BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF027I16

Length=669
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|EPS62329.1|  pectinesterase                                          196   4e-55   Genlisea aurea
ref|XP_011015915.1|  PREDICTED: pectinesterase-like                     194   2e-54   Populus euphratica
ref|XP_002271665.2|  PREDICTED: pectinesterase-like                     190   4e-53   Vitis vinifera
emb|CBI36883.3|  unnamed protein product                                190   4e-53   Vitis vinifera
ref|XP_011010963.1|  PREDICTED: pectinesterase-like                     190   5e-53   Populus euphratica
emb|CDP15269.1|  unnamed protein product                                186   7e-53   Coffea canephora [robusta coffee]
ref|XP_009592542.1|  PREDICTED: pectinesterase-like                     189   1e-52   Nicotiana tomentosiformis
ref|XP_011079629.1|  PREDICTED: pectinesterase-like                     188   2e-52   Sesamum indicum [beniseed]
emb|CDP15270.1|  unnamed protein product                                187   1e-51   Coffea canephora [robusta coffee]
gb|AHB84678.1|  pectin methylesterase                                   185   5e-51   Citrus reticulata [mandarin orange]
ref|XP_002301486.2|  hypothetical protein POPTR_0002s20370g             184   8e-51   
ref|XP_003519757.1|  PREDICTED: probable pectinesterase/pectinest...    183   2e-50   Glycine max [soybeans]
ref|XP_010269596.1|  PREDICTED: pectinesterase-like                     182   6e-50   Nelumbo nucifera [Indian lotus]
ref|XP_006444399.1|  hypothetical protein CICLE_v100237231mg            181   7e-50   
ref|XP_006480001.1|  PREDICTED: probable pectinesterase/pectinest...    181   1e-49   Citrus sinensis [apfelsine]
ref|XP_002523113.1|  Pectinesterase-3 precursor, putative               176   6e-48   Ricinus communis
ref|XP_007145198.1|  hypothetical protein PHAVU_007G218500g             176   6e-48   Phaseolus vulgaris [French bean]
ref|XP_009628637.1|  PREDICTED: pectinesterase-like                     176   9e-48   Nicotiana tomentosiformis
ref|XP_010259481.1|  PREDICTED: pectinesterase-like                     175   3e-47   Nelumbo nucifera [Indian lotus]
gb|KHG05999.1|  putative pectinesterase/pectinesterase inhibitor ...    173   1e-46   Gossypium arboreum [tree cotton]
ref|XP_007163135.1|  hypothetical protein PHAVU_001G209400g             173   1e-46   Phaseolus vulgaris [French bean]
ref|XP_003553658.2|  PREDICTED: probable pectinesterase/pectinest...    173   1e-46   Glycine max [soybeans]
ref|XP_009783075.1|  PREDICTED: pectinesterase-like                     171   7e-46   Nicotiana sylvestris
ref|XP_009765668.1|  PREDICTED: pectinesterase-like                     170   1e-45   Nicotiana sylvestris
gb|KJB41904.1|  hypothetical protein B456_007G127000                    169   3e-45   Gossypium raimondii
ref|XP_009614504.1|  PREDICTED: pectinesterase-like                     167   1e-44   Nicotiana tomentosiformis
ref|XP_010321856.1|  PREDICTED: pectinesterase                          166   3e-44   Solanum lycopersicum
gb|EYU46746.1|  hypothetical protein MIMGU_mgv1a0044632mg               157   8e-44   Erythranthe guttata [common monkey flower]
ref|XP_004494389.1|  PREDICTED: probable pectinesterase/pectinest...    164   9e-44   Cicer arietinum [garbanzo]
ref|XP_010069896.1|  PREDICTED: pectinesterase-like                     164   2e-43   Eucalyptus grandis [rose gum]
gb|KJB09419.1|  hypothetical protein B456_001G140500                    163   5e-43   Gossypium raimondii
ref|XP_004247400.1|  PREDICTED: pectinesterase-like                     159   7e-42   Solanum lycopersicum
ref|XP_006359860.1|  PREDICTED: probable pectinesterase/pectinest...    159   9e-42   Solanum tuberosum [potatoes]
ref|XP_008235121.1|  PREDICTED: pectinesterase-like                     158   2e-41   Prunus mume [ume]
ref|XP_009771845.1|  PREDICTED: pectinesterase-like                     158   3e-41   Nicotiana sylvestris
ref|XP_007201179.1|  hypothetical protein PRUPE_ppa003400mg             158   3e-41   
gb|KEH24404.1|  pectinesterase/pectinesterase inhibitor                 153   1e-39   Medicago truncatula
ref|XP_004290811.1|  PREDICTED: pectinesterase-like                     145   1e-36   Fragaria vesca subsp. vesca
gb|EPS67066.1|  pectinesterase                                          147   2e-36   Genlisea aurea
ref|XP_010910828.1|  PREDICTED: pectinesterase 3-like                   140   4e-36   
ref|XP_008359413.1|  PREDICTED: pectinesterase-like                     142   1e-35   
ref|XP_008795768.1|  PREDICTED: pectinesterase-like                     139   1e-34   Phoenix dactylifera
ref|XP_010556724.1|  PREDICTED: pectinesterase-like                     138   2e-34   Tarenaya hassleriana [spider flower]
ref|XP_009401623.1|  PREDICTED: pectinesterase 3-like                   134   2e-33   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN43496.1|  Putative pectinesterase/pectinesterase inhibitor 40     133   1e-32   Glycine soja [wild soybean]
gb|KJB49889.1|  hypothetical protein B456_008G143700                    133   2e-32   Gossypium raimondii
ref|XP_009383893.1|  PREDICTED: pectinesterase-like                     132   3e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009382521.1|  PREDICTED: pectinesterase-like                     128   8e-31   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACQ85264.1|  pectin methylesterase                                   127   1e-30   Musa acuminata AAA Group [Cavendish banana]
gb|AGG23325.1|  pectin methylesterase 1                                 127   2e-30   Musa acuminata AAA Group [Cavendish banana]
gb|KHN08672.1|  Putative pectinesterase/pectinesterase inhibitor 40     127   2e-30   Glycine soja [wild soybean]
ref|XP_010684346.1|  PREDICTED: pectinesterase-like                     122   1e-28   Beta vulgaris subsp. vulgaris [field beet]
tpg|DAA54386.1|  TPA: hypothetical protein ZEAMMB73_825660              113   5e-26   
ref|XP_006355852.1|  PREDICTED: probable pectinesterase/pectinest...    112   5e-26   
gb|KHN03710.1|  Putative pectinesterase/pectinesterase inhibitor 40     113   7e-26   Glycine soja [wild soybean]
ref|XP_006355816.1|  PREDICTED: pectinesterase-like                     113   1e-25   
ref|NP_001146685.1|  pectinesterase precursor                           114   1e-25   Zea mays [maize]
dbj|BAJ96804.1|  predicted protein                                      112   8e-25   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010230835.1|  PREDICTED: pectinesterase-like                     110   2e-24   Brachypodium distachyon [annual false brome]
gb|EEE54425.1|  hypothetical protein OsJ_01485                          110   3e-24   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002455538.1|  hypothetical protein SORBIDRAFT_03g012830          110   3e-24   Sorghum bicolor [broomcorn]
gb|EEC70505.1|  hypothetical protein OsI_01594                          110   3e-24   Oryza sativa Indica Group [Indian rice]
gb|ABQ42392.1|  pectin methylesterase-like protein                      105   2e-22   Taiwania cryptomerioides
gb|EMS68834.1|  Pectinesterase 1                                        103   2e-22   Triticum urartu
gb|ABZ89800.1|  pectin methylesterase-like protein                      102   2e-21   Taiwania cryptomerioides
ref|XP_010088304.1|  putative pectinesterase/pectinesterase inhib...    100   8e-21   
ref|XP_010501842.1|  PREDICTED: pectinesterase/pectinesterase inh...    100   1e-20   Camelina sativa [gold-of-pleasure]
emb|CDX97564.1|  BnaA05g25150D                                          100   1e-20   
ref|XP_009146386.1|  PREDICTED: pectinesterase/pectinesterase inh...    100   2e-20   Brassica rapa
ref|XP_002891774.1|  ATPME2                                             100   2e-20   Arabidopsis lyrata subsp. lyrata
gb|KGN44975.1|  Pectinesterase                                          100   2e-20   Cucumis sativus [cucumbers]
ref|XP_010465323.1|  PREDICTED: pectinesterase/pectinesterase inh...  99.4    2e-20   Camelina sativa [gold-of-pleasure]
ref|XP_009117000.1|  PREDICTED: pectinesterase/pectinesterase inh...  99.4    3e-20   Brassica rapa
ref|XP_010056842.1|  PREDICTED: pectinesterase-like                   98.6    4e-20   Eucalyptus grandis [rose gum]
gb|KDO53765.1|  hypothetical protein CISIN_1g018173mg                 96.7    5e-20   Citrus sinensis [apfelsine]
emb|CDX75765.1|  BnaC03g38480D                                        97.4    6e-20   
ref|XP_006407094.1|  hypothetical protein EUTSA_v10020354mg           98.2    6e-20   Eutrema salsugineum [saltwater cress]
emb|CDY39109.1|  BnaA01g29470D                                        98.2    6e-20   Brassica napus [oilseed rape]
emb|CDX98441.1|  BnaC05g39340D                                        98.2    7e-20   
ref|XP_004136014.1|  PREDICTED: probable pectinesterase/pectinest...  97.8    7e-20   Cucumis sativus [cucumbers]
emb|CDY33228.1|  BnaC01g37010D                                        97.8    8e-20   Brassica napus [oilseed rape]
gb|ABG46324.1|  putative pectin methylesterase                        95.5    1e-19   Picea abies
ref|XP_010489830.1|  PREDICTED: pectinesterase/pectinesterase inh...  93.6    2e-19   Camelina sativa [gold-of-pleasure]
ref|XP_006297218.1|  hypothetical protein CARUB_v10013226mg           96.7    2e-19   
ref|XP_004171768.1|  PREDICTED: probable pectinesterase/pectinest...  96.7    2e-19   
ref|NP_188048.1|  pectin methylesterase 3                             96.3    3e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007012502.1|  Pectin methylesterase 3                          95.9    3e-19   
sp|O04886.1|PME1_CITSI  RecName: Full=Pectinesterase 1; Short=PE ...  95.9    3e-19   Citrus sinensis [apfelsine]
ref|NP_001275859.1|  pectinesterase 1 precursor                       95.9    4e-19   Citrus sinensis [apfelsine]
sp|P83948.1|PME3_CITSI  RecName: Full=Pectinesterase 3; Short=PE ...  95.9    4e-19   Citrus sinensis [apfelsine]
gb|AAC50023.1|  ATPME2 precursor                                      95.9    4e-19   Arabidopsis thaliana [mouse-ear cress]
ref|NP_175786.1|  pectin methylesterase 2                             95.9    5e-19   Arabidopsis thaliana [mouse-ear cress]
gb|KJB54564.1|  hypothetical protein B456_009G039100                  94.0    5e-19   Gossypium raimondii
ref|XP_009116991.1|  PREDICTED: pectinesterase/pectinesterase inh...  95.5    5e-19   Brassica rapa
gb|AAC72288.1|  putative pectin methylesterase                        95.5    5e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010042403.1|  PREDICTED: probable pectinesterase/pectinest...  92.4    7e-19   Eucalyptus grandis [rose gum]
gb|KHF97383.1|  Pectinesterase/pectinesterase inhibitor U1            95.1    7e-19   Gossypium arboreum [tree cotton]
emb|CDY51798.1|  BnaC06g41940D                                        94.7    1e-18   Brassica napus [oilseed rape]
emb|CDY08206.1|  BnaA05g14130D                                        94.7    1e-18   Brassica napus [oilseed rape]
gb|KJB54563.1|  hypothetical protein B456_009G039100                  94.4    1e-18   Gossypium raimondii
ref|XP_010058837.1|  PREDICTED: uncharacterized protein LOC104446716  95.5    2e-18   
gb|AFW03476.1|  pectin methylesterase 2                               93.6    2e-18   Gossypium barbadense [Egyptian cotton]
gb|AFB77928.1|  pectin methylesterase                                 93.6    2e-18   Gossypium hirsutum [American cotton]
gb|ACN40984.1|  unknown                                               93.2    4e-18   Picea sitchensis
ref|XP_002885033.1|  ATPME3                                           92.8    4e-18   
ref|XP_002265171.1|  PREDICTED: pectinesterase                        92.8    4e-18   Vitis vinifera
emb|CDY60700.1|  BnaA01g37100D                                        92.8    5e-18   Brassica napus [oilseed rape]
gb|AER38243.1|  PME2                                                  92.4    5e-18   Gossypium barbadense [Egyptian cotton]
gb|KFK38797.1|  hypothetical protein AALP_AA3G161500                  92.8    5e-18   Arabis alpina [alpine rockcress]
ref|XP_010685210.1|  PREDICTED: pectinesterase-like                   92.4    6e-18   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009135376.1|  PREDICTED: pectinesterase/pectinesterase inh...  92.4    6e-18   Brassica rapa
ref|XP_004298672.1|  PREDICTED: 21 kDa protein                        88.6    7e-18   Fragaria vesca subsp. vesca
emb|CDY67447.1|  BnaA03g57460D                                        88.6    9e-18   Brassica napus [oilseed rape]
ref|XP_006658118.1|  PREDICTED: pectinesterase 3-like                 91.7    1e-17   
ref|XP_010543030.1|  PREDICTED: pectinesterase 2-like                 91.3    1e-17   Tarenaya hassleriana [spider flower]
ref|XP_003528739.1|  PREDICTED: pectinesterase/pectinesterase inh...  91.7    1e-17   
ref|XP_006307088.1|  hypothetical protein CARUB_v10008673mg           91.7    1e-17   Capsella rubella
ref|XP_006841486.1|  hypothetical protein AMTR_s00003p00120050        91.3    1e-17   Amborella trichopoda
ref|XP_011072691.1|  PREDICTED: pectinesterase-like                   91.3    1e-17   Sesamum indicum [beniseed]
ref|XP_010462289.1|  PREDICTED: pectinesterase 2                      91.3    1e-17   Camelina sativa [gold-of-pleasure]
ref|XP_009123661.1|  PREDICTED: pectinesterase 2                      91.3    2e-17   
ref|XP_010047425.1|  PREDICTED: pectinesterase-like                   91.3    2e-17   Eucalyptus grandis [rose gum]
ref|XP_003627459.1|  Pectinesterase                                   89.4    2e-17   
gb|KFK35693.1|  hypothetical protein AALP_AA4G024900                  90.5    2e-17   Arabis alpina [alpine rockcress]
ref|XP_010058840.1|  PREDICTED: pectinesterase-like                   90.5    3e-17   
ref|XP_010479961.1|  PREDICTED: pectinesterase 2-like                 90.1    4e-17   Camelina sativa [gold-of-pleasure]
ref|XP_006828586.1|  hypothetical protein AMTR_s00129p00044320        89.7    5e-17   Amborella trichopoda
gb|KDP28190.1|  hypothetical protein JCGZ_13961                       88.2    7e-17   Jatropha curcas
ref|NP_001265901.1|  pectinesterase 3-like                            89.4    7e-17   Cicer arietinum [garbanzo]
ref|XP_010501045.1|  PREDICTED: pectinesterase 2-like                 89.4    8e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010534986.1|  PREDICTED: pectinesterase/pectinesterase inh...  89.0    8e-17   Tarenaya hassleriana [spider flower]
gb|KHG08631.1|  Pectinesterase 3                                      89.0    9e-17   Gossypium arboreum [tree cotton]
ref|XP_007139063.1|  hypothetical protein PHAVU_009G261700g           88.6    1e-16   Phaseolus vulgaris [French bean]
gb|EEC82670.1|  hypothetical protein OsI_27314                        88.6    1e-16   Oryza sativa Indica Group [Indian rice]
ref|NP_001060620.1|  Os07g0675100                                     88.6    1e-16   
ref|XP_002324773.2|  hypothetical protein POPTR_0018s05360g           86.3    2e-16   
ref|XP_009606552.1|  PREDICTED: pectinesterase/pectinesterase inh...  88.2    2e-16   Nicotiana tomentosiformis
emb|CDY33229.1|  BnaC01g37020D                                        87.8    2e-16   Brassica napus [oilseed rape]
ref|XP_010029512.1|  PREDICTED: pectinesterase-like                   87.8    2e-16   Eucalyptus grandis [rose gum]
gb|AFW03481.1|  pectin methylesterase 2                               87.4    2e-16   Gossypium hirsutum [American cotton]
ref|XP_008228105.1|  PREDICTED: pectinesterase                        87.8    2e-16   Prunus mume [ume]
gb|KDP33985.1|  hypothetical protein JCGZ_07556                       87.8    2e-16   Jatropha curcas
ref|XP_010029511.1|  PREDICTED: pectinesterase-like                   87.8    2e-16   Eucalyptus grandis [rose gum]
gb|AFW03480.1|  pectin methylesterase 1                               87.8    2e-16   Gossypium hirsutum [American cotton]
ref|XP_003627458.1|  Pectinesterase                                   87.8    2e-16   Medicago truncatula
ref|XP_009762395.1|  PREDICTED: pectinesterase/pectinesterase inh...  87.4    3e-16   Nicotiana sylvestris
emb|CAB95025.1|  pectin methylesterase                                87.4    3e-16   Nicotiana tabacum [American tobacco]
ref|XP_007217169.1|  hypothetical protein PRUPE_ppa003285mg           87.4    3e-16   Prunus persica
ref|XP_006490093.1|  PREDICTED: 21 kDa protein-like                   84.0    3e-16   Citrus sinensis [apfelsine]
gb|KDO65437.1|  hypothetical protein CISIN_1g029238mg                 84.0    3e-16   Citrus sinensis [apfelsine]
gb|KJB57093.1|  hypothetical protein B456_009G147900                  87.0    4e-16   Gossypium raimondii
gb|AFB77929.1|  pectin methylesterase                                 87.0    4e-16   Gossypium hirsutum [American cotton]
gb|AFW03475.1|  pectin methylesterase 1                               87.0    4e-16   Gossypium barbadense [Egyptian cotton]
gb|KJB19687.1|  hypothetical protein B456_003G114500                  83.6    4e-16   Gossypium raimondii
ref|NP_001274969.1|  pectin methyl esterase                           86.7    5e-16   Solanum tuberosum [potatoes]
ref|XP_006392745.1|  hypothetical protein EUTSA_v10011343mg           86.7    5e-16   Eutrema salsugineum [saltwater cress]
ref|XP_011031815.1|  PREDICTED: pectinesterase-like                   86.7    6e-16   Populus euphratica
gb|AFI23411.1|  pectin methylesterase                                 86.7    6e-16   Coffea arabica [arabica coffee]
gb|ABK22631.1|  unknown                                               83.2    6e-16   Picea sitchensis
ref|XP_006421707.1|  hypothetical protein CICLE_v10005946mg           82.8    7e-16   Citrus clementina [clementine]
ref|NP_001233857.1|  pectinesterase/pectinesterase inhibitor U1 p...  86.3    8e-16   
ref|XP_006421706.1|  hypothetical protein CICLE_v10005926mg           82.4    9e-16   Citrus clementina [clementine]
ref|XP_008368265.1|  PREDICTED: pectinesterase 3-like                 84.3    1e-15   
gb|AAG17110.1|AF188895_1  putative pectin methylesterase 3            85.9    1e-15   Linum usitatissimum
ref|XP_009601611.1|  PREDICTED: pectinesterase-like                   85.9    1e-15   Nicotiana tomentosiformis
ref|XP_010273995.1|  PREDICTED: pectinesterase 1-like                 82.8    1e-15   
ref|XP_009151355.1|  PREDICTED: 21 kDa protein                        82.4    1e-15   Brassica rapa
ref|XP_004506603.1|  PREDICTED: 21 kDa protein-like                   82.0    1e-15   Cicer arietinum [garbanzo]
ref|XP_006490094.1|  PREDICTED: 21 kDa protein-like                   82.4    1e-15   
ref|XP_003625921.1|  Pectinesterase/pectinesterase inhibitor          82.0    1e-15   Medicago truncatula
ref|XP_007038418.1|  DC1.2-like, putative                             82.0    2e-15   
ref|XP_002510935.1|  21 kDa protein precursor, putative               81.6    2e-15   Ricinus communis
ref|XP_009335740.1|  PREDICTED: 21 kDa protein                        81.6    2e-15   Pyrus x bretschneideri [bai li]
ref|XP_009335681.1|  PREDICTED: 21 kDa protein-like                   81.6    2e-15   Pyrus x bretschneideri [bai li]
gb|AAO85706.1|  pectin methyl-esterase                                85.1    2e-15   Nicotiana benthamiana
ref|XP_010656074.1|  PREDICTED: pectinesterase-like                   84.7    2e-15   Vitis vinifera
ref|XP_002532944.1|  Pectinesterase-3 precursor, putative             84.7    2e-15   Ricinus communis
ref|XP_008460358.1|  PREDICTED: pectinesterase-like                   84.7    2e-15   Cucumis melo [Oriental melon]
ref|XP_002264167.1|  PREDICTED: 21 kDa protein                        81.3    3e-15   Vitis vinifera
ref|XP_010939846.1|  PREDICTED: pectinesterase-like                   84.3    3e-15   Elaeis guineensis
ref|XP_002304257.2|  pectinesterase family protein                    84.3    3e-15   Populus trichocarpa [western balsam poplar]
ref|XP_006369078.1|  hypothetical protein POPTR_0001s162502g          82.0    4e-15   
gb|ADE76337.1|  unknown                                               80.5    5e-15   Picea sitchensis
ref|XP_009767827.1|  PREDICTED: pectinesterase-like                   83.6    5e-15   Nicotiana sylvestris
ref|XP_010047424.1|  PREDICTED: pectinesterase-like                   83.6    5e-15   Eucalyptus grandis [rose gum]
ref|XP_010458855.1|  PREDICTED: 21 kDa protein-like                   80.1    6e-15   Camelina sativa [gold-of-pleasure]
ref|XP_002516186.1|  Pectinesterase-3 precursor, putative             83.6    6e-15   Ricinus communis
ref|XP_010273801.1|  PREDICTED: pectinesterase                        83.6    6e-15   Nelumbo nucifera [Indian lotus]
gb|ABK22757.1|  unknown                                               80.1    7e-15   Picea sitchensis
ref|XP_004144447.1|  PREDICTED: pectinesterase 3-like                 83.2    7e-15   
ref|XP_004168887.1|  PREDICTED: pectinesterase 3-like                 83.2    7e-15   
emb|CDX86901.1|  BnaC03g51710D                                        80.1    7e-15   
ref|XP_003521571.1|  PREDICTED: 21 kDa protein-like                   80.1    7e-15   Glycine max [soybeans]
gb|ACN40648.1|  unknown                                               80.1    8e-15   Picea sitchensis
ref|XP_010483948.1|  PREDICTED: 21 kDa protein-like isoform X1        79.7    1e-14   Camelina sativa [gold-of-pleasure]
ref|XP_004141734.1|  PREDICTED: pectinesterase 3-like                 82.8    1e-14   Cucumis sativus [cucumbers]
emb|CBI27756.3|  unnamed protein product                              82.8    1e-14   Vitis vinifera
ref|XP_010444081.1|  PREDICTED: 21 kDa protein-like                   79.7    1e-14   Camelina sativa [gold-of-pleasure]
ref|XP_004172115.1|  PREDICTED: pectinesterase 3-like                 82.4    1e-14   
ref|XP_006281048.1|  hypothetical protein CARUB_v10027064mg           79.7    1e-14   Capsella rubella
emb|CDX87244.1|  BnaC09g05590D                                        79.3    1e-14   
ref|XP_007039951.1|  Plant invertase/pectin methylesterase inhibi...  79.3    1e-14   
ref|XP_002277473.1|  PREDICTED: pectinesterase                        82.4    1e-14   
ref|XP_002864788.1|  invertase/pectin methylesterase inhibitor fa...  79.0    2e-14   Arabidopsis lyrata subsp. lyrata
ref|XP_008462453.1|  PREDICTED: pectinesterase-like                   82.0    2e-14   
ref|XP_008340373.1|  PREDICTED: pectinesterase 3-like                 82.0    2e-14   
gb|KFK27963.1|  hypothetical protein AALP_AA8G454300                  78.6    3e-14   Arabis alpina [alpine rockcress]
gb|KDP22409.1|  hypothetical protein JCGZ_26240                       78.6    3e-14   Jatropha curcas
ref|XP_004307822.1|  PREDICTED: 21 kDa protein-like                   78.2    3e-14   Fragaria vesca subsp. vesca
ref|XP_010264195.1|  PREDICTED: 21 kDa protein-like                   78.6    3e-14   Nelumbo nucifera [Indian lotus]
ref|XP_008238630.1|  PREDICTED: 21 kDa protein                        78.2    3e-14   Prunus mume [ume]
ref|XP_004958677.1|  PREDICTED: pectinesterase 3-like                 81.3    3e-14   Setaria italica
ref|NP_201042.2|  plant invertase/pectin methylesterase inhibitor...  77.8    4e-14   Arabidopsis thaliana [mouse-ear cress]
gb|AAN60276.1|  unknown                                               77.8    4e-14   Arabidopsis thaliana [mouse-ear cress]
gb|KDP33984.1|  hypothetical protein JCGZ_07555                       81.3    4e-14   Jatropha curcas
ref|XP_004245727.1|  PREDICTED: 21 kDa protein-like                   77.8    4e-14   Solanum lycopersicum
ref|XP_010096537.1|  Pectinesterase 3                                 79.7    5e-14   
ref|XP_010261668.1|  PREDICTED: pectinesterase-like                   80.9    5e-14   Nelumbo nucifera [Indian lotus]
ref|XP_008451545.1|  PREDICTED: pectinesterase-like                   80.9    5e-14   
gb|KHN32444.1|  21 kDa protein                                        77.4    5e-14   Glycine soja [wild soybean]
gb|AAC05147.1|  21 kD protein precursor                               77.8    5e-14   Pinus radiata
ref|XP_010420924.1|  PREDICTED: 21 kDa protein-like                   77.4    6e-14   Camelina sativa [gold-of-pleasure]
ref|XP_009112019.1|  PREDICTED: 21 kDa protein-like                   77.4    6e-14   Brassica rapa
ref|XP_010546336.1|  PREDICTED: 21 kDa protein-like                   77.4    6e-14   Tarenaya hassleriana [spider flower]
gb|KJB25638.1|  hypothetical protein B456_004G201600                  77.0    7e-14   Gossypium raimondii
gb|ABK96280.1|  unknown                                               77.0    8e-14   Populus trichocarpa x Populus deltoides
emb|CDY00279.1|  BnaA06g21800D                                        77.0    8e-14   
ref|XP_008800482.1|  PREDICTED: pectinesterase-like isoform X1        80.1    8e-14   Phoenix dactylifera
ref|XP_011076332.1|  PREDICTED: 21 kDa protein                        77.0    8e-14   Sesamum indicum [beniseed]
ref|XP_010519346.1|  PREDICTED: 21 kDa protein-like                   76.6    9e-14   Tarenaya hassleriana [spider flower]
ref|XP_008369014.1|  PREDICTED: 21 kDa protein                        76.6    9e-14   
ref|XP_008355483.1|  PREDICTED: 21 kDa protein-like                   76.6    1e-13   
ref|XP_006388348.1|  hypothetical protein POPTR_0214s00200g           79.7    1e-13   Populus trichocarpa [western balsam poplar]
ref|XP_003541070.2|  PREDICTED: 21 kDa protein-like                   77.0    1e-13   
gb|EYU21270.1|  hypothetical protein MIMGU_mgv1a003278mg              79.7    1e-13   Erythranthe guttata [common monkey flower]
ref|XP_004495957.1|  PREDICTED: 21 kDa protein-like                   76.3    1e-13   Cicer arietinum [garbanzo]
ref|XP_006355502.1|  PREDICTED: 21 kDa protein-like                   76.3    1e-13   Solanum tuberosum [potatoes]
ref|XP_004307823.1|  PREDICTED: 21 kDa protein-like                   76.3    1e-13   Fragaria vesca subsp. vesca
ref|XP_009767669.1|  PREDICTED: 21 kDa protein                        76.3    1e-13   Nicotiana sylvestris
gb|KJB20850.1|  hypothetical protein B456_003G168700                  76.3    2e-13   Gossypium raimondii
gb|AFK35257.1|  unknown                                               75.9    2e-13   Medicago truncatula
ref|XP_006394407.1|  hypothetical protein EUTSA_v10004950mg           75.9    2e-13   Eutrema salsugineum [saltwater cress]
emb|CAC01624.1|  putative pectin methylesterase                       79.0    2e-13   Populus tremula x Populus tremuloides
ref|XP_004139621.1|  PREDICTED: pectinesterase/pectinesterase inh...  79.0    2e-13   
gb|AAK69696.1|AF355057_1  putative pectin methylesterase LuPME5       79.0    2e-13   Linum usitatissimum
ref|XP_004154436.1|  PREDICTED: pectinesterase/pectinesterase inh...  79.0    2e-13   
gb|KGN44619.1|  hypothetical protein Csa_7G343850                     79.0    2e-13   Cucumis sativus [cucumbers]
ref|XP_007135363.1|  hypothetical protein PHAVU_010G123100g           79.3    3e-13   Phaseolus vulgaris [French bean]
ref|XP_010049073.1|  PREDICTED: probable pectinesterase/pectinest...  78.6    3e-13   Eucalyptus grandis [rose gum]
ref|XP_011012638.1|  PREDICTED: pectinesterase-like                   78.6    3e-13   Populus euphratica
ref|XP_010035021.1|  PREDICTED: 21 kDa protein-like                   75.1    4e-13   Eucalyptus grandis [rose gum]
gb|AFK47771.1|  unknown                                               75.1    4e-13   Lotus japonicus
gb|AFK38286.1|  unknown                                               75.1    4e-13   Lotus japonicus
gb|KEH29361.1|  plant invertase/pectin methylesterase inhibitor       74.7    4e-13   Medicago truncatula
gb|KDP33962.1|  hypothetical protein JCGZ_07533                       74.7    5e-13   Jatropha curcas
gb|ACU13418.1|  unknown                                               74.7    5e-13   Glycine max [soybeans]
gb|KDP25618.1|  hypothetical protein JCGZ_20774                       74.3    7e-13   Jatropha curcas
ref|XP_002463382.1|  hypothetical protein SORBIDRAFT_02g042780        77.4    7e-13   Sorghum bicolor [broomcorn]
ref|XP_010454384.1|  PREDICTED: 21 kDa protein-like                   74.3    7e-13   Camelina sativa [gold-of-pleasure]
ref|XP_010937249.1|  PREDICTED: pectinesterase-like                   77.4    7e-13   Elaeis guineensis
ref|XP_002322405.2|  ripening-related family protein                  73.9    7e-13   Populus trichocarpa [western balsam poplar]
ref|XP_010259553.1|  PREDICTED: 21 kDa protein-like                   73.9    8e-13   Nelumbo nucifera [Indian lotus]
ref|XP_002322404.2|  ripening-related family protein                  73.9    8e-13   Populus trichocarpa [western balsam poplar]
ref|XP_009610995.1|  PREDICTED: 21 kDa protein                        74.3    8e-13   
ref|XP_009370481.1|  PREDICTED: 21 kDa protein-like                   73.9    8e-13   Pyrus x bretschneideri [bai li]
gb|KDP40627.1|  hypothetical protein JCGZ_24626                       77.0    8e-13   Jatropha curcas
gb|AJH66132.1|  pectin methylesterase                                 77.0    9e-13   Malus domestica [apple tree]
ref|XP_009362111.1|  PREDICTED: 21 kDa protein-like                   73.9    9e-13   
ref|XP_008348472.1|  PREDICTED: pectinesterase-like                   77.0    1e-12   
gb|KJB70037.1|  hypothetical protein B456_011G055100                  76.6    1e-12   Gossypium raimondii
ref|XP_007209621.1|  hypothetical protein PRUPE_ppa011699mg           73.6    1e-12   Prunus persica
ref|XP_002322403.1|  ripening-related family protein                  73.6    1e-12   Populus trichocarpa [western balsam poplar]
ref|NP_001236761.1|  uncharacterized protein LOC100305537 precursor   73.6    1e-12   Glycine max [soybeans]
gb|AFK37116.1|  unknown                                               73.6    1e-12   Lotus japonicus
gb|KJB37508.1|  hypothetical protein B456_006G212000                  73.6    1e-12   Gossypium raimondii
ref|XP_003635233.1|  PREDICTED: 21 kDa protein-like                   73.6    1e-12   Vitis vinifera
ref|XP_010259038.1|  PREDICTED: 21 kDa protein-like                   73.6    1e-12   Nelumbo nucifera [Indian lotus]
emb|CAN70288.1|  hypothetical protein VITISV_015784                   73.2    1e-12   Vitis vinifera
ref|XP_011010937.1|  PREDICTED: 21 kDa protein-like isoform X2        73.2    1e-12   Populus euphratica
ref|XP_007024771.1|  Pectin methylesterase 3 isoform 2                76.3    1e-12   
ref|XP_004303758.1|  PREDICTED: pectinesterase-like                   76.3    2e-12   
ref|XP_011048630.1|  PREDICTED: pectinesterase-like                   76.3    2e-12   
ref|XP_002263991.1|  PREDICTED: 21 kDa protein                        73.2    2e-12   
ref|XP_011010936.1|  PREDICTED: 21 kDa protein-like isoform X1        73.2    2e-12   
ref|XP_008235094.1|  PREDICTED: 21 kDa protein-like                   73.2    2e-12   
ref|XP_004243686.1|  PREDICTED: 21 kDa protein                        72.8    2e-12   
ref|XP_010493188.1|  PREDICTED: 21 kDa protein-like                   73.2    2e-12   
ref|XP_006444353.1|  hypothetical protein CICLE_v10022355mg           72.8    2e-12   
ref|XP_007039937.1|  Plant invertase/pectin methylesterase inhibi...  72.8    2e-12   
ref|XP_011078159.1|  PREDICTED: pectinesterase-like isoform X1        75.9    2e-12   
ref|XP_007024770.1|  Pectin methylesterase 3 isoform 1                75.9    2e-12   
gb|AFQ23194.1|  pectin methylesterase                                 75.9    2e-12   
tpg|DAA64102.1|  TPA: hypothetical protein ZEAMMB73_876271            74.7    2e-12   
gb|AFK49039.1|  unknown                                               72.8    2e-12   
gb|KDP25617.1|  hypothetical protein JCGZ_20773                       72.8    2e-12   
ref|XP_004240754.1|  PREDICTED: 21 kDa protein-like                   72.4    2e-12   
ref|XP_009374503.1|  PREDICTED: 21 kDa protein-like                   72.8    3e-12   
ref|XP_007163112.1|  hypothetical protein PHAVU_001G207300g           72.4    3e-12   
ref|XP_006490092.1|  PREDICTED: 21 kDa protein-like                   72.4    3e-12   
ref|XP_011078160.1|  PREDICTED: pectinesterase-like isoform X2        75.5    3e-12   
ref|XP_007131335.1|  hypothetical protein PHAVU_011G005200g           72.4    3e-12   
ref|XP_010671450.1|  PREDICTED: probable pectinesterase/pectinest...  75.5    3e-12   
emb|CDP05319.1|  unnamed protein product                              72.4    3e-12   
ref|XP_011101127.1|  PREDICTED: 21 kDa protein-like                   72.4    3e-12   
gb|KDO65436.1|  hypothetical protein CISIN_1g028434mg                 72.4    4e-12   
ref|XP_006421708.1|  hypothetical protein CICLE_v10007178mg           72.4    4e-12   
gb|EYU43527.1|  hypothetical protein MIMGU_mgv1a024700mg              72.0    4e-12   
ref|XP_009393953.1|  PREDICTED: 21 kDa protein-like                   72.0    4e-12   
ref|XP_010550579.1|  PREDICTED: 21 kDa protein                        72.0    4e-12   
ref|XP_009594970.1|  PREDICTED: 21 kDa protein-like                   72.0    4e-12   
ref|XP_008380988.1|  PREDICTED: probable pectinesterase/pectinest...  74.7    5e-12   
ref|XP_008653464.1|  PREDICTED: pectinesterase-like                   74.7    5e-12   
ref|XP_009372895.1|  PREDICTED: 21 kDa protein-like                   71.6    5e-12   
ref|XP_009370482.1|  PREDICTED: 21 kDa protein-like                   71.6    6e-12   
ref|XP_002322406.1|  21K protein precursor                            71.6    6e-12   
ref|XP_009587354.1|  PREDICTED: 21 kDa protein-like                   71.2    6e-12   
ref|XP_008242331.1|  PREDICTED: pectinesterase-like                   74.3    6e-12   
ref|XP_006599763.1|  PREDICTED: pectinesterase/pectinesterase inh...  73.9    7e-12   
ref|XP_008357027.1|  PREDICTED: 21 kDa protein-like                   71.2    8e-12   
ref|XP_009779202.1|  PREDICTED: 21 kDa protein-like                   71.2    8e-12   
ref|XP_003517432.1|  PREDICTED: 21 kDa protein                        71.2    8e-12   
ref|XP_006357906.1|  PREDICTED: 21 kDa protein-like                   70.9    9e-12   
ref|XP_002264028.1|  PREDICTED: 21 kDa protein                        70.9    9e-12   
gb|ACU15105.1|  unknown                                               70.9    9e-12   
ref|XP_007210765.1|  hypothetical protein PRUPE_ppa020079mg           72.0    1e-11   
ref|XP_010062118.1|  PREDICTED: 21 kDa protein-like                   70.5    1e-11   
ref|XP_008387667.1|  PREDICTED: 21 kDa protein-like                   70.5    1e-11   
ref|XP_011010941.1|  PREDICTED: 21 kDa protein-like                   70.5    1e-11   
ref|XP_010545015.1|  PREDICTED: 21 kDa protein-like                   70.5    1e-11   
ref|XP_002523085.1|  21 kDa protein precursor, putative               70.5    1e-11   
ref|XP_006400644.1|  hypothetical protein EUTSA_v10014618mg           70.5    1e-11   
ref|XP_008783567.1|  PREDICTED: 21 kDa protein-like                   70.1    2e-11   
ref|XP_009351999.1|  PREDICTED: probable pectinesterase/pectinest...  73.2    2e-11   
gb|KJB25636.1|  hypothetical protein B456_004G201400                  70.1    2e-11   
ref|XP_004148136.1|  PREDICTED: 21 kDa protein-like                   70.1    2e-11   
gb|ABK24883.1|  unknown                                               72.8    2e-11   
ref|XP_008439100.1|  PREDICTED: 21 kDa protein-like                   69.7    2e-11   
gb|EYU24972.1|  hypothetical protein MIMGU_mgv1a023170mg              69.7    2e-11   
ref|XP_007131336.1|  hypothetical protein PHAVU_011G005300g           69.7    2e-11   
ref|XP_010091300.1|  21 kDa protein                                   69.7    2e-11   
ref|XP_007038423.1|  Plant invertase/pectin methylesterase inhibi...  70.1    2e-11   
gb|AAM67063.1|  putative ripening-related protein                     69.7    2e-11   
emb|CBA10126.1|  PME inhibitor                                        69.7    2e-11   
ref|XP_011094019.1|  PREDICTED: pectinesterase-like                   72.8    2e-11   
gb|EYU25806.1|  hypothetical protein MIMGU_mgv1a003215mg              72.4    2e-11   
gb|EYU19641.1|  hypothetical protein MIMGU_mgv1a003247mg              72.4    3e-11   
ref|XP_004170129.1|  PREDICTED: pectinesterase 3-like                 72.4    3e-11   
ref|XP_004139620.1|  PREDICTED: pectinesterase 3-like                 72.4    3e-11   
ref|XP_009401795.1|  PREDICTED: 21 kDa protein-like                   69.3    3e-11   
ref|XP_007204488.1|  hypothetical protein PRUPE_ppa019698mg           72.0    3e-11   
ref|XP_003559807.1|  PREDICTED: pectinesterase-like                   72.0    3e-11   
ref|XP_002267786.1|  PREDICTED: 21 kDa protein                        69.3    4e-11   
ref|XP_007210220.1|  hypothetical protein PRUPE_ppa015829mg           69.3    4e-11   
ref|XP_011041731.1|  PREDICTED: 21 kDa protein-like                   68.9    4e-11   
ref|XP_010055534.1|  PREDICTED: 21 kDa protein-like                   69.3    4e-11   
ref|XP_011081381.1|  PREDICTED: 21 kDa protein                        68.6    4e-11   
ref|XP_010062095.1|  PREDICTED: 21 kDa protein-like                   68.9    4e-11   
ref|XP_011076330.1|  PREDICTED: 21 kDa protein-like                   68.9    5e-11   
ref|XP_006838616.1|  hypothetical protein AMTR_s00002p00229990        68.9    5e-11   
gb|EYU25226.1|  hypothetical protein MIMGU_mgv1a0032972mg             70.9    5e-11   
ref|XP_002264101.1|  PREDICTED: 21 kDa protein-like                   68.9    5e-11   
ref|XP_011018248.1|  PREDICTED: 21 kDa protein                        68.9    5e-11   
ref|XP_011029962.1|  PREDICTED: 21 kDa protein-like                   68.6    5e-11   
ref|XP_009796710.1|  PREDICTED: 21 kDa protein-like                   68.6    6e-11   
ref|XP_010047423.1|  PREDICTED: pectinesterase-like                   71.2    6e-11   
ref|NP_564802.1|  plant invertase/pectin methylesterase inhibitor...  68.6    7e-11   
ref|XP_006288672.1|  hypothetical protein CARUB_v10001980mg           68.6    7e-11   
ref|XP_011033536.1|  PREDICTED: 21 kDa protein                        68.2    7e-11   
ref|XP_010430353.1|  PREDICTED: 21 kDa protein-like                   68.6    7e-11   
ref|XP_011084508.1|  PREDICTED: probable pectinesterase/pectinest...  71.2    7e-11   
ref|XP_003591526.1|  21 kDa protein                                   68.6    7e-11   
ref|XP_006289196.1|  hypothetical protein CARUB_v10002644mg           70.9    8e-11   
gb|EYU24974.1|  hypothetical protein MIMGU_mgv1a014119mg              68.2    8e-11   
ref|XP_010483947.1|  PREDICTED: 21 kDa protein-like                   68.2    8e-11   
ref|XP_008350094.1|  PREDICTED: 21 kDa protein-like                   68.2    8e-11   
ref|XP_010921646.1|  PREDICTED: putative pectinesterase/pectinest...  70.9    9e-11   
ref|XP_004511656.1|  PREDICTED: 21 kDa protein-like                   68.2    9e-11   
gb|KDP22406.1|  hypothetical protein JCGZ_26237                       67.8    9e-11   
gb|ABK94287.1|  unknown                                               67.8    1e-10   
ref|XP_006302816.1|  hypothetical protein CARUB_v10020941mg           68.2    1e-10   
ref|XP_009362113.1|  PREDICTED: 21 kDa protein-like                   68.2    1e-10   
ref|XP_010259198.1|  PREDICTED: 21 kDa protein-like                   68.2    1e-10   
ref|XP_010458832.1|  PREDICTED: 21 kDa protein-like                   67.8    1e-10   
ref|XP_010418275.1|  PREDICTED: 21 kDa protein-like                   67.8    1e-10   
ref|XP_010444080.1|  PREDICTED: 21 kDa protein-like                   67.8    1e-10   
ref|XP_010473499.1|  PREDICTED: 21 kDa protein-like                   67.8    1e-10   
ref|XP_002318283.1|  21K protein precursor                            67.8    1e-10   
ref|XP_008784634.1|  PREDICTED: 21 kDa protein-like                   67.8    1e-10   
ref|XP_009614734.1|  PREDICTED: probable pectinesterase/pectinest...  70.5    1e-10   
ref|XP_008376726.1|  PREDICTED: probable pectinesterase/pectinest...  70.5    1e-10   
gb|KJB51924.1|  hypothetical protein B456_008G238400                  67.8    1e-10   
ref|XP_008458040.1|  PREDICTED: LOW QUALITY PROTEIN: pectinestera...  70.5    1e-10   
ref|XP_009603391.1|  PREDICTED: 21 kDa protein-like                   67.4    1e-10   
ref|XP_011024825.1|  PREDICTED: probable pectinesterase/pectinest...  70.5    1e-10   
ref|XP_008369524.1|  PREDICTED: 21 kDa protein                        67.4    2e-10   
ref|XP_010273892.1|  PREDICTED: 21 kDa protein-like                   67.4    2e-10   
ref|XP_006452919.1|  hypothetical protein CICLE_v10007806mg           70.1    2e-10   
ref|XP_010069915.1|  PREDICTED: 21 kDa protein                        67.0    2e-10   
gb|KDO73733.1|  hypothetical protein CISIN_1g008261mg                 70.1    2e-10   
ref|XP_002872846.1|  predicted protein                                69.7    2e-10   
ref|NP_001275846.1|  putative thermostable pectinesterase             70.1    2e-10   
ref|XP_004234936.1|  PREDICTED: 21 kDa protein-like                   67.4    2e-10   
gb|AFK49081.1|  unknown                                               67.0    2e-10   
ref|XP_009608759.1|  PREDICTED: 21 kDa protein-like                   67.0    2e-10   
ref|XP_011076457.1|  PREDICTED: probable pectinesterase/pectinest...  69.7    2e-10   
ref|XP_009370483.1|  PREDICTED: 21 kDa protein-like                   67.0    2e-10   
gb|KFK42156.1|  hypothetical protein AALP_AA2G218600                  67.0    2e-10   
ref|XP_004234960.1|  PREDICTED: probable pectinesterase/pectinest...  69.7    2e-10   
gb|EMT05022.1|  Pectinesterase 3                                      69.3    2e-10   
ref|XP_002516188.1|  Pectinesterase-3 precursor, putative             69.7    2e-10   
gb|KFK40567.1|  hypothetical protein AALP_AA2G012900                  67.0    2e-10   
gb|EYU29496.1|  hypothetical protein MIMGU_mgv1a003055mg              69.7    2e-10   
ref|NP_201041.1|  plant invertase/pectin methylesterase inhibitor...  67.0    2e-10   
ref|XP_006362112.1|  PREDICTED: 21 kDa protein-like                   67.0    2e-10   
gb|KJB19691.1|  hypothetical protein B456_003G114800                  66.6    2e-10   
ref|XP_010426179.1|  PREDICTED: 21 kDa protein-like                   67.0    2e-10   
ref|XP_010259039.1|  PREDICTED: 21 kDa protein-like                   66.6    3e-10   
ref|XP_009767771.1|  PREDICTED: 21 kDa protein                        66.6    3e-10   
ref|XP_006826916.1|  hypothetical protein AMTR_s00010p00166600        66.6    3e-10   
ref|XP_009595798.1|  PREDICTED: 21 kDa protein-like                   66.6    3e-10   
ref|XP_006350555.1|  PREDICTED: probable pectinesterase/pectinest...  69.3    3e-10   
ref|XP_009618650.1|  PREDICTED: 21 kDa protein-like                   66.6    3e-10   
gb|ACN40878.1|  unknown                                               69.3    3e-10   
ref|XP_008238631.1|  PREDICTED: 21 kDa protein                        66.6    3e-10   
ref|XP_010503338.1|  PREDICTED: 21 kDa protein-like                   66.6    3e-10   
ref|XP_010515044.1|  PREDICTED: 21 kDa protein-like                   66.6    3e-10   
ref|XP_009799203.1|  PREDICTED: pectinesterase 1-like                 68.6    3e-10   
ref|NP_001289259.1|  probable pectinesterase/pectinesterase inhib...  69.3    3e-10   
ref|XP_002874013.1|  hypothetical protein ARALYDRAFT_488983           66.6    3e-10   
ref|XP_008812393.1|  PREDICTED: pectinesterase-like                   68.9    3e-10   
emb|CDP05320.1|  unnamed protein product                              66.2    4e-10   
ref|XP_009409132.1|  PREDICTED: pectinesterase-like                   68.9    4e-10   
ref|XP_008451567.1|  PREDICTED: 21 kDa protein                        66.2    4e-10   
ref|XP_003588521.1|  Pectinesterase                                   68.9    4e-10   
ref|XP_002886455.1|  hypothetical protein ARALYDRAFT_475076           66.2    4e-10   
ref|XP_010932336.1|  PREDICTED: pectinesterase-like                   68.6    4e-10   
ref|XP_002864786.1|  hypothetical protein ARALYDRAFT_496412           65.9    5e-10   
gb|AAM67138.1|  ripening-related protein-like                         65.9    5e-10   
ref|NP_192139.1|  Probable pectinesterase/pectinesterase inhibito...  68.6    5e-10   
ref|XP_010915944.1|  PREDICTED: probable pectinesterase/pectinest...  68.6    5e-10   
ref|XP_006440385.1|  hypothetical protein CICLE_v10023344mg           65.9    6e-10   
ref|XP_008779098.1|  PREDICTED: 21 kDa protein-like                   65.5    6e-10   
ref|XP_006490091.1|  PREDICTED: 21 kDa protein-like                   65.9    6e-10   
ref|XP_007220895.1|  hypothetical protein PRUPE_ppa003047mg           68.2    7e-10   
ref|XP_006421709.1|  hypothetical protein CICLE_v10005888mg           65.9    7e-10   
ref|XP_010919055.1|  PREDICTED: 21 kDa protein-like                   65.5    7e-10   
ref|XP_007039938.1|  Plant invertase/pectin methylesterase inhibi...  65.5    7e-10   
ref|XP_007039952.1|  Plant invertase/pectin methylesterase inhibi...  65.5    7e-10   
emb|CDY31841.1|  BnaC09g13080D                                        65.5    8e-10   
ref|XP_006345247.1|  PREDICTED: 21 kDa protein-like                   65.1    8e-10   
ref|XP_009372896.1|  PREDICTED: 21 kDa protein-like                   65.1    9e-10   
emb|CDP09903.1|  unnamed protein product                              65.1    9e-10   
ref|XP_006353777.1|  PREDICTED: 21 kDa protein-like                   65.1    1e-09   
ref|XP_006440386.1|  hypothetical protein CICLE_v10022313mg           65.1    1e-09   
emb|CDY70789.1|  BnaCnng69780D                                        65.1    1e-09   
ref|XP_010266532.1|  PREDICTED: probable pectinesterase/pectinest...  67.8    1e-09   
ref|NP_197574.1|  plant invertase/pectin methylesterase inhibitor...  65.1    1e-09   
ref|XP_010672019.1|  PREDICTED: 21 kDa protein-like                   65.1    1e-09   
ref|XP_007151983.1|  hypothetical protein PHAVU_004G091900g           65.1    1e-09   
ref|XP_010933727.1|  PREDICTED: 21 kDa protein                        65.1    1e-09   
gb|AFK45022.1|  unknown                                               64.7    1e-09   
ref|XP_010931030.1|  PREDICTED: 21 kDa protein-like                   64.7    1e-09   
ref|XP_009370516.1|  PREDICTED: 21 kDa protein-like                   64.7    1e-09   
ref|XP_004234934.1|  PREDICTED: 21 kDa protein-like                   64.7    1e-09   
gb|KDP22408.1|  hypothetical protein JCGZ_26239                       64.3    1e-09   
ref|XP_006281134.1|  hypothetical protein CARUB_v10027165mg           64.7    1e-09   
ref|XP_002317777.2|  hypothetical protein POPTR_0012s02170g           67.0    1e-09   
gb|KDP22407.1|  hypothetical protein JCGZ_26238                       64.7    1e-09   
ref|XP_008806757.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...  67.0    2e-09   
ref|XP_010687791.1|  PREDICTED: pectinesterase 3-like                 66.6    2e-09   
ref|XP_010553474.1|  PREDICTED: 21 kDa protein-like                   64.7    2e-09   
emb|CDY46921.1|  BnaA09g12730D                                        64.7    2e-09   
ref|XP_010533758.1|  PREDICTED: 21 kDa protein                        64.7    2e-09   
gb|AFK45126.1|  unknown                                               64.3    2e-09   
ref|XP_009113050.1|  PREDICTED: 21 kDa protein                        64.3    2e-09   
ref|XP_009348912.1|  PREDICTED: pectinesterase-like                   67.0    2e-09   
ref|XP_010267633.1|  PREDICTED: probable pectinesterase/pectinest...  67.0    2e-09   
ref|XP_006367807.1|  PREDICTED: 21 kDa protein-like                   64.3    2e-09   
ref|XP_010261671.1|  PREDICTED: pectinesterase-like                   67.0    2e-09   
ref|XP_006291874.1|  hypothetical protein CARUB_v10018051mg           64.3    2e-09   
ref|XP_009149923.1|  PREDICTED: 21 kDa protein                        64.3    2e-09   
ref|XP_010035249.1|  PREDICTED: probable pectinesterase/pectinest...  66.6    2e-09   
gb|ACJ86212.1|  unknown                                               64.7    2e-09   
emb|CDX99059.1|  BnaA06g17500D                                        64.3    2e-09   
ref|XP_006421712.1|  hypothetical protein CICLE_v10007113mg           64.3    2e-09   
ref|XP_009392885.1|  PREDICTED: 21 kDa protein-like                   64.3    2e-09   
ref|XP_010671449.1|  PREDICTED: probable pectinesterase/pectinest...  66.6    2e-09   
ref|XP_003611258.1|  Pectinesterase                                   64.3    2e-09   
ref|XP_006391825.1|  hypothetical protein EUTSA_v10023696mg           64.3    2e-09   
ref|XP_009597893.1|  PREDICTED: 21 kDa protein-like                   64.3    2e-09   
ref|XP_010093661.1|  21 kDa protein                                   64.3    2e-09   
ref|XP_006381574.1|  hypothetical protein POPTR_0006s14010g           63.9    2e-09   
ref|XP_002264891.1|  PREDICTED: 21 kDa protein                        63.9    2e-09   
gb|KJB81040.1|  hypothetical protein B456_013G126800                  66.2    2e-09   
ref|XP_007218426.1|  hypothetical protein PRUPE_ppa011607mg           63.9    2e-09   
gb|ACJ83345.1|  unknown                                               63.9    2e-09   
ref|XP_008376226.1|  PREDICTED: 21 kDa protein-like                   63.9    3e-09   
ref|XP_007050926.1|  Plant invertase/pectin methylesterase inhibi...  63.9    3e-09   
ref|NP_001235143.1|  uncharacterized protein LOC100527116 precursor   63.9    3e-09   
ref|XP_010035020.1|  PREDICTED: 21 kDa protein-like                   64.3    3e-09   



