIIFFKFNVSSGGKK  391



>ref|XP_003961956.1| PREDICTED: obg-like ATPase 1-like [Takifugu rubripes]
Length=398

 Score =   253 bits (646),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 125/202 (62%), Positives = 151/202 (75%), Gaps = 2/202 (1%)
 Frame = -3

Query  703  LDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQE  527
            +DE K  R   +W   +IE+LN +  LT+KP++YLVN++EKDY RKKNK+L KI  WV  
Sbjct  196  VDEKKHVRYYHDWNDKEIEVLNKYLFLTSKPMIYLVNLSEKDYIRKKNKWLVKIKEWVDG  255

Query  526  HG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  350
            H  G L+IPFS  LE SL DM  +E  KYC E+K QSAL +IIK G++A+ L YFFTAGP
Sbjct  256  HDPGALVIPFSGGLENSLQDMSEEEMQKYCVEHKTQSALSRIIKAGYAALQLEYFFTAGP  315

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMKF+D KE GSE AVKA GKYRQ+G+
Sbjct  316  DEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKFQDFKEEGSESAVKAAGKYRQQGR  375

Query  169  TYVVQDGDVIFFKFNVSGGGKK  104
             YVV+DGD+IFFKFN     KK
Sbjct  376  NYVVEDGDIIFFKFNTPNAPKK  397



>gb|KFV04274.1| Obg-like ATPase 1, partial [Tauraco erythrolophus]
Length=276

 Score =   249 bits (636),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 149/202 (74%), Gaps = 2/202 (1%)
 Frame = -3

Query  703  LDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQE  527
            +DE K  R   +W   +I++LN     T+KP++YLVN++EKDY RKKNK+L KI  WV +
Sbjct  74   IDEKKAVRFYHDWNDKEIDVLNKHLFFTSKPMIYLVNLSEKDYIRKKNKWLIKIKEWVDK  133

Query  526  HG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  350
            H  G L+IPFS ALE  L DM  +E  KY EEN  QSAL KIIK G++A+ L YFFTAGP
Sbjct  134  HDPGALVIPFSGALELKLQDMSAEEKQKYLEENMTQSALAKIIKAGYAALQLEYFFTAGP  193

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+
Sbjct  194  DEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEGGSEAAVKAAGKYRQQGR  253

Query  169  TYVVQDGDVIFFKFNVSGGGKK  104
             Y+V+DGD+IFFKFN     KK
Sbjct  254  NYIVEDGDIIFFKFNTPQQPKK  275



>ref|XP_007431000.1| PREDICTED: obg-like ATPase 1-like isoform X3 [Python bivittatus]
Length=353

 Score =   251 bits (642),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 126/202 (62%), Positives = 151/202 (75%), Gaps = 2/202 (1%)
 Frame = -3

Query  703  LDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQE  527
            +DE K  R   +W   +I++LN    LT+KP++YL+N++EKDY RKKNK+L KI  WV +
Sbjct  151  IDEKKPVRFYHDWNDKEIDVLNKHLFLTSKPMIYLINLSEKDYIRKKNKWLIKIKEWVDK  210

Query  526  HG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  350
            H  G L+IPFS ALE  L +M  +E  KY EEN  QSALPKIIK G++A+ L YFFTAGP
Sbjct  211  HDPGALVIPFSGALELKLQEMSAEEKQKYLEENMTQSALPKIIKAGYAALQLEYFFTAGP  270

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMKFED KE GSE AVKA GKYRQ+G+
Sbjct  271  DEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKFEDFKEGGSEAAVKAAGKYRQQGR  330

Query  169  TYVVQDGDVIFFKFNVSGGGKK  104
             YVV+DGDVIFFKFN     KK
Sbjct  331  NYVVEDGDVIFFKFNTPQQPKK  352



>ref|XP_009276861.1| PREDICTED: obg-like ATPase 1 [Aptenodytes forsteri]
Length=294

 Score =   249 bits (637),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 149/202 (74%), Gaps = 2/202 (1%)
 Frame = -3

Query  703  LDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQE  527
            +DE K  R   +W   +I++LN     T+KP++YLVN++EKDY RKKNK+L KI  WV +
Sbjct  92   IDEKKAVRFYHDWNDKEIDVLNKHLFFTSKPMIYLVNLSEKDYIRKKNKWLIKIKEWVDK  151

Query  526  HG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  350
            H  G L+IPFS ALE  L DM  +E  KY EEN  QSAL KIIK G++A+ L YFFTAGP
Sbjct  152  HDPGALVIPFSGALELKLQDMSAEEKQKYLEENMTQSALAKIIKAGYAALQLEYFFTAGP  211

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+
Sbjct  212  DEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEGGSEAAVKAAGKYRQQGR  271

Query  169  TYVVQDGDVIFFKFNVSGGGKK  104
             Y+V+DGD+IFFKFN     KK
Sbjct  272  NYIVEDGDIIFFKFNTPQQPKK  293



>emb|CEI96573.1| Putative Obg-like ATPase 1 [Rhizopus microsporus]
Length=398

 Score =   253 bits (646),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 119/201 (59%), Positives = 150/201 (75%), Gaps = 1/201 (0%)
 Frame = -3

Query  703  LDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEH  524
            + +GKD R G W   ++E++N   LLTAKPV+YL N++EKDY RKKNK+LPKI AW+ E+
Sbjct  197  VQQGKDVRHGNWSNKEVEVINGLHLLTAKPVIYLANLSEKDYIRKKNKWLPKIKAWIDEN  256

Query  523  G-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPD  347
              G+++IP+S A E  L     +E  +  +EN   S L KII  G++A+ LIYFFT GPD
Sbjct  257  SPGDMMIPYSGAYEYRLTLASAEEKEQIQKENNAPSVLSKIIVNGYAALQLIYFFTGGPD  316

Query  346  EVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKT  167
            EV+ W IR+ TKAPQAAG IHTD ERGFI AEVMK+EDLKELGSE AVKA GKY Q+GK 
Sbjct  317  EVRAWTIRKNTKAPQAAGVIHTDFERGFIMAEVMKYEDLKELGSESAVKAAGKYMQKGKD  376

Query  166  YVVQDGDVIFFKFNVSGGGKK  104
            Y+V+DGD+I+FKFNV+   KK
Sbjct  377  YIVEDGDIIYFKFNVTAPAKK  397



>ref|XP_628099.1| yyaF/YCHF TRANSFAC/OBG family small GTpase plus RNA binding domain 
TGS [Cryptosporidium parvum Iowa II]
 gb|EAK88561.1| yyaF/YCHF TRANSFAC/OBG family small GTpase plus RNA binding domain 
TGS [Cryptosporidium parvum Iowa II]
Length=398

 Score =   253 bits (646),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 122/192 (64%), Positives = 151/192 (79%), Gaps = 2/192 (1%)
 Frame = -3

Query  673  EWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSA  494
            +WK++++E+LN  Q LTAKPVVYLVN++EKDY R+KNKFLPKI  WV+EH   +IIP+SA
Sbjct  207  DWKSSEVELLNEHQFLTAKPVVYLVNLSEKDYIRQKNKFLPKIAEWVKEHIDGVIIPYSA  266

Query  493  ALERSLADMPPDE--AAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRR  320
              E +LA++  +E   A   E+   +S + KII TG+SA+NL+++FTAG DEVKCW IR 
Sbjct  267  EFEAALAELHTEEEKMAYIKEKGASKSMIDKIINTGYSALNLLHYFTAGEDEVKCWTIRS  326

Query  319  QTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVI  140
             TKAPQAAG IHTD ERGFICAEV KF DL ELGSE A+KA GKY Q+GK YVV+DGD+I
Sbjct  327  GTKAPQAAGIIHTDFERGFICAEVYKFTDLMELGSEAAIKAAGKYLQKGKDYVVEDGDII  386

Query  139  FFKFNVSGGGKK  104
            FFKFNV+  GKK
Sbjct  387  FFKFNVTNSGKK  398



>ref|XP_004092018.1| PREDICTED: obg-like ATPase 1 isoform 2 [Nomascus leucogenys]
Length=238

 Score =   248 bits (632),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 124/202 (61%), Positives = 150/202 (74%), Gaps = 2/202 (1%)
 Frame = -3

Query  703  LDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQE  527
            +D+ K  R   +W   +IE+LN    LT+KP+VYLVN++EKDY RKKNK+L KI  WV +
Sbjct  36   IDQKKPVRFYHDWNDKEIEVLNKHLFLTSKPMVYLVNLSEKDYIRKKNKWLIKIKEWVDK  95

Query  526  HG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  350
            +  G L+IPFS ALE  L ++  +E  KY E N  QSALPKIIK GF+A+ L YFFTAGP
Sbjct  96   YDPGALVIPFSGALELKLQELSAEERQKYLEANMTQSALPKIIKAGFAALQLEYFFTAGP  155

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+
Sbjct  156  DEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEEGSENAVKAAGKYRQQGR  215

Query  169  TYVVQDGDVIFFKFNVSGGGKK  104
             YVV+DGD+IFFKFN     KK
Sbjct  216  NYVVEDGDIIFFKFNTPQQPKK  237



>gb|EPY37092.1| GTP binding protein [Strigomonas culicis]
Length=392

 Score =   253 bits (645),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 116/204 (57%), Positives = 152/204 (75%), Gaps = 0/204 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            VK  L+EGK  R   W   +I+ LNT QLLTAKP ++L+NM+E D+ R++NK+L K+  W
Sbjct  189  VKEHLEEGKQIRCCHWNGKEIDYLNTIQLLTAKPAMFLINMSENDFCRQRNKWLKKLKDW  248

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            + E  GE +IPFSA LE S  +M P+E   YCEE+K +S + KII T ++ INLI++FTA
Sbjct  249  IDEQTGEPMIPFSAELESSFLNMSPEEVHAYCEEHKTKSQIHKIINTAYNVINLIHYFTA  308

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  176
            GPDEVKCW I+R TKAPQAAG IH+D+E+GFICAEV+++ED + L SE A +  GK  Q 
Sbjct  309  GPDEVKCWTIQRGTKAPQAAGRIHSDMEKGFICAEVIEWEDFERLKSESACRDEGKQHQH  368

Query  175  GKTYVVQDGDVIFFKFNVSGGGKK  104
            G+TY V+DGD+IFFKFN + GGKK
Sbjct  369  GRTYEVKDGDIIFFKFNAAKGGKK  392



>ref|XP_009977093.1| PREDICTED: obg-like ATPase 1, partial [Tauraco erythrolophus]
Length=283

 Score =   249 bits (635),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 149/202 (74%), Gaps = 2/202 (1%)
 Frame = -3

Query  703  LDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQE  527
            +DE K  R   +W   +I++LN     T+KP++YLVN++EKDY RKKNK+L KI  WV +
Sbjct  81   IDEKKAVRFYHDWNDKEIDVLNKHLFFTSKPMIYLVNLSEKDYIRKKNKWLIKIKEWVDK  140

Query  526  HG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  350
            H  G L+IPFS ALE  L DM  +E  KY EEN  QSAL KIIK G++A+ L YFFTAGP
Sbjct  141  HDPGALVIPFSGALELKLQDMSAEEKQKYLEENMTQSALAKIIKAGYAALQLEYFFTAGP  200

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+
Sbjct  201  DEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEGGSEAAVKAAGKYRQQGR  260

Query  169  TYVVQDGDVIFFKFNVSGGGKK  104
             Y+V+DGD+IFFKFN     KK
Sbjct  261  NYIVEDGDIIFFKFNTPQQPKK  282



>ref|XP_004426695.1| PREDICTED: obg-like ATPase 1 isoform 3 [Ceratotherium simum simum]
 ref|XP_004674580.1| PREDICTED: obg-like ATPase 1 isoform X3 [Condylura cristata]
 ref|XP_005324666.1| PREDICTED: obg-like ATPase 1 isoform X3 [Ictidomys tridecemlineatus]
Length=238

 Score =   247 bits (631),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 150/202 (74%), Gaps = 2/202 (1%)
 Frame = -3

Query  703  LDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQE  527
            +D+ K  R   +W   +IE+LN    LT+KP+VYLVN++EKDY RKKNK+L KI  WV +
Sbjct  36   MDQKKPVRFYHDWNDKEIEVLNKHLFLTSKPMVYLVNLSEKDYIRKKNKWLIKIKEWVDK  95

Query  526  HG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  350
            +  G L+IPFS ALE  L ++  +E  KY E N  QSALPKIIK GF+A+ L YFFTAGP
Sbjct  96   YDPGALVIPFSGALELKLQELSAEERQKYLEANMTQSALPKIIKAGFAALQLEYFFTAGP  155

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+
Sbjct  156  DEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEEGSENAVKAAGKYRQQGR  215

Query  169  TYVVQDGDVIFFKFNVSGGGKK  104
             Y+V+DGD+IFFKFN     KK
Sbjct  216  NYIVEDGDIIFFKFNTPQQPKK  237



>emb|CCW63611.1| unnamed protein product [Phytomonas sp. isolate EM1]
Length=393

 Score =   252 bits (644),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 116/204 (57%), Positives = 149/204 (73%), Gaps = 0/204 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            VK  L+EGK  R  +W   +I+ LNT QLLTAKP ++L+NM+E D+ R++NK+L K+  W
Sbjct  190  VKLFLEEGKQVRCCQWNGKEIDFLNTIQLLTAKPAMFLINMSENDFVRQRNKWLKKLKDW  249

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            + E   E +IPFSA LE     M P+E  +YCEE K +S LPKIIKT +S INLI++FTA
Sbjct  250  IDERTAEPMIPFSAELEAQFLTMTPEEVTRYCEEKKTKSQLPKIIKTAYSIINLIHYFTA  309

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  176
            GPDEVKCW I+R TKAPQAAG IH+D+E+GFICAEV+++ED   L +E A +  GK  Q+
Sbjct  310  GPDEVKCWTIQRGTKAPQAAGKIHSDMEKGFICAEVIEWEDFNRLENEAACREEGKQHQQ  369

Query  175  GKTYVVQDGDVIFFKFNVSGGGKK  104
            G+ Y VQDGD+IFFKFN    GKK
Sbjct  370  GRNYEVQDGDIIFFKFNAGKAGKK  393



>ref|XP_002261143.1| GTP-binding protein [Plasmodium knowlesi strain H]
 emb|CAQ38331.1| GTP-binding protein, putative [Plasmodium knowlesi strain H]
Length=392

 Score =   252 bits (644),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 123/205 (60%), Positives = 149/205 (73%), Gaps = 1/205 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            V + L E K  + G WK++++E++N +  LTAKPVVYLVNM+E D+ R+KNK L KI+ W
Sbjct  188  VLSFLKEHKWIKDGNWKSSEVEVINEYNFLTAKPVVYLVNMSETDFIRQKNKHLAKIYNW  247

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKV-QSALPKIIKTGFSAINLIYFFT  359
            VQE     IIP+ A +E  L  M  DE   Y EENK+ QS L KI+KTG+  INLI+FFT
Sbjct  248  VQEKNKGTIIPYCADMELKLLSMSEDEKKTYFEENKIKQSMLSKIVKTGYYEINLIHFFT  307

Query  358  AGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQ  179
             G DEVKCW IR+ TKAPQAAG IHTD E+GFICAEV K+ DL E  SE  VKA G+Y Q
Sbjct  308  CGADEVKCWTIRKGTKAPQAAGVIHTDFEKGFICAEVYKYTDLVEFKSESEVKANGRYLQ  367

Query  178  EGKTYVVQDGDVIFFKFNVSGGGKK  104
            +GK YVV+DGD+IFFKFNVS  GKK
Sbjct  368  KGKDYVVEDGDIIFFKFNVSSSGKK  392



>emb|CAG09966.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=346

 Score =   251 bits (641),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 122/202 (60%), Positives = 151/202 (75%), Gaps = 2/202 (1%)
 Frame = -3

Query  703  LDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQE  527
            +DE K  R   +W   ++E+LN +  LT+KP++YLVN++EKDY R+KNK+L KI  WV  
Sbjct  144  VDEKKHVRYYHDWNDKEVEVLNKYLFLTSKPMIYLVNLSEKDYVRRKNKWLVKIKEWVDG  203

Query  526  HG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  350
            H  G L+IPFS  LE SL +M  +E  KYC E+K QSAL +IIK G++A+ L YFFTAGP
Sbjct  204  HDPGALVIPFSGGLESSLQEMSEEEMLKYCTEHKTQSALSRIIKAGYAALQLEYFFTAGP  263

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMKF+D KE GSE AVKA GKYRQ+G+
Sbjct  264  DEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKFQDFKEEGSESAVKAAGKYRQQGR  323

Query  169  TYVVQDGDVIFFKFNVSGGGKK  104
             YVV+DGD+IFFKFN     KK
Sbjct  324  NYVVEDGDIIFFKFNTPNAPKK  345



>ref|XP_004878683.1| PREDICTED: obg-like ATPase 1-like [Heterocephalus glaber]
Length=238

 Score =   247 bits (631),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 150/202 (74%), Gaps = 2/202 (1%)
 Frame = -3

Query  703  LDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQE  527
            +D+ K  R   +W   +IE+LN    LT+KP+VYLVN++EKDY RKKNK+L KI  WV +
Sbjct  36   IDQKKPVRFYHDWNDKEIEVLNKHLFLTSKPMVYLVNLSEKDYIRKKNKWLIKIKEWVDK  95

Query  526  HG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  350
            +  G L+IPFS ALE  L ++  +E  KY E N  QSALPKIIK GF+A+ L YFFTAGP
Sbjct  96   YDPGALVIPFSGALELKLQELSAEERQKYLEANMTQSALPKIIKAGFAALQLEYFFTAGP  155

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+
Sbjct  156  DEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEEGSENAVKAAGKYRQQGR  215

Query  169  TYVVQDGDVIFFKFNVSGGGKK  104
             Y+V+DGD+IFFKFN     KK
Sbjct  216  NYIVEDGDIIFFKFNTPQQPKK  237



>ref|XP_010736092.1| PREDICTED: obg-like ATPase 1 isoform X1 [Larimichthys crocea]
Length=398

 Score =   252 bits (644),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 150/202 (74%), Gaps = 2/202 (1%)
 Frame = -3

Query  703  LDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQE  527
            LDE K  R   +W   +IE+LN +  LT+KP++YL+N++EKDY R+KNK+L KI  WV  
Sbjct  196  LDEKKHVRYYHDWNDKEIEVLNKYLFLTSKPMIYLINLSEKDYIRRKNKWLVKIKEWVDS  255

Query  526  HG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  350
            H  G L+IPFS  LE  L D   +E  KYC E+K QSAL KIIKTG++A+ L YFFTAGP
Sbjct  256  HDPGALVIPFSGGLENKLQDKSEEETQKYCTEHKTQSALSKIIKTGYAALQLEYFFTAGP  315

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMKF+D KE GSE AVKA GKYRQ+G+
Sbjct  316  DEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKFQDFKEEGSENAVKAAGKYRQQGR  375

Query  169  TYVVQDGDVIFFKFNVSGGGKK  104
             Y+V+DGD+IFFKFN     KK
Sbjct  376  NYIVEDGDIIFFKFNAPNAPKK  397



>ref|NP_001011708.1| obg-like ATPase 1 isoform 2 [Homo sapiens]
 ref|XP_001928832.2| PREDICTED: Obg-like ATPase 1 [Sus scrofa]
 ref|XP_003824290.1| PREDICTED: obg-like ATPase 1 isoform X2 [Pan paniscus]
 ref|XP_003949968.1| PREDICTED: obg-like ATPase 1 isoform X2 [Pan troglodytes]
 ref|XP_004032862.1| PREDICTED: obg-like ATPase 1-like isoform 2 [Gorilla gorilla 
gorilla]
 ref|XP_004409048.1| PREDICTED: obg-like ATPase 1 isoform 3 [Odobenus rosmarus divergens]
 ref|XP_004577109.1| PREDICTED: obg-like ATPase 1 isoform X4 [Ochotona princeps]
 ref|XP_006213992.1| PREDICTED: obg-like ATPase 1-like [Vicugna pacos]
 ref|XP_006744649.1| PREDICTED: obg-like ATPase 1 isoform X3 [Leptonychotes weddellii]
 ref|XP_011283607.1| PREDICTED: obg-like ATPase 1 isoform X2 [Felis catus]
 ref|XP_011355676.1| PREDICTED: obg-like ATPase 1 isoform X2 [Pteropus vampyrus]
 dbj|BAC11153.1| unnamed protein product [Homo sapiens]
 gb|EAX11150.1| GTP-binding protein PTD004, isoform CRA_b [Homo sapiens]
Length=238

 Score =   247 bits (630),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 150/202 (74%), Gaps = 2/202 (1%)
 Frame = -3

Query  703  LDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQE  527
            +D+ K  R   +W   +IE+LN    LT+KP+VYLVN++EKDY RKKNK+L KI  WV +
Sbjct  36   IDQKKPVRFYHDWNDKEIEVLNKHLFLTSKPMVYLVNLSEKDYIRKKNKWLIKIKEWVDK  95

Query  526  HG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  350
            +  G L+IPFS ALE  L ++  +E  KY E N  QSALPKIIK GF+A+ L YFFTAGP
Sbjct  96   YDPGALVIPFSGALELKLQELSAEERQKYLEANMTQSALPKIIKAGFAALQLEYFFTAGP  155

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+
Sbjct  156  DEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEEGSENAVKAAGKYRQQGR  215

Query  169  TYVVQDGDVIFFKFNVSGGGKK  104
             Y+V+DGD+IFFKFN     KK
Sbjct  216  NYIVEDGDIIFFKFNTPQQPKK  237



>ref|XP_005921550.1| PREDICTED: obg-like ATPase 1-like isoform X4 [Haplochromis burtoni]
Length=283

 Score =   248 bits (634),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 122/202 (60%), Positives = 148/202 (73%), Gaps = 2/202 (1%)
 Frame = -3

Query  703  LDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQE  527
            +DE K  R   +W   +IE+LN +  LT+KP++YLVN++EKDY R+KNK+L KI  WV  
Sbjct  81   VDEKKHIRYYHDWNDKEIEVLNKYLFLTSKPMIYLVNLSEKDYIRRKNKWLVKIKEWVDS  140

Query  526  HG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  350
            H  G L+IPFS  LE  L D   +E  KY  E+K QSAL KIIK G++A+ L YFFTAGP
Sbjct  141  HDPGALVIPFSGGLESLLQDKSEEERQKYSTEHKTQSALSKIIKAGYAALQLEYFFTAGP  200

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEV+ W IR+ TKAPQAAG IHTD ERGFI AEVMKF+D KE GSE AVKA GKYRQ+G+
Sbjct  201  DEVRAWTIRKGTKAPQAAGKIHTDFERGFIMAEVMKFQDFKEEGSESAVKAAGKYRQQGR  260

Query  169  TYVVQDGDVIFFKFNVSGGGKK  104
             Y+V+DGD+IFFKFN     KK
Sbjct  261  NYIVEDGDIIFFKFNAPNAPKK  282



>gb|ACO12256.1| Obg-like ATPase 1 [Lepeophtheirus salmonis]
Length=398

 Score =   252 bits (644),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 123/201 (61%), Positives = 147/201 (73%), Gaps = 1/201 (0%)
 Frame = -3

Query  712  KTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWV  533
            KT ++E K  R G W   DIE LN    +TAKP++YLVN++EKDY RKKNK+LPKI  +V
Sbjct  191  KTLIEEEKHIRFGTWSGNDIEFLNKHLFITAKPMIYLVNLSEKDYIRKKNKWLPKIKEYV  250

Query  532  QEHGGE-LIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
             +H    ++IPFS A E++L DMP DE AKY ++ K  SAL KII   + A+ L YFFTA
Sbjct  251  DKHDPRGIVIPFSGAFEQTLVDMPEDECAKYMDDVKCTSALEKIIIQAYKALQLEYFFTA  310

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  176
            GPDEVK W I + TKAPQAAG IHTD E+GFI AEVMKFED KE GSE A KA GKYRQ+
Sbjct  311  GPDEVKAWTILKHTKAPQAAGRIHTDFEKGFIMAEVMKFEDFKEEGSENAAKAAGKYRQQ  370

Query  175  GKTYVVQDGDVIFFKFNVSGG  113
            G+ YVV+DGD+IFFKFN   G
Sbjct  371  GRNYVVEDGDIIFFKFNAGAG  391



>ref|XP_001612801.1| GTP-binding protein [Plasmodium vivax Sal-1]
 gb|EDL43074.1| GTP-binding protein, putative [Plasmodium vivax]
Length=392

 Score =   252 bits (644),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 125/201 (62%), Positives = 147/201 (73%), Gaps = 1/201 (0%)
 Frame = -3

Query  703  LDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEH  524
            L E K  + G WKA++IE++N F  LTAKPVVYLVNM+E D+ R+KNK L KI+ WVQE 
Sbjct  192  LKEHKWIKDGNWKASEIEVINEFNFLTAKPVVYLVNMSEADFIRQKNKHLAKIYNWVQEK  251

Query  523  GGELIIPFSAALERSLADMPPDEAAKYCEENKV-QSALPKIIKTGFSAINLIYFFTAGPD  347
                IIP+ A +E  L  M  +E   Y +EN V QS L KIIKTG+  INLI+FFT GPD
Sbjct  252  NKGTIIPYCADMELKLLSMSEEEKNAYFKENNVKQSMLSKIIKTGYYEINLIHFFTCGPD  311

Query  346  EVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKT  167
            EVKCW IR+ TKAPQAAG IHTD E+GFICAEV K+ DL E  SE  VKA GKY Q+GK 
Sbjct  312  EVKCWTIRKGTKAPQAAGVIHTDFEKGFICAEVYKYADLVEFKSEGEVKANGKYLQKGKD  371

Query  166  YVVQDGDVIFFKFNVSGGGKK  104
            YVV+DGD++FFKFNVS  GKK
Sbjct  372  YVVEDGDIVFFKFNVSSSGKK  392



>gb|AAF71123.1|AF116721_103 PRO2455 [Homo sapiens]
Length=238

 Score =   247 bits (630),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 150/202 (74%), Gaps = 2/202 (1%)
 Frame = -3

Query  703  LDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQE  527
            +D+ K  R   +W   +IE+LN    LT+KP+VYLVN++EKDY RKKNK+L KI  WV +
Sbjct  36   IDQKKPVRFYHDWNDKEIEVLNKHLFLTSKPMVYLVNLSEKDYIRKKNKWLIKIKEWVDK  95

Query  526  HG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  350
            +  G L+IPFS ALE  L ++  +E  KY E N  QSALPKIIK GF+A+ L YFFTAGP
Sbjct  96   YDPGALVIPFSGALELKLQELSAEERQKYLEANMTQSALPKIIKAGFAALQLEYFFTAGP  155

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+
Sbjct  156  DEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEEGSENAVKAAGKYRQQGR  215

Query  169  TYVVQDGDVIFFKFNVSGGGKK  104
             Y+V+DGD+IFFKFN     KK
Sbjct  216  NYIVEDGDIIFFKFNTPRQPKK  237



>ref|XP_001349125.1| conserved GTP-binding protein, putative [Plasmodium falciparum 
3D7]
 emb|CAD50971.1| conserved GTP-binding protein, putative [Plasmodium falciparum 
3D7]
 gb|ETW57156.1| GTP-binding protein YchF [Plasmodium falciparum Palo Alto/Uganda]
 gb|ETW60067.1| GTP-binding protein YchF [Plasmodium falciparum CAMP/Malaysia]
 gb|EUR73781.1| GTP-binding protein YchF [Plasmodium falciparum 7G8]
 gb|EUT88305.1| GTP-binding protein YchF [Plasmodium falciparum Santa Lucia]
 gb|EWC77445.1| GTP-binding protein YchF [Plasmodium falciparum UGT5.1]
Length=393

 Score =   252 bits (643),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 125/205 (61%), Positives = 150/205 (73%), Gaps = 1/205 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            V   L E K  + G WK+ +IE+LN +  LTAKPVVYLVNM+E D+ R+KNK+L KI+ W
Sbjct  189  VLNYLKEHKWIKDGTWKSNEIEVLNEYNFLTAKPVVYLVNMSEADFIRQKNKYLAKIYNW  248

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKV-QSALPKIIKTGFSAINLIYFFT  359
            VQE     IIP+SA +E+ +  M  +E  +Y E N + QS L KIIKTG+  INLI+FFT
Sbjct  249  VQEKNKGTIIPYSAEVEQKILSMDEEEKKQYFETNNIKQSMLNKIIKTGYYEINLIHFFT  308

Query  358  AGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQ  179
             G DEVKCW IR+ TKAPQAAG IHTD E+GFICAEV K+ DL E  SE  VKA GKY Q
Sbjct  309  CGHDEVKCWTIRKGTKAPQAAGVIHTDFEKGFICAEVYKYTDLVEYKSEGEVKANGKYLQ  368

Query  178  EGKTYVVQDGDVIFFKFNVSGGGKK  104
            +GK YVV+DGD+IFFKFNVS GGKK
Sbjct  369  KGKDYVVEDGDIIFFKFNVSSGGKK  393



>ref|XP_007527278.1| PREDICTED: obg-like ATPase 1 isoform X2 [Erinaceus europaeus]
Length=238

 Score =   247 bits (630),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 149/202 (74%), Gaps = 2/202 (1%)
 Frame = -3

Query  703  LDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQE  527
            +D+ K  R   +W   +IE+LN    LT+KP+VYLVN++EKDY RKKNK+L KI  WV  
Sbjct  36   IDQKKPVRFYHDWNDKEIEVLNKHLFLTSKPMVYLVNLSEKDYIRKKNKWLIKIKEWVDN  95

Query  526  HG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  350
            +  G L+IPFS ALE  L ++  +E  KY E N  QSALPKIIK GF+A+ L YFFTAGP
Sbjct  96   YDPGALVIPFSGALELKLQELSAEERQKYLEANMTQSALPKIIKAGFAALQLEYFFTAGP  155

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+
Sbjct  156  DEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEEGSENAVKAAGKYRQQGR  215

Query  169  TYVVQDGDVIFFKFNVSGGGKK  104
             Y+V+DGD+IFFKFN     KK
Sbjct  216  NYIVEDGDIIFFKFNTPQQPKK  237



>gb|ADD38665.1| GTP-binding protein CG1354 [Lepeophtheirus salmonis]
Length=398

 Score =   252 bits (643),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 123/201 (61%), Positives = 147/201 (73%), Gaps = 1/201 (0%)
 Frame = -3

Query  712  KTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWV  533
            KT ++E K  R G W   DIE LN    +TAKP++YLVN++EKDY RKKNK+LPKI  +V
Sbjct  191  KTLIEEEKHIRFGTWSGNDIEFLNKHLFITAKPMIYLVNLSEKDYIRKKNKWLPKIKEYV  250

Query  532  QEHGGE-LIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
             +H    ++IPFS A E++L DMP DE AKY ++ K  SAL KII   + A+ L YFFTA
Sbjct  251  DKHDPRGIVIPFSGAFEQTLVDMPEDECAKYMDDVKCTSALEKIIIQAYKALQLEYFFTA  310

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  176
            GPDEVK W I + TKAPQAAG IHTD E+GFI AEVMKFED KE GSE A KA GKYRQ+
Sbjct  311  GPDEVKAWTILKHTKAPQAAGRIHTDFEKGFIMAEVMKFEDFKEEGSENAAKAAGKYRQQ  370

Query  175  GKTYVVQDGDVIFFKFNVSGG  113
            G+ YVV+DGD+IFFKFN   G
Sbjct  371  GRNYVVEDGDIIFFKFNAGAG  391



>gb|KFH65596.1| GTP-binding protein YchF [Mortierella verticillata NRRL 6337]
Length=399

 Score =   252 bits (643),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 117/205 (57%), Positives = 154/205 (75%), Gaps = 1/205 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            +K  +++ KD R G+W   ++E++N   LLTAKPV+YLVN++E DY RKKNK+L KIHAW
Sbjct  194  LKHVVEDHKDVRCGDWNNKEVEVINPLMLLTAKPVIYLVNLSEADYIRKKNKWLAKIHAW  253

Query  535  VQ-EHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFT  359
            VQ  + G+++IPFS ALE  ++DM   E  +  ++   QSALPKII +G+ A+NLIY+FT
Sbjct  254  VQTNNAGDMLIPFSGALESRISDMSEAEREEELKKIATQSALPKIIVSGYQALNLIYYFT  313

Query  358  AGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQ  179
             GP EV+CW IR+ TKAPQAAG IH+D ERGFI AE M+++DLKELG+E AVK  GKY Q
Sbjct  314  CGPQEVRCWSIRKGTKAPQAAGVIHSDFERGFIMAETMRYDDLKELGTEAAVKGAGKYMQ  373

Query  178  EGKTYVVQDGDVIFFKFNVSGGGKK  104
            +G+ Y V DGD+I FKFNV+   KK
Sbjct  374  KGRDYTVGDGDIIHFKFNVTAQPKK  398



>ref|XP_001515633.1| PREDICTED: obg-like ATPase 1 isoform X1 [Ornithorhynchus anatinus]
 ref|XP_007669441.1| PREDICTED: obg-like ATPase 1 isoform X1 [Ornithorhynchus anatinus]
 ref|XP_007669442.1| PREDICTED: obg-like ATPase 1 isoform X2 [Ornithorhynchus anatinus]
Length=396

 Score =   252 bits (643),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 126/202 (62%), Positives = 151/202 (75%), Gaps = 2/202 (1%)
 Frame = -3

Query  703  LDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQE  527
            LDE K  R   +W   +IE+LN    LT+KP++YLVN++EKDY RKKNK+L KI  WV +
Sbjct  194  LDEKKPVRFYHDWNDKEIEVLNKHLFLTSKPMIYLVNLSEKDYIRKKNKWLIKIKEWVDK  253

Query  526  HG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  350
            H  G L+IPFS ALE  L +M  +E  KY EEN  QSALPKIIK G++A+ L YFFTAGP
Sbjct  254  HDPGALVIPFSGALELKLQEMSAEEKQKYLEENMTQSALPKIIKAGYAALQLEYFFTAGP  313

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+
Sbjct  314  DEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEEGSETAVKAAGKYRQQGR  373

Query  169  TYVVQDGDVIFFKFNVSGGGKK  104
             Y+V+DGD+IFFKFN     KK
Sbjct  374  NYIVEDGDIIFFKFNTPQQPKK  395



>ref|XP_007938961.1| PREDICTED: obg-like ATPase 1 isoform X2 [Orycteropus afer afer]
Length=238

 Score =   247 bits (630),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 150/202 (74%), Gaps = 2/202 (1%)
 Frame = -3

Query  703  LDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQE  527
            +D+ K  R   +W   +IE+LN    LT+KP+VYLVN++EKDY RKKNK+L KI  WV +
Sbjct  36   VDQKKPVRFYHDWNDKEIEVLNKHLFLTSKPMVYLVNLSEKDYIRKKNKWLIKIKEWVDK  95

Query  526  HG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  350
            +  G L+IPFS ALE  L ++  +E  KY E N  QSALPKIIK GF+A+ L YFFTAGP
Sbjct  96   YDPGALVIPFSGALELKLQELSAEERQKYLEANMTQSALPKIIKAGFAALQLEYFFTAGP  155

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+
Sbjct  156  DEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEEGSENAVKAAGKYRQQGR  215

Query  169  TYVVQDGDVIFFKFNVSGGGKK  104
             Y+V+DGD+IFFKFN     KK
Sbjct  216  NYIVEDGDIIFFKFNTPQQPKK  237



>ref|XP_004267373.1| PREDICTED: obg-like ATPase 1 isoform 2 [Orcinus orca]
 ref|XP_004320700.1| PREDICTED: obg-like ATPase 1-like [Tursiops truncatus]
Length=238

 Score =   246 bits (629),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 150/202 (74%), Gaps = 2/202 (1%)
 Frame = -3

Query  703  LDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQE  527
            +D+ K  R   +W   +IE+LN    LT+KP+VYLVN++EKDY RKKNK+L KI  WV +
Sbjct  36   IDQKKPVRFCHDWNDKEIEVLNKHLFLTSKPMVYLVNLSEKDYIRKKNKWLIKIKEWVDK  95

Query  526  HG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  350
            +  G L+IPFS ALE  L ++  +E  KY E N  QSALPKIIK GF+A+ L YFFTAGP
Sbjct  96   YDPGALVIPFSGALELKLQELSAEERQKYLEANMTQSALPKIIKAGFAALQLEYFFTAGP  155

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+
Sbjct  156  DEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEEGSENAVKAAGKYRQQGR  215

Query  169  TYVVQDGDVIFFKFNVSGGGKK  104
             Y+V+DGD+IFFKFN     KK
Sbjct  216  NYIVEDGDIIFFKFNTPQQPKK  237



>ref|XP_005484131.1| PREDICTED: obg-like ATPase 1 [Zonotrichia albicollis]
Length=273

 Score =   248 bits (632),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 148/202 (73%), Gaps = 2/202 (1%)
 Frame = -3

Query  703  LDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQE  527
            +DE K  R   +W   +I++LN     T+KP++YLVN++EKDY RKKNK+L KI  WV +
Sbjct  71   IDEKKAVRFYHDWNDKEIDVLNKHLFFTSKPMIYLVNLSEKDYIRKKNKWLIKIKEWVDK  130

Query  526  HG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  350
            H  G L+IPFS ALE  L DM  +E  KY EEN  QSAL KIIK G++A+ L YFFTAGP
Sbjct  131  HDPGALVIPFSGALELKLQDMSAEEKQKYLEENMTQSALAKIIKAGYAALQLEYFFTAGP  190

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED K  GSE AVKA GKYRQ+G+
Sbjct  191  DEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKGEGSEAAVKAAGKYRQQGR  250

Query  169  TYVVQDGDVIFFKFNVSGGGKK  104
             YVV+DGD+IFFKFN     KK
Sbjct  251  NYVVEDGDIIFFKFNTPQQPKK  272



>gb|KFZ54967.1| Obg-like ATPase 1, partial [Caprimulgus carolinensis]
Length=315

 Score =   249 bits (635),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 149/202 (74%), Gaps = 2/202 (1%)
 Frame = -3

Query  703  LDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQE  527
            +DE K  R   +W   +I++LN     T+KP++YLVN++EKDY RKKNK+L KI  WV +
Sbjct  113  IDEKKAVRFYHDWNDKEIDVLNKHLFFTSKPMIYLVNLSEKDYIRKKNKWLIKIKEWVDK  172

Query  526  HG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  350
            H  G L+IPFS ALE  L DM  +E  KY EEN  QSAL KIIK G++A+ L YFFTAGP
Sbjct  173  HDPGALVIPFSGALELKLQDMSAEEKQKYLEENMTQSALAKIIKAGYAALQLEYFFTAGP  232

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+
Sbjct  233  DEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEGGSEAAVKAAGKYRQQGR  292

Query  169  TYVVQDGDVIFFKFNVSGGGKK  104
             Y+V+DGD+IFFKFN     KK
Sbjct  293  NYIVEDGDIIFFKFNTPQQPKK  314



>ref|XP_007451127.1| PREDICTED: obg-like ATPase 1 isoform X2 [Lipotes vexillifer]
Length=238

 Score =   246 bits (628),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 150/202 (74%), Gaps = 2/202 (1%)
 Frame = -3

Query  703  LDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQE  527
            +D+ K  R   +W   +IE+LN    LT+KP+VYLVN++EKDY RKKNK+L KI  WV +
Sbjct  36   IDQKKPVRFCHDWNDKEIEVLNKHLFLTSKPMVYLVNLSEKDYIRKKNKWLIKIKEWVDK  95

Query  526  HG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  350
            +  G L+IPFS ALE  L ++  +E  KY E N  QSALPKIIK GF+A+ L YFFTAGP
Sbjct  96   YDPGALVIPFSGALELKLQELSAEERQKYLEANMTQSALPKIIKAGFAALQLEYFFTAGP  155

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+
Sbjct  156  DEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEEGSENAVKAAGKYRQQGR  215

Query  169  TYVVQDGDVIFFKFNVSGGGKK  104
             Y+V+DGD+IFFKFN     KK
Sbjct  216  NYIVEDGDIIFFKFNAPQQPKK  237



>ref|XP_005452974.1| PREDICTED: obg-like ATPase 1-like isoform X5 [Oreochromis niloticus]
Length=350

 Score =   250 bits (638),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 149/202 (74%), Gaps = 2/202 (1%)
 Frame = -3

Query  703  LDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQE  527
            +DE K  R   +W   +IE+LN +  LT+KP++YLVN++EKDY R+KNK+L KI  WV  
Sbjct  148  VDEKKHIRYYHDWNDKEIEVLNKYLFLTSKPMIYLVNLSEKDYIRRKNKWLVKIKEWVDS  207

Query  526  HG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  350
            H  G L+IPFS  LE  L D   +E  KYC E+K QSAL KIIK G++A+ L YFFTAGP
Sbjct  208  HDPGALVIPFSGGLESLLQDKSEEERQKYCTEHKTQSALSKIIKAGYAALQLEYFFTAGP  267

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEV+ W IR+ TKAPQAAG IHTD ERGFI AEVMKF+D KE GSE AVKA GKYRQ+G+
Sbjct  268  DEVRAWTIRKGTKAPQAAGKIHTDFERGFIMAEVMKFQDFKEEGSESAVKAAGKYRQQGR  327

Query  169  TYVVQDGDVIFFKFNVSGGGKK  104
             Y+V+DGD+IFFKFN     KK
Sbjct  328  NYIVEDGDIIFFKFNAPNAPKK  349



>gb|EHA99193.1| Obg-like ATPase 1, partial [Heterocephalus glaber]
Length=271

 Score =   247 bits (631),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 150/202 (74%), Gaps = 2/202 (1%)
 Frame = -3

Query  703  LDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQE  527
            +D+ K  R   +W   +IE+LN    LT+KP+VYLVN++EKDY RKKNK+L KI  WV +
Sbjct  69   IDQKKPVRFYHDWNDKEIEVLNKHLFLTSKPMVYLVNLSEKDYIRKKNKWLIKIKEWVDK  128

Query  526  HG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  350
            +  G L+IPFS ALE  L ++  +E  KY E N  QSALPKIIK GF+A+ L YFFTAGP
Sbjct  129  YDPGALVIPFSGALELKLQELSAEERQKYLEANMTQSALPKIIKAGFAALQLEYFFTAGP  188

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+
Sbjct  189  DEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEEGSENAVKAAGKYRQQGR  248

Query  169  TYVVQDGDVIFFKFNVSGGGKK  104
             Y+V+DGD+IFFKFN     KK
Sbjct  249  NYIVEDGDIIFFKFNTPQQPKK  270



>gb|ESL11226.1| GTP-binding protein [Trypanosoma rangeli SC58]
Length=270

 Score =   247 bits (630),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 112/204 (55%), Positives = 147/204 (72%), Gaps = 0/204 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            VK  L+ G+  R   W   +I+ LNT QLLTAKP ++L NM+EK + R++ K+L K+  W
Sbjct  67   VKEHLENGEQVRCCHWNGKEIDYLNTLQLLTAKPAIFLANMSEKSFIRQRGKWLAKLKEW  126

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            + +H GE +IP SA +E    DM P+E  +YC+ NK +S + K++ T + AINLI++FTA
Sbjct  127  IDQHTGEPLIPVSAEMEAKFVDMSPEEVEEYCKANKTKSQVNKVVTTSYHAINLIHYFTA  186

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  176
            G DEVKCW I+R TKAPQAAG IHTD+E+GFICAEV+ +ED  +L SE A +  GK  QE
Sbjct  187  GADEVKCWTIQRGTKAPQAAGKIHTDMEKGFICAEVIHWEDYDKLESEAACREAGKQHQE  246

Query  175  GKTYVVQDGDVIFFKFNVSGGGKK  104
            G+ Y VQDGD+IFFKFNVS GGKK
Sbjct  247  GRNYEVQDGDIIFFKFNVSKGGKK  270



>ref|XP_007430998.1| PREDICTED: obg-like ATPase 1-like isoform X1 [Python bivittatus]
Length=401

 Score =   251 bits (641),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 126/202 (62%), Positives = 151/202 (75%), Gaps = 2/202 (1%)
 Frame = -3

Query  703  LDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQE  527
            +DE K  R   +W   +I++LN    LT+KP++YL+N++EKDY RKKNK+L KI  WV +
Sbjct  199  IDEKKPVRFYHDWNDKEIDVLNKHLFLTSKPMIYLINLSEKDYIRKKNKWLIKIKEWVDK  258

Query  526  HG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  350
            H  G L+IPFS ALE  L +M  +E  KY EEN  QSALPKIIK G++A+ L YFFTAGP
Sbjct  259  HDPGALVIPFSGALELKLQEMSAEEKQKYLEENMTQSALPKIIKAGYAALQLEYFFTAGP  318

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMKFED KE GSE AVKA GKYRQ+G+
Sbjct  319  DEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKFEDFKEGGSEAAVKAAGKYRQQGR  378

Query  169  TYVVQDGDVIFFKFNVSGGGKK  104
             YVV+DGDVIFFKFN     KK
Sbjct  379  NYVVEDGDVIFFKFNTPQQPKK  400



>ref|XP_001368232.1| PREDICTED: Obg-like ATPase 1 [Monodelphis domestica]
Length=396

 Score =   251 bits (641),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 125/202 (62%), Positives = 151/202 (75%), Gaps = 2/202 (1%)
 Frame = -3

Query  703  LDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQE  527
            +DE K  R   +W   +IE+LN    LT+KP++YLVN++EKDY RKKNK+L KI  WV +
Sbjct  194  IDEKKPVRFYHDWNDKEIEVLNKHLFLTSKPMIYLVNLSEKDYIRKKNKWLIKIKEWVDK  253

Query  526  HG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  350
            H  G L+IPFS ALE  L +M  +E  KY EEN  QSALPKIIK G++A+ L YFFTAGP
Sbjct  254  HDPGALVIPFSGALELKLQEMSAEEKQKYLEENMTQSALPKIIKAGYAALQLEYFFTAGP  313

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+
Sbjct  314  DEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEEGSENAVKAAGKYRQQGR  373

Query  169  TYVVQDGDVIFFKFNVSGGGKK  104
             Y+V+DGD+IFFKFN     KK
Sbjct  374  NYIVEDGDIIFFKFNTPQQPKK  395



>ref|XP_007430999.1| PREDICTED: obg-like ATPase 1-like isoform X2 [Python bivittatus]
Length=396

 Score =   251 bits (640),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 126/202 (62%), Positives = 151/202 (75%), Gaps = 2/202 (1%)
 Frame = -3

Query  703  LDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQE  527
            +DE K  R   +W   +I++LN    LT+KP++YL+N++EKDY RKKNK+L KI  WV +
Sbjct  194  IDEKKPVRFYHDWNDKEIDVLNKHLFLTSKPMIYLINLSEKDYIRKKNKWLIKIKEWVDK  253

Query  526  HG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  350
            H  G L+IPFS ALE  L +M  +E  KY EEN  QSALPKIIK G++A+ L YFFTAGP
Sbjct  254  HDPGALVIPFSGALELKLQEMSAEEKQKYLEENMTQSALPKIIKAGYAALQLEYFFTAGP  313

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMKFED KE GSE AVKA GKYRQ+G+
Sbjct  314  DEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKFEDFKEGGSEAAVKAAGKYRQQGR  373

Query  169  TYVVQDGDVIFFKFNVSGGGKK  104
             YVV+DGDVIFFKFN     KK
Sbjct  374  NYVVEDGDVIFFKFNTPQQPKK  395



>ref|XP_009330922.1| PREDICTED: obg-like ATPase 1 isoform X1 [Pygoscelis adeliae]
Length=294

 Score =   247 bits (631),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 122/202 (60%), Positives = 148/202 (73%), Gaps = 2/202 (1%)
 Frame = -3

Query  703  LDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQE  527
            +DE K  R   +W   +I++LN     T+KP++YLVN++EKDY RKKNK+L KI  WV +
Sbjct  92   IDEKKAVRFYHDWNDKEIDVLNKHLFFTSKPMIYLVNLSEKDYIRKKNKWLIKIKEWVDK  151

Query  526  HG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  350
            H  G L+IPFS ALE  L DM  +E  KY EEN   SAL KIIK G++A+ L YFFTAGP
Sbjct  152  HDPGALVIPFSGALELKLQDMSAEEKQKYLEENMTDSALAKIIKAGYAALQLEYFFTAGP  211

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+
Sbjct  212  DEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEGGSEAAVKAAGKYRQQGR  271

Query  169  TYVVQDGDVIFFKFNVSGGGKK  104
             Y+V+DGD+IFFKFN     KK
Sbjct  272  NYIVEDGDIIFFKFNTPQQPKK  293



>ref|XP_008136766.1| PREDICTED: obg-like ATPase 1 isoform X2 [Eptesicus fuscus]
Length=238

 Score =   245 bits (626),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 121/202 (60%), Positives = 150/202 (74%), Gaps = 2/202 (1%)
 Frame = -3

Query  703  LDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQE  527
            +D+ K  R   +W   +IE+LN +  LT+KP+VYLVN++EKDY RKKNK+L KI  WV +
Sbjct  36   IDQKKPVRFYHDWNDKEIEVLNKYLFLTSKPMVYLVNLSEKDYIRKKNKWLIKIKEWVDK  95

Query  526  HG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  350
               G L+IPFS ALE  L ++  +E  +Y E N  QSALPKIIK GF+A+ L YFFTAGP
Sbjct  96   SDPGALVIPFSGALELKLQELSAEERQQYLEANTTQSALPKIIKAGFAALQLEYFFTAGP  155

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK++D KE GSE AVKA GKYRQ+G+
Sbjct  156  DEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYDDFKEEGSENAVKAAGKYRQQGR  215

Query  169  TYVVQDGDVIFFKFNVSGGGKK  104
             Y+V+DGD+IFFKFN     KK
Sbjct  216  NYIVEDGDIIFFKFNTPQQPKK  237



>emb|CDO63681.1| GTP-binding protein, putative [Plasmodium reichenowi]
Length=393

 Score =   250 bits (639),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 124/205 (60%), Positives = 150/205 (73%), Gaps = 1/205 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            V   L E K  + G WK+ +IE+LN +  LTAKPVVYLVNM+E D+ R+KNK+L KI+ W
Sbjct  189  VLNYLKEHKWIKDGTWKSNEIEVLNEYNFLTAKPVVYLVNMSEADFIRQKNKYLAKIYNW  248

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKV-QSALPKIIKTGFSAINLIYFFT  359
            VQE     IIP+SA +E+ +  M  +E  +Y + N + QS L KIIKTG+  INLI+FFT
Sbjct  249  VQEKNKGTIIPYSAEVEQKILSMDEEEKKQYFQTNNIKQSMLNKIIKTGYYEINLIHFFT  308

Query  358  AGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQ  179
             G DEVKCW IR+ TKAPQAAG IHTD E+GFICAEV K+ DL E  SE  VKA GKY Q
Sbjct  309  CGHDEVKCWTIRKGTKAPQAAGVIHTDFEKGFICAEVYKYTDLVEYKSEGEVKANGKYLQ  368

Query  178  EGKTYVVQDGDVIFFKFNVSGGGKK  104
            +GK YVV+DGD+IFFKFNVS GGKK
Sbjct  369  KGKDYVVEDGDIIFFKFNVSSGGKK  393



>ref|XP_009236113.1| PREDICTED: obg-like ATPase 1 isoform X2 [Pongo abelii]
Length=238

 Score =   245 bits (626),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 122/202 (60%), Positives = 150/202 (74%), Gaps = 2/202 (1%)
 Frame = -3

Query  703  LDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQE  527
            +D+ K  R   +W   +IE+LN    LT+KP+VYLVN++EKDY RKKNK+L KI  WV +
Sbjct  36   IDQKKPVRFYHDWNDKEIEVLNKHLFLTSKPMVYLVNLSEKDYIRKKNKWLIKIKEWVDK  95

Query  526  HG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  350
            +  G L+IPFS ALE  L ++  +E  KY E N  QSALPKIIK GF+A+ L YFFTAGP
Sbjct  96   YDPGALVIPFSGALELKLQELSAEERQKYLEANMTQSALPKIIKAGFAALQLEYFFTAGP  155

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            +EV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+
Sbjct  156  EEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEEGSENAVKAAGKYRQQGR  215

Query  169  TYVVQDGDVIFFKFNVSGGGKK  104
             Y+V+DGD+IFFKFN     KK
Sbjct  216  NYIVEDGDIIFFKFNTPQQPKK  237



>ref|XP_003764019.1| PREDICTED: obg-like ATPase 1 [Sarcophilus harrisii]
Length=396

 Score =   251 bits (640),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 125/202 (62%), Positives = 151/202 (75%), Gaps = 2/202 (1%)
 Frame = -3