>gb|EPS62329.1| pectinesterase [Genlisea aurea]
Length=560

 Score =   196 bits (497),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 95/158 (60%), Positives = 123/158 (78%), Gaps = 2/158 (1%)
 Frame = -1

Query  471  IHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAA  292
            IH  + +QVA + AC+GTLYP+LCVST++  LP+ R KT+PEIIAAT+NVT+ EV+ +++
Sbjct  34   IHAYEHVQVAES-ACDGTLYPDLCVSTVSAVLPELRRKTLPEIIAATINVTMKEVRTASS  92

Query  291  NCSGIRRKL-PRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDLQTFFS  115
            NCS +RRKL  +L PLE RAL+DCLELFS T  +L K+ SDL  +++  K+Y DL+T  S
Sbjct  93   NCSSLRRKLNKKLEPLELRALEDCLELFSYTASDLSKIFSDLKASSAQEKYYDDLRTLLS  152

Query  114  AAMTNQATCLDGFAYSKKHVRRIIEKRLVQISHHVSNA  1
            AAMTNQ TCLDGFAYSK + R II+ RL +ISHH SNA
Sbjct  153  AAMTNQYTCLDGFAYSKNNTREIIQGRLKRISHHASNA  190



>ref|XP_011015915.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=558

 Score =   194 bits (492),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 97/157 (62%), Positives = 122/157 (78%), Gaps = 3/157 (2%)
 Frame = -1

Query  471  IHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAA  292
            +H  K +Q+AH+ AC+GTLYPELCVSTL + LPD  +K++PE I+AT+N T+DEV+AS+A
Sbjct  43   LHIHKHIQIAHS-ACKGTLYPELCVSTLVS-LPDLASKSLPEFISATLNKTMDEVRASSA  100

Query  291  NCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDLQTFFSA  112
            NC+ IR K+ +LGPLEK AL DC+ELF +T  EL+  +SDLA   S+SKHY DLQT  S 
Sbjct  101  NCNAIRNKI-KLGPLEKVALKDCIELFDDTIAELKSAISDLAPRKSTSKHYHDLQTLLSG  159

Query  111  AMTNQATCLDGFAYSKKHVRRIIEKRLVQISHHVSNA  1
            AMTNQ TCLDGFA SK  VR+ I+K L  ISHHVSN+
Sbjct  160  AMTNQYTCLDGFARSKGKVRKAIKKGLYNISHHVSNS  196



>ref|XP_002271665.2| PREDICTED: pectinesterase-like [Vitis vinifera]
Length=561

 Score =   190 bits (483),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 104/193 (54%), Positives = 132/193 (68%), Gaps = 3/193 (2%)
 Frame = -1

Query  579  AIVLLAFLSVTSFNSLFTKDGISSSTGPTHLDLNLNIHRQKLLQVAHTEACEGTLYPELC  400
            A  LL+ LS+++F  L           P + ++   +H  K +Q+AH+  CEGTLYPELC
Sbjct  8    AKFLLSLLSISAFAFLLLTTVKPLKKSPKNTEIP-QLHLHKHVQIAHSH-CEGTLYPELC  65

Query  399  VSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGPLEKRALDDCL  220
            VSTL+T  PD  +KT+PE+IAATV+ TV EVK SA+NCSGIRRKL  L  LE RA++DCL
Sbjct  66   VSTLST-FPDLASKTVPEVIAATVSHTVGEVKLSASNCSGIRRKLKNLNTLEGRAINDCL  124

Query  219  ELFSETRDELRKVLSDLATTASSSKHYVDLQTFFSAAMTNQATCLDGFAYSKKHVRRIIE  40
            EL   T  +L+  +SDL+   S +KHY DLQT  S ++TN  TCLDGFAYSKKH+R  IE
Sbjct  125  ELHDCTIAQLQSTISDLSHNNSPAKHYHDLQTLLSGSITNLYTCLDGFAYSKKHIRSSIE  184

Query  39   KRLVQISHHVSNA  1
              L  ISHHVSN+
Sbjct  185  GPLRNISHHVSNS  197



>emb|CBI36883.3| unnamed protein product [Vitis vinifera]
Length=549

 Score =   190 bits (483),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 104/193 (54%), Positives = 132/193 (68%), Gaps = 3/193 (2%)
 Frame = -1

Query  579  AIVLLAFLSVTSFNSLFTKDGISSSTGPTHLDLNLNIHRQKLLQVAHTEACEGTLYPELC  400
            A  LL+ LS+++F  L           P + ++   +H  K +Q+AH+  CEGTLYPELC
Sbjct  18   AKFLLSLLSISAFAFLLLTTVKPLKKSPKNTEIP-QLHLHKHVQIAHSH-CEGTLYPELC  75

Query  399  VSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGPLEKRALDDCL  220
            VSTL+T  PD  +KT+PE+IAATV+ TV EVK SA+NCSGIRRKL  L  LE RA++DCL
Sbjct  76   VSTLST-FPDLASKTVPEVIAATVSHTVGEVKLSASNCSGIRRKLKNLNTLEGRAINDCL  134

Query  219  ELFSETRDELRKVLSDLATTASSSKHYVDLQTFFSAAMTNQATCLDGFAYSKKHVRRIIE  40
            EL   T  +L+  +SDL+   S +KHY DLQT  S ++TN  TCLDGFAYSKKH+R  IE
Sbjct  135  ELHDCTIAQLQSTISDLSHNNSPAKHYHDLQTLLSGSITNLYTCLDGFAYSKKHIRSSIE  194

Query  39   KRLVQISHHVSNA  1
              L  ISHHVSN+
Sbjct  195  GPLRNISHHVSNS  207



>ref|XP_011010963.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=558

 Score =   190 bits (482),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 96/157 (61%), Positives = 121/157 (77%), Gaps = 3/157 (2%)
 Frame = -1

Query  471  IHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAA  292
            +H  K +Q+AH+ AC+GTLYPELCVSTL + L D  +K++PE I+AT+N T+DEV+AS+A
Sbjct  43   LHIHKHIQIAHS-ACKGTLYPELCVSTLVS-LSDLASKSLPEFISATLNKTMDEVRASSA  100

Query  291  NCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDLQTFFSA  112
            NC+ IR K+ +LGPLEK AL DC+ELF +T  EL+  +SDLA   S+SKHY DLQT  S 
Sbjct  101  NCNAIRNKI-KLGPLEKVALKDCIELFDDTIAELKSAISDLAPRKSTSKHYHDLQTLLSG  159

Query  111  AMTNQATCLDGFAYSKKHVRRIIEKRLVQISHHVSNA  1
            AMTNQ TCLDGFA SK  VR+ I+K L  ISHHVSN+
Sbjct  160  AMTNQYTCLDGFARSKGKVRKAIKKGLYNISHHVSNS  196



>emb|CDP15269.1| unnamed protein product [Coffea canephora]
Length=385

 Score =   186 bits (472),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 91/158 (58%), Positives = 120/158 (76%), Gaps = 3/158 (2%)
 Frame = -1

Query  471  IHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAA  292
            IH  + LQ+AH+  C+ T YP+LCVSTLAT  PD R +T+PEII+  VN TV EV+ S  
Sbjct  69   IHVHQHLQIAHS-TCQDTFYPDLCVSTLAT-FPDLRQRTLPEIISGMVNSTVFEVRDSKQ  126

Query  291  NCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDLQTFFSA  112
            NC+ IRRKL  L PL++RAL+DCL+L  +T  +L+  +SDL++  S+ +HY+DLQT FSA
Sbjct  127  NCTRIRRKLQNLDPLDRRALEDCLQLLDDTVAQLKAAISDLSSNKSALQHYMDLQTLFSA  186

Query  111  AMTNQATCLDGFAYS-KKHVRRIIEKRLVQISHHVSNA  1
            AMTNQ TCLDGFA+S +K++R  IE RL +ISHHVSN+
Sbjct  187  AMTNQDTCLDGFAFSRRKYIREFIEGRLRKISHHVSNS  224



>ref|XP_009592542.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=568

 Score =   189 bits (480),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 103/212 (49%), Positives = 141/212 (67%), Gaps = 10/212 (5%)
 Frame = -1

Query  633  MHNLKQKATLFFTISGCSAIVLLAFLSVTSFNSLFTKDGISSSTGPTHLDLNLNIHRQKL  454
            M+N++ K +L  TI   +A++LL F  + S       +  SSS+      +  +IH  K 
Sbjct  1    MYNIRHKPSLILTILASTALILLTFFVLLS-------NPKSSSSRAAEKTMTPHIHVHKN  53

Query  453  LQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIR  274
            +Q+A +  CEGTL+PELCVSTL++  P+   K+I EII++TV + V EV+ASA NCS +R
Sbjct  54   IQIAQSH-CEGTLHPELCVSTLSS-FPNLHRKSIAEIISSTVKIAVGEVRASAHNCSDLR  111

Query  273  RKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDLQTFFSAAMTNQA  94
            R +P+L P+EKRAL DC+EL  ET  ELR  LSDL+   S+SKHY D+QT  SAAMTN+ 
Sbjct  112  RHVPKLEPIEKRALQDCVELLGETIAELRTALSDLSPKKSASKHYNDIQTLLSAAMTNED  171

Query  93   TCLDGFAYS-KKHVRRIIEKRLVQISHHVSNA  1
            TCLDG  YS K ++ R +E  L  I+HHVSN+
Sbjct  172  TCLDGLFYSTKNNLTRYVEDNLHTIAHHVSNS  203



>ref|XP_011079629.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=566

 Score =   188 bits (478),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 91/158 (58%), Positives = 124/158 (78%), Gaps = 3/158 (2%)
 Frame = -1

Query  471  IHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAA  292
            IH  + +Q+A +  CEGTLYP+LCVST+A A P+ R KT+PEII+ T+NVT+ EV+ASA+
Sbjct  41   IHVYRHVQIAKS-TCEGTLYPDLCVSTVA-AFPELRRKTLPEIISGTINVTMKEVRASAS  98

Query  291  NCSGIRRKL-PRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDLQTFFS  115
            NCS +RRKL  +L PL+ +ALDDCLELFS+T  EL+++L++L+   S  K+Y DLQT  S
Sbjct  99   NCSSLRRKLMKKLAPLDLQALDDCLELFSDTVGELKRILAELSAGNSPEKYYDDLQTLLS  158

Query  114  AAMTNQATCLDGFAYSKKHVRRIIEKRLVQISHHVSNA  1
             AMTNQ TCLDGFAYSK + R++I+ RL +I+ H+SN+
Sbjct  159  GAMTNQDTCLDGFAYSKNNTRQLIQGRLKRITKHMSNS  196



>emb|CDP15270.1| unnamed protein product [Coffea canephora]
Length=587

 Score =   187 bits (474),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 91/158 (58%), Positives = 121/158 (77%), Gaps = 3/158 (2%)
 Frame = -1

Query  471  IHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAA  292
            IH  + LQ+AH+  C+ T YP+LCVSTLAT  PD R +T+PEII+  VN TV EV+ S  
Sbjct  61   IHVHQHLQIAHS-TCQDTFYPDLCVSTLAT-FPDLRQRTLPEIISGMVNSTVFEVRDSKQ  118

Query  291  NCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDLQTFFSA  112
            NC+ IRRKL  L PL++RAL+DCL+L  +T  +L+  +SDL++  S+ +HY+DLQT FSA
Sbjct  119  NCTRIRRKLQNLDPLDRRALEDCLQLLDDTFAQLKAAISDLSSNKSALQHYMDLQTLFSA  178

Query  111  AMTNQATCLDGFAYS-KKHVRRIIEKRLVQISHHVSNA  1
            AMTNQ TCLDGFA+S +K++R+ IE RL +ISHHVSN+
Sbjct  179  AMTNQDTCLDGFAFSGRKYIRKFIEGRLRKISHHVSNS  216



>gb|AHB84678.1| pectin methylesterase [Citrus reticulata]
Length=569

 Score =   185 bits (469),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 102/195 (52%), Positives = 132/195 (68%), Gaps = 12/195 (6%)
 Frame = -1

Query  582  SAIVLLAF-LSVTSFNSLFTKDGISSSTGPTHLDLNLNIHRQKLLQVAHTEACEGTLYPE  406
            SAI LL F LS  S  +L  K    ++  P     +L +H+    QVAH+ ACEGTLYPE
Sbjct  22   SAIFLLLFVLSAVSVTTL--KKNPKTTDAP-----HLRVHKH--FQVAHS-ACEGTLYPE  71

Query  405  LCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGPLEKRALDD  226
            LCVSTL + +PD  +K +PE+I+ T+N T+ E++AS++NCS I +  P    LEKRA++D
Sbjct  72   LCVSTLLS-VPDLASKRVPELISVTINRTLSELRASSSNCSSIGQSYPNFNTLEKRAIND  130

Query  225  CLELFSETRDELRKVLSDLATTASSSKHYVDLQTFFSAAMTNQATCLDGFAYSKKHVRRI  46
            CLELF +T  EL+  L+DL+   S SKHY DLQT FS AMTNQ TCLDGFAYS  +VR +
Sbjct  131  CLELFHDTIVELKSALNDLSPKKSPSKHYHDLQTLFSGAMTNQYTCLDGFAYSDGNVREV  190

Query  45   IEKRLVQISHHVSNA  1
            I+  L  IS HVSN+
Sbjct  191  IKSSLYNISRHVSNS  205



>ref|XP_002301486.2| hypothetical protein POPTR_0002s20370g [Populus trichocarpa]
 gb|EEE80759.2| hypothetical protein POPTR_0002s20370g [Populus trichocarpa]
Length=558

 Score =   184 bits (467),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 93/157 (59%), Positives = 120/157 (76%), Gaps = 3/157 (2%)
 Frame = -1

Query  471  IHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAA  292
            +H  K +Q+AH+ AC+GTLYPELCVSTL + LPD  +K++ E I+AT+N T+DEV+AS+A
Sbjct  43   LHIHKHIQIAHS-ACKGTLYPELCVSTLVS-LPDLASKSLQEFISATLNKTMDEVRASSA  100

Query  291  NCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDLQTFFSA  112
            +C+ IR K+ +LGPLEK AL DC+ELF +T  EL+  +S+LA    +SKHY DLQT  S 
Sbjct  101  DCNAIRNKM-KLGPLEKVALKDCIELFDDTIAELKSAISNLALRKPTSKHYHDLQTLLSG  159

Query  111  AMTNQATCLDGFAYSKKHVRRIIEKRLVQISHHVSNA  1
            AMTNQ TCLDGFA SK  VR+ I+K L  ISHHVSN+
Sbjct  160  AMTNQYTCLDGFARSKGKVRKAIKKGLYNISHHVSNS  196



>ref|XP_003519757.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 40-like 
[Glycine max]
Length=562

 Score =   183 bits (465),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 96/190 (51%), Positives = 128/190 (67%), Gaps = 8/190 (4%)
 Frame = -1

Query  570  LLAFLSVTSFNSLFTKDGISSSTGPTHLDLNLNIHRQKLLQVAHTEACEGTLYPELCVST  391
            LL FL  T F    T   I+ +  P    L+   H QK +QV     C+GTLYP+LCVST
Sbjct  16   LLLFLGTTHF----TNTPITITRAPDQKHLH---HFQKHIQVVAKSTCQGTLYPDLCVST  68

Query  390  LATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGPLEKRALDDCLELF  211
            LAT  PD   K++P++I++ VN T+ EV++S+ NCSG+++ L  L PL++RALDDCL+LF
Sbjct  69   LAT-FPDLATKSVPQVISSVVNHTMYEVRSSSYNCSGLKKMLKNLNPLDQRALDDCLKLF  127

Query  210  SETRDELRKVLSDLATTASSSKHYVDLQTFFSAAMTNQATCLDGFAYSKKHVRRIIEKRL  31
             +T  EL+  + DL+ +   SK + DLQT  S AMTN  TCLDGFAYSK  VR  IEK+L
Sbjct  128  EDTNVELKATIDDLSKSTIGSKRHHDLQTMLSGAMTNLYTCLDGFAYSKGRVRDRIEKKL  187

Query  30   VQISHHVSNA  1
            ++ISHHVSN+
Sbjct  188  LEISHHVSNS  197



>ref|XP_010269596.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=561

 Score =   182 bits (461),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 92/157 (59%), Positives = 116/157 (74%), Gaps = 2/157 (1%)
 Frame = -1

Query  471  IHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAA  292
            +H  K LQ+AH+ ACEGTLYPELCVST+++  PD  +KTIP+II+ATV  TV+EV+ SA+
Sbjct  44   LHLHKHLQIAHS-ACEGTLYPELCVSTVSS-FPDLASKTIPDIISATVQHTVNEVRTSAS  101

Query  291  NCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDLQTFFSA  112
            NC+G R K   L PL++ ALDDCLEL  ET  EL+  LSDL+   S S+HY DL T  SA
Sbjct  102  NCTGJRMKRRTLDPLQQMALDDCLELLDETVAELKSALSDLSPKNSPSRHYNDLGTLLSA  161

Query  111  AMTNQATCLDGFAYSKKHVRRIIEKRLVQISHHVSNA  1
            AMTN+ TCLDGF +SK +VR  I++ L  ISH VSN+
Sbjct  162  AMTNEYTCLDGFVHSKGNVREEIKQGLYNISHSVSNS  198



>ref|XP_006444399.1| hypothetical protein CICLE_v100237231mg, partial [Citrus clementina]
 gb|ESR57639.1| hypothetical protein CICLE_v100237231mg, partial [Citrus clementina]
Length=548

 Score =   181 bits (460),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 101/195 (52%), Positives = 131/195 (67%), Gaps = 12/195 (6%)
 Frame = -1

Query  582  SAIVLLAF-LSVTSFNSLFTKDGISSSTGPTHLDLNLNIHRQKLLQVAHTEACEGTLYPE  406
            SAI LL F LS  S  +L  K    ++  P     +L +H+    QVAH+ ACEGTLYPE
Sbjct  1    SAIFLLLFVLSAVSVTTL--KKNPKTTDAP-----HLRVHKH--FQVAHS-ACEGTLYPE  50

Query  405  LCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGPLEKRALDD  226
            LCVSTL + +PD  +K +PE+I+ T+N T+ E++AS++NCS I +  P    LEKRA++D
Sbjct  51   LCVSTLLS-VPDLASKRVPELISVTINRTLSELRASSSNCSSIGQSYPNFNTLEKRAIND  109

Query  225  CLELFSETRDELRKVLSDLATTASSSKHYVDLQTFFSAAMTNQATCLDGFAYSKKHVRRI  46
            CLELF +T  EL+  L+DL+     SKHY DLQT FS AMTNQ TCLDGFAYS  +VR +
Sbjct  110  CLELFHDTIVELKSALNDLSPKKLPSKHYHDLQTLFSGAMTNQYTCLDGFAYSDGNVRDV  169

Query  45   IEKRLVQISHHVSNA  1
            I+  L  IS HVSN+
Sbjct  170  IKSSLYNISRHVSNS  184



>ref|XP_006480001.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 40-like 
[Citrus sinensis]
Length=569

 Score =   181 bits (459),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 101/195 (52%), Positives = 131/195 (67%), Gaps = 12/195 (6%)
 Frame = -1

Query  582  SAIVLLAF-LSVTSFNSLFTKDGISSSTGPTHLDLNLNIHRQKLLQVAHTEACEGTLYPE  406
            SAI LL F LS  S  +L  K    ++  P     +L +H+    QVAH+ ACEGTLYPE
Sbjct  22   SAIFLLLFVLSAVSVTTL--KKNPKTTDAP-----HLRVHKH--FQVAHS-ACEGTLYPE  71

Query  405  LCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGPLEKRALDD  226
            LCVSTL + +PD  +K +PE+I+ T+N T+ E++AS++NCS I +  P    LEKRA++D
Sbjct  72   LCVSTLLS-VPDLASKRVPELISVTINRTLSELRASSSNCSSIGQSYPNFNTLEKRAIND  130

Query  225  CLELFSETRDELRKVLSDLATTASSSKHYVDLQTFFSAAMTNQATCLDGFAYSKKHVRRI  46
            CLELF +T  EL+  L+DL+     SKHY DLQT FS AMTNQ TCLDGFAYS  +VR +
Sbjct  131  CLELFHDTIVELKSALNDLSPKKLPSKHYHDLQTLFSGAMTNQYTCLDGFAYSDGNVRDV  190

Query  45   IEKRLVQISHHVSNA  1
            I+  L  IS HVSN+
Sbjct  191  IKSSLYNISRHVSNS  205



>ref|XP_002523113.1| Pectinesterase-3 precursor, putative [Ricinus communis]
 gb|EEF39298.1| Pectinesterase-3 precursor, putative [Ricinus communis]
Length=557

 Score =   176 bits (446),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 87/157 (55%), Positives = 118/157 (75%), Gaps = 2/157 (1%)
 Frame = -1

Query  471  IHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAA  292
            +H QK  Q+AH+ ACEGTLYPELCVSTL++ LPD   +++ ++I++T++ T+ EV+ S +
Sbjct  40   LHIQKHNQIAHS-ACEGTLYPELCVSTLSS-LPDLTYRSLQQLISSTISRTMYEVRVSYS  97

Query  291  NCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDLQTFFSA  112
            NCSGI+ KL +L  +E+ AL+DCLELF+ET DEL   +SDL +  S S+H+ DLQT  S 
Sbjct  98   NCSGIKNKLRKLNKIERVALNDCLELFTETMDELNVAISDLTSRKSVSQHHHDLQTLLSG  157

Query  111  AMTNQATCLDGFAYSKKHVRRIIEKRLVQISHHVSNA  1
            AMTNQ TCLDGFAYS+  VR+ I+  L  IS HVSN+
Sbjct  158  AMTNQYTCLDGFAYSRGRVRKTIKNSLYNISRHVSNS  194



>ref|XP_007145198.1| hypothetical protein PHAVU_007G218500g [Phaseolus vulgaris]
 gb|ESW17192.1| hypothetical protein PHAVU_007G218500g [Phaseolus vulgaris]
Length=553

 Score =   176 bits (446),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 85/157 (54%), Positives = 118/157 (75%), Gaps = 2/157 (1%)
 Frame = -1

Query  471  IHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAA  292
            +H  K +QVA +  C+GTLYP+LCVSTLAT  PD  +K++P++I++ VN T+ EVK+S  
Sbjct  35   LHFHKHMQVAQS-TCQGTLYPDLCVSTLAT-FPDLTSKSVPQVISSVVNHTMYEVKSSFY  92

Query  291  NCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDLQTFFSA  112
            NCS +++K+  L PL++RALDDCL+LF +T  EL+  + DL+ ++  SK + DLQT  S 
Sbjct  93   NCSSLKKKIRNLNPLDQRALDDCLKLFQDTNLELKTTIDDLSKSSIGSKRHHDLQTLLSG  152

Query  111  AMTNQATCLDGFAYSKKHVRRIIEKRLVQISHHVSNA  1
            AMTN  TCLDGFAYSK  VR  IEK+L++ISHH+SN+
Sbjct  153  AMTNLYTCLDGFAYSKGRVRDRIEKKLLEISHHMSNS  189



>ref|XP_009628637.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=567

 Score =   176 bits (445),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 106/210 (50%), Positives = 137/210 (65%), Gaps = 11/210 (5%)
 Frame = -1

Query  633  MHNLKQKATLFFTISGCSAIVLLAFLSVTSFNSLFTKDGISSSTGPTHLDLNLNIHRQKL  454
            M+NL++K +L  T+   SAIV L F         FT      S+  T L    +IH  K 
Sbjct  1    MYNLRRKTSLLLTLFALSAIVSLTF---------FTLSNNPKSSSKTVLTTTPHIHVHKN  51

Query  453  LQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIR  274
            +Q+AH+  C+ T YP+LCVSTL+  +PD   K+I +II++T+NVTV EVKASA NC+ IR
Sbjct  52   IQIAHSH-CQDTRYPKLCVSTLSL-IPDLAQKSISQIISSTINVTVAEVKASARNCTDIR  109

Query  273  RKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDLQTFFSAAMTNQA  94
              LP+L P EKRAL+DC++L   T  ELR  LSDL      S++Y DLQT  SAAMTNQA
Sbjct  110  EDLPQLEPYEKRALEDCVQLLDNTIIELRTTLSDLNPKKPPSQNYNDLQTLLSAAMTNQA  169

Query  93   TCLDGFAYSKKHVRRIIEKRLVQISHHVSN  4
            TCLDG A SKK++RR ++  L  I+HHVSN
Sbjct  170  TCLDGLARSKKNLRRYVQHNLHTIAHHVSN  199



>ref|XP_010259481.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=583

 Score =   175 bits (443),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 91/152 (60%), Positives = 113/152 (74%), Gaps = 3/152 (2%)
 Frame = -1

Query  453  LQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIR  274
            LQ+AH+ ACEGTLYPELCVSTL++  PD  +KTI ++I++TVN TV EV+ SA+NC+ IR
Sbjct  71   LQIAHS-ACEGTLYPELCVSTLSS-FPDLTSKTISQMISSTVNYTVKEVEISASNCTDIR  128

Query  273  RKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDLQTFFSAAMTNQA  94
            + L    PLE+RALDDCLELF ET  EL+  LSDL+  +S SKHY DLQT  SAAMTNQ 
Sbjct  129  KNLKAQDPLEQRALDDCLELFDETISELQTALSDLSPKSSPSKHYNDLQTLLSAAMTNQY  188

Query  93   TCLDGFAYSKKHV-RRIIEKRLVQISHHVSNA  1
            TCLDG +   + V R  I++ L  ISH VSN+
Sbjct  189  TCLDGLSLGNEQVIREEIKQNLNNISHLVSNS  220



>gb|KHG05999.1| putative pectinesterase/pectinesterase inhibitor 40 -like protein 
[Gossypium arboreum]
Length=560

 Score =   173 bits (438),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 88/158 (56%), Positives = 119/158 (75%), Gaps = 3/158 (2%)
 Frame = -1

Query  471  IHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAA  292
            +H    LQ+AH+ ACEGTLYP+LCVST+ + LPD  +KT+PE+I AT+N T+ EV+ S+A
Sbjct  43   LHVHNHLQIAHS-ACEGTLYPDLCVSTI-SVLPDLASKTLPELIQATLNQTMYEVRLSSA  100

Query  291  NCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTA-SSSKHYVDLQTFFS  115
            NC+GI +++      E+ A++DCLELF +T +EL+  L+DLA    + S++Y DLQTF S
Sbjct  101  NCTGIEKRIKSYSKREEAAINDCLELFDDTLEELKVALADLAPKKLAVSRNYHDLQTFLS  160

Query  114  AAMTNQATCLDGFAYSKKHVRRIIEKRLVQISHHVSNA  1
            AAMTNQ TCLDGFA SK +VR II+K L  I+HHVSN+
Sbjct  161  AAMTNQYTCLDGFARSKGNVRNIIKKGLHNITHHVSNS  198



>ref|XP_007163135.1| hypothetical protein PHAVU_001G209400g [Phaseolus vulgaris]
 gb|ESW35129.1| hypothetical protein PHAVU_001G209400g [Phaseolus vulgaris]
Length=601

 Score =   173 bits (438),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 98/194 (51%), Positives = 126/194 (65%), Gaps = 15/194 (8%)
 Frame = -1

Query  582  SAIVLLAFLSVTSFNSLFTKDGISSSTGPTHLDLNLNIHRQKLLQVAHTEACEGTLYPEL  403
            SA+ +L   SVT F+      G + S    HL             VA++  CEGTLYP+L
Sbjct  60   SAVHVLLLFSVTQFS---ITAGATRSLQQNHLHF----------HVANS-TCEGTLYPDL  105

Query  402  CVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGPLEKRALDDC  223
            CVSTL T+ PD  +KT+PE+I + VN T+ EV  S++NCS +R+KLP L  LEKRALDDC
Sbjct  106  CVSTL-TSFPDLTSKTVPEMIRSVVNHTIYEVTLSSSNCSSLRKKLPGLNKLEKRALDDC  164

Query  222  LELFSETRDELRKVLSDLATTASSSKHYVDLQTFFSAAMTNQATCLDGFAYSKKHVRRII  43
            L LF ET +EL+  + DL+ +   SK Y D QTF S AMTN  TCLDGFAYSK +VR  I
Sbjct  165  LNLFDETVEELKTTVKDLSQSTIGSKRYHDSQTFLSGAMTNLYTCLDGFAYSKGNVRDRI  224

Query  42   EKRLVQISHHVSNA  1
            E+ +++ISH VSN+
Sbjct  225  EEGVLEISHLVSNS  238



>ref|XP_003553658.2| PREDICTED: probable pectinesterase/pectinesterase inhibitor 39-like 
[Glycine max]
Length=615

 Score =   173 bits (438),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 90/170 (53%), Positives = 114/170 (67%), Gaps = 7/170 (4%)
 Frame = -1

Query  495  THLDLNLNIHRQKL-----LQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAAT  331
            TH  +  N  R         QVA++  CEGTLY +LCVSTLA+  PD  +KT+P++I + 
Sbjct  83   THFSITANATRTPQENSLHFQVANS-TCEGTLYSDLCVSTLAS-FPDLTSKTLPQMIRSV  140

Query  330  VNVTVDEVKASAANCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASS  151
            VN T+ EV  SA+NCSG+RR LP+L  LE+RALDDCL LF +T  EL   ++DL+ +   
Sbjct  141  VNHTIYEVTLSASNCSGLRRNLPKLDKLEQRALDDCLNLFDDTVSELETTIADLSQSTIG  200

Query  150  SKHYVDLQTFFSAAMTNQATCLDGFAYSKKHVRRIIEKRLVQISHHVSNA  1
             K Y D QT  S AMTN  TCLDGFAYSK HVR   E+ L++ISHHVSN+
Sbjct  201  PKRYHDAQTLLSGAMTNLYTCLDGFAYSKGHVRDRFEEGLLEISHHVSNS  250



>ref|XP_009783075.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=567

 Score =   171 bits (432),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 87/158 (55%), Positives = 114/158 (72%), Gaps = 3/158 (2%)
 Frame = -1

Query  471  IHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAA  292
            IH  K +Q+A +  CEGTL+PELCVSTL++  P+   K+I EII++TV V V EV+ SA 
Sbjct  47   IHVHKNIQIAQSH-CEGTLHPELCVSTLSS-FPNLHRKSIAEIISSTVKVAVGEVRDSAH  104

Query  291  NCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDLQTFFSA  112
            NCS +RR +P+L P+EKRAL DC+EL  ET  ELR  L+DL+   S+SKHY D+QT  SA
Sbjct  105  NCSDLRRNVPKLEPIEKRALQDCVELLGETIAELRTALTDLSPKKSASKHYNDIQTLLSA  164

Query  111  AMTNQATCLDGFAY-SKKHVRRIIEKRLVQISHHVSNA  1
            AMTN+ TCLDG  Y +K ++ R +E  L  I+HHVSN+
Sbjct  165  AMTNEDTCLDGLFYCTKNNLTRYVEDNLHTIAHHVSNS  202



>ref|XP_009765668.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=566

 Score =   170 bits (430),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 103/210 (49%), Positives = 138/210 (66%), Gaps = 12/210 (6%)
 Frame = -1

Query  633  MHNLKQKATLFFTISGCSAIVLLAFLSVTSFNSLFTKDGISSSTGPTHLDLNLNIHRQKL  454
            M+NL++K  L  T+   SAIV + F  +++     +K   +  T P       +IH  K 
Sbjct  1    MYNLRRKTPLLLTLFALSAIVSVTFFGLSNNPKSSSK---TVQTTP-------HIHVHKN  50

Query  453  LQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIR  274
            +Q+AH+  C+ T YP+LCVSTL + +PD   K+I +II++T+NVTV EVKASA NC+ IR
Sbjct  51   IQIAHSH-CQDTRYPKLCVSTL-SLIPDLAQKSISQIISSTINVTVAEVKASAKNCTEIR  108

Query  273  RKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDLQTFFSAAMTNQA  94
              LPRL P EKRAL+DC++L   T  EL+  LSDL    S S++Y DLQT  SAAMTNQA
Sbjct  109  EDLPRLEPYEKRALEDCVQLLDNTIIELKTTLSDLHPKKSPSQNYNDLQTLLSAAMTNQA  168

Query  93   TCLDGFAYSKKHVRRIIEKRLVQISHHVSN  4
            TCLDG A  KK++RR ++  L  I+HHVSN
Sbjct  169  TCLDGLARCKKNLRRYVQHNLHTIAHHVSN  198



>gb|KJB41904.1| hypothetical protein B456_007G127000 [Gossypium raimondii]
Length=560

 Score =   169 bits (428),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 86/158 (54%), Positives = 118/158 (75%), Gaps = 3/158 (2%)
 Frame = -1

Query  471  IHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAA  292
            +H    LQ+AH+ ACE TLYP+LCVST+ + LPD  +K++PE+I AT+N T+ EV+ S+A
Sbjct  43   LHVHNHLQIAHS-ACEATLYPDLCVSTI-SVLPDLASKSLPELIQATLNQTMYEVRLSSA  100

Query  291  NCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTA-SSSKHYVDLQTFFS  115
            NC+GI +++      E+ A++DCLELF +T +EL+  L+DLA    + S++Y DLQTF S
Sbjct  101  NCTGIEKRIKSYSKREEAAINDCLELFDDTLEELKVALADLAPKKLAVSRNYHDLQTFLS  160

Query  114  AAMTNQATCLDGFAYSKKHVRRIIEKRLVQISHHVSNA  1
            AAMTNQ TCLDGFA SK +VR II+K L  I+HHVSN+
Sbjct  161  AAMTNQYTCLDGFARSKGNVRNIIKKGLHNITHHVSNS  198



>ref|XP_009614504.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=563

 Score =   167 bits (423),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 100/215 (47%), Positives = 132/215 (61%), Gaps = 32/215 (15%)
 Frame = -1

Query  633  MHNLKQKATLFFTISGCSAIVLLAFLSVTSFNSLFTKDGISSSTGPTHLDLNLNIHRQKL  454
            M+N ++K +L  T+S   AI+LL F S                       L +++  Q +
Sbjct  1    MYNQRRKPSLLLTLS---AIILLIFFS-----------------------LPISLQTQNI  34

Query  453  -LQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGI  277
             L++AH+  C+ TLYP+LC+STL+  +P+   KTIPEII++TVN TVDEVKAS  NC+ I
Sbjct  35   QLEIAHSH-CQDTLYPQLCISTLSL-IPNLHQKTIPEIISSTVNTTVDEVKASTENCTNI  92

Query  276  RRKLPRLGPLEKRALDDCLELFSE-TRDELRKVLSDLATTASSS--KHYVDLQTFFSAAM  106
              K+ +L P+EKRALDDC+EL  + T  EL   L DL+T   +S  KHY DLQT  SAAM
Sbjct  93   LHKMSKLDPIEKRALDDCIELLGDSTISELNTTLYDLSTKNHNSPYKHYNDLQTLLSAAM  152

Query  105  TNQATCLDGFAYSKKHVRRIIEKRLVQISHHVSNA  1
            TNQ TCL GF  SK ++R  IE  L  I  HVSN+
Sbjct  153  TNQDTCLGGFDDSKHNLRHYIEHNLHTIEQHVSNS  187



>ref|XP_010321856.1| PREDICTED: pectinesterase [Solanum lycopersicum]
Length=564

 Score =   166 bits (421),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 87/161 (54%), Positives = 116/161 (72%), Gaps = 6/161 (4%)
 Frame = -1

Query  471  IHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAA  292
            IH  K +Q+A++  C+ TLYP+LC+STL+  +P+   K+IPEII++ VNVT++EVK+SA 
Sbjct  37   IHVHKNIQIANSH-CQDTLYPKLCISTLSL-IPNLHKKSIPEIISSNVNVTMNEVKSSAE  94

Query  291  NCSGIRRKLPRLGPLEKRALDDCLELFSETR-DELRKVLSDLATTASSS---KHYVDLQT  124
            NCS I   + +L P+EKRALDDC+EL  +T  DEL+  L+DL+T  SS+   KHY DLQT
Sbjct  95   NCSNILHHMSKLDPIEKRALDDCIELLGDTTIDELQTTLNDLSTKNSSNSPLKHYNDLQT  154

Query  123  FFSAAMTNQATCLDGFAYSKKHVRRIIEKRLVQISHHVSNA  1
              S AMTNQ TCL+G   SK  + + IEK L  ISHHVSN+
Sbjct  155  LLSGAMTNQDTCLEGIHKSKHKLSQYIEKNLHTISHHVSNS  195



>gb|EYU46746.1| hypothetical protein MIMGU_mgv1a0044632mg, partial [Erythranthe 
guttata]
Length=201

 Score =   157 bits (397),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 80/134 (60%), Positives = 98/134 (73%), Gaps = 2/134 (1%)
 Frame = -1

Query  471  IHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAA  292
            +H  K  QV     C+GTLYP LCVST+A A P+ R KT+PEIIA T+NVT+ EV+ SA 
Sbjct  42   LHVYKHAQVIAESTCDGTLYPGLCVSTVA-AFPELRQKTLPEIIAGTINVTMKEVRDSAT  100

Query  291  NCSGIRRKL-PRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDLQTFFS  115
            NCSG+RRKL  +L P +  ALDDCLELF++T  EL+K LSDL++ +   K+Y DLQT  S
Sbjct  101  NCSGLRRKLLKKLDPRDLIALDDCLELFADTVAELKKTLSDLSSGSPPEKYYDDLQTLLS  160

Query  114  AAMTNQATCLDGFA  73
             AMTNQ TCLDGFA
Sbjct  161  GAMTNQYTCLDGFA  174



>ref|XP_004494389.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 40-like 
[Cicer arietinum]
Length=549

 Score =   164 bits (416),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 81/151 (54%), Positives = 114/151 (75%), Gaps = 3/151 (2%)
 Frame = -1

Query  453  LQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIR  274
            LQVAH+  C+GTLYP LCVSTL+T   D  +K++P+II +T+N T++EVK+S+ NC+ ++
Sbjct  38   LQVAHS-TCQGTLYPNLCVSTLST-FQDLASKSVPQIICSTLNSTINEVKSSSFNCTRLK  95

Query  273  RKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDLQTFFSAAMTNQA  94
            ++ P L P ++RALDDCL LF  T +EL+  ++DL+ T  +SK Y + QT  S AMTN  
Sbjct  96   KR-PSLHPYDQRALDDCLNLFDNTIEELKSTINDLSQTKITSKPYHNCQTLLSGAMTNVY  154

Query  93   TCLDGFAYSKKHVRRIIEKRLVQISHHVSNA  1
            TCLDGFAYSK ++R  IEK+L +IS+HVSN+
Sbjct  155  TCLDGFAYSKTNLRHKIEKKLYKISNHVSNS  185



>ref|XP_010069896.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=561

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 119/161 (74%), Gaps = 6/161 (4%)
 Frame = -1

Query  471  IHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAA  292
             H ++ LQVAH+  C+GTLYP+LCVSTLA+  PD  +K++PEII++TVN+T  + +++++
Sbjct  34   FHTRRHLQVAHS-TCQGTLYPDLCVSTLAS-FPDLASKSVPEIISSTVNLTSAQARSASS  91

Query  291  NCSGIRRKLP-RLGPLEKRALDDCLELFSETRDELRKVLSDLATT---ASSSKHYVDLQT  124
            +CS + R+L  +LGPLE+RALDDCLEL + T DE  K +SDL++     + + H+ DLQT
Sbjct  92   SCSALERRLAAKLGPLERRALDDCLELLARTVDEFGKAISDLSSANGPTAPAAHFHDLQT  151

Query  123  FFSAAMTNQATCLDGFAYSKKHVRRIIEKRLVQISHHVSNA  1
              S AMTNQ TCLDGFAYSK+ VR  I+  L  IS HVSN+
Sbjct  152  LLSGAMTNQYTCLDGFAYSKQKVRDAIQSNLFNISRHVSNS  192



>gb|KJB09419.1| hypothetical protein B456_001G140500 [Gossypium raimondii]
Length=561

 Score =   163 bits (412),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 88/158 (56%), Positives = 112/158 (71%), Gaps = 3/158 (2%)
 Frame = -1

Query  471  IHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAA  292
             H    LQ A + AC+GTLYPELCVST+ + LPD  +K++PE+I+AT+N T+ EV+ S+A
Sbjct  43   FHVHNHLQRA-SSACDGTLYPELCVSTI-SVLPDLASKSLPELISATLNQTMHEVRLSSA  100

Query  291  NCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASS-SKHYVDLQTFFS  115
            N + I +KL     LE+ A++DCLELF  T  EL+ V S L    SS S++Y DLQTF S
Sbjct  101  NITNIEKKLKSYNTLEEAAINDCLELFDNTMAELKVVRSGLGPKGSSVSENYHDLQTFLS  160

Query  114  AAMTNQATCLDGFAYSKKHVRRIIEKRLVQISHHVSNA  1
            AAMTNQ TCLDGFA S  +VR II+K L  ISHHVSN+
Sbjct  161  AAMTNQQTCLDGFARSSGNVRSIIKKGLHNISHHVSNS  198



>ref|XP_004247400.1| PREDICTED: pectinesterase-like [Solanum lycopersicum]
Length=562

 Score =   159 bits (403),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 99/210 (47%), Positives = 132/210 (63%), Gaps = 18/210 (9%)
 Frame = -1

Query  633  MHNLKQKATLFFTISGCSAIVLLAFLSVTSFNSLFTKDGISSSTGPTHLDLNLNIHRQKL  454
            M++L+ K  L  ++     IV L F +  S NS                   ++IH  K 
Sbjct  1    MYSLQWKTPLLLSLLAIFIIVSLTFFTSLSKNS----------------SEIVHIHVHKN  44

Query  453  LQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIR  274
            +Q+AH+  CE  LY +LCVSTLA+ +PD   K+I +II++T+NVTV EVKASA NC+ IR
Sbjct  45   IQIAHSH-CEDALYKQLCVSTLAS-IPDLPQKSISQIISSTINVTVVEVKASAKNCTDIR  102

Query  273  RKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDLQTFFSAAMTNQA  94
              LP+L P EKRAL+DC++L  +T  EL+  L  L    S S++Y DLQT  SAAMTNQA
Sbjct  103  EDLPKLEPYEKRALEDCIQLLDDTIIELKSSLVALHPNRSLSQNYNDLQTLLSAAMTNQA  162

Query  93   TCLDGFAYSKKHVRRIIEKRLVQISHHVSN  4
            TCLDG   S K++RR +++RL  ISHHVSN
Sbjct  163  TCLDGLGRSTKNLRRFVQRRLHTISHHVSN  192



>ref|XP_006359860.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 40-like 
[Solanum tuberosum]
Length=562

 Score =   159 bits (402),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 103/210 (49%), Positives = 136/210 (65%), Gaps = 18/210 (9%)
 Frame = -1

Query  633  MHNLKQKATLFFTISGCSAIVLLAFLSVTSFNSLFTKDGISSSTGPTHLDLNLNIHRQKL  454
            M+NLK K  L  ++   SAIV L F +  S NS  T                ++IH  K 
Sbjct  1    MYNLKWKTPLLLSLLAISAIVCLTFFTSLSKNSSET----------------VHIHVHKN  44

Query  453  LQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIR  274
            +Q+AH+  CE  LY +LCVSTL++ +PD   K+I +II++T+NVTV EVKASA NC+ IR
Sbjct  45   IQIAHSH-CEDALYKQLCVSTLSS-IPDLPQKSISQIISSTINVTVVEVKASAKNCTDIR  102

Query  273  RKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDLQTFFSAAMTNQA  94
              LP+L P EKRAL+DC++L   T  +L+  L  L+   S S++Y DLQT  SAAMTNQA
Sbjct  103  EDLPKLEPYEKRALEDCIQLLDNTIIDLKSSLLALSPNRSLSQNYNDLQTLLSAAMTNQA  162

Query  93   TCLDGFAYSKKHVRRIIEKRLVQISHHVSN  4
            TCLDG   SKK++RR +++RL  ISHHVSN
Sbjct  163  TCLDGLGRSKKNLRRFVQRRLHTISHHVSN  192



>ref|XP_008235121.1| PREDICTED: pectinesterase-like [Prunus mume]
Length=562

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 97/213 (46%), Positives = 135/213 (63%), Gaps = 19/213 (9%)
 Frame = -1