Query  703  LDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQE  527
            +DE K  R   +W   +IE+LN    LT+KP++YLVN++EKDY RKKNK+L KI  WV +
Sbjct  194  IDEKKPVRFYHDWNDKEIEVLNKHLFLTSKPMIYLVNLSEKDYIRKKNKWLIKIKEWVDK  253

Query  526  HG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  350
            H  G L+IPFS ALE  L +M  +E  KY EEN  QSALPKIIK G++A+ L YFFTAGP
Sbjct  254  HDPGALVIPFSGALELKLQEMSAEEKQKYLEENMTQSALPKIIKAGYAALQLEYFFTAGP  313

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+
Sbjct  314  DEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEEGSENAVKAAGKYRQQGR  373

Query  169  TYVVQDGDVIFFKFNVSGGGKK  104
             Y+V+DGD+IFFKFN     KK
Sbjct  374  NYIVEDGDIIFFKFNTPQQPKK  395



>ref|XP_009932339.1| PREDICTED: obg-like ATPase 1 [Opisthocomus hoazin]
Length=273

 Score =   246 bits (629),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 122/201 (61%), Positives = 148/201 (74%), Gaps = 2/201 (1%)
 Frame = -3

Query  700  DEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEH  524
            DE K  R   +W   +I++LN     T+KP++YLVN++EKDY RKKNK+L KI  WV +H
Sbjct  72   DEKKAVRFYHDWNDKEIDVLNKHLFFTSKPMIYLVNLSEKDYVRKKNKWLIKIKEWVDKH  131

Query  523  G-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPD  347
              G L+IPFS ALE  L DM  +E  KY EEN  +SAL KIIK G++A+ L YFFTAGPD
Sbjct  132  DPGALVIPFSGALELKLQDMSAEEKQKYLEENMKESALAKIIKAGYAALQLEYFFTAGPD  191

Query  346  EVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKT  167
            EV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+ 
Sbjct  192  EVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEGGSEAAVKAAGKYRQQGRN  251

Query  166  YVVQDGDVIFFKFNVSGGGKK  104
            Y+V+DGD+IFFKFN     KK
Sbjct  252  YIVEDGDIIFFKFNTPQQPKK  272



>ref|XP_010605332.1| PREDICTED: obg-like ATPase 1 isoform X2 [Fukomys damarensis]
Length=294

 Score =   247 bits (631),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 150/202 (74%), Gaps = 2/202 (1%)
 Frame = -3

Query  703  LDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQE  527
            +D+ K  R   +W   +IE+LN    LT+KP+VYLVN++EKDY RKKNK+L KI  WV +
Sbjct  92   IDQKKPVRFYHDWNDKEIEVLNKHLFLTSKPMVYLVNLSEKDYIRKKNKWLIKIKEWVDK  151

Query  526  HG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  350
            +  G L+IPFS ALE  L ++  +E  KY E N  QSALPKIIK GF+A+ L YFFTAGP
Sbjct  152  YDPGALVIPFSGALELKLQELSAEERQKYLEANMTQSALPKIIKAGFAALQLEYFFTAGP  211

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+
Sbjct  212  DEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEEGSENAVKAAGKYRQQGR  271

Query  169  TYVVQDGDVIFFKFNVSGGGKK  104
             Y+V+DGD+IFFKFN     KK
Sbjct  272  NYIVEDGDIIFFKFNTPQQPKK  293



>gb|KFH07802.1| putative GTP-binding protein, partial [Toxoplasma gondii VAND]
Length=192

 Score =   243 bits (621),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 119/192 (62%), Positives = 148/192 (77%), Gaps = 2/192 (1%)
 Frame = -3

Query  673  EWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSA  494
            +WKA+++E+LN +Q LTAK VVYLVNM+EKD+ R+KNK+L KIH WV+ +    IIP+SA
Sbjct  1    DWKASEVEVLNEYQFLTAKQVVYLVNMSEKDFIRQKNKWLAKIHGWVEANVSGPIIPYSA  60

Query  493  ALERSLADMPPDEA-AKYCEE-NKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRR  320
              E  LA++P D A  KY ++    +S L KI+ TG+ A++LI+FFT G DEVKCW IR+
Sbjct  61   QFESKLAELPDDAAREKYIKDVGASRSQLDKIVTTGYHALHLIHFFTCGEDEVKCWTIRQ  120

Query  319  QTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVI  140
             TKAPQAAG IHTD ERGFICAEV K+EDL   GSE AVKA GKY Q+GK YVV+DGD+I
Sbjct  121  GTKAPQAAGVIHTDFERGFICAEVYKYEDLVAAGSENAVKAAGKYLQKGKDYVVEDGDII  180

Query  139  FFKFNVSGGGKK  104
            FFKFNV+  GKK
Sbjct  181  FFKFNVTNSGKK  192



>ref|XP_005510535.1| PREDICTED: obg-like ATPase 1-like, partial [Columba livia]
Length=362

 Score =   249 bits (636),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 150/202 (74%), Gaps = 2/202 (1%)
 Frame = -3

Query  703  LDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQE  527
            +DE K  R   +W   +I++LN +   T+KP++YLVN++EKDY RKKNK+L KI  WV +
Sbjct  160  IDEKKAVRFCHDWNDKEIDVLNKYLFFTSKPMIYLVNLSEKDYIRKKNKWLIKIKEWVDK  219

Query  526  HG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  350
            H  G L+IPFS ALE  L DM  +E  KY EEN  QSAL KIIK G++A+ L YFFTAGP
Sbjct  220  HDPGALVIPFSGALELKLQDMSAEEKQKYLEENMTQSALAKIIKAGYAALQLEYFFTAGP  279

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+
Sbjct  280  DEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEEGSEAAVKAAGKYRQQGR  339

Query  169  TYVVQDGDVIFFKFNVSGGGKK  104
             Y+V+DGD+IFFKFN     KK
Sbjct  340  NYIVEDGDIIFFKFNTPQQPKK  361



>gb|AEB61109.1| obg-like ATPase 1-like protein, partial [Equus caballus]
Length=291

 Score =   247 bits (630),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 150/202 (74%), Gaps = 2/202 (1%)
 Frame = -3

Query  703  LDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQE  527
            +D+ K  R   +W   +IE+LN    LT+KP+VYLVN++EKDY RKKNK+L KI  WV +
Sbjct  89   MDQKKPVRFYHDWNDKEIEVLNKHLFLTSKPMVYLVNLSEKDYIRKKNKWLIKIKEWVDK  148

Query  526  HG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  350
            +  G L+IPFS ALE  L ++  +E  KY E N  QSALPKIIK GF+A+ L YFFTAGP
Sbjct  149  YDPGALVIPFSGALELKLQELSAEERQKYLEANMTQSALPKIIKAGFAALQLEYFFTAGP  208

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+
Sbjct  209  DEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEEGSENAVKAAGKYRQQGR  268

Query  169  TYVVQDGDVIFFKFNVSGGGKK  104
             Y+V+DGD+IFFKFN     KK
Sbjct  269  NYIVEDGDIIFFKFNTPQQPKK  290



>ref|XP_010878192.1| PREDICTED: obg-like ATPase 1 isoform X4 [Esox lucius]
Length=398

 Score =   250 bits (639),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 122/195 (63%), Positives = 148/195 (76%), Gaps = 2/195 (1%)
 Frame = -3

Query  700  DEGKDARLG-EWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEH  524
            DE K  R   +W   +IE+LN +  LT+KP++YL+N++EKDY R+KNK+L KI  WV  H
Sbjct  196  DEKKHVRFCRDWNDKEIEVLNKYLFLTSKPMIYLINLSEKDYIRRKNKWLVKIKDWVDIH  255

Query  523  G-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPD  347
              G L+IPFS  LER L DM  +E  KYC+E+K QS L +IIK G+ A+ L YFFTAGPD
Sbjct  256  DPGALVIPFSGGLERILQDMSEEEIQKYCKEHKTQSVLTRIIKAGYGALQLEYFFTAGPD  315

Query  346  EVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKT  167
            EV+ W IR+ TKAPQAAG IHTD E+GFI AEVMKFED KE GSE AVKA GKYRQ+GKT
Sbjct  316  EVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKFEDFKEGGSENAVKAAGKYRQQGKT  375

Query  166  YVVQDGDVIFFKFNV  122
            YVV+DGD+IFF+FN 
Sbjct  376  YVVEDGDIIFFRFNT  390



>ref|XP_010878191.1| PREDICTED: obg-like ATPase 1 isoform X3 [Esox lucius]
Length=399

 Score =   250 bits (639),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 122/195 (63%), Positives = 148/195 (76%), Gaps = 2/195 (1%)
 Frame = -3

Query  700  DEGKDARLG-EWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEH  524
            DE K  R   +W   +IE+LN +  LT+KP++YL+N++EKDY R+KNK+L KI  WV  H
Sbjct  197  DEKKHVRFCRDWNDKEIEVLNKYLFLTSKPMIYLINLSEKDYIRRKNKWLVKIKDWVDIH  256

Query  523  G-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPD  347
              G L+IPFS  LER L DM  +E  KYC+E+K QS L +IIK G+ A+ L YFFTAGPD
Sbjct  257  DPGALVIPFSGGLERILQDMSEEEIQKYCKEHKTQSVLTRIIKAGYGALQLEYFFTAGPD  316

Query  346  EVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKT  167
            EV+ W IR+ TKAPQAAG IHTD E+GFI AEVMKFED KE GSE AVKA GKYRQ+GKT
Sbjct  317  EVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKFEDFKEGGSENAVKAAGKYRQQGKT  376

Query  166  YVVQDGDVIFFKFNV  122
            YVV+DGD+IFF+FN 
Sbjct  377  YVVEDGDIIFFRFNT  391



>ref|NP_001026425.1| obg-like ATPase 1 [Gallus gallus]
 sp|Q5ZM25.1|OLA1_CHICK RecName: Full=Obg-like ATPase 1 [Gallus gallus]
 emb|CAG31218.1| hypothetical protein RCJMB04_3f20 [Gallus gallus]
Length=396

 Score =   250 bits (638),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 124/202 (61%), Positives = 150/202 (74%), Gaps = 2/202 (1%)
 Frame = -3

Query  703  LDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQE  527
            +DE K  R   +W   +I++LN     T+KP++YLVN++EKDY RKKNK+L KI  WV +
Sbjct  194  IDEKKAVRFYHDWNDKEIDVLNKHLFFTSKPMIYLVNLSEKDYIRKKNKWLIKIKEWVDK  253

Query  526  HG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  350
            H  G L+IPFS ALE  L DM  +E  KY EEN  QSALPKIIK G++A+ L YFFTAGP
Sbjct  254  HDPGALVIPFSGALELKLQDMSAEEKQKYLEENMTQSALPKIIKAGYAALQLEYFFTAGP  313

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+
Sbjct  314  DEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEGGSEAAVKAAGKYRQQGR  373

Query  169  TYVVQDGDVIFFKFNVSGGGKK  104
             Y+V+DGD+IFFKFN     KK
Sbjct  374  NYIVEDGDIIFFKFNTPQQPKK  395



>emb|CBK21211.2| unnamed protein product [Blastocystis hominis]
Length=414

 Score =   251 bits (640),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 119/202 (59%), Positives = 149/202 (74%), Gaps = 1/202 (0%)
 Frame = -3

Query  706  SLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQE  527
            ++ EGKD R   W AA+IE++NT+QLL+AKP+VYL N++EK+Y  +K+  + K+   V  
Sbjct  212  TMQEGKDIRAVRWNAAEIEVINTYQLLSAKPIVYLCNLSEKNYILRKDPLMDKVREKVAA  271

Query  526  HG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  350
             G GE +IPFSA  E  L +M  +EA  YCE+   +S LP+II TG+  +NLI+FFTAG 
Sbjct  272  MGLGEQVIPFSARFETKLLNMSEEEAKAYCEKYHTKSQLPRIITTGYHVLNLIHFFTAGA  331

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEVKCW IR+ T APQAAG IHTD E+GFICAEV KFED KEL +E A+KA GK +QEG+
Sbjct  332  DEVKCWTIRKGTLAPQAAGVIHTDFEKGFICAEVYKFEDFKELKTEAAIKAAGKLKQEGR  391

Query  169  TYVVQDGDVIFFKFNVSGGGKK  104
             Y VQDGDVIFFKFNV   GKK
Sbjct  392  NYEVQDGDVIFFKFNVGTEGKK  413



>ref|XP_010878190.1| PREDICTED: obg-like ATPase 1 isoform X2 [Esox lucius]
Length=432

 Score =   251 bits (641),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 122/195 (63%), Positives = 148/195 (76%), Gaps = 2/195 (1%)
 Frame = -3

Query  700  DEGKDARLG-EWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEH  524
            DE K  R   +W   +IE+LN +  LT+KP++YL+N++EKDY R+KNK+L KI  WV  H
Sbjct  230  DEKKHVRFCRDWNDKEIEVLNKYLFLTSKPMIYLINLSEKDYIRRKNKWLVKIKDWVDIH  289

Query  523  G-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPD  347
              G L+IPFS  LER L DM  +E  KYC+E+K QS L +IIK G+ A+ L YFFTAGPD
Sbjct  290  DPGALVIPFSGGLERILQDMSEEEIQKYCKEHKTQSVLTRIIKAGYGALQLEYFFTAGPD  349

Query  346  EVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKT  167
            EV+ W IR+ TKAPQAAG IHTD E+GFI AEVMKFED KE GSE AVKA GKYRQ+GKT
Sbjct  350  EVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKFEDFKEGGSENAVKAAGKYRQQGKT  409

Query  166  YVVQDGDVIFFKFNV  122
            YVV+DGD+IFF+FN 
Sbjct  410  YVVEDGDIIFFRFNT  424



>ref|XP_010878189.1| PREDICTED: obg-like ATPase 1 isoform X1 [Esox lucius]
Length=433

 Score =   251 bits (641),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 122/195 (63%), Positives = 148/195 (76%), Gaps = 2/195 (1%)
 Frame = -3

Query  700  DEGKDARLG-EWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEH  524
            DE K  R   +W   +IE+LN +  LT+KP++YL+N++EKDY R+KNK+L KI  WV  H
Sbjct  231  DEKKHVRFCRDWNDKEIEVLNKYLFLTSKPMIYLINLSEKDYIRRKNKWLVKIKDWVDIH  290

Query  523  G-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPD  347
              G L+IPFS  LER L DM  +E  KYC+E+K QS L +IIK G+ A+ L YFFTAGPD
Sbjct  291  DPGALVIPFSGGLERILQDMSEEEIQKYCKEHKTQSVLTRIIKAGYGALQLEYFFTAGPD  350

Query  346  EVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKT  167
            EV+ W IR+ TKAPQAAG IHTD E+GFI AEVMKFED KE GSE AVKA GKYRQ+GKT
Sbjct  351  EVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKFEDFKEGGSENAVKAAGKYRQQGKT  410

Query  166  YVVQDGDVIFFKFNV  122
            YVV+DGD+IFF+FN 
Sbjct  411  YVVEDGDIIFFRFNT  425



>ref|XP_006866714.1| PREDICTED: obg-like ATPase 1 isoform X2 [Chrysochloris asiatica]
Length=238

 Score =   244 bits (624),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 149/202 (74%), Gaps = 2/202 (1%)
 Frame = -3

Query  703  LDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQE  527
            +D+ K  R   +W   +IE+LN    LT+KP+VYLVN++EKDY RKKNK+L KI  WV +
Sbjct  36   VDQKKPVRFYHDWNDKEIEVLNKHLFLTSKPMVYLVNLSEKDYIRKKNKWLIKIKEWVDK  95

Query  526  -HGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  350
               G L+IPFS ALE  L ++  +E  KY E N  QSALPKIIK GF+A+ L YFFTAGP
Sbjct  96   CDPGALVIPFSGALELKLQELSAEERQKYLEANMTQSALPKIIKAGFAALQLEYFFTAGP  155

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+
Sbjct  156  DEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEEGSENAVKAAGKYRQQGR  215

Query  169  TYVVQDGDVIFFKFNVSGGGKK  104
             Y+V+DGD+IFFKFN     KK
Sbjct  216  NYIVEDGDIIFFKFNTPQQPKK  237



>ref|XP_009952424.1| PREDICTED: obg-like ATPase 1, partial [Leptosomus discolor]
Length=277

 Score =   246 bits (628),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 122/202 (60%), Positives = 148/202 (73%), Gaps = 2/202 (1%)
 Frame = -3

Query  703  LDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQE  527
            +DE K  R   +W   +I++LN     T+KP++YLVN++EKDY RKKNK+L KI  WV +
Sbjct  75   IDEKKAVRFYHDWNDKEIDVLNKHLFFTSKPMIYLVNLSEKDYIRKKNKWLIKIKEWVDK  134

Query  526  HG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  350
            H  G L+IPFS ALE  L DM  +E  KY EEN   SAL KIIK G++A+ L YFFTAGP
Sbjct  135  HDPGALVIPFSGALELKLQDMSAEEKQKYLEENMXXSALAKIIKAGYAALQLEYFFTAGP  194

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+
Sbjct  195  DEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEGGSEAAVKAAGKYRQQGR  254

Query  169  TYVVQDGDVIFFKFNVSGGGKK  104
             Y+V+DGD+IFFKFN     KK
Sbjct  255  NYIVEDGDIIFFKFNTPQQPKK  276



>emb|CCW70456.1| unnamed protein product [Phytomonas sp. isolate Hart1]
Length=393

 Score =   249 bits (637),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 115/204 (56%), Positives = 148/204 (73%), Gaps = 0/204 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            VK+ L+EGK  R  +W   +I+ LNT QLLTAKP ++L+NM+E D+ R++NK+L K+  W
Sbjct  190  VKSFLEEGKQIRCCQWNGKEIDFLNTIQLLTAKPAMFLINMSENDFVRQRNKWLKKLKDW  249

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            + E   E +IPFSA LE     M P+E  KYCEE K +S LPKIIKT +S INLI++FTA
Sbjct  250  IDEQTAEPMIPFSAELETEFLSMTPEEITKYCEEKKTKSQLPKIIKTAYSIINLIHYFTA  309

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  176
            G DEVKCW I+R TKAPQAAG IH+D+E+GFICA+V+++ED   L SE   +  GK  Q+
Sbjct  310  GSDEVKCWTIQRGTKAPQAAGRIHSDMEKGFICADVIEWEDFNRLESEAVCREEGKQHQQ  369

Query  175  GKTYVVQDGDVIFFKFNVSGGGKK  104
            G+ Y VQDGD+IFFKFN S   KK
Sbjct  370  GRNYEVQDGDIIFFKFNTSKASKK  393



>ref|XP_003447358.1| PREDICTED: obg-like ATPase 1-like isoform X1 [Oreochromis niloticus]
Length=396

 Score =   249 bits (637),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 149/202 (74%), Gaps = 2/202 (1%)
 Frame = -3

Query  703  LDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQE  527
            +DE K  R   +W   +IE+LN +  LT+KP++YLVN++EKDY R+KNK+L KI  WV  
Sbjct  194  VDEKKHIRYYHDWNDKEIEVLNKYLFLTSKPMIYLVNLSEKDYIRRKNKWLVKIKEWVDS  253

Query  526  HG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  350
            H  G L+IPFS  LE  L D   +E  KYC E+K QSAL KIIK G++A+ L YFFTAGP
Sbjct  254  HDPGALVIPFSGGLESLLQDKSEEERQKYCTEHKTQSALSKIIKAGYAALQLEYFFTAGP  313

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEV+ W IR+ TKAPQAAG IHTD ERGFI AEVMKF+D KE GSE AVKA GKYRQ+G+
Sbjct  314  DEVRAWTIRKGTKAPQAAGKIHTDFERGFIMAEVMKFQDFKEEGSESAVKAAGKYRQQGR  373

Query  169  TYVVQDGDVIFFKFNVSGGGKK  104
             Y+V+DGD+IFFKFN     KK
Sbjct  374  NYIVEDGDIIFFKFNAPNAPKK  395



>ref|XP_005452973.1| PREDICTED: obg-like ATPase 1-like isoform X4 [Oreochromis niloticus]
Length=398

 Score =   249 bits (637),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 149/202 (74%), Gaps = 2/202 (1%)
 Frame = -3

Query  703  LDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQE  527
            +DE K  R   +W   +IE+LN +  LT+KP++YLVN++EKDY R+KNK+L KI  WV  
Sbjct  196  VDEKKHIRYYHDWNDKEIEVLNKYLFLTSKPMIYLVNLSEKDYIRRKNKWLVKIKEWVDS  255

Query  526  HG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  350
            H  G L+IPFS  LE  L D   +E  KYC E+K QSAL KIIK G++A+ L YFFTAGP
Sbjct  256  HDPGALVIPFSGGLESLLQDKSEEERQKYCTEHKTQSALSKIIKAGYAALQLEYFFTAGP  315

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEV+ W IR+ TKAPQAAG IHTD ERGFI AEVMKF+D KE GSE AVKA GKYRQ+G+
Sbjct  316  DEVRAWTIRKGTKAPQAAGKIHTDFERGFIMAEVMKFQDFKEEGSESAVKAAGKYRQQGR  375

Query  169  TYVVQDGDVIFFKFNVSGGGKK  104
             Y+V+DGD+IFFKFN     KK
Sbjct  376  NYIVEDGDIIFFKFNAPNAPKK  397



>ref|XP_008297045.1| PREDICTED: obg-like ATPase 1 [Stegastes partitus]
Length=398

 Score =   249 bits (637),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 122/202 (60%), Positives = 150/202 (74%), Gaps = 2/202 (1%)
 Frame = -3

Query  703  LDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQE  527
            +DE K+ R   +W   +IE+LN +  LT+KP++YLVN++EKDY R+KNK+L KI  WV  
Sbjct  196  VDEKKNVRYYHDWNDKEIEVLNKYLFLTSKPMIYLVNLSEKDYIRRKNKWLVKIKEWVDS  255

Query  526  HG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  350
            H  G L+IPFS  LE  L D   +E  KYC E+K QSAL KIIK G++A+ L YFFTAGP
Sbjct  256  HDPGALVIPFSGGLESQLQDSSEEERQKYCTEHKTQSALSKIIKAGYAALQLEYFFTAGP  315

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMKF+D KE GSE AVKA GKYRQ+G+
Sbjct  316  DEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKFQDFKEEGSENAVKAAGKYRQQGR  375

Query  169  TYVVQDGDVIFFKFNVSGGGKK  104
             Y+V+DGD+IFFKFN     KK
Sbjct  376  NYIVEDGDIIFFKFNAPNAPKK  397



>gb|KFH16391.1| putative GTP-binding protein, partial [Toxoplasma gondii MAS]
Length=223

 Score =   243 bits (621),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 119/192 (62%), Positives = 148/192 (77%), Gaps = 2/192 (1%)
 Frame = -3

Query  673  EWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSA  494
            +WKA+++E+LN +Q LTAK VVYLVNM+EKD+ R+KNK+L KIH WV+ +    IIP+SA
Sbjct  32   DWKASEVEVLNEYQFLTAKQVVYLVNMSEKDFIRQKNKWLAKIHGWVEANVSGPIIPYSA  91

Query  493  ALERSLADMPPDEA-AKYCEE-NKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRR  320
              E  LA++P D A  KY ++    +S L KI+ TG+ A++LI+FFT G DEVKCW IR+
Sbjct  92   QFESKLAELPDDAAREKYIKDVGASRSQLDKIVTTGYHALHLIHFFTCGEDEVKCWTIRQ  151

Query  319  QTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVI  140
             TKAPQAAG IHTD ERGFICAEV K+EDL   GSE AVKA GKY Q+GK YVV+DGD+I
Sbjct  152  GTKAPQAAGVIHTDFERGFICAEVYKYEDLVAAGSENAVKAAGKYLQKGKDYVVEDGDII  211

Query  139  FFKFNVSGGGKK  104
            FFKFNV+  GKK
Sbjct  212  FFKFNVTNSGKK  223



>ref|XP_005452972.1| PREDICTED: obg-like ATPase 1-like isoform X3 [Oreochromis niloticus]
Length=423

 Score =   250 bits (638),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 149/202 (74%), Gaps = 2/202 (1%)
 Frame = -3

Query  703  LDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQE  527
            +DE K  R   +W   +IE+LN +  LT+KP++YLVN++EKDY R+KNK+L KI  WV  
Sbjct  221  VDEKKHIRYYHDWNDKEIEVLNKYLFLTSKPMIYLVNLSEKDYIRRKNKWLVKIKEWVDS  280

Query  526  HG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  350
            H  G L+IPFS  LE  L D   +E  KYC E+K QSAL KIIK G++A+ L YFFTAGP
Sbjct  281  HDPGALVIPFSGGLESLLQDKSEEERQKYCTEHKTQSALSKIIKAGYAALQLEYFFTAGP  340

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEV+ W IR+ TKAPQAAG IHTD ERGFI AEVMKF+D KE GSE AVKA GKYRQ+G+
Sbjct  341  DEVRAWTIRKGTKAPQAAGKIHTDFERGFIMAEVMKFQDFKEEGSESAVKAAGKYRQQGR  400

Query  169  TYVVQDGDVIFFKFNVSGGGKK  104
             Y+V+DGD+IFFKFN     KK
Sbjct  401  NYIVEDGDIIFFKFNAPNAPKK  422



>gb|KFO14346.1| Obg-like ATPase 1, partial [Balearica regulorum gibbericeps]
Length=362

 Score =   248 bits (633),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 124/202 (61%), Positives = 149/202 (74%), Gaps = 2/202 (1%)
 Frame = -3

Query  703  LDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQE  527
            +DE K  R   +W   +I++LN     T+KP++YLVN++EKDY RKKNK+L KI  WV +
Sbjct  160  IDEKKAVRFYHDWNDKEIDVLNKHLFFTSKPMIYLVNLSEKDYIRKKNKWLIKIKEWVDK  219

Query  526  HG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  350
            H  G L+IPFS ALE  L DM  +E  KY EEN  QSAL KIIK G++A+ L YFFTAGP
Sbjct  220  HDPGALVIPFSGALELKLQDMSAEEKQKYLEENMTQSALAKIIKAGYAALQLEYFFTAGP  279

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+
Sbjct  280  DEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEGGSEAAVKAAGKYRQQGR  339

Query  169  TYVVQDGDVIFFKFNVSGGGKK  104
             YVV+DGD+IFFKFN     KK
Sbjct  340  NYVVEDGDIIFFKFNTPQQPKK  361



>gb|EFN78354.1| Obg-like ATPase 1 [Harpegnathos saltator]
Length=308

 Score =   246 bits (628),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 120/200 (60%), Positives = 147/200 (74%), Gaps = 1/200 (1%)
 Frame = -3

Query  703  LDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEH  524
            ++E K  R  +W A DIE+LN +  LT+KP++YLVN++EKDY RKKNK+L KI  WV ++
Sbjct  104  MEEKKHIRFADWSANDIEVLNKYLFLTSKPIIYLVNLSEKDYIRKKNKWLIKIKEWVDKN  163

Query  523  -GGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPD  347
              G ++IPFS   E  + DM   E AKY EE+KV SAL KII  G+ A+ L YFFTAG D
Sbjct  164  DAGAILIPFSGIFENKVLDMDEAERAKYFEEHKVTSALDKIIVQGYKALQLQYFFTAGHD  223

Query  346  EVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKT  167
            EVK W I++ TKAPQAAG IHTD E+GFI AEVMKF+D K  GSE AVKA GKYRQ+G+ 
Sbjct  224  EVKAWTIQKGTKAPQAAGKIHTDFEKGFIMAEVMKFDDFKNEGSEAAVKAAGKYRQQGRN  283

Query  166  YVVQDGDVIFFKFNVSGGGK  107
            YVV+DGD+IFFKFN   G K
Sbjct  284  YVVEDGDIIFFKFNAGAGLK  303



>ref|XP_006744648.1| PREDICTED: obg-like ATPase 1 isoform X2 [Leptonychotes weddellii]
Length=308

 Score =   246 bits (628),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 150/202 (74%), Gaps = 2/202 (1%)
 Frame = -3

Query  703  LDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQE  527
            +D+ K  R   +W   +IE+LN    LT+KP+VYLVN++EKDY RKKNK+L KI  WV +
Sbjct  106  IDQKKPVRFYHDWNDKEIEVLNKHLFLTSKPMVYLVNLSEKDYIRKKNKWLIKIKEWVDK  165

Query  526  HG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  350
            +  G L+IPFS ALE  L ++  +E  KY E N  QSALPKIIK GF+A+ L YFFTAGP
Sbjct  166  YDPGALVIPFSGALELKLQELSAEERQKYLEANMTQSALPKIIKAGFAALQLEYFFTAGP  225

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+
Sbjct  226  DEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEEGSENAVKAAGKYRQQGR  285

Query  169  TYVVQDGDVIFFKFNVSGGGKK  104
             Y+V+DGD+IFFKFN     KK
Sbjct  286  NYIVEDGDIIFFKFNTPQQPKK  307



>gb|KFW10028.1| Obg-like ATPase 1, partial [Fulmarus glacialis]
Length=362

 Score =   248 bits (633),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 149/202 (74%), Gaps = 2/202 (1%)
 Frame = -3

Query  703  LDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQE  527
            +DE K  R   +W   +I++LN     T+KP++YLVN++EKDY RKKNK+L KI  WV +
Sbjct  160  IDEKKAVRFYHDWNDKEIDVLNKHLFFTSKPMIYLVNLSEKDYVRKKNKWLIKIKEWVDK  219

Query  526  HG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  350
            H  G L+IPFS ALE  L DM  +E  KY EEN  QSAL KIIK G++A+ L YFFTAGP
Sbjct  220  HDPGALVIPFSGALELKLQDMSAEEKQKYLEENMTQSALAKIIKAGYAALQLEYFFTAGP  279

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+
Sbjct  280  DEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEGGSEAAVKAAGKYRQQGR  339

Query  169  TYVVQDGDVIFFKFNVSGGGKK  104
             Y+V+DGD+IFFKFN     KK
Sbjct  340  NYIVEDGDIIFFKFNTPQQPKK  361



>ref|XP_004341541.1| GTP binding protein [Acanthamoeba castellanii str. Neff]
 gb|ELR19455.1| GTP binding protein [Acanthamoeba castellanii str. Neff]
Length=395

 Score =   249 bits (635),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 124/201 (62%), Positives = 146/201 (73%), Gaps = 2/201 (1%)
 Frame = -3

Query  700  DEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWV-QEH  524
            +E K+ R G+W A +IE LN  QL+TAKPVVYLVNM+E DY  KKN++L KI  WV  + 
Sbjct  194  EEKKEVRYGDWNAREIEWLNELQLITAKPVVYLVNMSENDYFNKKNRWLAKIKQWVDSKQ  253

Query  523  GGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDE  344
              +LIIPFS ALE  L +MP ++   Y E +K   A+PKIIK G+SA+ LIYFFT G DE
Sbjct  254  KDQLIIPFSGALESKLLEMPEEDQKAYLEPHKALPAIPKIIKNGYSALRLIYFFTCGADE  313

Query  343  VKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTY  164
            V+CW IR+ TKAPQAAG IHTD   GFICAEVM + D KE GSE AVKA GKYRQEGK Y
Sbjct  314  VRCWTIRQGTKAPQAAGVIHTDFMNGFICAEVMAYADFKEHGSESAVKAAGKYRQEGKNY  373

Query  163  VVQDGDVIFFKFNVSGG-GKK  104
             V DGD++FFK N  GG GKK
Sbjct  374  TVVDGDIMFFKANTGGGLGKK  394



>ref|XP_003695060.1| PREDICTED: GTP-binding protein CG1354-like [Apis florea]
Length=397

 Score =   249 bits (635),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 122/200 (61%), Positives = 146/200 (73%), Gaps = 1/200 (1%)
 Frame = -3

Query  703  LDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEH  524
            +DE +  R  +W A DIE+LN +  LT+KPV+YL+N++EKDY RKKNK+L KI  WV ++
Sbjct  193  VDEKRHIRFADWSATDIEVLNKYLFLTSKPVIYLINLSEKDYVRKKNKWLIKIKEWVDKN  252

Query  523  G-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPD  347
              G ++IPFS   E  L DM   E  KY EENKV SAL KII  G+ A+ L YFFTAG D
Sbjct  253  DPGAILIPFSGVFENKLLDMNEAERGKYLEENKVTSALDKIIVQGYKALQLQYFFTAGHD  312

Query  346  EVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKT  167
            EVK W I+R TKAPQAAG IHTD E+GFI AEVMKF+D K  GSE AVKA GKYRQ+G+ 
Sbjct  313  EVKAWTIQRGTKAPQAAGKIHTDFEKGFIMAEVMKFDDFKNEGSEAAVKAAGKYRQQGRN  372

Query  166  YVVQDGDVIFFKFNVSGGGK  107
            YVV+DGD+IFFKFN   G K
Sbjct  373  YVVEDGDIIFFKFNAGAGLK  392



>ref|XP_008275154.1| PREDICTED: obg-like ATPase 1 [Stegastes partitus]
Length=395

 Score =   249 bits (635),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 147/202 (73%), Gaps = 2/202 (1%)
 Frame = -3

Query  703  LDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQE  527
            +DE K  R   +W   +IE+LN +  LT+KP++YLVN++EKDY RKKNK+L KI  WV  
Sbjct  193  VDEKKHVRFYNDWNDKEIEVLNKYLFLTSKPMIYLVNLSEKDYIRKKNKWLAKIKEWVDA  252

Query  526  HG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  350
            H  G L+IP S ALE  L DM  +E  KYCEE K QS L KIIKTG++A+ L YFFTAGP
Sbjct  253  HDPGALVIPLSGALESKLFDMEEEERNKYCEELKTQSVLTKIIKTGYAALQLEYFFTAGP  312

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEV+ W IR+  KAPQAAG IHTD E+GFI AEVMK+ D KE GSE A KA GKYRQ+G+
Sbjct  313  DEVRAWTIRKGAKAPQAAGKIHTDFEKGFIMAEVMKYSDFKEEGSESAAKAAGKYRQQGR  372

Query  169  TYVVQDGDVIFFKFNVSGGGKK  104
             YVV+DGD+IFFKFN     KK
Sbjct  373  NYVVEDGDIIFFKFNTPNAPKK  394



>ref|XP_003442972.1| PREDICTED: obg-like ATPase 1-like [Oreochromis niloticus]
 ref|XP_004540365.1| PREDICTED: obg-like ATPase 1-like isoform X1 [Maylandia zebra]
 ref|XP_004540366.1| PREDICTED: obg-like ATPase 1-like isoform X2 [Maylandia zebra]
Length=395

 Score =   249 bits (635),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 122/202 (60%), Positives = 148/202 (73%), Gaps = 2/202 (1%)
 Frame = -3

Query  703  LDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQE  527
            ++E K  R   +W   +IE+LN +  LT+KP++YLVN++EKDY RKKNK+L KI  WV  
Sbjct  193  VEEKKHIRFYHDWNDKEIEVLNKYLFLTSKPMIYLVNLSEKDYIRKKNKWLAKIKEWVDA  252

Query  526  HG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  350
            H  G ++IP S ALE  L DM  +E  KYCEE K QS L KIIKTG++A+ L YFFTAGP
Sbjct  253  HDPGAMVIPLSGALEFKLQDMEEEERNKYCEEQKTQSVLTKIIKTGYAALQLEYFFTAGP  312