Query  633  MHNLKQKATLFFTISGCSAIVLLAFLSVTSF-NSLFTKDGISSSTGPTHLDLNLNIHRQK  457
            M+NL+++  L  ++   SA++L+   S T F NS       +S+T  TH      +H + 
Sbjct  1    MYNLRRRTKLLLSVLPTSALLLILLFSNTHFRNS-------NSNTPKTH------VHNR-  46

Query  456  LLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGI  277
             +Q+A   AC+ TLY  LCVSTL+T  PD   K++P+II+ TV+ TV EV+AS++NC+GI
Sbjct  47   -IQLAAHSACQDTLYKLLCVSTLST-FPDLTTKSVPQIISYTVSHTVSEVQASSSNCTGI  104

Query  276  -RRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDLQTFFSAAMTN  100
             +++  +L  L++ ALDDCLELF +T  EL  V+SDL+    SS  Y DL+T  S AMTN
Sbjct  105  IKKQFKKLDALQQIALDDCLELFDDTIAELNAVISDLSIKKLSSNRYYDLKTLLSGAMTN  164

Query  99   QATCLDGFAYSKKHVRRIIEKRLVQISHHVSNA  1
            Q TCLDGF      VR+ I+ RL  IS HVSNA
Sbjct  165  QYTCLDGFN-DTGIVRQEIQSRLQTISQHVSNA  196



>ref|XP_009771845.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=561

 Score =   158 bits (399),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 83/154 (54%), Positives = 107/154 (69%), Gaps = 5/154 (3%)
 Frame = -1

Query  453  LQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIR  274
            L++AH+  C+ TLYP+LC+STL+  +P+   KTIPEII++TVN T+DEVK S  NC+ I 
Sbjct  36   LEIAHSH-CQDTLYPQLCISTLSL-IPNLHQKTIPEIISSTVNATIDEVKGSTENCTKIL  93

Query  273  RKLPRLGPLEKRALDDCLELFSE-TRDELRKVLSDLATTASSS--KHYVDLQTFFSAAMT  103
             K+ +L P+EKRALDDC+EL  + T  EL   L DL+T   +S  KHY DLQT  SAAMT
Sbjct  94   HKMSKLDPIEKRALDDCIELLGDSTISELNTTLYDLSTKNHNSPYKHYNDLQTLLSAAMT  153

Query  102  NQATCLDGFAYSKKHVRRIIEKRLVQISHHVSNA  1
            NQ TCL GF  SK ++R  +E  L  I  HVSN+
Sbjct  154  NQDTCLSGFDDSKHNLRHYVEHNLHTIEQHVSNS  187



>ref|XP_007201179.1| hypothetical protein PRUPE_ppa003400mg [Prunus persica]
 gb|EMJ02378.1| hypothetical protein PRUPE_ppa003400mg [Prunus persica]
Length=578

 Score =   158 bits (399),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 94/214 (44%), Positives = 131/214 (61%), Gaps = 17/214 (8%)
 Frame = -1

Query  639  TRMHNLKQKATLFFTISGCSAIVLLAFLSVTSFNSLFTKDGISSSTGPTHLDLNLNIHRQ  460
            T M+NL+++  L  ++   SA++L+   S T   +       S+S  P         H  
Sbjct  11   TTMYNLRRRTKLLLSVLPTSALLLILLFSNTHLRN-------SNSITP-------KTHVH  56

Query  459  KLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSG  280
              +Q+A   AC+ TLY +LCVSTL+T  PD   K++P+II+ TV+ TV EV+AS++NC+G
Sbjct  57   NRIQLAAHSACQDTLYKDLCVSTLST-FPDLSTKSVPQIISYTVSHTVSEVQASSSNCTG  115

Query  279  I-RRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDLQTFFSAAMT  103
            I +++  +L  L++ ALDDCLELF +T  EL+ V+SDL+    SS  Y DL+T  S AMT
Sbjct  116  IIKKQFKKLDALQQIALDDCLELFDDTIAELKAVISDLSVEKLSSDRYYDLKTLLSGAMT  175

Query  102  NQATCLDGFAYSKKHVRRIIEKRLVQISHHVSNA  1
            NQ TCLDGF      VR  I+ RL  IS HVSNA
Sbjct  176  NQYTCLDGFN-DTGIVRHEIQSRLQTISQHVSNA  208



>gb|KEH24404.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=557

 Score =   153 bits (386),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 110/156 (71%), Gaps = 9/156 (6%)
 Frame = -1

Query  453  LQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIR  274
            +QVA + ACEGTLY +LCVSTL+T LPD  +KT+P+II + +N T+ EVK S++NC+G+R
Sbjct  42   IQVAQS-ACEGTLYQDLCVSTLST-LPDLTSKTVPQIICSVLNNTIKEVKQSSSNCTGLR  99

Query  273  -RKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLA----TTASSSKHYVDLQTFFSAA  109
             R       L++RAL+DC+ LF  T DEL+  +SDL+    T ASSSK   D QT  S A
Sbjct  100  IRGRSAQSILDQRALEDCVNLFDTTIDELKTTISDLSQTQTTVASSSKR--DCQTLLSGA  157

Query  108  MTNQATCLDGFAYSKKHVRRIIEKRLVQISHHVSNA  1
            MTN  TCLDGFAYSK  +R+ IE +L  IS HVSN+
Sbjct  158  MTNVYTCLDGFAYSKSKLRKKIEAKLNDISSHVSNS  193



>ref|XP_004290811.1| PREDICTED: pectinesterase-like [Fragaria vesca subsp. vesca]
Length=567

 Score =   145 bits (365),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 90/218 (41%), Positives = 138/218 (63%), Gaps = 19/218 (9%)
 Frame = -1

Query  633  MHNLKQKATLFFTISGCSAIVLLAFLSVTSFNSLFTKDGISSSTGPT-HLDLNLNIHRQK  457
            M++L+++  L  ++   SA +L+ F S+  F         ++S  PT    +++  H Q 
Sbjct  1    MYSLRRRTKLLLSLLPTSAFILIIFFSLNHF---------TNSPKPTKEFTIHVEKHNQ-  50

Query  456  LLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGI  277
            L QVAH+  C+ TLY +LCVSTL T+ P+  +KT+P+II++TVN T+ EV AS +NC+GI
Sbjct  51   LNQVAHS-TCQNTLYKDLCVSTL-TSFPNLSSKTVPQIISSTVNKTMYEVIASNSNCTGI  108

Query  276  RR-KLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTAS-SSKHYVDLQTFFSAAMT  103
            ++    +L  ++++ALDDCLELF +T  +L+  +S+L++  S ++KHY  L+T  SAAMT
Sbjct  109  KKHNKNKLAAVQQQALDDCLELFDDTVAQLKVTMSELSSKKSPAAKHYNHLRTLLSAAMT  168

Query  102  NQATCLDGFAYSK----KHVRRIIEKRLVQISHHVSNA  1
            NQ TCL+GF  S     K V+  +E RL     H SNA
Sbjct  169  NQYTCLEGFDSSTSSTVKAVKAELESRLNTTCKHFSNA  206



>gb|EPS67066.1| pectinesterase [Genlisea aurea]
Length=955

 Score =   147 bits (370),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 78/144 (54%), Positives = 99/144 (69%), Gaps = 3/144 (2%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLG  253
            AC+G LY +LCVST+ T L  RR  T+PE+IAATV+V + EV ++++N   +RRKL +  
Sbjct  451  ACDGALYDDLCVSTVVTKL--RRNTTLPEMIAATVDVAMAEVMSASSNFRNLRRKLKKAE  508

Query  252  PLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDLQTFFSAAMTNQATCLDGFA  73
             L+ RALDDCLEL S T +EL +VL      AS  KHY DL+T  S +MTNQ TCLDG A
Sbjct  509  LLDVRALDDCLELLSSTAEELSEVLEMTTAPASPVKHYDDLKTLLSGSMTNQYTCLDGLA  568

Query  72   YSKKHVRRIIEKRLVQISHHVSNA  1
            Y     RR+IE R  +ISHH+SNA
Sbjct  569  YGNTR-RRLIEARTRRISHHLSNA  591



>ref|XP_010910828.1| PREDICTED: pectinesterase 3-like [Elaeis guineensis]
Length=338

 Score =   140 bits (354),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 78/158 (49%), Positives = 106/158 (67%), Gaps = 4/158 (3%)
 Frame = -1

Query  471  IHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAA  292
            +H    LQ A    C+GTLYP+LCVSTLA  +P+  +K++P++IAA VN T ++V+ SA+
Sbjct  41   LHVHSHLQAA-ARHCDGTLYPDLCVSTLAD-IPNLTSKSLPDVIAAVVNRTANDVRFSAS  98

Query  291  NCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDLQTFFSA  112
            NCS   R+   +   ++ AL+DCLEL  +T D+LR   +DL T  ++S H  D+QT  SA
Sbjct  99   NCSSYLRRRGYMDSRQRLALNDCLELLDQTLDDLRTAAADL-TCGNASVHVSDIQTVLSA  157

Query  111  AMTNQATCLDGFAY-SKKHVRRIIEKRLVQISHHVSNA  1
            AMTNQ TCLDGFAY +   VR  IE RL  +SH VSN+
Sbjct  158  AMTNQYTCLDGFAYVNGGGVRPSIEGRLNHVSHLVSNS  195



>ref|XP_008359413.1| PREDICTED: pectinesterase-like [Malus domestica]
Length=579

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 94/222 (42%), Positives = 132/222 (59%), Gaps = 23/222 (10%)
 Frame = -1

Query  633  MHNLKQKATLFFTISGCSAIVLLAFLSVTSFNSLFTKDGISSSTGPTHLDLNLNIHRQK-  457
            M+NL++   L  T+   S + L    S   F +       S+S  P    ++   H QK 
Sbjct  1    MYNLRRTKILLSTLFLTSILFLSLLFSKPHFKN-------SNSKSP---KIHFQNHIQKQ  50

Query  456  LLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGI  277
            +L+ AH  AC+ TLY  LC+STLAT  P+  +KT+P+II++TV+ TV EVKAS++NC+ I
Sbjct  51   VLETAH-WACQDTLYKSLCLSTLAT-FPNLASKTLPQIISSTVSHTVLEVKASSSNCTSI  108

Query  276  RRKLP-RLGPLEKRALDDCLELFSETRDELRKVLSDLATTAS-SSKHYVDLQTFFSAAMT  103
            +++   +L  L++ ALDDCLEL   T DEL+  +SDL+   + +S  Y DL+   SAAMT
Sbjct  109  KKQFSKKLSSLQQWALDDCLELLDNTIDELKSAISDLSXNKTLNSNRYYDLKALLSAAMT  168

Query  102  NQATCLDGFAYSKKH--------VRRIIEKRLVQISHHVSNA  1
            NQ TCLDGF+ +           VR  IE R+  IS HVSNA
Sbjct  169  NQDTCLDGFSANGTAPRSSNXGIVRSEIEGRINTISQHVSNA  210



>ref|XP_008795768.1| PREDICTED: pectinesterase-like [Phoenix dactylifera]
Length=557

 Score =   139 bits (350),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 78/158 (49%), Positives = 107/158 (68%), Gaps = 4/158 (3%)
 Frame = -1

Query  471  IHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAA  292
            +H +  LQVA +  C+GTLYP+LCVSTLA  +P+  +K +P++IAA VN T   V++SA+
Sbjct  43   LHIRSDLQVA-SRHCDGTLYPDLCVSTLAD-IPNLSSKPLPDVIAAVVNRTAAAVRSSAS  100

Query  291  NCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDLQTFFSA  112
            NC+    +   +   ++ AL+DCLEL  +T D+LR  ++DLA   +SS H  DLQT  SA
Sbjct  101  NCTSYLHRRGHMDFRQRLALNDCLELLDQTLDDLRTAIADLA-GCNSSAHVSDLQTVLSA  159

Query  111  AMTNQATCLDGFAY-SKKHVRRIIEKRLVQISHHVSNA  1
            A+TNQ TCLDGFAY +   VR  IE RL  +SH VSN+
Sbjct  160  AITNQYTCLDGFAYVNGGGVRPSIEGRLYHVSHLVSNS  197



>ref|XP_010556724.1| PREDICTED: pectinesterase-like [Tarenaya hassleriana]
Length=547

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 73/149 (49%), Positives = 104/149 (70%), Gaps = 7/149 (5%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKL-PRL  256
            ACE T + +LC S L++ LP   + ++PE+IAATVN T+ EV  S++NCSG++R+L P L
Sbjct  50   ACERTRFKDLCFSPLSS-LPPGNSSSVPELIAATVNETISEVMISSSNCSGLQRRLGPDL  108

Query  255  GPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDLQTFFSAAMTNQATCLDGF  76
             P + RAL+DCLEL  +T  +L   L+DL  + S+++ + DLQT  SAAMTNQ TCLDGF
Sbjct  109  SPRDSRALEDCLELLGDTAGDLDDALADLH-SPSAAREFYDLQTLLSAAMTNQYTCLDGF  167

Query  75   AYSKKH----VRRIIEKRLVQISHHVSNA  1
            A+++++    VR  I+  L  IS HVSN+
Sbjct  168  AFNERNRKYRVRDSIKDSLFNISRHVSNS  196



>ref|XP_009401623.1| PREDICTED: pectinesterase 3-like [Musa acuminata subsp. malaccensis]
Length=352

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 75/173 (43%), Positives = 106/173 (61%), Gaps = 6/173 (3%)
 Frame = -1

Query  510  SSTGPTHLDLNLNIHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAAT  331
            S+  P      L +H       A  + C+GT+YPELCVSTL +  PD  +K++P +I AT
Sbjct  31   SAPKPVAYHHKLRVHSHLHAAAAAVDHCDGTIYPELCVSTL-SVFPDLHSKSLPAVICAT  89

Query  330  VNVTVDEVKASAANCSG-IRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTAS  154
            +N T   V+ SA NC+  + R+   L   ++ A+ DCL+LFS+T DELR   + L  T+ 
Sbjct  90   INATEAAVRGSAKNCTDYLNRRGYNLDGRQRLAIGDCLDLFSQTLDELRAASAGL--TSG  147

Query  153  SSKHYVDLQTFFSAAMTNQATCLDGFAYSKK--HVRRIIEKRLVQISHHVSNA  1
            +S H  D+QT  SAA+TNQ TCLDGF+Y  K    R +I++RL  +SH VSN+
Sbjct  148  ASAHVDDVQTVLSAAITNQYTCLDGFSYVGKGGGYRSVIKRRLYHVSHLVSNS  200



>gb|KHN43496.1| Putative pectinesterase/pectinesterase inhibitor 40 [Glycine 
soja]
Length=481

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 80/115 (70%), Gaps = 0/115 (0%)
 Frame = -1

Query  345  IIAATVNVTVDEVKASAANCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLA  166
            +I + VN T+ EV  SA+NCSG+RR LP L  LE+RALDDCL LF +T  EL   ++DL+
Sbjct  1    MIRSVVNHTIYEVTLSASNCSGLRRNLPELDKLEQRALDDCLNLFDDTVSELETTIADLS  60

Query  165  TTASSSKHYVDLQTFFSAAMTNQATCLDGFAYSKKHVRRIIEKRLVQISHHVSNA  1
             +    K Y D QT  S AMTN  TCLDGFAYSK HVR   E+ L++ISHHVSN+
Sbjct  61   QSTIGPKRYHDAQTLLSGAMTNLYTCLDGFAYSKGHVRDRFEEGLLEISHHVSNS  115



>gb|KJB49889.1| hypothetical protein B456_008G143700 [Gossypium raimondii]
Length=558

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 76/172 (44%), Positives = 112/172 (65%), Gaps = 8/172 (5%)
 Frame = -1

Query  513  SSSTGPTHLDLNLNIHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAA  334
            S  T  TH     + H    LQ+A+T ACEGTLYP+LCV+T++  L +  ++++P++I+A
Sbjct  31   SPETSETH-----HFHVNNNLQIAYT-ACEGTLYPDLCVATVSI-LQNLASRSLPDLISA  83

Query  333  TVNVTVDEVKASAANCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATT-A  157
             +  T+DEV+ S ANC+ I + L     LE  A++DC+ELF+ T  ELR  L++L     
Sbjct  84   ILIQTMDEVRLSCANCTEIEKGLKSNTTLEWAAINDCIELFNHTLAELRVALAELKPKRV  143

Query  156  SSSKHYVDLQTFFSAAMTNQATCLDGFAYSKKHVRRIIEKRLVQISHHVSNA  1
              S++Y  ++TF SAAMTNQ TCLDGF  SK   + +I++ L  ISHH+SN+
Sbjct  144  RLSRNYHKIKTFLSAAMTNQYTCLDGFHGSKGKTKYVIKEALHNISHHISNS  195



>ref|XP_009383893.1| PREDICTED: pectinesterase-like [Musa acuminata subsp. malaccensis]
Length=567

 Score =   132 bits (333),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 75/161 (47%), Positives = 104/161 (65%), Gaps = 6/161 (4%)
 Frame = -1

Query  477  LNIHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKAS  298
            L++H  +L   A  + C+GTLYP+LCVSTL+T +PD  AK++PE+I A+VN T   V+ +
Sbjct  47   LHVH-SRLQATAAADHCDGTLYPDLCVSTLST-IPDLHAKSLPEVICASVNTTAAAVRNA  104

Query  297  AANCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDLQTFF  118
            A NC+    +   L P ++ A+ DCL+LFS+T DEL    +  A  A  + H  D+QT  
Sbjct  105  AKNCTNFLHRRGYLDPRQRLAVTDCLDLFSQTLDELGAASA--ALAADPAAHVDDVQTVL  162

Query  117  SAAMTNQATCLDGFAYSKK--HVRRIIEKRLVQISHHVSNA  1
            SAA+TNQ TCLDGFAY  +    R  IE+RL  +SH VSN+
Sbjct  163  SAAITNQYTCLDGFAYVGRGGGYRPAIERRLYHVSHLVSNS  203



>ref|XP_009382521.1| PREDICTED: pectinesterase-like [Musa acuminata subsp. malaccensis]
Length=566

 Score =   128 bits (322),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 77/169 (46%), Positives = 104/169 (62%), Gaps = 11/169 (7%)
 Frame = -1

Query  498  PTHLDLNLNIHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVT  319
            P H  L+++ H Q       T+ C+GTLYP+LC STL+T +PD  +K++PE+I AT+N +
Sbjct  42   PYHHRLHVHSHLQDA-----TDHCDGTLYPDLCASTLST-IPDLHSKSLPEVICATINAS  95

Query  318  VDEVKASAANCSG-IRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKH  142
               V  SA NC+  +      L   ++ AL DCL+LFS+T DEL    SDL  TA+   H
Sbjct  96   EAAVIKSAKNCTKYLHHHNYTLDTRQRYALTDCLDLFSQTLDELLDATSDL--TANPGSH  153

Query  141  YVDLQTFFSAAMTNQATCLDGFAYSKKH--VRRIIEKRLVQISHHVSNA  1
               +QT  SAA+TNQ TCLDGFAY  K    R +IE+ L  +SH VSN+
Sbjct  154  VDHVQTLLSAAITNQYTCLDGFAYVGKDGGYRSVIEQPLYHVSHLVSNS  202



>gb|ACQ85264.1| pectin methylesterase [Musa acuminata AAA Group]
Length=565

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 77/169 (46%), Positives = 103/169 (61%), Gaps = 11/169 (7%)
 Frame = -1

Query  498  PTHLDLNLNIHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVT  319
            P H  L+++ H Q       T  C+GTLYP+LC STL+T +PD  +K++PE+I AT+N +
Sbjct  41   PYHHRLHVHSHLQDA-----TGHCDGTLYPDLCASTLST-IPDLHSKSLPEVICATINAS  94

Query  318  VDEVKASAANCSG-IRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKH  142
               V  SA NC+  +      L   ++ AL DCL+LFS+T DEL    SDL  TA+   H
Sbjct  95   EGAVIKSAKNCTKYLHHHNYTLDTRQRYALTDCLDLFSQTLDELLDATSDL--TANPGSH  152

Query  141  YVDLQTFFSAAMTNQATCLDGFAYSKKH--VRRIIEKRLVQISHHVSNA  1
               +QT  SAA+TNQ TCLDGFAY  K    R +IE+ L  +SH VSN+
Sbjct  153  VDHVQTLLSAAITNQYTCLDGFAYVGKDGGYRSVIEQPLYHVSHLVSNS  201



>gb|AGG23325.1| pectin methylesterase 1 [Musa acuminata AAA Group]
Length=566

 Score =   127 bits (320),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 77/169 (46%), Positives = 103/169 (61%), Gaps = 11/169 (7%)
 Frame = -1

Query  498  PTHLDLNLNIHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVT  319
            P H  L+++ H Q       T  C+GTLYP+LC STL+T +PD  +K++PE+I AT+N +
Sbjct  42   PYHHRLHVHSHLQDA-----TXHCDGTLYPDLCASTLST-IPDLHSKSLPEVICATINAS  95

Query  318  VDEVKASAANCSG-IRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKH  142
               V  SA NC+  +      L   ++ AL DCL+LFS+T DEL    SDL  TA+   H
Sbjct  96   EXAVIKSAKNCTKYLHHHNYTLDTRQRYALTDCLDLFSQTLDELLDATSDL--TANPGSH  153

Query  141  YVDLQTFFSAAMTNQATCLDGFAYSKKH--VRRIIEKRLVQISHHVSNA  1
               +QT  SAA+TNQ TCLDGFAY  K    R +IE+ L  +SH VSN+
Sbjct  154  VDHVQTLLSAAITNQYTCLDGFAYVGKDGGYRSVIEQPLYHVSHLVSNS  202



>gb|KHN08672.1| Putative pectinesterase/pectinesterase inhibitor 40 [Glycine 
soja]
Length=471

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 78/104 (75%), Gaps = 0/104 (0%)
 Frame = -1

Query  312  EVKASAANCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVD  133
            EV++S+ NCSG+++ L  L PL++RALDDCL+LF +T  EL+  + DL+ +   SK + D
Sbjct  3    EVRSSSYNCSGLKKMLKNLNPLDQRALDDCLKLFEDTNVELKATIDDLSKSTIGSKRHHD  62

Query  132  LQTFFSAAMTNQATCLDGFAYSKKHVRRIIEKRLVQISHHVSNA  1
            LQT  S AMTN  TCLDGFAYSK  VR  IEK+L++ISHHVSN+
Sbjct  63   LQTMLSGAMTNLYTCLDGFAYSKGRVRDRIEKKLLEISHHVSNS  106



>ref|XP_010684346.1| PREDICTED: pectinesterase-like [Beta vulgaris subsp. vulgaris]
Length=576

 Score =   122 bits (307),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 72/164 (44%), Positives = 105/164 (64%), Gaps = 10/164 (6%)
 Frame = -1

Query  477  LNIHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKAS  298
            +++H Q  LQ+A +  C+GTLY +LC+STL+  +P    K++ EI+   ++VT  EV+AS
Sbjct  38   IHLHVQNHLQLAQSH-CDGTLYTDLCISTLSN-IPHLHKKSLTEILRYVISVTEAEVRAS  95

Query  297  AANCSGI----RRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDL  130
            A N SG+    R  L RL   +  A+ DCLEL ++T DEL  VL ++      S +  ++
Sbjct  96   ATNISGLESVNRHTLSRL---QHFAVRDCLELLADTTDELDTVLDEMTGQCGPSNNVSNI  152

Query  129  QTFFSAAMTNQATCLDGF-AYSKKHVRRIIEKRLVQISHHVSNA  1
            +T+ SAAMT Q TCLDGF   S K +RR+IE  L+ I+HHVSN+
Sbjct  153  RTYLSAAMTYQYTCLDGFDVGSSKTLRRLIETGLLNITHHVSNS  196



>tpg|DAA54386.1| TPA: hypothetical protein ZEAMMB73_825660 [Zea mays]
Length=347

 Score =   113 bits (283),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 70/156 (45%), Positives = 90/156 (58%), Gaps = 15/156 (10%)
 Frame = -1

Query  429  CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGP  250
            C+GTLYPELC+STLA  +PD   K +P++I A VN T D V A+++NCS   +    L  
Sbjct  44   CDGTLYPELCLSTLAD-IPDLHKKPLPDVICAAVNRTEDVVVATSSNCSYYLQDR-SLSA  101

Query  249  LEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDLQ------------TFFSAAM  106
             ++ A++DCLEL S T DELR   +DLA+ A        +             T  SAA+
Sbjct  102  RDRLAINDCLELLSTTMDELRASTADLASPAGRGSASAGVSQGARRATMEHVMTVLSAAI  161

Query  105  TNQATCLDGFAY-SKKHVRRIIEKRLVQISHHVSNA  1
            TNQ TCLDGFAY S   VRR IE     +S  VSN+
Sbjct  162  TNQYTCLDGFAYQSGGRVRRYIEPTFHHVSRMVSNS  197



>ref|XP_006355852.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 40-like 
[Solanum tuberosum]
Length=264

 Score =   112 bits (279),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 59/110 (54%), Positives = 75/110 (68%), Gaps = 4/110 (4%)
 Frame = -1

Query  318  VDEVKASAANCSGIRRKLPRLGPLEKRALDDCLELFSETR-DELRKVLSDLAT---TASS  151
            ++EVK+SA NCS I   + +L P+EKRALDDC+EL  +T  DEL+  L DL+T   + S 
Sbjct  1    MNEVKSSAENCSNILHHVSKLDPIEKRALDDCIELLGDTTIDELQTTLYDLSTKNISNSP  60

Query  150  SKHYVDLQTFFSAAMTNQATCLDGFAYSKKHVRRIIEKRLVQISHHVSNA  1
             KHY DLQT  S AMTNQ TCL+G   SK ++ + IEK L  IS HVSN+
Sbjct  61   LKHYYDLQTLLSGAMTNQDTCLNGIYNSKHNLSQYIEKNLHTISQHVSNS  110



>gb|KHN03710.1| Putative pectinesterase/pectinesterase inhibitor 40 [Glycine 
soja]
Length=415

 Score =   113 bits (283),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 56/106 (53%), Positives = 77/106 (73%), Gaps = 3/106 (3%)
 Frame = -1

Query  312  EVKASAANCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLA--TTASSSKHY  139
            E+++++ NCSG+++ L  L PL++RALD CL+LF +T  EL+  + DL+  +T  S +H+
Sbjct  3    EIRSTSYNCSGLKKMLKNLNPLDQRALDYCLKLFEDTSVELKATIDDLSIKSTIGSKRHH  62

Query  138  VDLQTFFSAAMTNQATCLDGFAYSKKHVRRIIEKRLVQISHHVSNA  1
             DLQT  S AMTN  T LDGFAYSK  V   IEK+L+QISHHVSN+
Sbjct  63   -DLQTLLSGAMTNLYTYLDGFAYSKGRVGDRIEKKLLQISHHVSNS  107



>ref|XP_006355816.1| PREDICTED: pectinesterase-like [Solanum tuberosum]
Length=479

 Score =   113 bits (283),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 60/110 (55%), Positives = 76/110 (69%), Gaps = 4/110 (4%)
 Frame = -1

Query  318  VDEVKASAANCSGIRRKLPRLGPLEKRALDDCLELFSETR-DELRKVLSDLATTASSS--  148
            ++EVK+SA NCS I   + +L P+EKRALDDC+EL  +T  DEL+  L DL+T  SS+  
Sbjct  1    MNEVKSSAENCSNILHHVSKLDPIEKRALDDCIELLGDTTIDELQTTLYDLSTKNSSNSP  60

Query  147  -KHYVDLQTFFSAAMTNQATCLDGFAYSKKHVRRIIEKRLVQISHHVSNA  1
             KHY DLQT  S AMTNQ TCL+G   SK ++ + IEK L  IS HVSN+
Sbjct  61   LKHYNDLQTLLSGAMTNQDTCLNGIYNSKHNLSQYIEKNLHTISQHVSNS  110



>ref|NP_001146685.1| pectinesterase precursor [Zea mays]
 gb|ACL54524.1| unknown [Zea mays]
 tpg|DAA54385.1| TPA: pectinesterase [Zea mays]
Length=563

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 70/156 (45%), Positives = 90/156 (58%), Gaps = 15/156 (10%)
 Frame = -1

Query  429  CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGP  250
            C+GTLYPELC+STLA  +PD   K +P++I A VN T D V A+++NCS   +    L  
Sbjct  44   CDGTLYPELCLSTLAD-IPDLHKKPLPDVICAAVNRTEDVVVATSSNCSYYLQDR-SLSA  101

Query  249  LEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDLQ------------TFFSAAM  106
             ++ A++DCLEL S T DELR   +DLA+ A        +             T  SAA+
Sbjct  102  RDRLAINDCLELLSTTMDELRASTADLASPAGRGSASAGVSQGARRATMEHVMTVLSAAI  161

Query  105  TNQATCLDGFAY-SKKHVRRIIEKRLVQISHHVSNA  1
            TNQ TCLDGFAY S   VRR IE     +S  VSN+
Sbjct  162  TNQYTCLDGFAYQSGGRVRRYIEPTFHHVSRMVSNS  197



>dbj|BAJ96804.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=566

 Score =   112 bits (279),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 64/145 (44%), Positives = 91/145 (63%), Gaps = 4/145 (3%)
 Frame = -1

Query  429  CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGP  250
            C+GTLYPELC+STLA  +PD   K +P++I A VN T  EV   +ANCSG  R+   L  
Sbjct  55   CDGTLYPELCLSTLAD-IPDLHKKPLPDVICAAVNRTETEVTTMSANCSGYLRER-SLSG  112

Query  249  LEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVD-LQTFFSAAMTNQATCLDGFA  73
             +  A+ DC+EL   T +EL    +DL + +++ +  +D   T  SAA+TNQ TCL+GF+
Sbjct  113  RDHLAVTDCMELLETTMEELVATTADLESPSAARRPTMDHAMTVLSAAITNQQTCLEGFS  172

Query  72   YSK-KHVRRIIEKRLVQISHHVSNA  1
            Y K   VRR +E  ++ I+  VSN+
Sbjct  173  YQKGGEVRRYMEPGILHIAKMVSNS  197



>ref|XP_010230835.1| PREDICTED: pectinesterase-like [Brachypodium distachyon]
Length=561

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 64/149 (43%), Positives = 84/149 (56%), Gaps = 8/149 (5%)
 Frame = -1

Query  429  CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGP  250
            CEGTLYPELC+STLAT +PD   K +P++I ATVN T  EV   A+NCS   ++   L P
Sbjct  43   CEGTLYPELCLSTLAT-VPDLHKKPLPDVICATVNRTEVEVADMASNCSSFLQQGKSLPP  101

Query  249  LEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDLQTFFSAAMTNQATCLDGFAY  70
             ++ A+ DC+EL   T DEL+   SDL   ++ +     + T  S A+TNQ TCL GF Y
Sbjct  102  RDRVAIADCIELLGTTMDELQATTSDLQQPSNGATVVDHVMTVLSGAITNQHTCLSGFTY  161

Query  69   SKKH-------VRRIIEKRLVQISHHVSN  4
                        R  +E  +  IS  VSN
Sbjct  162  HGPRNGGQVSLARPYMEPGIRHISRMVSN  190



>gb|EEE54425.1| hypothetical protein OsJ_01485 [Oryza sativa Japonica Group]
Length=584

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 90/157 (57%), Gaps = 17/157 (11%)
 Frame = -1

Query  429  CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCS-GIRRKLPRLG  253
            CEGTLYPELC+STLA  +PD   K++P++I  TVN T D V A++ NCS  I  K   L 
Sbjct  49   CEGTLYPELCLSTLAD-IPDLHTKSLPDVICGTVNRTKDAVAATSYNCSHYINSKY--LT  105

Query  252  PLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVD------------LQTFFSAA  109
            P ++ A+ DC+EL   T DEL+   SDL + A +  +               + T  SAA
Sbjct  106  PRDRLAISDCMELLDTTMDELQATTSDLESPAVAGGNNGSASMAAKRVTMDHVMTELSAA  165

Query  108  MTNQATCLDGFAY-SKKHVRRIIEKRLVQISHHVSNA  1
            MTNQ TCLDGF Y   + VR  +E  +  +S  VSN+
Sbjct  166  MTNQYTCLDGFDYKDGERVRHYMESSIHHVSRMVSNS  202



>ref|XP_002455538.1| hypothetical protein SORBIDRAFT_03g012830 [Sorghum bicolor]
 gb|EES00658.1| hypothetical protein SORBIDRAFT_03g012830 [Sorghum bicolor]
Length=576

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 67/156 (43%), Positives = 90/156 (58%), Gaps = 15/156 (10%)
 Frame = -1

Query  429  CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGP  250
            C+GTLYPELC+STLA  +PD   K +P++I A VN T D V A++ NCS   +    L  
Sbjct  49   CDGTLYPELCLSTLAD-IPDLHKKPLPDVICAAVNHTEDVVTATSTNCSYYLQDR-SLSA  106

Query  249  LEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYV------------DLQTFFSAAM  106
             ++ A++DCLEL S T DELR   +DL+T++  +                 + T  SAA+
Sbjct  107  RDRLAINDCLELLSTTMDELRATTADLSTSSGGNGSAAAPSVGTRRVTMDHVMTVLSAAI  166

Query  105  TNQATCLDGFAY-SKKHVRRIIEKRLVQISHHVSNA  1
            TNQ TCLDGFAY +   VR  IE     +S  VSN+
Sbjct  167  TNQYTCLDGFAYQNGGRVRHYIEPTFHHVSRMVSNS  202



>gb|EEC70505.1| hypothetical protein OsI_01594 [Oryza sativa Indica Group]
Length=565

 Score =   110 bits (275),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 90/157 (57%), Gaps = 17/157 (11%)
 Frame = -1

Query  429  CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCS-GIRRKLPRLG  253
            CEGTLYPELC+STLA  +PD   K++P++I  TVN T D V A++ NCS  I  K   L 
Sbjct  49   CEGTLYPELCLSTLAD-IPDLHTKSLPDVICGTVNRTKDAVAATSYNCSHYINSKY--LT  105

Query  252  PLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVD------------LQTFFSAA  109
            P ++ A+ DC+EL   T DEL+   SDL + A +  +               + T  SAA
Sbjct  106  PRDRLAISDCMELLDTTMDELQATTSDLESPAVAGGNNGSASMAAKRVTMDHVMTELSAA  165

Query  108  MTNQATCLDGFAY-SKKHVRRIIEKRLVQISHHVSNA  1
            MTNQ TCLDGF Y   + VR  +E  +  +S  VSN+
Sbjct  166  MTNQYTCLDGFDYKDGERVRHYMESSIHHVSRMVSNS  202



>gb|ABQ42392.1| pectin methylesterase-like protein [Taiwania cryptomerioides]
Length=595

 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 65/160 (41%), Positives = 91/160 (57%), Gaps = 6/160 (4%)
 Frame = -1

Query  471  IHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAA  292
            + R K    A   AC  TLY ELCVS++++           EI+ A VNV ++ VK   A
Sbjct  64   VRRWKSTSNAVKNACSSTLYQELCVSSISSYEGLSSQAGHMEILDAAVNVAINAVKKGQA  123

Query  291  NCSGIRRKLPR-LGPLEKRALDDCLELFSETRDELRKVLSDL--ATTASSSKHYVDLQTF  121
            +    R    R L   ++ AL+DC+E++ +T DEL   LSDL  AT  S  KH  DL+T 
Sbjct  124  HT---RSLFSRDLDSRQRGALNDCMEMYDDTLDELHDTLSDLHNATFLSMPKHAADLETL  180

Query  120  FSAAMTNQATCLDGFAYSKKHVRRIIEKRLVQISHHVSNA  1
             SAA+TNQ TCL+GF   K H+++ ++  L  +SH VSN+
Sbjct  181  LSAAITNQFTCLEGFTLCKGHLKQQVKGELHNVSHLVSNS  220



>gb|EMS68834.1| Pectinesterase 1 [Triticum urartu]
Length=449

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 63/145 (43%), Positives = 87/145 (60%), Gaps = 4/145 (3%)
 Frame = -1

Query  429  CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGP  250
            CEGTLYPELC+STLA  +PD   K +P++I A VN T  EV   +ANCS        L  
Sbjct  54   CEGTLYPELCLSTLAD-IPDLHKKPLPDVICAAVNRTETEVTTMSANCSAYLHGR-SLTS  111

Query  249  LEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVD-LQTFFSAAMTNQATCLDGFA  73
             +  A+ DC+EL   T DEL    +DL + +++ +  ++   T  SAA+TNQ TCL+GF+
Sbjct  112  RDHLAVMDCMELLDTTMDELVATTADLQSPSAARRPTMEHAVTVLSAAITNQQTCLEGFS  171

Query  72   YSK-KHVRRIIEKRLVQISHHVSNA  1
            Y K   VRR +E  +  I+  VSN+
Sbjct  172  YQKGGEVRRYMEPGIRHIAKMVSNS  196



>gb|ABZ89800.1| pectin methylesterase-like protein [Taiwania cryptomerioides]
Length=584

 Score =   102 bits (254),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 60/147 (41%), Positives = 88/147 (60%), Gaps = 4/147 (3%)
 Frame = -1

Query  435  EACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRL  256
            +AC  TL+PELCVS++A+           EI+ + V V +  V+ + A+   + R  P L
Sbjct  65   DACSSTLHPELCVSSIASYGGLSSKADHMEIVESAVRVGIGAVEKAKAHVRRLSR--PGL  122

Query  255  GPLEKRALDDCLELFSETRDELRKVLSDL--ATTASSSKHYVDLQTFFSAAMTNQATCLD  82
               ++ AL DC+E+F +T +EL+  L+DL  AT  S  K+  DL+T  S A+TNQ TCLD
Sbjct  123  DFRQRGALKDCMEMFDDTLEELQDTLTDLQNATFMSLPKYADDLKTLLSGAITNQYTCLD  182

Query  81   GFAYSKKHVRRIIEKRLVQISHHVSNA  1
            GF   K H+R+ +   L+ ISH VSN+
Sbjct  183  GFHLCKGHLRQDLNAELLNISHLVSNS  209



>ref|XP_010088304.1| putative pectinesterase/pectinesterase inhibitor 39 [Morus notabilis]
 gb|EXB33529.1| putative pectinesterase/pectinesterase inhibitor 39 [Morus notabilis]
Length=553

 Score =   100 bits (249),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 64/122 (52%), Positives = 86/122 (70%), Gaps = 4/122 (3%)
 Frame = -1

Query  366  RAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGPLEKRALDDCLELFSETRDELR  187
            R  T+P   A  ++ T+ EVKAS+ NC+ I R L    P++KRALDDCLEL  +T  EL 
Sbjct  2    RRNTLP---ATLLSHTLKEVKASSTNCTNIERNLRSSDPVQKRALDDCLELLDDTIAELN  58

Query  186  KVLSDLATTASSSKHYVDLQTFFSAAMTNQATCLDGFAYSK-KHVRRIIEKRLVQISHHV  10
             V+ DL++  S+SKH+ DLQT  S AMTNQ TC+DGF ++K K+VR  I++RL+ IS+HV
Sbjct  59   DVVFDLSSRKSASKHFHDLQTLLSGAMTNQYTCVDGFDFAKGKYVRSNIQERLLTISNHV  118

Query  9    SN  4
            SN
Sbjct  119  SN  120



>ref|XP_010501842.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3-like [Camelina 
sativa]
Length=592

 Score =   100 bits (249),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 59/149 (40%), Positives = 87/149 (58%), Gaps = 6/149 (4%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLG  253
            +C  TLYPELC+S +ATA    +  +  ++I A++N+T   V+ +      + +K   L 
Sbjct  62   SCSSTLYPELCISAVATA-GGVKLTSQKDVIEASLNLTTTAVEHNYFTVKKLIKKRKGLT  120

Query  252  PLEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTFFSAAMTNQATCLD  82
            P EK AL DCLE   ET DEL   + DL    T  +  +H  DL+T  S+A+TNQ TCLD
Sbjct  121  PREKTALHDCLETIDETLDELHDAVEDLHLYPTKKTLREHASDLKTLISSAITNQETCLD  180

Query  81   GFAY--SKKHVRRIIEKRLVQISHHVSNA  1
            GF++  + K VR+ ++K  + + H  SNA
Sbjct  181  GFSHDSADKEVRKALQKGQIHVEHMCSNA  209



>emb|CDX97564.1| BnaA05g25150D [Brassica napus]
Length=592

 Score =   100 bits (248),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 61/149 (41%), Positives = 86/149 (58%), Gaps = 6/149 (4%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLG  253
            AC  TLYPELC+S +ATA    +  +  ++I A++N+T   V+ +      + +K   L 
Sbjct  64   ACSSTLYPELCISAVATA-GGVKLTSQKDVIEASLNLTTTAVEHNYFGVKKLIKKTKGLT  122

Query  252  PLEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTFFSAAMTNQATCLD  82
            P EK AL DCLE   ET DEL + L DL       S  +H  DL+T  S+A+TNQ TCLD
Sbjct  123  PREKTALHDCLETIDETLDELHEALEDLHMYPNKKSLREHAGDLKTLISSAITNQETCLD  182

Query  81   GFAY--SKKHVRRIIEKRLVQISHHVSNA  1
            GF++  + K VR+ + K  + + H  SNA
Sbjct  183  GFSHDAADKKVRKALLKGQMHVEHMCSNA  211



>ref|XP_009146386.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3 [Brassica 
rapa]
Length=592

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 61/149 (41%), Positives = 86/149 (58%), Gaps = 6/149 (4%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLG  253
            AC  TLYPELC+S +ATA    +  +  ++I A++N+T   V+ +      + +K   L 
Sbjct  64   ACSSTLYPELCISAVATA-GGVKLTSQKDVIEASLNLTTTAVEHNYFGVKKLIKKTKGLT  122

Query  252  PLEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTFFSAAMTNQATCLD  82
            P EK AL DCLE   ET DEL + L DL       S  +H  DL+T  S+A+TNQ TCLD
Sbjct  123  PREKTALHDCLETIDETLDELHEALEDLHMYPNKKSLREHAGDLKTLISSAITNQETCLD  182

Query  81   GFAY--SKKHVRRIIEKRLVQISHHVSNA  1
            GF++  + K VR+ + K  + + H  SNA
Sbjct  183  GFSHDAADKKVRKALLKGQMHVEHMCSNA  211



>ref|XP_002891774.1| ATPME2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68033.1| ATPME2 [Arabidopsis lyrata subsp. lyrata]
Length=586

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 76/222 (34%), Positives = 110/222 (50%), Gaps = 26/222 (12%)
 Frame = -1

Query  642  VTRMHNLKQKATLFFTISGCSAIVLLAFLSVTSFNSLFTKDGISSSTGPTHLDLNLNIHR  463
            +++  + K    L  +    +AI LL F +V          GI+++T     + N N   
Sbjct  8    ISKFSDFKNNKKLILS---SAAIALLLFATVV---------GIAATT-----NQNKNKKI  50

Query  462  QKLLQVAHT---EACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAA  292
              L   +H      C  TLYPELC ST+A A   ++  +  E+I A++N+T   VK +  
Sbjct  51   TTLSSTSHAVLKSVCSSTLYPELCFSTVA-ATGGKQLTSQKEVIEASLNLTTKAVKHNYF  109

Query  291  NCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTF  121
                +  K   L P E  AL DCLE   ET DEL   + D+       S  KH  DL+T 
Sbjct  110  AVKKLIAKRKGLTPREVTALHDCLETIDETLDELHVAVEDIHQYPKQKSLRKHADDLKTL  169

Query  120  FSAAMTNQATCLDGFAY--SKKHVRRIIEKRLVQISHHVSNA  1
             S+A+TNQ TCLDGF+Y  + + VR+++ K  V + H  SNA
Sbjct  170  ISSAITNQGTCLDGFSYDDADRKVRKVLLKGQVHVEHMCSNA  211



>gb|KGN44975.1| Pectinesterase [Cucumis sativus]
Length=614

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 60/154 (39%), Positives = 85/154 (55%), Gaps = 5/154 (3%)
 Frame = -1

Query  456  LLQVAHTEA---CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANC  286
            L Q  H  A   C GTL+P+LC S L++  P   + +  ++  + +N T  EV  +  NC
Sbjct  93   LFQTFHQTARSLCNGTLFPDLCFSKLSS-FPQLASLSPEKLAGSALNFTSREVLLAYTNC  151

Query  285  SGIRRKL-PRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDLQTFFSAA  109
            + ++  L   L P ++ ALDDCLEL   +  EL+  + DLA + S + H  DL T  SAA
Sbjct  152  TNLKTHLYSGLNPTDRHALDDCLELLDGSIAELKASIFDLAPSQSPALHSHDLLTLVSAA  211

Query  108  MTNQATCLDGFAYSKKHVRRIIEKRLVQISHHVS  7
            MTN  TC+DGF  S   VR  +E  L +I  H+S
Sbjct  212  MTNHRTCVDGFYNSSGTVRSRVELYLGKIGQHLS  245



>ref|XP_010465323.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3 [Camelina 
sativa]
Length=592

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 58/149 (39%), Positives = 87/149 (58%), Gaps = 6/149 (4%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLG  253
            +C  TLYPELC+S +ATA    +  +  ++I A++N+T   V+ +      + +K   L 
Sbjct  62   SCSSTLYPELCISAVATA-GGVKLTSQKDVIEASLNLTTTAVEHNYFTVKKLIKKRKGLT  120

Query  252  PLEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTFFSAAMTNQATCLD  82
            P EK AL DCLE   ET DEL + + DL    T  +  +H  DL+T  S+A+TNQ TCLD
Sbjct  121  PREKTALHDCLETIDETLDELHEAVEDLHLYPTKKTLREHAADLKTLISSAITNQETCLD  180

Query  81   GFAY--SKKHVRRIIEKRLVQISHHVSNA  1
            GF++  + K VR+ ++   + + H  SNA
Sbjct  181  GFSHDGADKQVRKALQMGQIHVEHMCSNA  209



>ref|XP_009117000.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3-like [Brassica 
rapa]
Length=592

 Score = 99.4 bits (246),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 59/149 (40%), Positives = 86/149 (58%), Gaps = 6/149 (4%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLG  253
            AC  TLYPELC+S +AT+    +  +  ++I A++N+T   V+ +      + + +  L 
Sbjct  64   ACSSTLYPELCISAVATS-GGVKLTSQKDVIEASLNLTTTAVEHNYFTVKKLIKNMKGLT  122

Query  252  PLEKRALDDCLELFSETRDELRKVLSDLATTASSS---KHYVDLQTFFSAAMTNQATCLD  82
            P EK AL DCLE   ET DEL + L DL    +     +H  DL+T  S+A+TNQ TCLD
Sbjct  123  PREKTALHDCLETIDETLDELHETLEDLQMYPNKKTLREHAGDLKTLISSAITNQETCLD  182

Query  81   GFAY--SKKHVRRIIEKRLVQISHHVSNA  1
            GF++  + K VR+ + K  V + H  SNA
Sbjct  183  GFSHDDADKKVRKFLLKGQVHVEHMCSNA  211



>ref|XP_010056842.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=538

 Score = 98.6 bits (244),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 60/157 (38%), Positives = 91/157 (58%), Gaps = 11/157 (7%)
 Frame = -1

Query  453  LQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIR  274
            LQV H+  C GT Y +LCVSTLA+      + + PEII+A ++ +  EV+A++ +C+ ++
Sbjct  31   LQVTHSR-CRGTPYSDLCVSTLAS-FTGLASMSFPEIISAMLHQSASEVRAASTHCTVMK  88

Query  273  RK-LPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDLQTFFSAAMTNQ  97
               L +L  LE++ALD CLELF +  D+    +S L ++  + +HY DLQ+  S  MTN 
Sbjct  89   NHFLGKLSMLERQALDICLELFRDIFDDFDNAVSYLESSKVTVRHYYDLQSLLSGMMTNV  148

Query  96   ATCLDGFAYSKKHVRRI-----IEKRLVQISHHVSNA  1
             TC D F     H   +     ++ RL  I  HVSN+
Sbjct  149  YTCTDEF---DPHTDNLNLGDSMKDRLSNILRHVSNS  182



>gb|KDO53765.1| hypothetical protein CISIN_1g018173mg [Citrus sinensis]
Length=360

 Score = 96.7 bits (239),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 63/153 (41%), Positives = 87/153 (57%), Gaps = 13/153 (8%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPD--RRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPR  259
            +C  T YP+LC S +A A+P+  ++  +  ++I  ++N+T   V+    N  GI++ L R
Sbjct  72   SCSSTRYPDLCFSAIA-AVPEASKKVTSQKDVIEMSLNITTTAVEH---NYFGIQKLLKR  127

Query  258  --LGPLEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTFFSAAMTNQA  94
              L   EK AL DCLE   ET DEL K + DL       S S+H  DL+T  SAAMTNQ 
Sbjct  128  TNLTKREKVALHDCLETIDETLDELHKAVEDLEEYPNKKSLSQHADDLKTLMSAAMTNQG  187

Query  93   TCLDGFAY--SKKHVRRIIEKRLVQISHHVSNA  1
            TCLDGF++  + KHVR  +    V +    SNA
Sbjct  188  TCLDGFSHDDANKHVRDALSDGQVHVEKMCSNA  220



>emb|CDX75765.1| BnaC03g38480D [Brassica napus]
Length=479

 Score = 97.4 bits (241),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 59/151 (39%), Positives = 87/151 (58%), Gaps = 6/151 (4%)
 Frame = -1

Query  438  TEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPR  259
            T AC  T YPELC+STLAT+    +  +  ++I A++N+T   V+ +      + +K   
Sbjct  51   TSACSSTRYPELCISTLATS-GGVKLTSQKDVIEASLNLTTTAVEHNYFTVKKLIKKRKG  109

Query  258  LGPLEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTFFSAAMTNQATC  88
            L P EK AL DCLE   ET DEL + + DL       S  +H  DL+T  S+A+TNQ TC
Sbjct  110  LTPREKTALHDCLETIDETLDELHEAVEDLQLYPNKKSLREHAGDLKTLISSAITNQETC  169

Query  87   LDGFAYSK--KHVRRIIEKRLVQISHHVSNA  1
            LDGF++ +  K +R+ + K  + + +  SNA
Sbjct  170  LDGFSHDRADKKIRKALLKGQMHVEYMCSNA  200



>ref|XP_006407094.1| hypothetical protein EUTSA_v10020354mg [Eutrema salsugineum]
 gb|ESQ48547.1| hypothetical protein EUTSA_v10020354mg [Eutrema salsugineum]
Length=592

 Score = 98.2 bits (243),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 59/149 (40%), Positives = 87/149 (58%), Gaps = 6/149 (4%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLG  253
            +C  TLYPELCVS +AT+  D +  +  ++I A++N+T   V+ +      + +    L 
Sbjct  64   SCSSTLYPELCVSAVATS-GDVKLTSQKDVIEASLNLTTIAVEHNYFTVKKLIKNRKGLT  122

Query  252  PLEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTFFSAAMTNQATCLD  82
            P EK AL DCLE   ET DEL + + DL    T  +  +H  DL+T  S+A+TNQ TCLD
Sbjct  123  PREKTALHDCLETIDETLDELHEAVEDLHLYPTKKTLREHAGDLKTLISSAITNQETCLD  182

Query  81   GFAY--SKKHVRRIIEKRLVQISHHVSNA  1
            GF++  + K VR+ + K  + + H  SNA
Sbjct  183  GFSHDAADKKVRKALMKGQIHVEHMCSNA  211



>emb|CDY39109.1| BnaA01g29470D [Brassica napus]
Length=558

 Score = 98.2 bits (243),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 59/149 (40%), Positives = 86/149 (58%), Gaps = 6/149 (4%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLG  253
            AC  TLYPELC+S +AT+    +  +  ++I A++N+T   V+ +      + +    L 
Sbjct  64   ACSSTLYPELCISAVATS-GGVKLTSQKDVIEASLNLTTIAVEHNYFTVKKLIKNRKGLT  122

Query  252  PLEKRALDDCLELFSETRDELRKVLSDLATTASSS---KHYVDLQTFFSAAMTNQATCLD  82
            P EK AL DCLE   ET DEL + L DL    +     +H  DL+T  S+A+TNQ TCLD
Sbjct  123  PREKTALHDCLETIDETLDELHETLEDLQMYPNKKTLREHAGDLKTLISSAITNQETCLD  182

Query  81   GFAY--SKKHVRRIIEKRLVQISHHVSNA  1
            GF++  + K VR+++ K  V + H  SNA
Sbjct  183  GFSHDDADKKVRKVLLKGQVHVEHMCSNA  211



>emb|CDX98441.1| BnaC05g39340D [Brassica napus]
Length=572

 Score = 98.2 bits (243),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 60/149 (40%), Positives = 85/149 (57%), Gaps = 6/149 (4%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLG  253
            AC  TLYPELC+S +ATA    +  +  ++I A++N+T   V+ +      + +    L 
Sbjct  64   ACSSTLYPELCISAVATA-GGVKLMSQKDVIEASLNLTTTAVEHNYFGVKKLIKNTKGLT  122

Query  252  PLEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTFFSAAMTNQATCLD  82
            P EK AL DCLE   ET DEL + L DL       S  +H  DL+T  S+A+TNQ TCLD
Sbjct  123  PREKTALHDCLETIDETLDELHEALEDLHMYPNKKSLREHAGDLKTLISSAITNQETCLD  182

Query  81   GFAY--SKKHVRRIIEKRLVQISHHVSNA  1
            GF++  + K VR+ + K  + + H  SNA
Sbjct  183  GFSHDAADKKVRKALLKGQMHVEHMCSNA  211



>ref|XP_004136014.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 40-like 
[Cucumis sativus]
Length=561

 Score = 97.8 bits (242),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 56/142 (39%), Positives = 81/142 (57%), Gaps = 2/142 (1%)
 Frame = -1

Query  429  CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKL-PRLG  253
            C GTL+P+LC S L++  P   + +  ++  + +N T  EV  +  NC+ ++  L   L 
Sbjct  52   CNGTLFPDLCFSKLSS-FPQLASLSPEKLAGSALNFTSREVLLAYTNCTNLKTHLYSGLN  110

Query  252  PLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDLQTFFSAAMTNQATCLDGFA  73
            P ++ ALDDCLEL   +  EL+  + DLA + S + H  DL T  SAAMTN  TC+DGF 
Sbjct  111  PTDRHALDDCLELLDGSIAELKASIFDLAPSQSPALHSHDLLTLVSAAMTNHRTCVDGFY  170

Query  72   YSKKHVRRIIEKRLVQISHHVS  7
             S   VR  +E  L +I  H+S
Sbjct  171  NSSGTVRSRVELYLGKIGQHLS  192



>emb|CDY33228.1| BnaC01g37010D [Brassica napus]
Length=592

 Score = 97.8 bits (242),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 59/149 (40%), Positives = 86/149 (58%), Gaps = 6/149 (4%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLG  253
            AC  TLYPELC+S +AT+    +  +  ++I A++N+T   V+ +      + +    L 
Sbjct  64   ACSSTLYPELCISAVATS-GGVKLTSQKDVIEASLNLTTIAVEHNYFTVKKLIKNRKGLT  122

Query  252  PLEKRALDDCLELFSETRDELRKVLSDLATTASSS---KHYVDLQTFFSAAMTNQATCLD  82
            P EK AL DCLE   ET DEL + L DL    +     +H  DL+T  S+A+TNQ TCLD
Sbjct  123  PREKTALHDCLETIDETLDELHETLEDLQMYPNKKTLREHAGDLKTLISSAITNQETCLD  182

Query  81   GFAY--SKKHVRRIIEKRLVQISHHVSNA  1
            GF++  + K VR+++ K  V + H  SNA
Sbjct  183  GFSHDDADKKVRKVLLKGQVHVEHMCSNA  211



>gb|ABG46324.1| putative pectin methylesterase [Picea abies]
Length=393

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 63/158 (40%), Positives = 86/158 (54%), Gaps = 6/158 (4%)
 Frame = -1

Query  465  RQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIP-EIIAATVNVTVDEVKASAAN  289
            R K    A   AC  TLYPE CVS++++  P    +  P EI+   V +++  V+   AN
Sbjct  26   RWKSTSKAVHHACSSTLYPEFCVSSVSS-FPGLSKRPGPMEILKVVVKLSIAAVEK--AN  82

Query  288  CSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLA--TTASSSKHYVDLQTFFS  115
                R   P L   ++ AL DC ELF ET DEL   LSDL   T  S  +   DL+T  S
Sbjct  83   ARARRLSRPGLDQRQRGALQDCFELFDETLDELYSTLSDLKNKTFISIPQSASDLETLLS  142

Query  114  AAMTNQATCLDGFAYSKKHVRRIIEKRLVQISHHVSNA  1
            AA+TNQ TC+D F + K ++++ +   L  ISH VSN+
Sbjct  143  AAITNQYTCIDSFTHCKGNLKQSLLGGLRNISHLVSNS  180



>ref|XP_010489830.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3-like [Camelina 
sativa]
Length=213

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/141 (40%), Positives = 83/141 (59%), Gaps = 6/141 (4%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLG  253
            +C  TLYPELC+S +ATA    +  +  ++I A++N+T   V+ +      + +K   L 
Sbjct  62   SCSSTLYPELCISAVATA-GGVKLTSQKDVIEASLNLTTTAVEHNYFTVKKLIKKRKGLT  120

Query  252  PLEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTFFSAAMTNQATCLD  82
            P EK AL DCLE   ET DEL   + DL    T  +  +H  DL+T  S+A+TNQ TCLD
Sbjct  121  PREKTALHDCLETIDETLDELHDAVEDLHLYPTKKTLREHAGDLKTLISSAITNQETCLD  180

Query  81   GFAY--SKKHVRRIIEKRLVQ  25
            GF++  + K VR+ ++K  V+
Sbjct  181  GFSHDSADKEVRKALQKGQVR  201



>ref|XP_006297218.1| hypothetical protein CARUB_v10013226mg, partial [Capsella rubella]
 gb|EOA30116.1| hypothetical protein CARUB_v10013226mg, partial [Capsella rubella]
Length=623

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 59/149 (40%), Positives = 85/149 (57%), Gaps = 6/149 (4%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLG  253
            +C  TLYPELC+S +ATA       +  ++I A++N+T   V+ +      + +K   L 
Sbjct  93   SCSSTLYPELCISAVATA-GGVELTSQKDVIEASLNLTKTAVEHNYFTVRKLIKKRKGLT  151

Query  252  PLEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTFFSAAMTNQATCLD  82
            P EK AL DCLE   ET DEL   + DL    T  +  +H  DL+T  S+A+TNQ TCLD
Sbjct  152  PREKTALHDCLETIDETLDELHDAVEDLHLYPTKKTLRQHAGDLKTLISSAITNQETCLD  211

Query  81   GFAY--SKKHVRRIIEKRLVQISHHVSNA  1
            GF++  + K VR+ + K  + + H  SNA
Sbjct  212  GFSHDGADKQVRKALLKGQIHVEHMCSNA  240



>ref|XP_004171768.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 40-like 
[Cucumis sativus]
Length=591

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/142 (39%), Positives = 81/142 (57%), Gaps = 2/142 (1%)
 Frame = -1

Query  429  CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKL-PRLG  253
            C GTL+P+LC S L++  P   + +  ++  + +N T  EV  +  NC+ ++  L   L 
Sbjct  82   CNGTLFPDLCFSKLSS-FPLLASLSPEKLAGSALNFTSREVLLAYTNCTNLKTHLYSGLN  140

Query  252  PLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDLQTFFSAAMTNQATCLDGFA  73
            P ++ ALDDCLEL   +  EL+  + DLA + S + H  DL T  SAAMTN  TC+DGF 
Sbjct  141  PTDRHALDDCLELLDGSIAELKASIFDLAPSQSPALHSHDLLTLVSAAMTNHRTCVDGFY  200

Query  72   YSKKHVRRIIEKRLVQISHHVS  7
             S   VR  +E  L +I  H+S
Sbjct  201  NSSGTVRSRVELYLGKIGQHLS  222



>ref|NP_188048.1| pectin methylesterase 3 [Arabidopsis thaliana]
 sp|O49006.2|PME3_ARATH RecName: Full=Pectinesterase/pectinesterase inhibitor 3; Includes: 
RecName: Full=Pectinesterase inhibitor 3; AltName: Full=Pectin 
methylesterase inhibitor 3; Includes: RecName: Full=Pectinesterase 
3; Short=PE 3; AltName: Full=Pectin methylesterase 
27; Short=AtPME27; AltName: Full=Pectin methylesterase 
3; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB01037.1| pectinesterase [Arabidopsis thaliana]
 gb|AAK59769.1| AT3g14310/MLN21_9 [Arabidopsis thaliana]
 gb|AAK97722.1| AT3g14310/MLN21_9 [Arabidopsis thaliana]
 gb|AAN28889.1| At3g14310/MLN21_9 [Arabidopsis thaliana]
 gb|AEE75500.1| pectin methylesterase 3 [Arabidopsis thaliana]
Length=592

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 58/149 (39%), Positives = 85/149 (57%), Gaps = 6/149 (4%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLG  253
            +C  T YPELC+S + TA       +  ++I A+VN+T+  V+ +      + +K   L 
Sbjct  62   SCSSTRYPELCISAVVTA-GGVELTSQKDVIEASVNLTITAVEHNYFTVKKLIKKRKGLT  120

Query  252  PLEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTFFSAAMTNQATCLD  82
            P EK AL DCLE   ET DEL + + DL    T  +  +H  DL+T  S+A+TNQ TCLD
Sbjct  121  PREKTALHDCLETIDETLDELHETVEDLHLYPTKKTLREHAGDLKTLISSAITNQETCLD  180

Query  81   GFAY--SKKHVRRIIEKRLVQISHHVSNA  1
            GF++  + K VR+ + K  + + H  SNA
Sbjct  181  GFSHDDADKQVRKALLKGQIHVEHMCSNA  209



>ref|XP_007012502.1| Pectin methylesterase 3 [Theobroma cacao]
 gb|EOY30121.1| Pectin methylesterase 3 [Theobroma cacao]
Length=573

 Score = 95.9 bits (237),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 61/152 (40%), Positives = 90/152 (59%), Gaps = 9/152 (6%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPD--RRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPR  259
            +C  TLYPELC+ST++ A PD   + K+  ++I  ++N+T+  V+++  +   +      
Sbjct  61   SCSSTLYPELCLSTISAA-PDAETKIKSPKDVIVTSMNLTITAVQSNYLSIKKLISTNKN  119

Query  258  LGPLEKRALDDCLELFSETRDELRKVLSDLAT----TASSSKHYVDLQTFFSAAMTNQAT  91
            L   EK AL+DCLEL  ET DEL K   DL+       S S+H  +L+T  SAAMTNQ T
Sbjct  120  LPKREKTALNDCLELEDETLDELYKAEQDLSDYPTFNKSISQHADELKTLLSAAMTNQET  179

Query  90   CLDGFAY--SKKHVRRIIEKRLVQISHHVSNA  1
            CLDGF++  + K VR+ +    + + H  SNA
Sbjct  180  CLDGFSHDSADKKVRQALIDGQMHVFHMCSNA  211



>sp|O04886.1|PME1_CITSI RecName: Full=Pectinesterase 1; Short=PE 1; AltName: Full=Pectin 
methylesterase; Flags: Precursor [Citrus sinensis]
 gb|AAB57667.1| pectinesterase [Citrus sinensis]
Length=584

 Score = 95.9 bits (237),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 63/153 (41%), Positives = 87/153 (57%), Gaps = 13/153 (8%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPD--RRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPR  259
            +C  T YP+LC S +A A+P+  ++  +  ++I  ++N+T   V+    N  GI++ L R
Sbjct  72   SCSSTRYPDLCFSAIA-AVPEASKKVTSQKDVIEMSLNITTTAVEH---NYFGIQKLLKR  127

Query  258  --LGPLEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTFFSAAMTNQA  94
              L   EK AL DCLE   ET DEL K + DL       S S+H  DL+T  SAAMTNQ 
Sbjct  128  TNLTKREKVALHDCLETIDETLDELHKAVEDLEEYPNKKSLSQHADDLKTLMSAAMTNQG  187

Query  93   TCLDGFAY--SKKHVRRIIEKRLVQISHHVSNA  1
            TCLDGF++  + KHVR  +    V +    SNA
Sbjct  188  TCLDGFSHDDANKHVRDALSDGQVHVEKMCSNA  220



>ref|NP_001275859.1| pectinesterase 1 precursor [Citrus sinensis]
 ref|XP_006426800.1| hypothetical protein CICLE_v10025238mg [Citrus clementina]
 gb|AAB57670.1| pectinesterase [Citrus sinensis]
 gb|ESR40040.1| hypothetical protein CICLE_v10025238mg [Citrus clementina]
Length=584

 Score = 95.9 bits (237),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 63/153 (41%), Positives = 87/153 (57%), Gaps = 13/153 (8%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPD--RRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPR  259
            +C  T YP+LC S +A A+P+  ++  +  ++I  ++N+T   V+    N  GI++ L R
Sbjct  72   SCSSTRYPDLCFSAIA-AVPEASKKVTSQKDVIEMSLNITTTAVEH---NYFGIQKLLKR  127

Query  258  --LGPLEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTFFSAAMTNQA  94
              L   EK AL DCLE   ET DEL K + DL       S S+H  DL+T  SAAMTNQ 
Sbjct  128  TNLTKREKVALHDCLETIDETLDELHKAVEDLEEYPNKKSLSQHADDLKTLMSAAMTNQG  187

Query  93   TCLDGFAY--SKKHVRRIIEKRLVQISHHVSNA  1
            TCLDGF++  + KHVR  +    V +    SNA
Sbjct  188  TCLDGFSHDDANKHVRDALSDGQVHVEKMCSNA  220



>sp|P83948.1|PME3_CITSI RecName: Full=Pectinesterase 3; Short=PE 3; AltName: Full=Pectin 
methylesterase 3; Flags: Precursor [Citrus sinensis]
Length=584