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMKF D KE GSE A KA GKYRQ+G+
Sbjct  313  DEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKFTDFKEEGSETAAKAAGKYRQQGR  372

Query  169  TYVVQDGDVIFFKFNVSGGGKK  104
             Y+V+DGD+IFFKFN     KK
Sbjct  373  NYIVEDGDIIFFKFNTPNAPKK  394



>ref|XP_006788528.1| PREDICTED: obg-like ATPase 1-like [Neolamprologus brichardi]
Length=398

 Score =   249 bits (635),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 122/202 (60%), Positives = 149/202 (74%), Gaps = 2/202 (1%)
 Frame = -3

Query  703  LDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQE  527
            +DE K  R   +W   +IE+LN +  LT+KP++YLVN++EKDY R+KNK+L KI  WV  
Sbjct  196  VDEKKHIRYYHDWNDKEIEVLNKYLFLTSKPMIYLVNLSEKDYIRRKNKWLVKIKEWVDS  255

Query  526  HG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  350
            H  G L+IPFS  LE  L D   +E  KYC E+K QSA+ KIIK G++A+ L YFFTAGP
Sbjct  256  HDPGALVIPFSGGLESLLQDKSEEERQKYCTEHKTQSAVSKIIKAGYAALQLEYFFTAGP  315

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEV+ W IR+ TKAPQAAG IHTD ERGFI AEVMKF+D KE GSE AVKA GKYRQ+G+
Sbjct  316  DEVRAWTIRKGTKAPQAAGKIHTDFERGFIMAEVMKFQDFKEEGSESAVKAAGKYRQQGR  375

Query  169  TYVVQDGDVIFFKFNVSGGGKK  104
             Y+V+DGD+IFFKFN     KK
Sbjct  376  NYIVEDGDIIFFKFNAPNAPKK  397



>gb|KFP41102.1| Obg-like ATPase 1, partial [Chlamydotis macqueenii]
Length=362

 Score =   248 bits (632),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 149/202 (74%), Gaps = 2/202 (1%)
 Frame = -3

Query  703  LDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQE  527
            +DE K  R   +W   +I++LN     T+KP++YLVN++EKDY RKKNK+L KI  WV +
Sbjct  160  IDEKKAVRFYHDWNDKEIDVLNKHLFFTSKPMIYLVNLSEKDYIRKKNKWLIKIKEWVDK  219

Query  526  HG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  350
            H  G L+IPFS ALE  L DM  +E  KY EEN  QSAL KIIK G++A+ L YFFTAGP
Sbjct  220  HDPGALVIPFSGALELKLQDMSAEEKQKYLEENMTQSALAKIIKAGYAALQLEYFFTAGP  279

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+
Sbjct  280  DEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEGGSEAAVKAAGKYRQQGR  339

Query  169  TYVVQDGDVIFFKFNVSGGGKK  104
             Y+V+DGD+IFFKFN     KK
Sbjct  340  NYIVEDGDIIFFKFNTPQQPKK  361



>gb|KFM07037.1| Obg-like ATPase 1, partial [Aptenodytes forsteri]
 gb|KFQ51755.1| Obg-like ATPase 1, partial [Nestor notabilis]
 gb|KFV50449.1| Obg-like ATPase 1, partial [Gavia stellata]
Length=362

 Score =   248 bits (632),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 149/202 (74%), Gaps = 2/202 (1%)
 Frame = -3

Query  703  LDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQE  527
            +DE K  R   +W   +I++LN     T+KP++YLVN++EKDY RKKNK+L KI  WV +
Sbjct  160  IDEKKAVRFYHDWNDKEIDVLNKHLFFTSKPMIYLVNLSEKDYIRKKNKWLIKIKEWVDK  219

Query  526  HG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  350
            H  G L+IPFS ALE  L DM  +E  KY EEN  QSAL KIIK G++A+ L YFFTAGP
Sbjct  220  HDPGALVIPFSGALELKLQDMSAEEKQKYLEENMTQSALAKIIKAGYAALQLEYFFTAGP  279

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+
Sbjct  280  DEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEGGSEAAVKAAGKYRQQGR  339

Query  169  TYVVQDGDVIFFKFNVSGGGKK  104
             Y+V+DGD+IFFKFN     KK
Sbjct  340  NYIVEDGDIIFFKFNTPQQPKK  361



>ref|XP_006636567.1| PREDICTED: obg-like ATPase 1-like isoform X2 [Lepisosteus oculatus]
Length=348

 Score =   247 bits (631),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 122/201 (61%), Positives = 148/201 (74%), Gaps = 2/201 (1%)
 Frame = -3

Query  700  DEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEH  524
            DE K  R   EW   +IE+LN +  LT+KP++YLVN++EKDY RKKNK+L KI  WV  H
Sbjct  147  DEKKHVRYCHEWNDKEIEVLNKYLFLTSKPMIYLVNLSEKDYIRKKNKWLVKIKEWVDSH  206

Query  523  G-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPD  347
              G ++IPFS  LE  L DM  +E  KY EE+K QS L KIIK+G++A+ L YFFTAGPD
Sbjct  207  DPGAMVIPFSGGLELKLQDMSDEEKEKYTEEHKTQSVLTKIIKSGYAALQLEYFFTAGPD  266

Query  346  EVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKT  167
            EV+ W IR+ TKAPQAAG IH+D E+GFI AEVMKF+D KE GSE AVKA GKYRQ+G+ 
Sbjct  267  EVRAWTIRKGTKAPQAAGKIHSDFEKGFIMAEVMKFQDFKEEGSESAVKAAGKYRQQGRN  326

Query  166  YVVQDGDVIFFKFNVSGGGKK  104
            Y V+DGD+IFFKFN     KK
Sbjct  327  YTVEDGDIIFFKFNTPNQPKK  347



>gb|KFV08740.1| Obg-like ATPase 1, partial [Pterocles gutturalis]
Length=362

 Score =   247 bits (631),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 149/202 (74%), Gaps = 2/202 (1%)
 Frame = -3

Query  703  LDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQE  527
            +DE K  R   +W   +I++LN     T+KP++YLVN++EKDY RKKNK+L KI  WV +
Sbjct  160  IDEKKAVRFYHDWNDKEIDVLNKHLFFTSKPMIYLVNLSEKDYIRKKNKWLIKIKEWVDK  219

Query  526  HG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  350
            H  G L+IPFS ALE  L DM  +E  KY EEN  QSAL KIIK G++A+ L YFFTAGP
Sbjct  220  HDPGALVIPFSGALELKLQDMSAEEKQKYLEENMTQSALAKIIKAGYAALQLEYFFTAGP  279

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+
Sbjct  280  DEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEGGSEAAVKAAGKYRQQGR  339

Query  169  TYVVQDGDVIFFKFNVSGGGKK  104
             Y+V+DGD+IFFKFN     KK
Sbjct  340  NYIVEDGDIIFFKFNTPQQPKK  361



>ref|XP_005723778.1| PREDICTED: obg-like ATPase 1-like [Pundamilia nyererei]
 ref|XP_005934395.1| PREDICTED: obg-like ATPase 1-like [Haplochromis burtoni]
Length=395

 Score =   248 bits (634),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 119/191 (62%), Positives = 143/191 (75%), Gaps = 1/191 (1%)
 Frame = -3

Query  673  EWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFS  497
            +W   +IE+LN +  LT+KP++YLVN++EKDY RKKNK+L KI  WV  H  G ++IP S
Sbjct  204  DWNDKEIEVLNKYLFLTSKPMIYLVNLSEKDYIRKKNKWLAKIKEWVDAHDPGAMVIPLS  263

Query  496  AALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQ  317
             ALE  L DM  +E  KYCEE K QS L KIIKTG++A+ L YFFTAGPDEV+ W IR+ 
Sbjct  264  GALEFKLQDMEEEERNKYCEEQKTQSVLTKIIKTGYAALQLEYFFTAGPDEVRAWTIRKG  323

Query  316  TKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIF  137
            TKAPQAAG IHTD E+GFI AEVMKF D KE GSE A KA GKYRQ+G+ Y+V+DGD+IF
Sbjct  324  TKAPQAAGKIHTDFEKGFIMAEVMKFTDFKEEGSETAAKAAGKYRQQGRNYIVEDGDIIF  383

Query  136  FKFNVSGGGKK  104
            FKFN     KK
Sbjct  384  FKFNTPNAPKK  394



>gb|AGG11697.1| hypothetical protein, partial [Leptomonas pyrrhocoris]
Length=392

 Score =   248 bits (633),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 114/204 (56%), Positives = 150/204 (74%), Gaps = 0/204 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            VK  L+EGK  R  +W   +++ILNT QLLTAKP ++LVNM+E D+ R++NK+L K+  W
Sbjct  189  VKEVLEEGKQIRCCQWNGKEVDILNTLQLLTAKPAMFLVNMSENDFLRQRNKWLKKLKDW  248

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            + EH GE +IPFSA LE +   M  +E  K+CEE K +S + KII T ++ INLI++FTA
Sbjct  249  IDEHTGEPMIPFSAELESNFVSMSQEEVDKFCEEKKTKSQIHKIINTAYNCINLIHYFTA  308

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  176
            G DEVKCW I+R TKAPQAAG IH+D+E+GFICAEV+++ D   L SE A +  GK  Q+
Sbjct  309  GSDEVKCWTIQRGTKAPQAAGKIHSDMEKGFICAEVIEWADFDRLESESACRDEGKQHQQ  368

Query  175  GKTYVVQDGDVIFFKFNVSGGGKK  104
            G+ Y VQDGD+IFFKFN + GGKK
Sbjct  369  GRNYEVQDGDIIFFKFNAAKGGKK  392



>ref|XP_006003588.1| PREDICTED: obg-like ATPase 1 isoform X2 [Latimeria chalumnae]
 ref|XP_006003589.1| PREDICTED: obg-like ATPase 1 isoform X3 [Latimeria chalumnae]
 ref|XP_006003590.1| PREDICTED: obg-like ATPase 1 isoform X4 [Latimeria chalumnae]
Length=396

 Score =   248 bits (633),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 125/201 (62%), Positives = 149/201 (74%), Gaps = 2/201 (1%)
 Frame = -3

Query  700  DEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEH  524
            DE K  R   +W   +IE+LN    LT+KP++YLVN++EKDY RKKNK+L KI  WV +H
Sbjct  195  DEKKHVRYYHDWNDKEIEVLNKHLFLTSKPMIYLVNLSEKDYIRKKNKWLIKIKEWVDKH  254

Query  523  G-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPD  347
              G L+IPFS ALE  L DM  +E  KY EE K QSAL KIIK G++A+ L YFFTAGPD
Sbjct  255  DPGALVIPFSGALELKLQDMSDEEKQKYLEEYKTQSALSKIIKAGYAALQLEYFFTAGPD  314

Query  346  EVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKT  167
            EV+ W I++ TKAPQAAG IHTD E+GFI AEVMKFED KE GSE AVKA GKYRQ+G+ 
Sbjct  315  EVRAWTIKKGTKAPQAAGKIHTDFEKGFIMAEVMKFEDFKEGGSEAAVKAAGKYRQQGRN  374

Query  166  YVVQDGDVIFFKFNVSGGGKK  104
            Y+V+DGD+IFFKFN     KK
Sbjct  375  YIVEDGDIIFFKFNTPQQSKK  395



>ref|XP_005798398.1| PREDICTED: obg-like ATPase 1-like [Xiphophorus maculatus]
Length=395

 Score =   248 bits (633),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/202 (59%), Positives = 148/202 (73%), Gaps = 2/202 (1%)
 Frame = -3

Query  703  LDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQE  527
            ++E K  R   EW   +IE+LN +  LT+KP++YLVN++EKDY RKKNK+L KI  WV  
Sbjct  193  VEEKKHVRFYHEWNDKEIEVLNKYLFLTSKPMIYLVNLSEKDYIRKKNKWLAKIKEWVDA  252

Query  526  HG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  350
            H  G ++IP S A+E  L +M  +E+ KYCEE K QS L KIIKTG++ + L YFFTAGP
Sbjct  253  HDPGAMVIPLSGAVEAKLQEMEEEESTKYCEEQKTQSVLTKIIKTGYAGLQLEYFFTAGP  312

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMKF D KE GSE A KA GKYRQ+G+
Sbjct  313  DEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKFNDFKEEGSESAAKAAGKYRQQGR  372

Query  169  TYVVQDGDVIFFKFNVSGGGKK  104
             Y+V+DGD+IFFKFN     KK
Sbjct  373  NYIVEDGDIIFFKFNTPNAPKK  394



>ref|XP_005723547.1| PREDICTED: obg-like ATPase 1-like isoform X4 [Pundamilia nyererei]
 ref|XP_005921549.1| PREDICTED: obg-like ATPase 1-like isoform X3 [Haplochromis burtoni]
Length=348

 Score =   246 bits (629),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 122/202 (60%), Positives = 148/202 (73%), Gaps = 2/202 (1%)
 Frame = -3

Query  703  LDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQE  527
            +DE K  R   +W   +IE+LN +  LT+KP++YLVN++EKDY R+KNK+L KI  WV  
Sbjct  146  VDEKKHIRYYHDWNDKEIEVLNKYLFLTSKPMIYLVNLSEKDYIRRKNKWLVKIKEWVDS  205

Query  526  HG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  350
            H  G L+IPFS  LE  L D   +E  KY  E+K QSAL KIIK G++A+ L YFFTAGP
Sbjct  206  HDPGALVIPFSGGLESLLQDKSEEERQKYSTEHKTQSALSKIIKAGYAALQLEYFFTAGP  265

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEV+ W IR+ TKAPQAAG IHTD ERGFI AEVMKF+D KE GSE AVKA GKYRQ+G+
Sbjct  266  DEVRAWTIRKGTKAPQAAGKIHTDFERGFIMAEVMKFQDFKEEGSESAVKAAGKYRQQGR  325

Query  169  TYVVQDGDVIFFKFNVSGGGKK  104
             Y+V+DGD+IFFKFN     KK
Sbjct  326  NYIVEDGDIIFFKFNAPNAPKK  347



>gb|KFW86891.1| Obg-like ATPase 1, partial [Manacus vitellinus]
Length=370

 Score =   247 bits (631),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 149/202 (74%), Gaps = 2/202 (1%)
 Frame = -3

Query  703  LDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQE  527
            +DE K  R   +W   +I++LN     T+KP++YLVN++EKDY RKKNK+L KI  WV +
Sbjct  168  IDEKKAVRFYHDWNDKEIDVLNKHLFFTSKPMIYLVNLSEKDYIRKKNKWLIKIKEWVDK  227

Query  526  HG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  350
            H  G L+IPFS ALE  L DM  +E  KY EEN  QSAL KIIK G++A+ L YFFTAGP
Sbjct  228  HDPGALVIPFSGALELKLQDMSAEEKQKYLEENMTQSALAKIIKAGYAALQLEYFFTAGP  287

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+
Sbjct  288  DEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEGGSEAAVKAAGKYRQQGR  347

Query  169  TYVVQDGDVIFFKFNVSGGGKK  104
             Y+V+DGD+IFFKFN     KK
Sbjct  348  NYIVEDGDIIFFKFNTPQQPKK  369



>ref|XP_008116320.1| PREDICTED: obg-like ATPase 1 isoform X2 [Anolis carolinensis]
Length=395

 Score =   248 bits (633),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 118/191 (62%), Positives = 147/191 (77%), Gaps = 1/191 (1%)
 Frame = -3

Query  673  EWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFS  497
            +W   +I++LN +  LT+KP++YLVN++EKDY RKKN++L KI  WV +H  G L+IPFS
Sbjct  204  DWNDKEIDVLNKYLFLTSKPMIYLVNLSEKDYIRKKNRWLIKIKEWVDKHDPGALVIPFS  263

Query  496  AALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQ  317
             ALE  L +M  +E  KY EEN  QSALPKIIK G++A+ L YFFTAGPDEV+ W IR+ 
Sbjct  264  GALELKLQEMSAEEKQKYLEENMTQSALPKIIKAGYAALQLEYFFTAGPDEVRAWTIRKG  323

Query  316  TKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIF  137
            TKAPQAAG IH+D E+GFI AEVMKFED KE G+E AVKA GKYRQ+G+ Y+V+DGD+IF
Sbjct  324  TKAPQAAGKIHSDFEKGFIMAEVMKFEDFKEGGTEAAVKAAGKYRQQGRNYIVEDGDIIF  383

Query  136  FKFNVSGGGKK  104
            FKFN     KK
Sbjct  384  FKFNTPQQPKK  394



>ref|XP_005799467.1| PREDICTED: obg-like ATPase 1-like [Xiphophorus maculatus]
Length=409

 Score =   248 bits (634),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 121/202 (60%), Positives = 148/202 (73%), Gaps = 2/202 (1%)
 Frame = -3

Query  703  LDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQE  527
            +DE K  R   +W   +I++LN +  LT+KP++YLVN++EKDY R+KNK+L KI  WV  
Sbjct  207  MDEKKHVRYYHDWNDKEIDVLNKYLFLTSKPMIYLVNLSEKDYIRRKNKWLVKIKEWVDS  266

Query  526  HG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  350
            H  G L+IPFS  LE  L DM  +E  K C+E+K QSAL KIIK G++A+ L YFFT GP
Sbjct  267  HDPGALVIPFSGNLESRLQDMSEEERQKCCKEHKTQSALSKIIKAGYAALQLEYFFTTGP  326

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEV+ W IR+ TKAPQAAG IHTD ERGFI AEVMKF+D KE GSE AVKA GKYRQ+G+
Sbjct  327  DEVRAWTIRKGTKAPQAAGKIHTDFERGFIMAEVMKFQDFKEEGSESAVKAAGKYRQQGR  386