 Score = 95.9 bits (237),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 63/153 (41%), Positives = 87/153 (57%), Gaps = 13/153 (8%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPD--RRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPR  259
            +C  T YP+LC S +A A+P+  ++  +  ++I  ++N+T   V+    N  GI++ L R
Sbjct  72   SCSSTRYPDLCFSAIA-AVPEASKKVTSQKDVIEMSLNITTTAVEH---NYFGIQKLLKR  127

Query  258  --LGPLEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTFFSAAMTNQA  94
              L   EK AL DCLE   ET DEL K + DL       S S+H  DL+T  SAAMTNQ 
Sbjct  128  TNLTKREKVALHDCLETIDETLDELHKAVEDLEEYPNKKSLSQHADDLKTLMSAAMTNQG  187

Query  93   TCLDGFAY--SKKHVRRIIEKRLVQISHHVSNA  1
            TCLDGF++  + KHVR  +    V +    SNA
Sbjct  188  TCLDGFSHDDANKHVRDALSDGQVHVEKMCSNA  220



>gb|AAC50023.1| ATPME2 precursor, partial [Arabidopsis thaliana]
Length=582

 Score = 95.9 bits (237),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 80/148 (54%), Gaps = 6/148 (4%)
 Frame = -1

Query  429  CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGP  250
            C  TLYPELC S +A A   +   +  E+I A++N+T   VK +      +  K   L P
Sbjct  61   CSSTLYPELCFSAVA-ATGGKELTSQKEVIEASLNLTTKAVKHNYFAVKKLIAKRKGLTP  119

Query  249  LEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTFFSAAMTNQATCLDG  79
             E  AL DCLE   ET DEL   + DL       S  KH  DL+T  S+A+TNQ TCLDG
Sbjct  120  REVTALHDCLETIDETLDELHVAVEDLHQYPKQKSLRKHADDLKTLISSAITNQGTCLDG  179

Query  78   FAY--SKKHVRRIIEKRLVQISHHVSNA  1
            F+Y  + + VR+ + K  V + H  SNA
Sbjct  180  FSYDDADRKVRKALLKGQVHVEHMCSNA  207



>ref|NP_175786.1| pectin methylesterase 2 [Arabidopsis thaliana]
 sp|Q42534.2|PME2_ARATH RecName: Full=Pectinesterase 2; Short=PE 2; AltName: Full=Pectin 
methylesterase 2; Short=AtPME2; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF02856.1|AC009324_5 pectinesterase 2 [Arabidopsis thaliana]
 gb|AAK32805.1|AF361637_1 At1g53830/T18A20_6 [Arabidopsis thaliana]
 gb|AAM91439.1| At1g53830/T18A20_6 [Arabidopsis thaliana]
 gb|AEE33007.1| pectin methylesterase 2 [Arabidopsis thaliana]
Length=587

 Score = 95.9 bits (237),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 80/148 (54%), Gaps = 6/148 (4%)
 Frame = -1

Query  429  CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGP  250
            C  TLYPELC S +A A   +   +  E+I A++N+T   VK +      +  K   L P
Sbjct  66   CSSTLYPELCFSAVA-ATGGKELTSQKEVIEASLNLTTKAVKHNYFAVKKLIAKRKGLTP  124

Query  249  LEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTFFSAAMTNQATCLDG  79
             E  AL DCLE   ET DEL   + DL       S  KH  DL+T  S+A+TNQ TCLDG
Sbjct  125  REVTALHDCLETIDETLDELHVAVEDLHQYPKQKSLRKHADDLKTLISSAITNQGTCLDG  184

Query  78   FAY--SKKHVRRIIEKRLVQISHHVSNA  1
            F+Y  + + VR+ + K  V + H  SNA
Sbjct  185  FSYDDADRKVRKALLKGQVHVEHMCSNA  212



>gb|KJB54564.1| hypothetical protein B456_009G039100 [Gossypium raimondii]
Length=412

 Score = 94.0 bits (232),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 63/154 (41%), Positives = 90/154 (58%), Gaps = 12/154 (8%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATAL-PDRRAKTIPEIIAATVNVTVDEVKASAANCSGI---RRKL  265
            +C  TLYPELC ST+++A   + + K   ++I  ++N+TV  V+++  +   +   RRK 
Sbjct  52   SCSSTLYPELCYSTISSAPHAETKVKNPKDVIEMSLNLTVTAVQSNYLSIKKLISTRRK-  110

Query  264  PRLGPLEKRALDDCLELFSETRDELRKVLSDLAT----TASSSKHYVDLQTFFSAAMTNQ  97
              L   EK AL+DCLEL  ET DEL     DL+       S S+H  DL++  SAAMTNQ
Sbjct  111  -SLTEREKAALNDCLELVDETLDELLVAEHDLSDYPSFNKSISQHAEDLKSLLSAAMTNQ  169

Query  96   ATCLDGFAYSK--KHVRRIIEKRLVQISHHVSNA  1
             TCLDGF++ K  K VR+ +    + + H  SNA
Sbjct  170  ETCLDGFSHDKADKKVRQALLDGQMHVFHMCSNA  203



>ref|XP_009116991.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3-like [Brassica 
rapa]
Length=592

 Score = 95.5 bits (236),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 58/149 (39%), Positives = 86/149 (58%), Gaps = 6/149 (4%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLG  253
            AC  TLY ELC+S +AT+    +  +  ++I A++N+T   V+ +      + + +  L 
Sbjct  64   ACSSTLYTELCISAVATS-GGVKLTSQKDVIEASLNLTTIAVEHNYFTVKKLIKNMKGLT  122

Query  252  PLEKRALDDCLELFSETRDELRKVLSDLATTASSS---KHYVDLQTFFSAAMTNQATCLD  82
            P EK AL DCLE   ET DEL + L DL    +     +H  DL+T  S+A+TNQ TCLD
Sbjct  123  PREKTALHDCLETIDETLDELHETLEDLQMYPNKKTLREHAGDLKTLISSAITNQETCLD  182

Query  81   GFAY--SKKHVRRIIEKRLVQISHHVSNA  1
            GF++  + K VR+++ K  V + H  SNA
Sbjct  183  GFSHDDADKKVRKVLLKGQVHVEHMCSNA  211



>gb|AAC72288.1| putative pectin methylesterase [Arabidopsis thaliana]
Length=592

 Score = 95.5 bits (236),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 59/153 (39%), Positives = 87/153 (57%), Gaps = 14/153 (9%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATA----LPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKL  265
            +C  T YPELC+S + TA    L  ++     ++I A+VN+T+  V+ +      + +K 
Sbjct  62   SCSSTRYPELCISAVVTAGACELTSQK-----DVIEASVNLTITAVEHNYFTVKKLIKKR  116

Query  264  PRLGPLEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTFFSAAMTNQA  94
              L P EK AL DCLE   ET DEL + + DL    T  +  +H  DL+T  S+A+TNQ 
Sbjct  117  KGLTPREKTALHDCLETIDETLDELHETVEDLHLYPTKKTLREHAGDLKTLISSAITNQE  176

Query  93   TCLDGFAY--SKKHVRRIIEKRLVQISHHVSNA  1
            TCLDGF++  + K VR+ + K  + + H  SNA
Sbjct  177  TCLDGFSHDDADKQVRKALLKGQIHVEHMCSNA  209



>ref|XP_010042403.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 40, 
partial [Eucalyptus grandis]
Length=253

 Score = 92.4 bits (228),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 57/154 (37%), Positives = 88/154 (57%), Gaps = 5/154 (3%)
 Frame = -1

Query  453  LQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIR  274
            LQV H+  C GT Y +LCVSTLA +       +  EII+A ++ +  EV+A++ +C+ ++
Sbjct  31   LQVTHSR-CRGTPYSDLCVSTLA-SFTGLATMSFLEIISAMLHQSASEVRAASTHCTVMK  88

Query  273  RKLP-RLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDLQTFFSAAMTNQ  97
               P +L  LE++ALD CLEL  +  D+    +S L ++  + +HY DLQ+  S  MTN 
Sbjct  89   NHFPEKLSMLERQALDICLELSRDILDDFDNAVSYLESSKVTIRHYYDLQSLLSGLMTNV  148

Query  96   ATCLDGFAYSKKHVR--RIIEKRLVQISHHVSNA  1
             TC D       ++     ++ RL  IS HVSN+
Sbjct  149  YTCTDELDPPTDNLNLGDSMKDRLSNISRHVSNS  182



>gb|KHF97383.1| Pectinesterase/pectinesterase inhibitor U1 [Gossypium arboreum]
Length=567

 Score = 95.1 bits (235),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 65/155 (42%), Positives = 91/155 (59%), Gaps = 14/155 (9%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPD--RRAKTIPEIIAATVNVTVDEVKASAANCSGI---RRK  268
            +C  TLYPELC ST+++A PD   + K   ++I  ++N+TV  V+++  +   +   RRK
Sbjct  52   SCSSTLYPELCYSTISSA-PDAETKVKNPKDVIELSLNLTVTAVQSNYLSIKKLISTRRK  110

Query  267  LPRLGPLEKRALDDCLELFSETRDELRKVLSDLAT----TASSSKHYVDLQTFFSAAMTN  100
               L   EK AL+DCLEL  ET DEL     DL+       S S+H  DL++  SAAMTN
Sbjct  111  --SLTEREKAALNDCLELVDETLDELFVAEHDLSDYPSFNKSISQHADDLKSLLSAAMTN  168

Query  99   QATCLDGFAYSK--KHVRRIIEKRLVQISHHVSNA  1
            Q TCLDGF++ K  K VR+ +    + + H  SNA
Sbjct  169  QETCLDGFSHDKADKKVRQALLDGQMHVFHMCSNA  203



>emb|CDY51798.1| BnaC06g41940D [Brassica napus]
Length=585

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 60/148 (41%), Positives = 81/148 (55%), Gaps = 7/148 (5%)
 Frame = -1

Query  429  CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGP  250
            C  TLYPELC S  A A   ++  +  ++I A++N+T + VK +      +  K   L  
Sbjct  66   CSSTLYPELCFS--AVAATGKKLTSDKDVIEASLNLTTNAVKHNYFAVKKLITKRKGLTA  123

Query  249  LEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTFFSAAMTNQATCLDG  79
             E  AL DCLE+  ET DEL   L DL       S  KH  DL+T  S+A+TNQ TCLDG
Sbjct  124  RELTALHDCLEIIDETLDELHVALEDLHQYPKGKSLRKHADDLKTLISSAITNQGTCLDG  183

Query  78   FAYSK--KHVRRIIEKRLVQISHHVSNA  1
            F+Y K  + +R+ + K  V + H  SNA
Sbjct  184  FSYDKADRKLRKALLKGQVHVEHMCSNA  211



>emb|CDY08206.1| BnaA05g14130D [Brassica napus]
Length=585

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 60/148 (41%), Positives = 81/148 (55%), Gaps = 7/148 (5%)
 Frame = -1

Query  429  CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGP  250
            C  TLYPELC S  A A   ++  +  ++I A++N+T + VK +      +  K   L  
Sbjct  66   CSSTLYPELCFS--AVAATGKKLTSDKDVIEASLNLTTNAVKHNYFAVKKLITKRKGLTA  123

Query  249  LEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTFFSAAMTNQATCLDG  79
             E  AL DCLE+  ET DEL   L DL       S  KH  DL+T  S+A+TNQ TCLDG
Sbjct  124  REVTALHDCLEIIDETLDELHVALEDLDQYPKGKSLRKHADDLKTLISSAITNQGTCLDG  183

Query  78   FAYSK--KHVRRIIEKRLVQISHHVSNA  1
            F+Y K  + +R+ + K  V + H  SNA
Sbjct  184  FSYDKADRKLRKALLKGQVHVEHMCSNA  211



>gb|KJB54563.1| hypothetical protein B456_009G039100 [Gossypium raimondii]
Length=567

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 63/154 (41%), Positives = 90/154 (58%), Gaps = 12/154 (8%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATAL-PDRRAKTIPEIIAATVNVTVDEVKASAANCSGI---RRKL  265
            +C  TLYPELC ST+++A   + + K   ++I  ++N+TV  V+++  +   +   RRK 
Sbjct  52   SCSSTLYPELCYSTISSAPHAETKVKNPKDVIEMSLNLTVTAVQSNYLSIKKLISTRRK-  110

Query  264  PRLGPLEKRALDDCLELFSETRDELRKVLSDLAT----TASSSKHYVDLQTFFSAAMTNQ  97
              L   EK AL+DCLEL  ET DEL     DL+       S S+H  DL++  SAAMTNQ
Sbjct  111  -SLTEREKAALNDCLELVDETLDELLVAEHDLSDYPSFNKSISQHAEDLKSLLSAAMTNQ  169

Query  96   ATCLDGFAYSK--KHVRRIIEKRLVQISHHVSNA  1
             TCLDGF++ K  K VR+ +    + + H  SNA
Sbjct  170  ETCLDGFSHDKADKKVRQALLDGQMHVFHMCSNA  203



>ref|XP_010058837.1| PREDICTED: uncharacterized protein LOC104446716 [Eucalyptus grandis]
Length=1688

 Score = 95.5 bits (236),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 59/169 (35%), Positives = 91/169 (54%), Gaps = 15/169 (9%)
 Frame = -1

Query  474   NIHRQKLLQVAHTEAC-----EGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDE  310
             N H+ +     HT+ C      GT Y +LCVSTLA+        + PEII+A ++ +  E
Sbjct  1169  NYHKDQYSHTRHTQPCPLPRCRGTPYSDLCVSTLAS-FTGLATMSFPEIISAMLHQSASE  1227

Query  309   VKASAANCSGIRRKLP-RLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVD  133
             V+A++ +C+ ++   P +L  LE++ALD CLEL  +  D+    +S L ++  + +HY D
Sbjct  1228  VRAASTHCTVMKNHFPEKLSMLERQALDICLELSRDILDDFDNAVSYLESSKVTIRHYYD  1287

Query  132   LQTFFSAAMTNQATCLDGFAYSKKHVRRI-----IEKRLVQISHHVSNA  1
             LQ+  S  MTN  TC D       H   +     ++ RL  IS HVSN+
Sbjct  1288  LQSLLSGVMTNVYTCTDEL---DPHTDNLNLGDSMKDRLSNISRHVSNS  1333



>gb|AFW03476.1| pectin methylesterase 2 [Gossypium barbadense]
Length=521

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 63/153 (41%), Positives = 89/153 (58%), Gaps = 10/153 (7%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPD--RRAKTIPEIIAATVNVTVDEVKASAANCSG-IRRKLP  262
            +C  TLYPELC ST+++A PD   + K   ++I  ++N+TV  V+++  +    I  +  
Sbjct  52   SCSSTLYPELCYSTISSA-PDAETKVKNPKDVIELSLNLTVTAVQSNYLSIKKLISTQRK  110

Query  261  RLGPLEKRALDDCLELFSETRDELRKVLSDLAT----TASSSKHYVDLQTFFSAAMTNQA  94
             L   EK AL+DCLEL  ET DEL     DL+       S S+H  DL++  SAAMTNQ 
Sbjct  111  SLTEREKAALNDCLELVDETLDELFVAEHDLSDYPSFNKSISQHADDLKSLLSAAMTNQE  170

Query  93   TCLDGFAYSK--KHVRRIIEKRLVQISHHVSNA  1
            TCLDGF++ K  K VR+ +    + + H  SNA
Sbjct  171  TCLDGFSHDKADKKVRQALLDGQMHVFHMCSNA  203



>gb|AFB77928.1| pectin methylesterase [Gossypium hirsutum]
Length=567

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 63/153 (41%), Positives = 89/153 (58%), Gaps = 10/153 (7%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPD--RRAKTIPEIIAATVNVTVDEVKASAANCSG-IRRKLP  262
            +C  TLYPELC ST+++A PD   + K   ++I  ++N+TV  V+++  +    I  +  
Sbjct  52   SCSSTLYPELCYSTISSA-PDAETKVKNPKDVIELSLNLTVTAVQSNYLSIKKLISTQRK  110

Query  261  RLGPLEKRALDDCLELFSETRDELRKVLSDLAT----TASSSKHYVDLQTFFSAAMTNQA  94
             L   EK AL+DCLEL  ET DEL     DL+       S S+H  DL++  SAAMTNQ 
Sbjct  111  SLTEREKAALNDCLELVDETLDELFVAEHDLSDYPSFNKSISQHADDLKSLLSAAMTNQE  170

Query  93   TCLDGFAYSK--KHVRRIIEKRLVQISHHVSNA  1
            TCLDGF++ K  K VR+ +    + + H  SNA
Sbjct  171  TCLDGFSHDKADKKVRQALLDGQMHVFHMCSNA  203



>gb|ACN40984.1| unknown [Picea sitchensis]
Length=601

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 60/149 (40%), Positives = 91/149 (61%), Gaps = 9/149 (6%)
 Frame = -1

Query  435  EACEGTLYPELCVSTLAT--ALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLP  262
            +AC  TLYPELCVS++++   L DR      EI+   ++V++  V+ + A  + I    P
Sbjct  83   DACSSTLYPELCVSSVSSFPGLSDRAGPI--EIVHVVLSVSIAAVEKANA-LARIMWTRP  139

Query  261  RLGPLEKRALDDCLELFSETRDELRKVLSDLATTA--SSSKHYVDLQTFFSAAMTNQATC  88
             L   ++ AL DCLELF ET DEL + +S+L   +  S+ +   DL+T  SAA+TNQ TC
Sbjct  140  GLSHRKRGALQDCLELFDETLDELYETVSNLKNGSCMSAPEKVNDLETLLSAAITNQYTC  199

Query  87   LDGFAYSKKHVRRIIEKRLVQISHHVSNA  1
            LD  A  + ++R+ ++  L+ ISH VSN+
Sbjct  200  LDSSA--RSNLRQELQGGLMSISHLVSNS  226



>ref|XP_002885033.1| ATPME3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61292.1| ATPME3 [Arabidopsis lyrata subsp. lyrata]
Length=590

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 56/149 (38%), Positives = 84/149 (56%), Gaps = 6/149 (4%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLG  253
            +C  T YPELC+S +A         +  ++I A++N+T+  V+ +  N   + +K   L 
Sbjct  61   SCSSTRYPELCISAVANT-GGVEITSQKDVIEASLNLTIIAVEHNYFNVKKLIKKRKGLT  119

Query  252  PLEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTFFSAAMTNQATCLD  82
            P EK AL DCLE   ET DEL + + DL       +  +H  DL+T  S+A+TNQ TCLD
Sbjct  120  PREKTALHDCLETIDETLDELHETVEDLHLYPARKTLREHAGDLKTLISSAITNQETCLD  179

Query  81   GFAY--SKKHVRRIIEKRLVQISHHVSNA  1
            GF++  + K VR+ + K  + + H  SNA
Sbjct  180  GFSHDDADKQVRKALLKGQIHVEHMCSNA  208



>ref|XP_002265171.1| PREDICTED: pectinesterase [Vitis vinifera]
Length=611

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 63/153 (41%), Positives = 86/153 (56%), Gaps = 13/153 (8%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPD--RRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKL--  265
            AC  T YP+LC S +AT +P   ++  +  ++IA ++N+TV  V+    N   I + L  
Sbjct  100  ACSSTRYPDLCYSAIAT-VPGASKKVTSQKDVIAVSLNITVTAVEH---NYFTIEKLLDF  155

Query  264  PRLGPLEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTFFSAAMTNQA  94
              L   EK AL DCLE   ET DEL   + DL       S ++H  DL+T  SAAMTNQ 
Sbjct  156  KNLTKREKAALHDCLETIDETLDELHVAMDDLDEYPDKKSLTQHADDLKTLMSAAMTNQE  215

Query  93   TCLDGFAY--SKKHVRRIIEKRLVQISHHVSNA  1
            TCLDGF++  + KHVR ++ K    + H  SNA
Sbjct  216  TCLDGFSHDDADKHVREVLLKGQRHVEHMCSNA  248



>emb|CDY60700.1| BnaA01g37100D [Brassica napus]
Length=556

 Score = 92.8 bits (229),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 58/149 (39%), Positives = 85/149 (57%), Gaps = 10/149 (7%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLG  253
            AC  TLYPELC+S +AT+    +  +  ++I A++N+T   V+ +      + + +  L 
Sbjct  64   ACSSTLYPELCISAVATS-GGVKLTSQKDVIEASLNLTTTAVEHNYFTVKKLIKNMKGLT  122

Query  252  PLEKRALDDCLELFSETRDELRKVLSDLATTASSS---KHYVDLQTFFSAAMTNQATCLD  82
            P EK AL DCLE   ET DEL + L DL    +     +H  DL+T  S+A+TNQ TCLD
Sbjct  123  PREKTALHDCLETIDETLDELHETLEDLQMYPNKKTLREHAGDLKTLISSAITNQETCLD  182

Query  81   GFAY--SKKHVRRIIEKRLVQISHHVSNA  1
            GF++  + K VR+     L++  H  SNA
Sbjct  183  GFSHDDADKKVRKF----LLKGQHMCSNA  207



>gb|AER38243.1| PME2 [Gossypium barbadense]
Length=521

 Score = 92.4 bits (228),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 63/153 (41%), Positives = 88/153 (58%), Gaps = 10/153 (7%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPD--RRAKTIPEIIAATVNVTVDEVKASAANCSG-IRRKLP  262
            +C  TLYPELC ST+++A PD   + K    +I  ++N+TV  V+++  +    I  +  
Sbjct  52   SCSSTLYPELCYSTISSA-PDAETKVKNPKGVIELSLNLTVTAVQSNYLSIKKLISTQRK  110

Query  261  RLGPLEKRALDDCLELFSETRDELRKVLSDLAT----TASSSKHYVDLQTFFSAAMTNQA  94
             L   EK AL+DCLEL  ET DEL     DL+       S S+H  DL++  SAAMTNQ 
Sbjct  111  SLTEREKAALNDCLELVDETLDELFVAEHDLSDYPSFNKSISQHADDLKSLLSAAMTNQE  170

Query  93   TCLDGFAYSK--KHVRRIIEKRLVQISHHVSNA  1
            TCLDGF++ K  K VR+ +    + + H  SNA
Sbjct  171  TCLDGFSHDKADKKVRQALLDGQMHVFHMCSNA  203



>gb|KFK38797.1| hypothetical protein AALP_AA3G161500 [Arabis alpina]
Length=593

 Score = 92.8 bits (229),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 58/149 (39%), Positives = 84/149 (56%), Gaps = 6/149 (4%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLG  253
            AC  TLYPELC+S LAT+  D +  +  ++I A++N+T   V+ +      + +    L 
Sbjct  64   ACSPTLYPELCISALATS-GDVKLTSQKDVIEASLNLTTTVVEHNYFTVKKLIKNRKGLT  122

Query  252  PLEKRALDDCLELFSETRDELRKVLSDLATTASSS---KHYVDLQTFFSAAMTNQATCLD  82
            P EK AL DCLE   ET DEL + + DL    +     +H  DL+T  S+A+TNQ TCLD
Sbjct  123  PREKTALHDCLETIDETLDELHEAVEDLHVYPNKKTLREHAGDLKTLISSAITNQETCLD  182

Query  81   GFAYSK--KHVRRIIEKRLVQISHHVSNA  1
            GF++ +  K VR+ + K    +    SNA
Sbjct  183  GFSHDEADKKVRKALLKGQKHVERMCSNA  211



>ref|XP_010685210.1| PREDICTED: pectinesterase-like [Beta vulgaris subsp. vulgaris]
Length=592

 Score = 92.4 bits (228),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 65/181 (36%), Positives = 91/181 (50%), Gaps = 23/181 (13%)
 Frame = -1

Query  474  NIHRQKLLQVAHT---EACEGTLYPELCVSTLATALPDRRAK--TIPEIIAATVNVTVDE  310
            N H  KL    HT    +C  T YP+LC S +A+A      K  T  ++IAA++N+T   
Sbjct  41   NNHNPKLSHETHTILKASCSNTKYPDLCYSAIASAPSSTTTKISTQKDVIAASLNLTTLA  100

Query  309  VKASAANCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATT----------  160
            V+ +      +      L   E+ AL DCLE   ET DELR+ L DL +           
Sbjct  101  VEHNFFTVEKLIETRKNLTVRERNALHDCLESIDETLDELRRTLQDLLSYTHTNNNNNNN  160

Query  159  -----ASSSKHYV-DLQTFFSAAMTNQATCLDGFAYSK--KHVRRIIEKRLVQISHHVSN  4
                   S K Y  D++T  SAAMT+Q TCLDGF++++  +HVR  ++   V + H  SN
Sbjct  161  NNNKRGKSLKDYADDMKTLVSAAMTDQETCLDGFSHNRADRHVRETLQSGQVHVEHMCSN  220

Query  3    A  1
            A
Sbjct  221  A  221



>ref|XP_009135376.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3-like [Brassica 
rapa]
Length=591

 Score = 92.4 bits (228),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 59/151 (39%), Positives = 85/151 (56%), Gaps = 6/151 (4%)
 Frame = -1

Query  438  TEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPR  259
            T AC  T YPELC+S +AT+       +  ++I A++N+T   V+ +      + +K   
Sbjct  62   TSACISTRYPELCISAVATS-GGVELTSQKDVIEASLNLTKTVVEHNYFTVKKLIKKRKG  120

Query  258  LGPLEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTFFSAAMTNQATC  88
            L P EK AL DCLE   ET DEL + + DL       S  +H  DL+T  S+A+TNQ TC
Sbjct  121  LTPREKTALHDCLETIDETLDELHEAVEDLHLYPNKKSLREHAGDLKTLISSAITNQETC  180

Query  87   LDGFAY--SKKHVRRIIEKRLVQISHHVSNA  1
            LDGF++  + K VR+ + K  + + H  SNA
Sbjct  181  LDGFSHDGADKKVRKALFKGQMHVEHMCSNA  211



>ref|XP_004298672.1| PREDICTED: 21 kDa protein [Fragaria vesca subsp. vesca]
Length=197

 Score = 88.6 bits (218),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 58/154 (38%), Positives = 91/154 (59%), Gaps = 16/154 (10%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAAT-VNVTVDEVKASAA---NCSGIRRKL  265
            +C  TLYP+LC ++L+  +   + KT P+++A T +NVT+   KA++A    CS    K+
Sbjct  40   SCSVTLYPKLCYTSLS--IYAGKIKTSPKVLAHTALNVTLRATKATSAVINRCS----KV  93

Query  264  PRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYV----DLQTFFSAAMTNQ  97
              L P+E  A  DC+E  S+  DELRK + +L      S+ ++    D+QT+ SAA+T++
Sbjct  94   HGLKPIEVAATLDCVEEISDALDELRKSIGELGHAVKGSRSFLFQISDIQTWVSAALTDE  153

Query  96   ATCLDGFAYSK--KHVRRIIEKRLVQISHHVSNA  1
             TCLDGF   K    V  I+ + + +I+H  SNA
Sbjct  154  DTCLDGFDEPKLNGRVETIVRREITKIAHLTSNA  187



>emb|CDY67447.1| BnaA03g57460D [Brassica napus]
Length=220

 Score = 88.6 bits (218),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 57/147 (39%), Positives = 82/147 (56%), Gaps = 6/147 (4%)
 Frame = -1

Query  438  TEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPR  259
            T AC  T YPELC+S +AT+       +  ++I A++N+T   V+ +      + +K   
Sbjct  62   TSACISTRYPELCISAVATS-GGVELTSQKDVIEASLNLTKTVVEHNYFTVKKLIKKRKG  120

Query  258  LGPLEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTFFSAAMTNQATC  88
            L P EK AL DCLE   ET DEL + + DL       S  +H  DL+T  S+A+TNQ TC
Sbjct  121  LTPREKTALHDCLETIDETLDELHEAVEDLHLYPNKKSLREHAGDLKTLISSAITNQETC  180

Query  87   LDGFAY--SKKHVRRIIEKRLVQISHH  13
            LDGF++  + K VR+ + K  V+  H 
Sbjct  181  LDGFSHDGADKKVRKALFKGQVRKQHQ  207



>ref|XP_006658118.1| PREDICTED: pectinesterase 3-like [Oryza brachyantha]
Length=577

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 60/148 (41%), Positives = 88/148 (59%), Gaps = 6/148 (4%)
 Frame = -1

Query  429  CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGP  250
            C GTL+ ++CVSTLAT +P+   K + ++I+  V      V+AS+ANCS   ++  +L  
Sbjct  63   CAGTLHRDVCVSTLAT-IPNLAQKPLRDVISEVVGRAASAVRASSANCSSYLQRSQQLRV  121

Query  249  LEKRALDDCLELFSETRDELRKVLSDL-ATTASSSKHYVDLQTFFSAAMTNQATCLDGF-  76
             ++ AL DCLELF  T D+L    ++L A   S+ +    +QT  SAAMTNQ TCL+GF 
Sbjct  122  RDRLALSDCLELFGHTLDQLGTAAAELSAGNRSAEESIAGVQTVLSAAMTNQYTCLEGFA  181

Query  75   ---AYSKKHVRRIIEKRLVQISHHVSNA  1
               A     VR  I+ R+  ++H VSN+
Sbjct  182  GPSASEDGRVRPYIQGRIYHVAHLVSNS  209



>ref|XP_010543030.1| PREDICTED: pectinesterase 2-like [Tarenaya hassleriana]
Length=529

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 57/152 (38%), Positives = 85/152 (56%), Gaps = 8/152 (5%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATA--LPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPR  259
            AC  T+Y +LCVS ++TA  +  +   +  ++I A++N+T   V+ +      + +    
Sbjct  69   ACSSTIYRDLCVSAVSTAAAVTGQELTSQRDVIEASLNITKIAVEHNYFTVKKLLKNRKG  128

Query  258  LGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSK----HYVDLQTFFSAAMTNQAT  91
            L   EK AL DCLE   ET DE+ + + DL    +  K    H  DL+T  S+A+TNQ T
Sbjct  129  LTEREKTALHDCLETIDETLDEIHEAVEDLNGYPNEKKSLRQHADDLKTLISSAITNQET  188

Query  90   CLDGFAYSK--KHVRRIIEKRLVQISHHVSNA  1
            CLDGF++ K  K VR+ +EK  V + H  SNA
Sbjct  189  CLDGFSHDKADKKVRKALEKGQVHVEHMCSNA  220



>ref|XP_003528739.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3-like [Glycine 
max]
Length=598

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 63/178 (35%), Positives = 94/178 (53%), Gaps = 12/178 (7%)
 Frame = -1

Query  513  SSSTGPTHLDLNLNIHRQKLLQVAHTEACEGTLYPELCVSTLATALPD--RRAKTIPEII  340
            +S    T   L+L+ H   +++     AC  T YPELC S +A+  P+   +  T  ++I
Sbjct  53   NSDNSATSTPLSLSHHSHTIVK----SACSSTFYPELCYSAIASE-PNVTHKITTNRDVI  107

Query  339  AATVNVTVDEVKASAANCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATT  160
              ++ +T   V+ +      +  +   L   EK AL DCLE   ET DELR+   +L   
Sbjct  108  QLSLKITFRAVEQNYFTVKKLFTEHDDLTKREKTALHDCLETIDETLDELREAQHNLELY  167

Query  159  ASSS---KHYVDLQTFFSAAMTNQATCLDGFAY--SKKHVRRIIEKRLVQISHHVSNA  1
             +     +H  DL+T  SAA+TNQ TCLDGF++  + KHVR+ +EK  V + H  SNA
Sbjct  168  PNKKTLYQHADDLKTLISAAITNQVTCLDGFSHDDADKHVRKALEKGQVHVEHMCSNA  225



>ref|XP_006307088.1| hypothetical protein CARUB_v10008673mg [Capsella rubella]
 gb|EOA39986.1| hypothetical protein CARUB_v10008673mg [Capsella rubella]
Length=584

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 61/151 (40%), Positives = 83/151 (55%), Gaps = 12/151 (8%)
 Frame = -1

Query  429  CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGP  250
            C  TLYPELC S +A A   +   +  ++I A++N+T    KA   N   +++ + +   
Sbjct  66   CSSTLYPELCYSAVA-ASGGKELTSHKDVIEASLNLTT---KAVTHNYFAVKKLITKRKG  121

Query  249  LEKR---ALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTFFSAAMTNQATC  88
            L  R   AL DCLE   ET DEL +   DL    T  S  KH  DL+T  S+A+TNQ TC
Sbjct  122  LTAREVTALHDCLETIDETLDELHEAKEDLHMYPTQKSLRKHADDLKTLISSAITNQGTC  181

Query  87   LDGFAY--SKKHVRRIIEKRLVQISHHVSNA  1
            LDGF+Y  + K VR+ + K  V + H  SNA
Sbjct  182  LDGFSYDNADKKVRKALLKGQVHVEHMCSNA  212



>ref|XP_006841486.1| hypothetical protein AMTR_s00003p00120050 [Amborella trichopoda]
 gb|ERN03161.1| hypothetical protein AMTR_s00003p00120050 [Amborella trichopoda]
Length=540

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 60/149 (40%), Positives = 95/149 (64%), Gaps = 5/149 (3%)
 Frame = -1