Query  169  TYVVQDGDVIFFKFNVSGGGKK  104
             Y V+DGD+IFFKFN     KK
Sbjct  387  NYTVEDGDIIFFKFNAPNAPKK  408



>gb|ETN73871.1| GTP-binding protein YchF [Necator americanus]
Length=396

 Score =   248 bits (633),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 126/209 (60%), Positives = 150/209 (72%), Gaps = 5/209 (2%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            VK  L+E K  RL  W   +IE+LN    LTAKP+VYLVN++EKDY RKKNK+LPKI  W
Sbjct  188  VKKDLEEKKPVRLDTWNEKEIEVLNKHLFLTAKPIVYLVNLSEKDYIRKKNKWLPKIKEW  247

Query  535  V-QEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFT  359
            + +E  G  +IPFS A E  L DMP DE  K+C+EN+  S L KII TG+ A+ L YFFT
Sbjct  248  IDKEDPGASLIPFSGAFENKLLDMPEDEREKFCKENQTSSNLDKIIHTGYKALQLEYFFT  307

Query  358  AGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQ  179
            AG DEVK W I++ T AP+AAG IHTD E+GFI AEVMK  DL ELG E  VKA GKYRQ
Sbjct  308  AGKDEVKAWTIQKGTLAPKAAGRIHTDFEKGFIMAEVMKVADLMELGEENKVKAAGKYRQ  367

Query  178  EGKTYVVQDGDVIFFKFN----VSGGGKK  104
            +GKTYVV+DGD+I FKFN    ++GG KK
Sbjct  368  QGKTYVVEDGDIILFKFNAGAGLTGGKKK  396



>ref|XP_004557802.1| PREDICTED: obg-like ATPase 1-like isoform X2 [Maylandia zebra]
Length=350

 Score =   246 bits (629),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 122/202 (60%), Positives = 148/202 (73%), Gaps = 2/202 (1%)
 Frame = -3

Query  703  LDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQE  527
            +DE K  R   +W   +IE+LN +  LT+KP++YLVN++EKDY R+KNK+L KI  WV  
Sbjct  148  VDEKKHIRYYHDWNDKEIEVLNKYLFLTSKPMIYLVNLSEKDYIRRKNKWLVKIKEWVDS  207

Query  526  HG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  350
            H  G L+IPFS  LE  L D   +E  KY  E+K QSAL KIIK G++A+ L YFFTAGP
Sbjct  208  HDPGALVIPFSGGLESLLQDKSEEERQKYSTEHKTQSALSKIIKAGYAALQLEYFFTAGP  267

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEV+ W IR+ TKAPQAAG IHTD ERGFI AEVMKF+D KE GSE AVKA GKYRQ+G+
Sbjct  268  DEVRAWTIRKGTKAPQAAGKIHTDFERGFIMAEVMKFQDFKEEGSESAVKAAGKYRQQGR  327

Query  169  TYVVQDGDVIFFKFNVSGGGKK  104
             Y+V+DGD+IFFKFN     KK
Sbjct  328  NYIVEDGDIIFFKFNAPNAPKK  349



>gb|EYC24730.1| hypothetical protein Y032_0013g2079 [Ancylostoma ceylanicum]
Length=396

 Score =   248 bits (633),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 125/209 (60%), Positives = 150/209 (72%), Gaps = 5/209 (2%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            VK  LDE K  RL  W   +IE+LN    LTAKP+VYLVN++EKDY RKKNK+LPKI  W
Sbjct  188  VKKDLDEKKPIRLDTWNEKEIEVLNKHLFLTAKPIVYLVNLSEKDYIRKKNKWLPKIKEW  247

Query  535  VQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFT  359
            + ++  G ++IPFS   E  L DMP DE  K+C+EN+  S L KI+ TG+ A+ L YFFT
Sbjct  248  IDKNDPGAVLIPFSGVFENKLIDMPEDEREKFCKENQTSSNLDKIVHTGYKALQLEYFFT  307

Query  358  AGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQ  179
            AG DEVK W I++ T AP+AAG IHTD E+GFI AEVMK  DL ELG E  VKA GKYRQ
Sbjct  308  AGKDEVKAWTIQKGTLAPKAAGRIHTDFEKGFIMAEVMKVADLMELGEENKVKAAGKYRQ  367

Query  178  EGKTYVVQDGDVIFFKFN----VSGGGKK  104
            +GKTYVV+DGDVI FKFN    ++GG KK
Sbjct  368  QGKTYVVEDGDVILFKFNAGAGLTGGKKK  396



>ref|XP_005723546.1| PREDICTED: obg-like ATPase 1-like isoform X3 [Pundamilia nyererei]
Length=350

 Score =   246 bits (629),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 122/202 (60%), Positives = 148/202 (73%), Gaps = 2/202 (1%)
 Frame = -3

Query  703  LDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQE  527
            +DE K  R   +W   +IE+LN +  LT+KP++YLVN++EKDY R+KNK+L KI  WV  
Sbjct  148  VDEKKHIRYYHDWNDKEIEVLNKYLFLTSKPMIYLVNLSEKDYIRRKNKWLVKIKEWVDS  207

Query  526  HG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  350
            H  G L+IPFS  LE  L D   +E  KY  E+K QSAL KIIK G++A+ L YFFTAGP
Sbjct  208  HDPGALVIPFSGGLESLLQDKSEEERQKYSTEHKTQSALSKIIKAGYAALQLEYFFTAGP  267

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEV+ W IR+ TKAPQAAG IHTD ERGFI AEVMKF+D KE GSE AVKA GKYRQ+G+
Sbjct  268  DEVRAWTIRKGTKAPQAAGKIHTDFERGFIMAEVMKFQDFKEEGSESAVKAAGKYRQQGR  327

Query  169  TYVVQDGDVIFFKFNVSGGGKK  104
             Y+V+DGD+IFFKFN     KK
Sbjct  328  NYIVEDGDIIFFKFNAPNAPKK  349



>ref|XP_006798459.1| PREDICTED: obg-like ATPase 1-like [Neolamprologus brichardi]
Length=395

 Score =   248 bits (633),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 122/202 (60%), Positives = 148/202 (73%), Gaps = 2/202 (1%)
 Frame = -3

Query  703  LDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQE  527
            ++E K  R   +W   +IE+LN +  LT+KP++YLVN++EKDY RKKNK+L KI  WV  
Sbjct  193  VEEKKHIRFYHDWNDKEIEVLNKYLFLTSKPMLYLVNLSEKDYIRKKNKWLAKIKEWVDA  252

Query  526  HG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  350
            H  G ++IP S ALE  L DM  +E  KYCEE K QS L KIIKTG++A+ L YFFTAGP
Sbjct  253  HDPGAMVIPLSGALEFKLQDMEEEERNKYCEEQKTQSVLTKIIKTGYAALQLEYFFTAGP  312

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMKF D KE GSE A KA GKYRQ+G+
Sbjct  313  DEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKFTDFKEEGSETAAKAAGKYRQQGR  372

Query  169  TYVVQDGDVIFFKFNVSGGGKK  104
             Y+V+DGD+IFFKFN     KK
Sbjct  373  NYIVEDGDIIFFKFNTPNAPKK  394



>ref|XP_006003587.1| PREDICTED: obg-like ATPase 1 isoform X1 [Latimeria chalumnae]
Length=401

 Score =   248 bits (633),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 125/201 (62%), Positives = 149/201 (74%), Gaps = 2/201 (1%)
 Frame = -3

Query  700  DEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEH  524
            DE K  R   +W   +IE+LN    LT+KP++YLVN++EKDY RKKNK+L KI  WV +H
Sbjct  200  DEKKHVRYYHDWNDKEIEVLNKHLFLTSKPMIYLVNLSEKDYIRKKNKWLIKIKEWVDKH  259

Query  523  G-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPD  347
              G L+IPFS ALE  L DM  +E  KY EE K QSAL KIIK G++A+ L YFFTAGPD
Sbjct  260  DPGALVIPFSGALELKLQDMSDEEKQKYLEEYKTQSALSKIIKAGYAALQLEYFFTAGPD  319

Query  346  EVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKT  167
            EV+ W I++ TKAPQAAG IHTD E+GFI AEVMKFED KE GSE AVKA GKYRQ+G+ 
Sbjct  320  EVRAWTIKKGTKAPQAAGKIHTDFEKGFIMAEVMKFEDFKEGGSEAAVKAAGKYRQQGRN  379

Query  166  YVVQDGDVIFFKFNVSGGGKK  104
            Y+V+DGD+IFFKFN     KK
Sbjct  380  YIVEDGDIIFFKFNTPQQSKK  400



>emb|CDQ57167.1| unnamed protein product [Oncorhynchus mykiss]
Length=399

 Score =   248 bits (633),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 121/195 (62%), Positives = 146/195 (75%), Gaps = 2/195 (1%)
 Frame = -3

Query  700  DEGKDAR-LGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEH  524
            DE K  R   +W   +IE+LN +  LT+KP++YL+N++EKDY R+KNK+L KI  WV  H
Sbjct  197  DEKKHVRYCRDWTEKEIEVLNKYLFLTSKPMIYLINLSEKDYIRRKNKWLVKIKEWVDSH  256

Query  523  G-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPD  347
              G L+IPFS  +E  L DM  +E  KYC E+K QS L +IIK G+ A+ L YFFTAGPD
Sbjct  257  DPGALVIPFSGGVESLLQDMSEEEIQKYCTEHKAQSVLTRIIKAGYGALQLEYFFTAGPD  316

Query  346  EVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKT  167
            EV+ W IR+ TKAPQAAG IHTD E+GFI AEVMKFED KE GSE AVKA GKYRQ+GKT
Sbjct  317  EVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKFEDFKEGGSENAVKAAGKYRQQGKT  376

Query  166  YVVQDGDVIFFKFNV  122
            Y+V+DGDVIFFKFN 
Sbjct  377  YIVEDGDVIFFKFNT  391



>ref|XP_007576845.1| PREDICTED: obg-like ATPase 1 [Poecilia formosa]
Length=395

 Score =   248 bits (632),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 121/202 (60%), Positives = 147/202 (73%), Gaps = 2/202 (1%)
 Frame = -3

Query  703  LDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQE  527
            ++E K  R   EW   +IE+LN +  LT+KP++YLVN++EKDY RKKNK+L KI  WV  
Sbjct  193  VEEKKHVRFYHEWNDKEIEVLNKYLFLTSKPMIYLVNLSEKDYIRKKNKWLAKIKEWVDA  252

Query  526  HG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  350
            H  G ++IP S A+E  L +M  +E  KYCEE K QS L KIIKTG++ + L YFFTAGP
Sbjct  253  HDPGAMVIPLSGAVEAKLQEMEEEERTKYCEEQKTQSVLTKIIKTGYAGLQLEYFFTAGP  312

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMKF D KE GSE A KA GKYRQ+G+
Sbjct  313  DEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKFNDFKEEGSESAAKAAGKYRQQGR  372

Query  169  TYVVQDGDVIFFKFNVSGGGKK  104
             YVV+DGD+IFFKFN     KK
Sbjct  373  NYVVEDGDIIFFKFNTPNAPKK  394



>gb|EDL27121.1| RIKEN cDNA 2810409H07, isoform CRA_a [Mus musculus]
 gb|EDL27122.1| RIKEN cDNA 2810409H07, isoform CRA_a [Mus musculus]
Length=309

 Score =   245 bits (625),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 122/202 (60%), Positives = 150/202 (74%), Gaps = 2/202 (1%)
 Frame = -3

Query  703  LDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQE  527
            +D+ K  R   +W   +IE+LN    LT+KP+VYLVN++EKDY RKKNK+L KI  WV +
Sbjct  107  IDQKKPVRFYHDWNDKEIEVLNKHLFLTSKPMVYLVNLSEKDYIRKKNKWLIKIKEWVDK  166

Query  526  HG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  350
            +  G L+IPFS ALE  L ++  +E  KY E N  QSALPKIIK GF+A+ L YFFTAGP
Sbjct  167  YDPGALVIPFSGALELKLQELSAEERQKYLEANMTQSALPKIIKAGFAALQLEYFFTAGP  226

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED K+ GSE AVKA GKYRQ+G+
Sbjct  227  DEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKDEGSENAVKAAGKYRQQGR  286

Query  169  TYVVQDGDVIFFKFNVSGGGKK  104
             Y+V+DGD+IFFKFN     KK
Sbjct  287  NYIVEDGDIIFFKFNTPQQPKK  308



>ref|XP_005237197.1| PREDICTED: obg-like ATPase 1 [Falco peregrinus]
Length=395

 Score =   248 bits (632),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 149/202 (74%), Gaps = 2/202 (1%)
 Frame = -3

Query  703  LDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQE  527
            +DE K  R   +W   +I++LN     T+KP++YLVN++EKDY RKKNK+L KI  WV +
Sbjct  193  IDEKKAVRFYHDWNDKEIDVLNKHLFFTSKPMIYLVNLSEKDYIRKKNKWLIKIKEWVDK  252

Query  526  HG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  350
            H  G L+IPFS ALE  L DM  +E  KY EEN  QSAL KIIK G++A+ L YFFTAGP
Sbjct  253  HDPGALVIPFSGALELKLQDMSAEEKQKYLEENMTQSALAKIIKAGYAALQLEYFFTAGP  312

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+
Sbjct  313  DEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEGGSEAAVKAAGKYRQQGR  372

Query  169  TYVVQDGDVIFFKFNVSGGGKK  104
             Y+V+DGD+IFFKFN     KK
Sbjct  373  NYIVEDGDIIFFKFNTPQQPKK  394



>ref|XP_005452971.1| PREDICTED: obg-like ATPase 1-like isoform X2 [Oreochromis niloticus]
Length=471

 Score =   250 bits (638),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 149/202 (74%), Gaps = 2/202 (1%)
 Frame = -3

Query  703  LDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQE  527
            +DE K  R   +W   +IE+LN +  LT+KP++YLVN++EKDY R+KNK+L KI  WV  
Sbjct  269  VDEKKHIRYYHDWNDKEIEVLNKYLFLTSKPMIYLVNLSEKDYIRRKNKWLVKIKEWVDS  328

Query  526  HG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  350
            H  G L+IPFS  LE  L D   +E  KYC E+K QSAL KIIK G++A+ L YFFTAGP
Sbjct  329  HDPGALVIPFSGGLESLLQDKSEEERQKYCTEHKTQSALSKIIKAGYAALQLEYFFTAGP  388

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEV+ W IR+ TKAPQAAG IHTD ERGFI AEVMKF+D KE GSE AVKA GKYRQ+G+
Sbjct  389  DEVRAWTIRKGTKAPQAAGKIHTDFERGFIMAEVMKFQDFKEEGSESAVKAAGKYRQQGR  448

Query  169  TYVVQDGDVIFFKFNVSGGGKK  104
             Y+V+DGD+IFFKFN     KK
Sbjct  449  NYIVEDGDIIFFKFNAPNAPKK  470



>ref|XP_396711.3| PREDICTED: obg-like ATPase 1-like isoformX1 [Apis mellifera]
 ref|XP_006557926.1| PREDICTED: obg-like ATPase 1-like isoform X2 [Apis mellifera]
Length=397

 Score =   248 bits (632),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 122/200 (61%), Positives = 146/200 (73%), Gaps = 1/200 (1%)
 Frame = -3

Query  703  LDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEH  524
            +DE +  R  +W A DIE+LN +  LT+KPV+YL+N++EKDY RKKNK+L KI  WV ++
Sbjct  193  VDEKRHIRFADWSATDIEVLNKYLFLTSKPVIYLINLSEKDYVRKKNKWLIKIKEWVDKN  252

Query  523  G-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPD  347
              G ++IPFS A E  L DM   E  KY EE KV SAL KII  G+ A+ L YFFTAG D
Sbjct  253  DPGAILIPFSGAFENKLLDMNEAERGKYLEEGKVTSALDKIIVQGYKALQLQYFFTAGHD  312

Query  346  EVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKT  167
            EVK W I+R TKAPQAAG IHTD E+GFI AEVMKF+D K  GSE AVKA GKYRQ+G+ 
Sbjct  313  EVKAWTIQRGTKAPQAAGKIHTDFEKGFIMAEVMKFDDFKNEGSEAAVKAAGKYRQQGRN  372

Query  166  YVVQDGDVIFFKFNVSGGGK  107
            YVV+DGD+IFFKFN   G K
Sbjct  373  YVVEDGDIIFFKFNAGAGLK  392



>emb|CDJ43406.1| GTP binding protein, putative [Eimeria tenella]
Length=372

 Score =   247 bits (630),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 152/202 (75%), Gaps = 2/202 (1%)
 Frame = -3

Query  703  LDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEH  524
            L + K  + G WKAA++E+LN +Q LTAK VVYLVNM+EKD+ R+KNK+L KIH WVQE+
Sbjct  171  LQDNKWVQQGNWKAAEVEVLNEYQFLTAKTVVYLVNMSEKDFIRQKNKWLAKIHNWVQEN  230

Query  523  GGELIIPFSAALERSLADMPPDEAAK-YCEENKV-QSALPKIIKTGFSAINLIYFFTAGP  350
                IIP+SA  E  LA+M  +E  + Y + +   +S + KII+TG+ A++LI+FFT G 
Sbjct  231  VQGPIIPYSAVFENKLAEMASEEERQNYIKSSGASKSMIDKIIQTGYHALHLIHFFTCGE  290

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEVKCW IR  TKAPQAAG IHTD ERGFICAEV K+ DL ELGSE AVKA GKY Q+GK
Sbjct  291  DEVKCWTIRAGTKAPQAAGVIHTDFERGFICAEVYKYTDLVELGSENAVKAAGKYLQKGK  350

Query  169  TYVVQDGDVIFFKFNVSGGGKK  104
             YVV+DGD+IFFKFNV+   KK
Sbjct  351  DYVVEDGDIIFFKFNVTNSAKK  372



>ref|NP_001268915.1| obg-like ATPase 1 isoform 2 [Danio rerio]
Length=348

 Score =   246 bits (628),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 122/202 (60%), Positives = 145/202 (72%), Gaps = 2/202 (1%)
 Frame = -3