Query  447  VAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRK  268
            ++H+  CE TLYP+LC+STL+++L     ++I    AAT+N+T      + ++CS +  +
Sbjct  31   LSHSHMCEDTLYPDLCLSTLSSSLKTTPRQSI----AATLNLTAKSATEAISSCSNLSHE  86

Query  267  LPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDLQTFFSAAMTNQATC  88
            +      ++RAL DC EL S +  ++   L+DL+ ++S S   + LQTF SAA+TNQ TC
Sbjct  87   ISSTDLPDQRALSDCEELLSTSLGDISSCLADLSNSSSRSSS-IHLQTFLSAAITNQYTC  145

Query  87   LDGFAYSKKHVRRIIEKRLVQISHHVSNA  1
            LDGF+Y+   +R  IE  +V IS H+SN+
Sbjct  146  LDGFSYANHTLRSRIEANIVNISRHISNS  174



>ref|XP_011072691.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=551

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 58/140 (41%), Positives = 79/140 (56%), Gaps = 13/140 (9%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPD-RRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKL---  265
            +C  TLYPELC S +A +L D ++  +  ++I  ++NVT+  V+    N   I + L   
Sbjct  49   SCSSTLYPELCYSAIADSLSDNKKVTSKKDVIILSLNVTISSVQR---NYFAIEKLLYAG  105

Query  264  -PRLGPLEKRALDDCLELFSETRDELRKVLSDLAT---TASSSKHYVDLQTFFSAAMTNQ  97
               L   EK AL DCLE   ET DEL   + DL       S  +H  DL+T  S+A+TNQ
Sbjct  106  KSNLTEREKTALHDCLETIDETLDELHTAVKDLKEYPLKKSIREHADDLKTLLSSAITNQ  165

Query  96   ATCLDGFAYSK--KHVRRII  43
             TCLDGF+Y K  KHVR ++
Sbjct  166  ETCLDGFSYGKSDKHVREVL  185



>ref|XP_010462289.1| PREDICTED: pectinesterase 2 [Camelina sativa]
Length=584

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 59/148 (40%), Positives = 79/148 (53%), Gaps = 6/148 (4%)
 Frame = -1

Query  429  CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGP  250
            C  TLYPELC S +A A   +   +  ++I A++N+T   V+ +      +  K   L  
Sbjct  66   CSSTLYPELCFSAVA-ATGGKELASQKDVIEASLNLTTKAVRHNYFAVKKLITKRKGLTA  124

Query  249  LEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTFFSAAMTNQATCLDG  79
             E  AL DCLE   ET DEL   + DL       S  KH  DL+T  S+A+TNQ TCLDG
Sbjct  125  REVTALHDCLETIDETLDELHVAVEDLHQYPKQKSLRKHADDLKTLISSAITNQGTCLDG  184

Query  78   FAY--SKKHVRRIIEKRLVQISHHVSNA  1
            F+Y  + K VR+ + K  V + H  SNA
Sbjct  185  FSYDNADKQVRKALLKGQVHVEHMCSNA  212



>ref|XP_009123661.1| PREDICTED: pectinesterase 2 [Brassica rapa]
Length=604

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 62/165 (38%), Positives = 82/165 (50%), Gaps = 22/165 (13%)
 Frame = -1

Query  429  CEGTLYPELCVSTLATA----LPDRRAKTIP-------------EIIAATVNVTVDEVKA  301
            C  TLYPELC S +A       PD+     P             ++I A++N+T + VK 
Sbjct  66   CSSTLYPELCFSAVAATGKKLTPDKDVIEAPAVAATGKKLTSDKDVIEASLNLTTNAVKH  125

Query  300  SAANCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDL  130
            +      +  K   L   E  AL DCLE+  ET DEL   L DL       S  KH  DL
Sbjct  126  NYFAVKKLITKRKGLTAREVTALHDCLEIIDETLDELHVALEDLDQYPKGKSLRKHADDL  185

Query  129  QTFFSAAMTNQATCLDGFAYSK--KHVRRIIEKRLVQISHHVSNA  1
            +T  S+A+TNQ TCLDGF+Y K  + +R+ + K  V + H  SNA
Sbjct  186  KTLISSAITNQGTCLDGFSYDKADRKLRKALLKGQVHVEHMCSNA  230



>ref|XP_010047425.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=585

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 57/153 (37%), Positives = 88/153 (58%), Gaps = 9/153 (6%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATA--LPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPR  259
            +C  TLYP+LC+S L ++  L     KT  ++IA ++N+T+  V+ +  +   +    P 
Sbjct  63   SCSSTLYPDLCLSQLTSSPSLASNAVKTPKDVIALSLNLTIAYVQHNYFSIKKVAAVRPG  122

Query  258  LGPLEKRALDDCLELFSETRDELRKVLSDL-----ATTASSSKHYVDLQTFFSAAMTNQA  94
            L   E+ AL DCLE+  ET DE+R+ L++L         S+S+   D++T  SAAMTNQ 
Sbjct  123  LTARERTALHDCLEMVDETLDEVRETLAELLAYPNGGNKSASELAEDMKTLLSAAMTNQE  182

Query  93   TCLDGFAY--SKKHVRRIIEKRLVQISHHVSNA  1
            TCLDGF++  + K VR  +    + + H  SNA
Sbjct  183  TCLDGFSHDSADKKVREALLGGQMHVFHLCSNA  215



>ref|XP_003627459.1| Pectinesterase [Medicago truncatula]
Length=391

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 58/153 (38%), Positives = 88/153 (58%), Gaps = 13/153 (8%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPDRRAKTI--PEIIAATVNVTVDEVKASAANCSGIRRKLPR  259
            AC  TLYPELC S +++  P+   K     ++I+ ++N+T    +A   N   + + L R
Sbjct  71   ACTTTLYPELCFSAISSE-PNITHKITNHKDVISLSLNITT---RAVEHNYFTVEKLLLR  126

Query  258  --LGPLEKRALDDCLELFSETRDELRKVLSDLATTASSS---KHYVDLQTFFSAAMTNQA  94
              L   EK AL DCLE   ET DEL++  +DL    S     +H  DL+T  S+A+TNQ 
Sbjct  127  KSLTKREKIALHDCLETIDETLDELKEAQNDLVLYPSKKTLYQHADDLKTLISSAITNQV  186

Query  93   TCLDGFAY--SKKHVRRIIEKRLVQISHHVSNA  1
            TCLDGF++  + K VR+++++  + + H  SNA
Sbjct  187  TCLDGFSHDDADKEVRKVLQEGQIHVEHMCSNA  219



>gb|KFK35693.1| hypothetical protein AALP_AA4G024900 [Arabis alpina]
Length=588

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 58/151 (38%), Positives = 85/151 (56%), Gaps = 13/151 (9%)
 Frame = -1

Query  429  CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGP  250
            C  TLYPELC S ++T    ++  +  ++I A++N+T + V     N   ++++L +   
Sbjct  66   CSSTLYPELCFSAVSTT--GKKLTSQKDVIEASLNLTRNAV---TNNYLDVKKQLAKRKG  120

Query  249  LEKR---ALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTFFSAAMTNQATC  88
            L  R   AL DCLE   ET DEL K + DL       S  KH  DL+T  S+A+TNQ TC
Sbjct  121  LTVREVTALHDCLETMDETLDELYKAVKDLHIYPNGKSLRKHSDDLKTLISSAITNQETC  180

Query  87   LDGFAY--SKKHVRRIIEKRLVQISHHVSNA  1
            LDG +Y  + + VR+++ K  V + H  SNA
Sbjct  181  LDGLSYNDADRKVRKVLLKGQVHVEHMCSNA  211



>ref|XP_010058840.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=599

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 54/146 (37%), Positives = 84/146 (58%), Gaps = 4/146 (3%)
 Frame = -1

Query  429  CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRK-LPRLG  253
            C GT Y  LCVSTLA+      + + PEII+  ++ +  EV+A++ +C+ ++   L +L 
Sbjct  99   CRGTPYSGLCVSTLAS-FTGLASMSFPEIISGMLHQSASEVRAASTHCTVMKNHFLEKLS  157

Query  252  PLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDLQTFFSAAMTNQATCLDGFA  73
             LE++ALD CLELF +  D+    +S L +   + +HY DLQ+  S  MTN  TC D F 
Sbjct  158  MLERQALDICLELFRDILDDFDNTVSYLDSLKVTIRHYYDLQSLLSGMMTNVYTCTDEFD  217

Query  72   YSKKHVR--RIIEKRLVQISHHVSNA  1
             +  ++     ++ RL  IS  VSN+
Sbjct  218  PNTDNLNLGDSMKDRLSNISRQVSNS  243



>ref|XP_010479961.1| PREDICTED: pectinesterase 2-like [Camelina sativa]
Length=594

 Score = 90.1 bits (222),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 58/148 (39%), Positives = 79/148 (53%), Gaps = 6/148 (4%)
 Frame = -1

Query  429  CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGP  250
            C  TLYP+LC S +A A   +   +  ++I A++N+T   V+ +      +  K   L  
Sbjct  76   CSSTLYPDLCFSAVA-ATGGKELASQKDVIEASLNLTTKAVRHNYFAVKKLITKRKGLTA  134

Query  249  LEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTFFSAAMTNQATCLDG  79
             E  AL DCLE   ET DEL   + DL       S  KH  DL+T  S+A+TNQ TCLDG
Sbjct  135  REVTALHDCLETIDETLDELHVAVEDLHQYPKQKSLRKHADDLKTLISSAITNQGTCLDG  194

Query  78   FAY--SKKHVRRIIEKRLVQISHHVSNA  1
            F+Y  + K VR+ + K  V + H  SNA
Sbjct  195  FSYDNADKQVRKALLKGQVHVEHMCSNA  222



>ref|XP_006828586.1| hypothetical protein AMTR_s00129p00044320 [Amborella trichopoda]
 gb|ERM96002.1| hypothetical protein AMTR_s00129p00044320 [Amborella trichopoda]
Length=564

 Score = 89.7 bits (221),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 63/152 (41%), Positives = 84/152 (55%), Gaps = 12/152 (8%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPD--RRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPR  259
            AC  TLYPELC S+L +A P    +A +  ++I A +N+++    A       +++   R
Sbjct  48   ACSSTLYPELCFSSL-SAFPAAAEKASSQKDVIEAALNLSI---TAGEHAYFKLKKLYGR  103

Query  258  LGPLEKR--ALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTFFSAAMTNQA  94
               LE    AL DCLEL  ET DELRK   +L    +  S S H  DL+T  S AMTNQ 
Sbjct  104  KDVLEAEHTALHDCLELVDETLDELRKTDEELELYPSKKSISDHASDLKTLLSGAMTNQE  163

Query  93   TCLDGFAYSK-KHVRRIIEKRLVQISHHVSNA  1
            TCLDGF++ K   VR+II    V +   +SNA
Sbjct  164  TCLDGFSHIKGGGVRKIISGGCVYVEKLISNA  195



>gb|KDP28190.1| hypothetical protein JCGZ_13961 [Jatropha curcas]
Length=430

 Score = 88.2 bits (217),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = -1

Query  198  DELRKVLSDLATTASSSKHYVDLQTFFSAAMTNQATCLDGFAYSKKHVRRIIEKRLVQIS  19
            DEL+  L+DL +  S+S+HY +LQT  SAAMTNQ TCLDGFAYS+ +VR++I+  L  IS
Sbjct  2    DELKVALNDLYSRKSASQHYHELQTLLSAAMTNQYTCLDGFAYSEGNVRKVIKSNLYNIS  61

Query  18   HHVSNA  1
            HHVSN+
Sbjct  62   HHVSNS  67



>ref|NP_001265901.1| pectinesterase 3-like [Cicer arietinum]
 emb|CAE76633.2| pectin methylesterase [Cicer arietinum]
Length=584

 Score = 89.4 bits (220),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 55/151 (36%), Positives = 86/151 (57%), Gaps = 9/151 (6%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPD--RRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPR  259
            AC  TLYP+LC S +++  P+   +     ++I+ ++N+T   V+ +      + R+   
Sbjct  70   ACTTTLYPDLCFSAISSE-PNITHKINNHKDVISLSLNITTRAVEHNFFTVENLLRR-KN  127

Query  258  LGPLEKRALDDCLELFSETRDELRKVLSDLATTASSS---KHYVDLQTFFSAAMTNQATC  88
            L   EK AL DCLE   +T DEL++   DL    +     +H  DL+T  SAA+TNQ TC
Sbjct  128  LSEREKIALHDCLETIDDTLDELKEAQRDLVLYPNKKTLYQHADDLKTLISAAITNQVTC  187

Query  87   LDGFAY--SKKHVRRIIEKRLVQISHHVSNA  1
            LDGF++  + K VR+++E+  V + H  SNA
Sbjct  188  LDGFSHDGADKQVRKVLEQGQVHVEHMCSNA  218



>ref|XP_010501045.1| PREDICTED: pectinesterase 2-like [Camelina sativa]
Length=594

 Score = 89.4 bits (220),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 57/148 (39%), Positives = 79/148 (53%), Gaps = 6/148 (4%)
 Frame = -1

Query  429  CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGP  250
            C  TLYP+LC S +A A   +   +  ++I A++N+T   V+ +      +  K   L  
Sbjct  76   CSSTLYPDLCFSAVA-ATGGKELASQKDVIEASLNLTTKAVRHNYFAVKKLITKRKGLTA  134

Query  249  LEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTFFSAAMTNQATCLDG  79
             E  AL DCLE+  ET D L   + DL       S  KH  DL+T  S+A+TNQ TCLDG
Sbjct  135  REVTALHDCLEMIDETLDGLHVAVEDLHQYPKQKSLRKHADDLKTLISSAITNQGTCLDG  194

Query  78   FAY--SKKHVRRIIEKRLVQISHHVSNA  1
            F+Y  + K VR+ + K  V + H  SNA
Sbjct  195  FSYDNADKQVRKALLKGQVHVEHMCSNA  222



>ref|XP_010534986.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3-like [Tarenaya 
hassleriana]
 ref|XP_010534987.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3-like [Tarenaya 
hassleriana]
Length=587

 Score = 89.0 bits (219),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 57/150 (38%), Positives = 82/150 (55%), Gaps = 6/150 (4%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLAT-ALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRL  256
            AC    Y +LCVS ++T AL      +  ++I A++N+T   V+ +      +  K   L
Sbjct  63   ACSSARYQDLCVSAISTSALTGVELTSQRDVIEASLNITTTAVEHNYFTIKKLLEKRKGL  122

Query  255  GPLEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTFFSAAMTNQATCL  85
               EK AL DCLE   ET DEL + + DL       S  +H  DL+T  S+A+TNQ TCL
Sbjct  123  TKREKTALHDCLETIDETLDELHEAMDDLNEYPDKKSLRQHADDLKTLISSAITNQETCL  182

Query  84   DGFAY--SKKHVRRIIEKRLVQISHHVSNA  1
            DGF++  + K VR+ +EK  + + H  SNA
Sbjct  183  DGFSHDDADKKVRKALEKGQIHVEHMCSNA  212



>gb|KHG08631.1| Pectinesterase 3 [Gossypium arboreum]
Length=582

 Score = 89.0 bits (219),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 58/140 (41%), Positives = 81/140 (58%), Gaps = 14/140 (10%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPDRRAKTI---PEIIAATVNVTVDEVKASAANCSGIRRKLP  262
            AC GT YP+LC S +AT +P   AK +    ++I  ++N+T   V+    N   I++ L 
Sbjct  68   ACSGTFYPDLCFSAVAT-VPAGTAKKVRSQKDVIELSLNITTTAVEH---NYFKIKKLLA  123

Query  261  R--LGPLEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTFFSAAMTNQ  97
            R  L   EK AL DCLE   ET DEL + + DL       S ++H  DL+T  SAAMTNQ
Sbjct  124  RKDLTTREKTALHDCLETIDETLDELHEAVEDLHEYPNKKSLTQHADDLKTLMSAAMTNQ  183

Query  96   ATCLDGFAY--SKKHVRRII  43
             TCLDGF++  + K +R ++
Sbjct  184  ETCLDGFSHEGADKKIREVL  203



>ref|XP_007139063.1| hypothetical protein PHAVU_009G261700g [Phaseolus vulgaris]
 gb|ESW11057.1| hypothetical protein PHAVU_009G261700g [Phaseolus vulgaris]
Length=580

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 70/197 (36%), Positives = 104/197 (53%), Gaps = 15/197 (8%)
 Frame = -1

Query  570  LLAFLSVTSFNSLFTKDGISSSTGPTHLDLNLNIHRQKLLQVAHTEACEGTLYPELCVST  391
            LL  L+ T F +L    G+SS     H   + + H   +++     AC  TLYPELC+S+
Sbjct  25   LLFALAATLFIALAVVAGVSSRKNSAHNASSTSSH--AIIK----SACSSTLYPELCLSS  78

Query  390  LATALPDR--RAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGPLEKRALDDCLE  217
            +A+  P +  +  T   +I  ++N+TV  V+ +      + RK   L   +K AL DCLE
Sbjct  79   IASE-PGKADKVSTHKNVIEQSLNITVGIVERNYFTVEKLLRK-KGLTKRQKTALHDCLE  136

Query  216  LFSETRDELRKVLSDLATTASS---SKHYVDLQTFFSAAMTNQATCLDGFAYSK--KHVR  52
               ET DEL K + +L    S    S H  DL+T  S+A+TNQ TCLDGF++ +  K +R
Sbjct  137  TIDETLDELHKAIDELKEYPSKKSLSHHAEDLKTLMSSAITNQETCLDGFSHDQADKRLR  196

Query  51   RIIEKRLVQISHHVSNA  1
            + ++   V   H  SNA
Sbjct  197  QHLQAGQVHAEHLCSNA  213



>gb|EEC82670.1| hypothetical protein OsI_27314 [Oryza sativa Indica Group]
Length=579

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 57/148 (39%), Positives = 88/148 (59%), Gaps = 6/148 (4%)
 Frame = -1

Query  429  CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGP  250
            C GTL+ ++CVSTL+T +P+   K + ++I+  V      V+AS++NC+   ++  +L  
Sbjct  72   CAGTLHRDVCVSTLST-IPNLARKPLRDVISEVVGRAASAVRASSSNCTSYLQRPRQLRT  130

Query  249  LEKRALDDCLELFSETRDELRKVLSDL-ATTASSSKHYVDLQTFFSAAMTNQATCLDGF-  76
             ++ AL DCLELF  T D L    ++L A  +++ +    +QT  SAAMTNQ TCLDGF 
Sbjct  131  RDRLALSDCLELFGHTLDLLGTAAAELSAGNSTAEESAAGVQTVLSAAMTNQYTCLDGFA  190

Query  75   ---AYSKKHVRRIIEKRLVQISHHVSNA  1
               A     VR  I+ R+  ++H VSN+
Sbjct  191  GPSASEDGRVRPFIQGRIYHVAHLVSNS  218



>ref|NP_001060620.1| Os07g0675100 [Oryza sativa Japonica Group]
 dbj|BAC83543.1| putative pectinesterase [Oryza sativa Japonica Group]
 dbj|BAD31979.1| putative pectinesterase [Oryza sativa Japonica Group]
 dbj|BAF22534.1| Os07g0675100 [Oryza sativa Japonica Group]
 dbj|BAG94978.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE67808.1| hypothetical protein OsJ_25560 [Oryza sativa Japonica Group]
Length=579

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 57/148 (39%), Positives = 88/148 (59%), Gaps = 6/148 (4%)
 Frame = -1

Query  429  CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGP  250
            C GTL+ ++CVSTL+T +P+   K + ++I+  V      V+AS++NC+   ++  +L  
Sbjct  72   CAGTLHRDVCVSTLST-IPNLARKPLRDVISEVVGRAASAVRASSSNCTSYLQRPRQLRT  130

Query  249  LEKRALDDCLELFSETRDELRKVLSDL-ATTASSSKHYVDLQTFFSAAMTNQATCLDGF-  76
             ++ AL DCLELF  T D L    ++L A  +++ +    +QT  SAAMTNQ TCLDGF 
Sbjct  131  RDRLALSDCLELFGHTLDLLGTAAAELSAGNSTAEESAAGVQTVLSAAMTNQYTCLDGFA  190

Query  75   ---AYSKKHVRRIIEKRLVQISHHVSNA  1
               A     VR  I+ R+  ++H VSN+
Sbjct  191  GPSASEDGRVRPFIQGRIYHVAHLVSNS  218



>ref|XP_002324773.2| hypothetical protein POPTR_0018s05360g [Populus trichocarpa]
 gb|EEF03338.2| hypothetical protein POPTR_0018s05360g [Populus trichocarpa]
Length=359

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 75/218 (34%), Positives = 108/218 (50%), Gaps = 32/218 (15%)
 Frame = -1

Query  630  HN-LKQKATLFFTISGCSAIVLL-AFLSVTSFNSLFTKDGISSSTGPTHLDLNLNIHRQK  457
            HN LK K  LF ++   S+I+L+ A +S+ +        G++SS   T  +   N H   
Sbjct  7    HNTLKNKKRLFLSL--FSSILLVTAIVSIVA--------GVTSSKNSTESN---NDH---  50

Query  456  LLQVAHT---EACEGTLYPELCVSTLATALPD--RRAKTIPEIIAATVNVTVDEVKASAA  292
              QVAHT    +C  TLYP LC S L+ A+PD   + K+  ++I  ++N T+   + S  
Sbjct  51   --QVAHTILKSSCSSTLYPHLCFSALS-AVPDATSKIKSKKDVIDLSLNRTMSATRHSYF  107

Query  291  NCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSK----HYVDLQT  124
                +          E  AL DCL + +ET D+L K   +L    S  K    H  DL+ 
Sbjct  108  KIQKLTSTRRSFTERENTALHDCLVMLNETLDQLSKAYQELQDYPSLKKSLSVHADDLKI  167

Query  123  FFSAAMTNQATCLDGFAYSK--KHVRRIIEKRLVQISH  16
              SAAMTNQ TCLDGF++ K  K VR +     + + H
Sbjct  168  LLSAAMTNQETCLDGFSHDKADKKVRELFIDEEMHVYH  205



>ref|XP_009606552.1| PREDICTED: pectinesterase/pectinesterase inhibitor U1 [Nicotiana 
tomentosiformis]
Length=589

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 59/163 (36%), Positives = 85/163 (52%), Gaps = 9/163 (6%)
 Frame = -1

Query  462  QKLLQVAHT---EACEGTLYPELCVSTLATALP-DRRAKTIPEIIAATVNVTVDEVKASA  295
            Q +   AH     ACE TL+PELC ST+A+     ++  +  ++I  ++N+T   V+ + 
Sbjct  62   QAITSAAHAIVKSACENTLHPELCYSTIASVSDFSKKVTSQKDVIELSLNITCKAVQHNF  121

Query  294  ANCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQT  124
                 + +    L P EK AL DCLE   ET DEL   + DL       S   H  DL+T
Sbjct  122  FTVEKLIKTRKGLTPREKVALHDCLETIDETLDELHTAIDDLELYPNKKSLKDHADDLKT  181

Query  123  FFSAAMTNQATCLDGFAY--SKKHVRRIIEKRLVQISHHVSNA  1
              S+A+TNQ TCLDGF++  + K VR+ + K    +    SNA
Sbjct  182  LISSAITNQETCLDGFSHDDADKKVRKALLKGQKHVEKMCSNA  224



>emb|CDY33229.1| BnaC01g37020D [Brassica napus]
Length=570

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 58/149 (39%), Positives = 82/149 (55%), Gaps = 10/149 (7%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLG  253
            AC  TLYPELCVS +A +    +  +  ++I A++N+T   V+ +      + +    L 
Sbjct  64   ACSSTLYPELCVSAVAIS-GGVKLTSQKDVIEASLNLTTTAVEHNYFTVKKLIKNKKGLT  122

Query  252  PLEKRALDDCLELFSETRDELRKVLSDLATTASSS---KHYVDLQTFFSAAMTNQATCLD  82
            P EK AL DCLE   ET DEL + L DL    +     +H  DL+T  S+A+TNQ TCLD
Sbjct  123  PREKTALHDCLETIDETLDELHETLEDLQMYPNKKTLREHAGDLKTLISSAITNQETCLD  182

Query  81   GFAY--SKKHVRRIIEKRLVQISHHVSNA  1
            GF++  + K VR      L++  H  SNA
Sbjct  183  GFSHDDADKKVRNF----LLKGQHMCSNA  207



>ref|XP_010029512.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=587

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 74/218 (34%), Positives = 107/218 (49%), Gaps = 26/218 (12%)
 Frame = -1

Query  621  KQKATLFFTISGCSAIVLLAFLSVTSFNSLFTKDGISSSTGPTHLDLNLNIHRQKLLQVA  442
            K+   L  +ISGC    LL   +V          GI +     H D NL++    L    
Sbjct  16   KRNRKLLLSISGC----LLLVAAVI---------GIVAGVHSGHHDRNLDV--STLTPPT  60

Query  441  HT---EACEGTLYPELCVSTLATALPDRRAK-TIPEIIAATVNVTVDEVKASAANCSGIR  274
            H     +C  T YP+LC S +A          T  ++I A++N+T   V+ +      + 
Sbjct  61   HAILKSSCSSTRYPDLCYSAVAAFPGAAAGLATQKDVIEASLNITTVAVEHNFFAVEKLL  120

Query  273  RKLPR-LGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSK----HYVDLQTFFSAA  109
             K  + L   EKRAL DCLE   ET DELR+   DL++  S++K    H  DL+T  S+A
Sbjct  121  SKRSKSLTKREKRALHDCLETIDETLDELREAERDLSSYPSAAKSLKQHADDLKTLMSSA  180

Query  108  MTNQATCLDGFAY--SKKHVRRIIEKRLVQISHHVSNA  1
            +TNQ TCLDGF++  + + VR+ + K  V +    SNA
Sbjct  181  ITNQETCLDGFSHEDADRQVRKALAKGQVHVEKMCSNA  218



>gb|AFW03481.1| pectin methylesterase 2, partial [Gossypium hirsutum]
Length=521

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 61/153 (40%), Positives = 87/153 (57%), Gaps = 10/153 (7%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPD--RRAKTIPEIIAATVNVTVDEVKASAANCSG-IRRKLP  262
            +C  TLYPELC ST+++A PD   + K   ++   ++N+TV  V+++  +    I  +  
Sbjct  52   SCSSTLYPELCYSTISSA-PDAETKVKNPKDVTELSLNLTVTAVQSNYLSIKKLISTQRK  110

Query  261  RLGPLEKRALDDCLELFSETRDELRKVLSDLAT----TASSSKHYVDLQTFFSAAMTNQA  94
             L   EK AL+DCLEL  ET DEL     DL+       S S+H   L++  SAAMTNQ 
Sbjct  111  SLTEREKAALNDCLELVDETLDELFVAEHDLSDYPSFNKSISQHADVLKSLLSAAMTNQE  170

Query  93   TCLDGFAYSK--KHVRRIIEKRLVQISHHVSNA  1
            TCLDGF++ K  K VR+ +    + + H  SNA
Sbjct  171  TCLDGFSHDKADKKVRQALLDGQMHVFHMCSNA  203



>ref|XP_008228105.1| PREDICTED: pectinesterase [Prunus mume]
Length=587

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 56/150 (37%), Positives = 84/150 (56%), Gaps = 6/150 (4%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLG  253
            +C  TLYP+LC STLA     ++  +  ++I  ++N+T   V+ +      + +   +L 
Sbjct  73   SCSSTLYPDLCFSTLAAPGAAKKVSSQKDVIELSLNITTTAVEHNFFAVKKLLKSRKKLT  132

Query  252  PLEKRALDDCLELFSETRDELRKVLSDLATTASSSK---HYV-DLQTFFSAAMTNQATCL  85
              EK AL DCLE   ET DEL   ++DL    +  K    Y  DL+T  S+A+TNQ TCL
Sbjct  133  KREKVALHDCLENIDETLDELHAAVADLHEYPNKKKSLTQYADDLKTLISSAITNQETCL  192

Query  84   DGFAY--SKKHVRRIIEKRLVQISHHVSNA  1
            DGF++  + K VR+++EK  V +    SNA
Sbjct  193  DGFSHDDADKKVRKVLEKGQVHVEQLCSNA  222



>gb|KDP33985.1| hypothetical protein JCGZ_07556 [Jatropha curcas]
Length=583

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 57/147 (39%), Positives = 82/147 (56%), Gaps = 12/147 (8%)
 Frame = -1

Query  450  QVAHT---EACEGTLYPELCVSTLATALPDR---RAKTIPEIIAATVNVTVDEVKASAAN  289
            Q AH     +C  TLYPELC ST++T LPD    + K+  ++I  ++NVT D VK + + 
Sbjct  58   QAAHVVLKSSCSTTLYPELCFSTIST-LPDDAVTKIKSTRDVIDLSLNVTKDSVKQTYSK  116

Query  288  CSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASS---SKHYVDLQTFF  118
               +          E+ A  DCL + +ET DE+ KV  +L   +S    S+H   L+   
Sbjct  117  IEKLAYSGTNYTQRERIAFHDCLLVLNETLDEINKVEDELKEYSSKETISQHADVLKILL  176

Query  117  SAAMTNQATCLDGFAY--SKKHVRRII  43
            SAAMTNQ TCLDGF+Y  + K +R++ 
Sbjct  177  SAAMTNQETCLDGFSYDTADKEIRQLF  203



>ref|XP_010029511.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=577

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 58/152 (38%), Positives = 84/152 (55%), Gaps = 8/152 (5%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPDRRAK-TIPEIIAATVNVTVDEVKASAANCSGI-RRKLPR  259
            +C  T YP+LC S +A          T  ++I A++N+T   V+ +      +  ++  R
Sbjct  58   SCSSTRYPDLCYSAVAAFPGAAAGLATQKDVIEASLNITTVAVEQNFFTVEKLLSKRSKR  117

Query  258  LGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSK----HYVDLQTFFSAAMTNQAT  91
            L   EKRAL DCLE   ET DEL++   DL +  S++K    H  DL+T  SAA+TNQ T
Sbjct  118  LTKREKRALHDCLETIDETLDELQQAARDLNSYPSAAKSLKQHADDLKTLMSAAITNQET  177

Query  90   CLDGFAY--SKKHVRRIIEKRLVQISHHVSNA  1
            CLDGF++  + + VR  +EK  V +    SNA
Sbjct  178  CLDGFSHEDADRQVREALEKGQVHVEKMCSNA  209



>gb|AFW03480.1| pectin methylesterase 1 [Gossypium hirsutum]
Length=582

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 58/140 (41%), Positives = 80/140 (57%), Gaps = 14/140 (10%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPDRRAKTI---PEIIAATVNVTVDEVKASAANCSGIRRKLP  262
            AC GT YP+LC S + TA+P   AK +    ++I  ++N T   V+    N   I++ L 
Sbjct  68   ACSGTFYPDLCFSAV-TAVPAGTAKKVRSQKDVIELSLNTTTTAVEH---NYFKIKKLLA  123

Query  261  R--LGPLEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTFFSAAMTNQ  97
            R  L   EK AL DCLE   ET DEL + + DL       S ++H  DL+T  SAAMTNQ
Sbjct  124  RKDLTTREKTALHDCLETIDETLDELHEAVEDLHEYPNKKSLTQHADDLKTLMSAAMTNQ  183

Query  96   ATCLDGFAY--SKKHVRRII  43
             TCLDGF++  + K +R ++
Sbjct  184  ETCLDGFSHEGADKKIREVL  203



>ref|XP_003627458.1| Pectinesterase [Medicago truncatula]
 gb|AET01934.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=589

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 58/153 (38%), Positives = 88/153 (58%), Gaps = 13/153 (8%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPDRRAKTI--PEIIAATVNVTVDEVKASAANCSGIRRKLPR  259
            AC  TLYPELC S +++  P+   K     ++I+ ++N+T    +A   N   + + L R
Sbjct  71   ACTTTLYPELCFSAISSE-PNITHKITNHKDVISLSLNITT---RAVEHNYFTVEKLLLR  126

Query  258  --LGPLEKRALDDCLELFSETRDELRKVLSDLATTASSS---KHYVDLQTFFSAAMTNQA  94
              L   EK AL DCLE   ET DEL++  +DL    S     +H  DL+T  S+A+TNQ 
Sbjct  127  KSLTKREKIALHDCLETIDETLDELKEAQNDLVLYPSKKTLYQHADDLKTLISSAITNQV  186

Query  93   TCLDGFAY--SKKHVRRIIEKRLVQISHHVSNA  1
            TCLDGF++  + K VR+++++  + + H  SNA
Sbjct  187  TCLDGFSHDDADKEVRKVLQEGQIHVEHMCSNA  219



>ref|XP_009762395.1| PREDICTED: pectinesterase/pectinesterase inhibitor U1 [Nicotiana 
sylvestris]
Length=589

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 59/163 (36%), Positives = 85/163 (52%), Gaps = 9/163 (6%)
 Frame = -1

Query  462  QKLLQVAHT---EACEGTLYPELCVSTLATALP-DRRAKTIPEIIAATVNVTVDEVKASA  295
            Q +   AH     ACE TL+PELC ST+A+     ++  +  ++I  ++N+T   V+ + 
Sbjct  62   QAITSAAHAIVKSACENTLHPELCYSTIASVSDFSKKVTSQKDVIELSLNITCRAVQHNF  121