Query  703  LDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQE  527
            +DE K  R   EW   +IE+LN    LT+KP++YLVN++EKDY RKKNK+L KI  WV  
Sbjct  146  VDEKKHVRYYHEWNDKEIEVLNKHLFLTSKPMIYLVNLSEKDYIRKKNKWLVKIKEWVDA  205

Query  526  HG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  350
            H  G L+IP S   E    DM  +E  KYCEENK QS L KIIK+G+SA+ L YFFTAGP
Sbjct  206  HDPGALVIPLSGGFESKYQDMSDEEKQKYCEENKTQSILTKIIKSGYSALQLEYFFTAGP  265

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEV+ W +R+ TKAPQAAG IHTD E+GFI AEVMKF D KE GSE A KA GKYRQ+G+
Sbjct  266  DEVRAWTVRKGTKAPQAAGKIHTDFEKGFIMAEVMKFTDFKEEGSENAAKAAGKYRQQGR  325

Query  169  TYVVQDGDVIFFKFNVSGGGKK  104
             Y+V+DGD+IFFKFN     KK
Sbjct  326  NYIVEDGDIIFFKFNTPNQPKK  347



>ref|XP_009070315.1| PREDICTED: obg-like ATPase 1 [Acanthisitta chloris]
Length=396

 Score =   247 bits (631),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 124/202 (61%), Positives = 149/202 (74%), Gaps = 2/202 (1%)
 Frame = -3

Query  703  LDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQE  527
            +DE K  R   +W   +I++LN     T+KP++YLVN++EKDY RKKNK+L KI  WV +
Sbjct  194  IDEKKAVRFYHDWNDKEIDVLNKHLFFTSKPMIYLVNLSEKDYIRKKNKWLIKIKEWVDK  253

Query  526  HG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  350
            H  G L+IPFS ALE  L DM  +E  KY EEN  QSAL KIIK G++A+ L YFFTAGP
Sbjct  254  HDPGALVIPFSGALELKLQDMSAEEKQKYLEENMTQSALAKIIKAGYAALQLEYFFTAGP  313

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+
Sbjct  314  DEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEGGSEAAVKAAGKYRQQGR  373

Query  169  TYVVQDGDVIFFKFNVSGGGKK  104
             YVV+DGD+IFFKFN     KK
Sbjct  374  NYVVEDGDIIFFKFNTPQQPKK  395



>ref|XP_002198993.1| PREDICTED: obg-like ATPase 1 isoform 1 [Taeniopygia guttata]
 ref|XP_004176777.1| PREDICTED: obg-like ATPase 1 isoform 2 [Taeniopygia guttata]
Length=396

 Score =   247 bits (631),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 124/202 (61%), Positives = 149/202 (74%), Gaps = 2/202 (1%)
 Frame = -3

Query  703  LDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQE  527
            +DE K  R   +W   +I++LN     T+KP++YLVN++EKDY RKKNK+L KI  WV +
Sbjct  194  IDEKKAVRFYHDWNDKEIDVLNKHLFFTSKPMIYLVNLSEKDYIRKKNKWLIKIKEWVDK  253

Query  526  HG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  350
            H  G L+IPFS ALE  L DM  +E  KY EEN  QSAL KIIK G++A+ L YFFTAGP
Sbjct  254  HDPGALVIPFSGALELKLQDMSAEEKQKYLEENMTQSALAKIIKAGYAALQLEYFFTAGP  313

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+
Sbjct  314  DEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEGGSEAAVKAAGKYRQQGR  373

Query  169  TYVVQDGDVIFFKFNVSGGGKK  104
             YVV+DGD+IFFKFN     KK
Sbjct  374  NYVVEDGDIIFFKFNTPQQPKK  395



>ref|XP_007546548.1| PREDICTED: obg-like ATPase 1 [Poecilia formosa]
Length=398

 Score =   247 bits (631),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 122/202 (60%), Positives = 148/202 (73%), Gaps = 2/202 (1%)
 Frame = -3

Query  703  LDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQE  527
            +DE K  R   +W   +I++LN +  LT+KPV+YLVN++EKDY R+KNK+L KI  WV  
Sbjct  196  MDEKKHVRYYHDWNDKEIDVLNKYLFLTSKPVIYLVNVSEKDYIRRKNKWLVKIKEWVDS  255

Query  526  HG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  350
            H  G L+IPFS  LE  L DM  +E  K C+E+K QSAL KIIK G++A+ L YFFT GP
Sbjct  256  HDPGALVIPFSGNLESRLQDMSEEERQKCCKEHKTQSALSKIIKAGYAALQLEYFFTTGP  315

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEV+ W IR+ TKAPQAAG IHTD ERGFI AEVMKF+D KE GSE AVKA GKYRQ+G+
Sbjct  316  DEVRAWTIRKGTKAPQAAGKIHTDFERGFIMAEVMKFQDFKEEGSESAVKAAGKYRQQGR  375

Query  169  TYVVQDGDVIFFKFNVSGGGKK  104
             Y V+DGD+IFFKFN     KK
Sbjct  376  NYTVEDGDIIFFKFNAPNAPKK  397



>emb|CDJ65501.1| GTP binding protein, putative [Eimeria necatrix]
Length=372

 Score =   246 bits (629),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 152/202 (75%), Gaps = 2/202 (1%)
 Frame = -3

Query  703  LDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEH  524
            L + K  + G WKAA++E+LN +Q LTAK VVYLVN++EKD+ R+KNK+L KIH WVQE+
Sbjct  171  LQDNKWVQQGNWKAAEVEVLNEYQFLTAKTVVYLVNLSEKDFIRQKNKWLAKIHNWVQEN  230

Query  523  GGELIIPFSAALERSLADMPPDEAAK-YCEENKV-QSALPKIIKTGFSAINLIYFFTAGP  350
                IIP+SA  E  LA+M  +E  + Y + +   +S L KII+TG+ A++LI+FFT G 
Sbjct  231  VQGPIIPYSAVFENKLAEMASEEERQNYIKSSGASKSMLDKIIQTGYHALHLIHFFTCGE  290

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEVKCW IR  TKAPQAAG IHTD ERGFICAEV K+ DL ELGSE AVKA GKY Q+GK
Sbjct  291  DEVKCWTIRAGTKAPQAAGVIHTDFERGFICAEVYKYTDLVELGSENAVKAAGKYLQKGK  350

Query  169  TYVVQDGDVIFFKFNVSGGGKK  104
             YVV+DGD+IFFKFNV+   KK
Sbjct  351  DYVVEDGDIIFFKFNVTNSAKK  372



>gb|ESL05473.1| GTP-binding protein [Trypanosoma rangeli SC58]
Length=361

 Score =   246 bits (628),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 112/204 (55%), Positives = 147/204 (72%), Gaps = 0/204 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            VK  L+ G+  R   W   +I+ LNT QLLTAKP ++L NM+EK + R++ K+L K+  W
Sbjct  158  VKEHLENGEQVRCCHWNGKEIDYLNTLQLLTAKPAIFLANMSEKSFIRQRGKWLAKLKEW  217

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            + +H GE +IP SA +E    DM P+E  +YC+ NK +S + K++ T + AINLI++FTA
Sbjct  218  IDQHTGEPLIPVSAEMEAKFVDMSPEEVEEYCKANKTKSQVNKVVTTSYHAINLIHYFTA  277

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  176
            G DEVKCW I+R TKAPQAAG IHTD+E+GFICAEV+ +ED  +L SE A +  GK  QE
Sbjct  278  GADEVKCWTIQRGTKAPQAAGKIHTDMEKGFICAEVIHWEDYDKLESEAACREAGKQHQE  337

Query  175  GKTYVVQDGDVIFFKFNVSGGGKK  104
            G+ Y VQDGD+IFFKFNVS GGKK
Sbjct  338  GRNYEVQDGDIIFFKFNVSKGGKK  361



>ref|XP_003400207.1| PREDICTED: GTP-binding protein CG1354-like [Bombus terrestris]
Length=397

 Score =   247 bits (631),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 122/200 (61%), Positives = 147/200 (74%), Gaps = 1/200 (1%)
 Frame = -3

Query  703  LDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEH  524
            +DE +  R  +W A DIE+LN +  LT+KPV+YLVN++EKDY RKKNK+L KI  WV ++
Sbjct  193  VDEKRHIRFADWSATDIEVLNKYLFLTSKPVIYLVNLSEKDYIRKKNKWLIKIKEWVDKN  252

Query  523  G-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPD  347
              G ++IPFS   E  L DM   E AKY EENKV SAL KII  G+ A+ L YFFTAG D
Sbjct  253  DPGAILIPFSGTFENKLFDMDDAERAKYQEENKVTSALDKIIVQGYKALQLQYFFTAGHD  312

Query  346  EVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKT  167
            EVK W I++ TKAPQAAG IHTD E+GFI AEVMKF+D K  GSE AVKA GKYRQ+G+ 
Sbjct  313  EVKAWTIQKGTKAPQAAGKIHTDFEKGFIMAEVMKFDDFKNEGSEAAVKAAGKYRQQGRN  372

Query  166  YVVQDGDVIFFKFNVSGGGK  107
            YVV+DGD++FFKFN   G K
Sbjct  373  YVVEDGDIVFFKFNAGAGLK  392



>gb|EGI59771.1| GTP-binding protein [Acromyrmex echinatior]
Length=349

 Score =   246 bits (627),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 121/199 (61%), Positives = 146/199 (73%), Gaps = 1/199 (1%)
 Frame = -3

Query  700  DEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG  521
            DE K  R  +W A DIE+LN +  LT+KP++YLVN++EKDY RKKNK+L KI  WV ++ 
Sbjct  146  DEKKHIRFADWSANDIEVLNKYLFLTSKPIIYLVNLSEKDYIRKKNKWLIKIKEWVDKND  205

Query  520  -GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDE  344
             G ++IPFS   E  + DM   E AKY EE+KV SAL KII  G+ A+ L YFFT+G DE
Sbjct  206  PGAVLIPFSGVFENKIFDMDEAERAKYFEEHKVTSALDKIIVQGYKALQLQYFFTSGHDE  265

Query  343  VKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTY  164
            VK W I++ TKAPQAAG IHTD E+GFI AEVMKFED K  GSE AVKA GKYRQ+G+ Y
Sbjct  266  VKAWTIQKGTKAPQAAGKIHTDFEKGFIMAEVMKFEDFKNEGSEAAVKAAGKYRQQGRNY  325

Query  163  VVQDGDVIFFKFNVSGGGK  107
            VV+DGD+IFFKFN   G K
Sbjct  326  VVEDGDIIFFKFNAGAGLK  344



>ref|XP_005049114.1| PREDICTED: obg-like ATPase 1 [Ficedula albicollis]
Length=396

 Score =   247 bits (631),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 124/202 (61%), Positives = 149/202 (74%), Gaps = 2/202 (1%)
 Frame = -3

Query  703  LDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQE  527
            +DE K  R   +W   +I++LN     T+KP++YLVN++EKDY RKKNK+L KI  WV +
Sbjct  194  IDEKKAVRFYHDWNDKEIDVLNKHLFFTSKPMIYLVNLSEKDYIRKKNKWLIKIKEWVDK  253

Query  526  HG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  350
            H  G L+IPFS ALE  L DM  +E  KY EEN  QSAL KIIK G++A+ L YFFTAGP
Sbjct  254  HDPGALVIPFSGALELKLQDMSAEEKQKYLEENMTQSALAKIIKAGYAALQLEYFFTAGP  313

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+
Sbjct  314  DEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEGGSEAAVKAAGKYRQQGR  373

Query  169  TYVVQDGDVIFFKFNVSGGGKK  104
             YVV+DGD+IFFKFN     KK
Sbjct  374  NYVVEDGDIIFFKFNTPQQPKK  395



>ref|XP_005519864.1| PREDICTED: obg-like ATPase 1 isoform X1 [Pseudopodoces humilis]
 ref|XP_005519865.1| PREDICTED: obg-like ATPase 1 isoform X2 [Pseudopodoces humilis]
 ref|XP_005519866.1| PREDICTED: obg-like ATPase 1 isoform X3 [Pseudopodoces humilis]
 ref|XP_008632970.1| PREDICTED: obg-like ATPase 1 isoform X1 [Corvus brachyrhynchos]
 ref|XP_008632971.1| PREDICTED: obg-like ATPase 1 isoform X1 [Corvus brachyrhynchos]
 gb|KFO59967.1| Obg-like ATPase 1 [Corvus brachyrhynchos]
Length=396

 Score =   247 bits (631),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 124/202 (61%), Positives = 149/202 (74%), Gaps = 2/202 (1%)
 Frame = -3

Query  703  LDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQE  527
            +DE K  R   +W   +I++LN     T+KP++YLVN++EKDY RKKNK+L KI  WV +
Sbjct  194  IDEKKAVRFYHDWNDKEIDVLNKHLFFTSKPMIYLVNLSEKDYIRKKNKWLIKIKEWVDK  253

Query  526  HG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  350
            H  G L+IPFS ALE  L DM  +E  KY EEN  QSAL KIIK G++A+ L YFFTAGP
Sbjct  254  HDPGALVIPFSGALELKLQDMSAEEKQKYLEENMTQSALAKIIKAGYAALQLEYFFTAGP  313

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+
Sbjct  314  DEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEGGSEAAVKAAGKYRQQGR  373

Query  169  TYVVQDGDVIFFKFNVSGGGKK  104
             YVV+DGD+IFFKFN     KK
Sbjct  374  NYVVEDGDIIFFKFNTPQQPKK  395



>ref|XP_008397950.1| PREDICTED: obg-like ATPase 1 [Poecilia reticulata]
Length=395

 Score =   247 bits (631),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 121/202 (60%), Positives = 147/202 (73%), Gaps = 2/202 (1%)
 Frame = -3

Query  703  LDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQE  527
            ++E K  R   EW   +IE+LN +  LT+KP++YLVN++EKDY RKKNK+L KI  WV  
Sbjct  193  VEEKKHVRFYHEWNDKEIEVLNKYLFLTSKPMIYLVNLSEKDYIRKKNKWLAKIKEWVDA  252

Query  526  HG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  350
            H  G ++IP S A+E  L +M  +E+ KYCEE K QS L KIIKTG++ + L YFFTAGP
Sbjct  253  HDPGAMVIPLSGAVEAKLQEMEEEESTKYCEEQKTQSVLTKIIKTGYAGLQLEYFFTAGP  312

Query  349  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  170
            DEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMKF D KE GSE A KA GKYRQ G+
Sbjct  313  DEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKFNDFKEEGSESAAKAAGKYRQLGR  372

Query  169  TYVVQDGDVIFFKFNVSGGGKK  104
             YVV+DGD+IFFKFN     KK
Sbjct  373  NYVVEDGDIIFFKFNTPNAPKK  394



>ref|XP_010700320.1| GTP binding protein, putative [Leishmania panamensis]
 gb|AIN99613.1| GTP binding protein, putative [Leishmania panamensis]
Length=392

 Score =   247 bits (630),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 114/204 (56%), Positives = 148/204 (73%), Gaps = 0/204 (0%)
 Frame = -3

Query  715  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  536
            VK  L+EGK  R  +W   +I+ LNT QLLTAKP ++LVNM+E DY R++NK+L K+  W
Sbjct  189  VKGVLEEGKQVRCCQWNGKEIDFLNTVQLLTAKPAMFLVNMSENDYVRQRNKWLKKLKDW  248

Query  535  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  356
            + EH GE +IPFSA LE +   M P+E  +YC E   +S + KI+ T +S INLI++FTA
Sbjct  249  IDEHTGEPMIPFSAELETTFIAMSPEEVDRYCAEKTTRSQVHKIVNTAYSIINLIHYFTA  308

Query  355  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  176
            G DEVKCW I+R TKAPQAAG IHTD+E+GFICAEV+++ D   L +E A +  GK  Q+
Sbjct  309  GADEVKCWTIQRGTKAPQAAGRIHTDMEKGFICAEVIEWADFDRLENEAACRDEGKQHQQ  368

Query  175  GKTYVVQDGDVIFFKFNVSGGGKK  104
            G+ Y VQDGD+IFFKFN + GGKK
Sbjct  369  GRNYEVQDGDIIFFKFNAAKGGKK  392



>ref|XP_003704224.1| PREDICTED: GTP-binding protein CG1354-like [Megachile rotundata]
Length=397

 Score =   247 bits (630),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 122/200 (61%), Positives = 147/200 (74%), Gaps = 1/200 (1%)
 Frame = -3

Query  703  LDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEH  524
            +DE +  R  +W A DIE+LN +  LT+KPV+YLVN++EKDY RKKNK+L KI  WV ++
Sbjct  193  VDEKRHIRFADWSATDIEVLNKYLFLTSKPVIYLVNLSEKDYIRKKNKWLIKIKEWVDKN  252

Query  523  G-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPD  347
              G ++IPFS A E  L DM   E AKY EENKV SAL KII  G+ A+ L YFFTAG D
Sbjct  253  DPGAVLIPFSGAFENKLLDMDEVERAKYLEENKVTSALDKIIVQGYKALQLQYFFTAGHD  312

Query  346  EVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKT  167
            EVK W I++ TKAPQAAG IHTD E+GFI AEVMK++D K  GSE  VKA GKYRQ+G+ 
Sbjct  313  EVKAWTIQKGTKAPQAAGKIHTDFEKGFIMAEVMKYDDFKNEGSEAGVKAAGKYRQQGRN  372

Query  166  YVVQDGDVIFFKFNVSGGGK  107
            YVV+DGD+IFFKFN   G K
Sbjct  373  YVVEDGDIIFFKFNAGAGLK  392



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1260188911410