Query  294  ANCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQT  124
                 + +    L P EK AL DCLE   ET DEL   + DL       S   H  DL+T
Sbjct  122  FKVEKLIKTRKGLKPREKVALHDCLETIDETLDELHTAIKDLELYPNKKSLKAHADDLKT  181

Query  123  FFSAAMTNQATCLDGFAY--SKKHVRRIIEKRLVQISHHVSNA  1
              S+A+TNQ TCLDGF++  + K VR+ + K    +    SNA
Sbjct  182  LISSAITNQETCLDGFSHDDADKKVRKALLKGQKHVEKMCSNA  224



>emb|CAB95025.1| pectin methylesterase [Nicotiana tabacum]
Length=579

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 59/163 (36%), Positives = 85/163 (52%), Gaps = 9/163 (6%)
 Frame = -1

Query  462  QKLLQVAHT---EACEGTLYPELCVSTLATALP-DRRAKTIPEIIAATVNVTVDEVKASA  295
            Q +   AH     ACE TL+PELC ST+A+     ++  +  ++I  ++N+T   V+ + 
Sbjct  52   QAITSAAHAIVKSACENTLHPELCYSTIASVSDFSKKVTSQKDVIELSLNITCRAVQHNF  111

Query  294  ANCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQT  124
                 + +    L P EK AL DCLE   ET DEL   + DL       S   H  DL+T
Sbjct  112  FKVEKLIKTRKGLKPREKVALHDCLETIDETLDELHTAIKDLELYPNKKSLKAHADDLKT  171

Query  123  FFSAAMTNQATCLDGFAY--SKKHVRRIIEKRLVQISHHVSNA  1
              S+A+TNQ TCLDGF++  + K VR+ + K    +    SNA
Sbjct  172  LISSAITNQETCLDGFSHDDADKKVRKALLKGQKHVEKMCSNA  214



>ref|XP_007217169.1| hypothetical protein PRUPE_ppa003285mg [Prunus persica]
 gb|EMJ18368.1| hypothetical protein PRUPE_ppa003285mg [Prunus persica]
Length=587

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 56/150 (37%), Positives = 84/150 (56%), Gaps = 6/150 (4%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLG  253
            +C  TLYP+LC STLA     ++  +  ++I  ++N+T   V  +      + +   +L 
Sbjct  73   SCSSTLYPDLCFSTLAAPGAAKKVSSQKDVIELSLNITTTAVGHNFFAVKKLLKSRKKLT  132

Query  252  PLEKRALDDCLELFSETRDELRKVLSDLATTASSSK---HYV-DLQTFFSAAMTNQATCL  85
              EK AL DCLE   ET DEL   ++DL    + +K    Y  DL+T  S+A+TNQ TCL
Sbjct  133  KREKVALHDCLENIDETLDELHAAVADLHEYPNKNKPLTQYADDLKTLISSAITNQETCL  192

Query  84   DGFAY--SKKHVRRIIEKRLVQISHHVSNA  1
            DGF++  + K VR+++EK  V +    SNA
Sbjct  193  DGFSHDDADKKVRKVLEKGQVHVEQLCSNA  222



>ref|XP_006490093.1| PREDICTED: 21 kDa protein-like [Citrus sinensis]
Length=196

 Score = 84.0 bits (206),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 55/151 (36%), Positives = 89/151 (59%), Gaps = 15/151 (10%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPDRRA---KTIPEIIA-ATVNVTVDEVKASAANCSGIRRKL  265
            +C  T YP LC  +LA     R A   +T P+++A A++NVT+   K+++A    I + L
Sbjct  42   SCSSTTYPTLCYKSLA-----RHASLIQTSPKLLAHASLNVTLAMAKSTSAVMLKISKSL  96

Query  264  PRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYV--DLQTFFSAAMTNQAT  91
              + P E  A+ DCLE  S++ DELRK + ++    +S+      D+QT+ SAA+T++ T
Sbjct  97   G-MKPREAEAMQDCLEELSDSVDELRKSIGEMGLIKASNFELTMNDIQTWVSAALTDETT  155

Query  90   CLDGFAYSKKHVR-RIIEKRLVQISHHVSNA  1
            C DGF   K  V  +++  ++V+I+H  SNA
Sbjct  156  CSDGF--EKNTVNGKVVRGQIVKIAHMTSNA  184



>gb|KDO65437.1| hypothetical protein CISIN_1g029238mg [Citrus sinensis]
Length=196

 Score = 84.0 bits (206),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 54/151 (36%), Positives = 89/151 (59%), Gaps = 15/151 (10%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPDRRA---KTIPEIIA-ATVNVTVDEVKASAANCSGIRRKL  265
            +C  T YP LC  +LA     R A   +T P+++A A++NVT+ + K+++A    + +  
Sbjct  42   SCSSTTYPTLCYKSLA-----RHASLIQTSPKLLAHASLNVTLAKAKSTSAVMLKMSKS-  95

Query  264  PRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYV--DLQTFFSAAMTNQAT  91
            P + P E  A+ DCLE  S++ DELRK + ++    +S+      D+QT+ SAA+T+  T
Sbjct  96   PGMKPREADAMQDCLEELSDSVDELRKSIGEMGLIKASNFELTMNDIQTWVSAALTDDTT  155

Query  90   CLDGFAYSKKHVR-RIIEKRLVQISHHVSNA  1
            C DGF   K  V  +++  ++V+I+H  SNA
Sbjct  156  CSDGF--EKNTVNGKVVRGQIVKIAHMTSNA  184



>gb|KJB57093.1| hypothetical protein B456_009G147900 [Gossypium raimondii]
Length=582

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 57/140 (41%), Positives = 80/140 (57%), Gaps = 14/140 (10%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPDRRAKTI---PEIIAATVNVTVDEVKASAANCSGIRRKLP  262
            AC GT YP+LC S + T +P   AK +    ++I  ++N+T   V+    N   I++ L 
Sbjct  68   ACSGTFYPDLCFSAVTT-VPAGTAKKVRSQKDVIELSLNITTTAVEH---NYFKIKKLLA  123

Query  261  R--LGPLEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTFFSAAMTNQ  97
            R  L   EK AL DCLE   ET DEL + + DL       S ++H  DL+T  SAAMTNQ
Sbjct  124  RKDLTTREKTALHDCLETIDETLDELHEAVEDLHEYPNKKSLTQHADDLKTLMSAAMTNQ  183

Query  96   ATCLDGFAY--SKKHVRRII  43
             TCLDGF++  + K +R ++
Sbjct  184  ETCLDGFSHEGADKKIREVL  203



>gb|AFB77929.1| pectin methylesterase [Gossypium hirsutum]
Length=582

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 57/140 (41%), Positives = 80/140 (57%), Gaps = 14/140 (10%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPDRRAKTI---PEIIAATVNVTVDEVKASAANCSGIRRKLP  262
            AC GT YP+LC S + T +P   AK +    ++I  ++N+T   V+    N   I++ L 
Sbjct  68   ACSGTFYPDLCFSAVTT-VPAGTAKKVRSQKDVIELSLNITTTAVEH---NYFKIKKLLA  123

Query  261  R--LGPLEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTFFSAAMTNQ  97
            R  L   EK AL DCLE   ET DEL + + DL       S ++H  DL+T  SAAMTNQ
Sbjct  124  RKDLTTREKTALHDCLETIDETLDELHEAVEDLHEYPNKKSLTQHADDLKTLMSAAMTNQ  183

Query  96   ATCLDGFAY--SKKHVRRII  43
             TCLDGF++  + K +R ++
Sbjct  184  ETCLDGFSHEGADKKIREVL  203



>gb|AFW03475.1| pectin methylesterase 1 [Gossypium barbadense]
Length=582

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 57/140 (41%), Positives = 80/140 (57%), Gaps = 14/140 (10%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPDRRAKTI---PEIIAATVNVTVDEVKASAANCSGIRRKLP  262
            AC GT YP+LC S + T +P   AK +    ++I  ++N+T   V+    N   I++ L 
Sbjct  68   ACSGTFYPDLCFSAVTT-VPAGTAKKVRSQKDVIELSLNITTTAVEH---NYFKIKKLLA  123

Query  261  R--LGPLEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTFFSAAMTNQ  97
            R  L   EK AL DCLE   ET DEL + + DL       S ++H  DL+T  SAAMTNQ
Sbjct  124  RKDLTTREKTALHDCLETIDETLDELHEAVEDLHEYPNKKSLTQHADDLKTLMSAAMTNQ  183

Query  96   ATCLDGFAY--SKKHVRRII  43
             TCLDGF++  + K +R ++
Sbjct  184  ETCLDGFSHEGADKKIREVL  203



>gb|KJB19687.1| hypothetical protein B456_003G114500 [Gossypium raimondii]
 gb|KJB19688.1| hypothetical protein B456_003G114500 [Gossypium raimondii]
Length=201

 Score = 83.6 bits (205),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 54/152 (36%), Positives = 86/152 (57%), Gaps = 14/152 (9%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPDRRAKTIPEIIA-ATVNVTVDEVKASAANCSGIRRKLPR-  259
            +C  T YP+LC  +L T       +T P++IA A +NVT+   K+++A    +  KL + 
Sbjct  44   SCSSTTYPKLCYESLLT--QASMIQTSPQLIAHAALNVTLSTAKSTSA----LMVKLAKS  97

Query  258  --LGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYV--DLQTFFSAAMTNQAT  91
              L P E  A+ DC+E   +T DELRK +S++     S+   +  D+QT+ SAA+T++ T
Sbjct  98   QGLKPTEVGAMQDCVEELEDTIDELRKSISEMGQLKGSNFGLMINDIQTWVSAALTDENT  157

Query  90   CLDGFAYSKKH--VRRIIEKRLVQISHHVSNA  1
            C DGF     +  V+  +  ++V I+H  SNA
Sbjct  158  CADGFGGKNMNGSVKTAVRSKIVTIAHLTSNA  189



>ref|NP_001274969.1| pectin methyl esterase [Solanum tuberosum]
 gb|AAF23892.1|AF152172_1 pectin methyl esterase [Solanum tuberosum]
Length=576

 Score = 86.7 bits (213),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 54/150 (36%), Positives = 81/150 (54%), Gaps = 6/150 (4%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALP-DRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRL  256
            AC  TL+PELC S +       ++  +  ++I  ++N+TV  V+ +      + +    L
Sbjct  65   ACSNTLHPELCYSAIVNVTDFSKKVTSQKDVIELSLNITVKAVRRNYYAVKELIKTRKGL  124

Query  255  GPLEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTFFSAAMTNQATCL  85
             P EK AL DCLE   ET DEL   ++DL       S  +H  DL+T  S+A+TNQ TCL
Sbjct  125  TPREKVALHDCLETMDETLDELHTAVADLELYPNKKSLKEHAEDLKTLISSAITNQETCL  184

Query  84   DGFAYSK--KHVRRIIEKRLVQISHHVSNA  1
            DGF++ +  K VR+++ K    +    SNA
Sbjct  185  DGFSHDEADKKVRKVLLKGQKHVEKMCSNA  214



>ref|XP_006392745.1| hypothetical protein EUTSA_v10011343mg [Eutrema salsugineum]
 gb|ESQ30031.1| hypothetical protein EUTSA_v10011343mg [Eutrema salsugineum]
Length=584

 Score = 86.7 bits (213),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 59/152 (39%), Positives = 84/152 (55%), Gaps = 14/152 (9%)
 Frame = -1

Query  429  CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKL-PRLG  253
            C  T YPELC S +A+    ++  +  ++I A++N+T + VK    N   +++ +  R G
Sbjct  66   CTSTRYPELCFSAVAST--GKKLTSHKDVIEASLNLTTNVVKH---NYFAVKKLITKRKG  120

Query  252  PLEKR---ALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTFFSAAMTNQAT  91
             L  R   AL DCLE   ET DEL   + DL       S  KH  DL+T  S+A+TNQ T
Sbjct  121  GLRAREATALHDCLETIDETLDELHVAVEDLHQYPKGKSLRKHADDLKTLISSAITNQET  180

Query  90   CLDGFAY--SKKHVRRIIEKRLVQISHHVSNA  1
            CLDGF+Y  + + VR+ + K  V + H  SNA
Sbjct  181  CLDGFSYDDADRKVRKALMKGQVHVEHMCSNA  212



>ref|XP_011031815.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=580

 Score = 86.7 bits (213),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 62/170 (36%), Positives = 90/170 (53%), Gaps = 16/170 (9%)
 Frame = -1

Query  477  LNIHRQKLLQVAHT---EACEGTLYPELCVSTLATALPDRRAK--TIPEIIAATVNVTVD  313
            +N HR    +  H     +C  TLYPELC S +AT +P   +   +  ++I  ++N+T  
Sbjct  48   VNSHRNSKNEGTHAILKSSCSSTLYPELCYSAVAT-VPGATSNLASQKDVIELSINLTT-  105

Query  312  EVKASAANCSGIRRKLP--RLGPLEKRALDDCLELFSETRDELRKVLSDL---ATTASSS  148
              KA   N   + + +   +L   EK AL DCLE+  ET DEL + L DL       S  
Sbjct  106  --KAVQHNFFTVEKLIATKKLSKREKTALHDCLEIIDETLDELHEALVDLNEYPNNKSLK  163

Query  147  KHYVDLQTFFSAAMTNQATCLDGFAYSK--KHVRRIIEKRLVQISHHVSN  4
            KH  DL+T  S+A+TNQ TCLDGF++ +  K VR+ + K  + +    SN
Sbjct  164  KHADDLKTLLSSAITNQETCLDGFSHDEADKKVRKALLKGQIHVEKMCSN  213



>gb|AFI23411.1| pectin methylesterase [Coffea arabica]
Length=587

 Score = 86.7 bits (213),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 60/152 (39%), Positives = 81/152 (53%), Gaps = 9/152 (6%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPDRRAKTI---PEIIAATVNVTVDEVKASAANCSGIRRKLP  262
            +C  TLYP+LC STLA  LP   ++ I    ++I   +N T   V+ +      +     
Sbjct  75   SCSNTLYPDLCFSTLAN-LPQAVSQKITSQKDVIELVLNHTTTTVEHNYFAVEHLIATHH  133

Query  261  RLGPLEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTFFSAAMTNQAT  91
             L   EK AL DCLE   ET DEL + + DL    +  S  +H  DL+T  SAAMTNQ T
Sbjct  134  NLTEREKTALHDCLETIDETLDELHQTVKDLELYPSKKSLKQHADDLKTLMSAAMTNQET  193

Query  90   CLDGFAY--SKKHVRRIIEKRLVQISHHVSNA  1
            CLDGF++  + KHVR+ +    V +    SNA
Sbjct  194  CLDGFSHDDADKHVRQELSNGQVHVEKLCSNA  225



>gb|ABK22631.1| unknown [Picea sitchensis]
 gb|ACN40721.1| unknown [Picea sitchensis]
Length=204

 Score = 83.2 bits (204),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 43/146 (29%), Positives = 87/146 (60%), Gaps = 3/146 (2%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLG  253
            +C  TLYP+LCVS+L++     +A T   ++   + V++   +  +   +G++ +   + 
Sbjct  42   SCNVTLYPQLCVSSLSSYAGSLKA-TQSNLVNVALQVSLVTARNVSVWAAGMKSRRALMS  100

Query  252  PLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHY--VDLQTFFSAAMTNQATCLDG  79
              E+ AL DC+E F +T D++R+ L++L     ++  +   +++T+ SAA+TN+ +CLDG
Sbjct  101  RRERAALGDCIEDFGDTADQIRQSLAELKKLRRNTFKFQMSNVETWMSAALTNEDSCLDG  160

Query  78   FAYSKKHVRRIIEKRLVQISHHVSNA  1
            F  +K  V+ ++  R+ ++   +SNA
Sbjct  161  FQVAKGRVKAMVTGRVQKVCKMISNA  186



>ref|XP_006421707.1| hypothetical protein CICLE_v10005946mg [Citrus clementina]
 gb|ESR34947.1| hypothetical protein CICLE_v10005946mg [Citrus clementina]
Length=196

 Score = 82.8 bits (203),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 54/151 (36%), Positives = 88/151 (58%), Gaps = 15/151 (10%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPDRRA---KTIPEIIA-ATVNVTVDEVKASAANCSGIRRKL  265
            +C  T YP LC  +LA     R A   +T P+++A A++NVT+   K+++A    + +  
Sbjct  42   SCSSTTYPTLCYKSLA-----RHASLIQTSPKLLAHASLNVTLAMAKSTSAVMLKMSKS-  95

Query  264  PRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYV--DLQTFFSAAMTNQAT  91
            P + P E  A+ DCLE  S++ DELRK + ++    +S+      D+QT+ SAA+T+  T
Sbjct  96   PGMKPREADAMQDCLEELSDSVDELRKSIGEMGLIKASNFELTMNDIQTWVSAALTDDTT  155

Query  90   CLDGFAYSKKHVR-RIIEKRLVQISHHVSNA  1
            C DGF   K  V  +++  ++V+I+H  SNA
Sbjct  156  CSDGF--EKNTVNGKVVRGQIVKIAHMTSNA  184



>ref|NP_001233857.1| pectinesterase/pectinesterase inhibitor U1 precursor [Solanum 
lycopersicum]
 sp|Q43143.1|PMEU1_SOLLC RecName: Full=Pectinesterase/pectinesterase inhibitor U1; Includes: 
RecName: Full=Pectinesterase inhibitor U1; AltName: Full=Pectin 
methylesterase inhibitor U1; Includes: RecName: Full=Pectinesterase 
U1; Short=PE U1; AltName: Full=Pectin methylesterase 
U1; Flags: Precursor [Solanum lycopersicum]
 gb|AAD09283.1| pectin methylesterase [Solanum lycopersicum]
 gb|AAL02367.1| pectin methylesterase [Solanum lycopersicum]
Length=583

 Score = 86.3 bits (212),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 54/150 (36%), Positives = 80/150 (53%), Gaps = 6/150 (4%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALP-DRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRL  256
            AC  TL+PELC S +       ++  +  ++I  ++N+TV  V+ +      + +    L
Sbjct  69   ACSNTLHPELCYSAIVNVSDFSKKVTSQKDVIELSLNITVKAVRRNYYAVKELIKTRKGL  128

Query  255  GPLEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTFFSAAMTNQATCL  85
             P EK AL DCLE   ET DEL   + DL       S  +H  DL+T  S+A+TNQ TCL
Sbjct  129  TPREKVALHDCLETMDETLDELHTAVEDLELYPNKKSLKEHVEDLKTLISSAITNQETCL  188

Query  84   DGFAYSK--KHVRRIIEKRLVQISHHVSNA  1
            DGF++ +  K VR+++ K    +    SNA
Sbjct  189  DGFSHDEADKKVRKVLLKGQKHVEKMCSNA  218



>ref|XP_006421706.1| hypothetical protein CICLE_v10005926mg [Citrus clementina]
 gb|ESR34946.1| hypothetical protein CICLE_v10005926mg [Citrus clementina]
Length=200

 Score = 82.4 bits (202),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 54/151 (36%), Positives = 89/151 (59%), Gaps = 15/151 (10%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPDRRA---KTIPEIIA-ATVNVTVDEVKASAANCSGIRRKL  265
            +C  T YP LC  +LA     R A   +T P+++A A++NVT+   K+++A    + +  
Sbjct  46   SCSSTTYPTLCYKSLA-----RHASLIQTSPKLLAHASLNVTLAMAKSTSAVMLKMSKS-  99

Query  264  PRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYV--DLQTFFSAAMTNQAT  91
            P + P E  A+ DCLE  S++ DELRK + ++    +S+      D+QT+ SAA+T++ T
Sbjct  100  PGMKPREVDAMQDCLEELSDSVDELRKSIGEMGLIKASNFELTMSDIQTWVSAALTDETT  159

Query  90   CLDGFAYSKKHVR-RIIEKRLVQISHHVSNA  1
            C DGF   K  V  +++  ++V+I+H  SNA
Sbjct  160  CSDGF--EKNTVNGKVVRAQIVKIAHMTSNA  188



>ref|XP_008368265.1| PREDICTED: pectinesterase 3-like [Malus domestica]
Length=375

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 55/152 (36%), Positives = 84/152 (55%), Gaps = 9/152 (6%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPD--RRAKTIPEIIAATVNVTVDEVKASAANCSGI-RRKLP  262
            +C  TLYPELC STLA   P+  ++  +  ++I  ++N+T   V+ +      + + +  
Sbjct  70   SCSSTLYPELCFSTLALH-PEAAKKVSSQKDVIELSLNITTKAVQHNFFTVEKLLKSRKN  128

Query  261  RLGPLEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTFFSAAMTNQAT  91
            +L   EK AL DCLE   ET DEL   + DL       + ++H  DL+T  S+A+TNQ T
Sbjct  129  KLTKREKGALHDCLETIDETLDELHDAVEDLHEYPNKKTLTQHADDLKTLISSAITNQET  188

Query  90   CLDGFAY--SKKHVRRIIEKRLVQISHHVSNA  1
            CLDGF++  + K VR++     V +    SNA
Sbjct  189  CLDGFSHDDADKKVRKVFLAGQVHVEKLCSNA  220



>gb|AAG17110.1|AF188895_1 putative pectin methylesterase 3 [Linum usitatissimum]
Length=555

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 56/151 (37%), Positives = 82/151 (54%), Gaps = 5/151 (3%)
 Frame = -1

Query  438  TEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPR  259
            T +C  T +P+LC S+LA+A       T  ++I A++NVT   V  + A  +        
Sbjct  44   TSSCSNTRHPDLCFSSLASAPVHVSLNTQMDVIKASINVTCTSVLRNIAAVNKALSTRTD  103

Query  258  LGPLEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTFFSAAMTNQATC  88
            L P  + AL DC+E  S + DEL   L++L       S ++H  DL+T  SAA TNQ TC
Sbjct  104  LTPRSRSALKDCVETMSTSLDELHVALAELDEYPNKKSITRHADDLKTLLSAATTNQETC  163

Query  87   LDGFAY--SKKHVRRIIEKRLVQISHHVSNA  1
            LDGF++  S+K VR+ +E   V++     NA
Sbjct  164  LDGFSHDDSEKKVRKTLETGPVRVEKMCGNA  194



>ref|XP_009601611.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=592

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 57/151 (38%), Positives = 81/151 (54%), Gaps = 7/151 (5%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPDRRAKTI--PEIIAATVNVTVDEVKASAANCSGIRRKLPR  259
            +C  TL+ ELC ST+A  +P+   K     ++I  ++N+T   V+ +      + +    
Sbjct  75   SCSITLHQELCYSTIANNIPNSSKKVTNQKDVIELSLNITTKAVQRNYYAIDKLVKTRKG  134

Query  258  LGPLEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTFFSAAMTNQATC  88
            L   EK AL DCLE   ET DEL   + DL       S  +H  DL+T  SAA+TNQ TC
Sbjct  135  LTEREKIALHDCLETIDETIDELHTAVEDLEKYPNAKSLRQHADDLKTLISAAITNQETC  194

Query  87   LDGFAYSK--KHVRRIIEKRLVQISHHVSNA  1
            LDGF++ +  K VR+I+ K  V +    SNA
Sbjct  195  LDGFSHDEADKKVRKILLKGQVYVEKLCSNA  225



>ref|XP_010273995.1| PREDICTED: pectinesterase 1-like [Nelumbo nucifera]
Length=226

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 50/127 (39%), Positives = 75/127 (59%), Gaps = 10/127 (8%)
 Frame = -1

Query  429  CEGTLYPELCVSTLATALPDRRAKTIPE-IIAATVNVTVDEVKASAANCSGIRRKLPRLG  253
            C  TLYP LC STL +++P  +  T P  I+   +N+T + V  S  +  G+  +   L 
Sbjct  72   CAKTLYPSLCFSTL-SSIPSSKNATHPRHILVIAINLTFNSVNISQTHIMGLLTR-QDLN  129

Query  252  PLEKRALDDCLELFSETRDELR--KVLSDLATTASSS-----KHYVDLQTFFSAAMTNQA  94
            P E+ AL DCLE+  +T+ EL+  + L DL   +S+S     + Y +L+T  SAAMTN+ 
Sbjct  130  PQERNALQDCLEMLDQTQYELQQAQALQDLRYFSSASVGFHGRLYSNLKTLLSAAMTNEN  189

Query  93   TCLDGFA  73
            TC+DGF+
Sbjct  190  TCIDGFS  196



>ref|XP_009151355.1| PREDICTED: 21 kDa protein [Brassica rapa]
Length=198

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 52/148 (35%), Positives = 88/148 (59%), Gaps = 8/148 (5%)
 Frame = -1

Query  429  CEGTLYPELCVSTLATALPDRRAKTIPEIIA-ATVNVTVDEVKASAANCSGIRRKLPRLG  253
            C  T YP LCV++L+T       +T  +++A A +N+T+   KA++A    + R   RL 
Sbjct  42   CTFTTYPRLCVTSLST--QSSLIQTSHKLMAHAALNITLASAKATSAMMVRVSRS-SRLK  98

Query  252  PLEKRALDDCLELFSETRDELRKVLSDLATTASSSK--HYVDLQTFFSAAMTNQATCLDG  79
            P E  A+ DC+E   +T +ELRK + ++   + S+   +  D+QT+ SAA+T++ TCLDG
Sbjct  99   PREVSAMRDCVEELGDTLEELRKSIGEMGQLSGSNYEVYMNDIQTWVSAALTDEYTCLDG  158

Query  78   FAYSKKH--VRRIIEKRLVQISHHVSNA  1
            F   + +  V+ ++  R++ I+H  SNA
Sbjct  159  FEGDEMNGKVKVLVRGRILIIAHLTSNA  186



>ref|XP_004506603.1| PREDICTED: 21 kDa protein-like [Cicer arietinum]
Length=198

 Score = 82.0 bits (201),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 51/152 (34%), Positives = 87/152 (57%), Gaps = 14/152 (9%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPDRRAKTIPE----IIAATVNVTVDEVKASAANCSGIRRKL  265
            +C  T YP LC ++L      + A +I      +    +NVT+  VK++ A  S +  K 
Sbjct  41   SCSSTTYPRLCYASLV-----KHANSIQTNRFLLTDTALNVTLATVKSTWAMMSSLA-KT  94

Query  264  PRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYV--DLQTFFSAAMTNQAT  91
              L P E  A+ DC+EL S++ DELRK +++++   +S+      D+QT+ SAA+T+Q+T
Sbjct  95   RELKPRETAAMKDCIELLSDSIDELRKSINEMSRLRTSNFELTMSDIQTWVSAALTDQST  154

Query  90   CLDGFA--YSKKHVRRIIEKRLVQISHHVSNA  1
            C DGF    +   ++ I++ ++VQ++   SNA
Sbjct  155  CSDGFEEINATGDIKTIVQVKIVQVAQLTSNA  186



>ref|XP_006490094.1| PREDICTED: 21 kDa protein-like [Citrus sinensis]
 gb|KDO65438.1| hypothetical protein CISIN_1g027094mg [Citrus sinensis]
Length=228

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 54/151 (36%), Positives = 89/151 (59%), Gaps = 15/151 (10%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPDRRA---KTIPEIIA-ATVNVTVDEVKASAANCSGIRRKL  265
            +C  T YP LC  +LA     R A   +T P+++A A++NVT+   K+++A    + +  
Sbjct  74   SCSSTTYPTLCYKSLA-----RHASLIQTSPKLLAHASLNVTLAMAKSTSAVMLKMSKS-  127

Query  264  PRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYV--DLQTFFSAAMTNQAT  91
            P + P E  A+ DCLE  S++ DELRK + ++    +S+      D+QT+ SAA+T++ T
Sbjct  128  PGMKPREVDAMQDCLEELSDSVDELRKSIGEMGLIKASNFELTMSDIQTWVSAALTDETT  187

Query  90   CLDGFAYSKKHVR-RIIEKRLVQISHHVSNA  1
            C DGF   K  V  +++  ++V+I+H  SNA
Sbjct  188  CSDGF--EKNTVNGKVVRAQIVKIAHMTSNA  216



>ref|XP_003625921.1| Pectinesterase/pectinesterase inhibitor [Medicago truncatula]
 ref|XP_003628462.1| Pectinesterase/pectinesterase inhibitor [Medicago truncatula]
 gb|AES82139.1| plant invertase/pectin methylesterase inhibitor [Medicago truncatula]
Length=197

 Score = 82.0 bits (201),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 54/150 (36%), Positives = 78/150 (52%), Gaps = 10/150 (7%)
 Frame = -1

Query  435  EACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRL  256
            EAC  T Y  LC+ TLA    +   +T  +   A V+VT+ EVK    N      KL + 
Sbjct  36   EACSVTRYQNLCIHTLA-QFSNTAGRTPSKWARAGVSVTISEVK----NVQAYLTKLKKN  90

Query  255  GPLEKR---ALDDCLELFSETRDELRKVLSDLATTASS--SKHYVDLQTFFSAAMTNQAT  91
            G ++ R   AL DC+E F    DEL K L  L   + +  S    DL T+ SAA+TN+ T
Sbjct  91   GKMKGRNRVALSDCIETFGYAVDELHKSLGVLRKLSKNTFSTQMGDLNTWISAALTNEDT  150

Query  90   CLDGFAYSKKHVRRIIEKRLVQISHHVSNA  1
            CLDGF    +   ++++ ++  +S+  SNA
Sbjct  151  CLDGFEGKTEKKIKLLQNKVKNVSYITSNA  180



>ref|XP_007038418.1| DC1.2-like, putative [Theobroma cacao]
 gb|EOY22919.1| DC1.2-like, putative [Theobroma cacao]
Length=201

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 50/149 (34%), Positives = 89/149 (60%), Gaps = 8/149 (5%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPDRRAKTIPEIIA-ATVNVTVDEVKASAANCSGIRRKLPRL  256
            +C  T YP+LC  TL+T       +T P+++A A +NVT+   ++++A    + +    L
Sbjct  44   SCSSTTYPKLCFETLST--HASLIQTSPQLLAHAALNVTLSTTESTSAMMVTLSKS-HGL  100

Query  255  GPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYV--DLQTFFSAAMTNQATCLD  82
             P E  A+ DC+E  S++ DELRK +S++     S+   +  D+QT+ SAA+T+++TC D
Sbjct  101  KPREAEAMQDCVEELSDSIDELRKSISEMGQVKGSNFGLMINDVQTWVSAALTDESTCSD  160

Query  81   GFAYS--KKHVRRIIEKRLVQISHHVSNA  1
            GF  +    +V+  +  ++++I+H  SNA
Sbjct  161  GFQGNNMNGNVKTAVRTKILRIAHLTSNA  189



>ref|XP_002510935.1| 21 kDa protein precursor, putative [Ricinus communis]
 gb|EEF51537.1| 21 kDa protein precursor, putative [Ricinus communis]
Length=201

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 58/167 (35%), Positives = 96/167 (57%), Gaps = 20/167 (12%)
 Frame = -1

Query  462  QKLLQVAHTE----ACEGTLYPELCVSTLATALPDRRAKTIPEIIA-ATVNVTVDEVKAS  298
            + L Q   TE    +C  T YP LC S+L   +   + +T P ++A A +NVT+    AS
Sbjct  30   RNLAQTTSTEFIRTSCSTTTYPRLCYSSLK--IHASKIQTSPMLLANAALNVTL----AS  83

Query  297  AANCSGIRRKLPR---LGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYV---  136
              + S + +KL +   + P E  A+ DC++  +++ DELRK + +L   A  SK  +   
Sbjct  84   TRSTSTMMQKLSKSHGMKPREVSAMQDCMDELTDSVDELRKSIDELGK-AQGSKFGLMMN  142

Query  135  DLQTFFSAAMTNQATCLDGFAYS--KKHVRRIIEKRLVQISHHVSNA  1
            D+QT+ SAA+T+++TC DGFA S     ++ ++ ++ V+I+H  SNA
Sbjct  143  DVQTWVSAALTDESTCSDGFAGSTMNGELKTLVRQQTVKIAHLTSNA  189



>ref|XP_009335740.1| PREDICTED: 21 kDa protein [Pyrus x bretschneideri]
Length=202

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 53/148 (36%), Positives = 81/148 (55%), Gaps = 5/148 (3%)
 Frame = -1

Query  435  EACEGTLYPELCVSTLATALPDRRAKTIPEIIA-ATVNVTVDEVKASAANCSGIRRKLPR  259
            EAC  T Y +LC+ +LA+      AK  P   A A V+V++ E K++A     +++   R
Sbjct  39   EACSVTRYRDLCIHSLASF--STSAKNSPSRWARAGVSVSLSETKSAAHYLVTLKKHRRR  96

Query  258  LGPLEKRALDDCLELFSETRDELRKVLSDLATTASSS--KHYVDLQTFFSAAMTNQATCL  85
            +    K AL DC+E F    DEL K L  L T   ++      DL+T+ SAA+T+  TCL
Sbjct  97   MQGRNKVALSDCIECFGNAIDELHKSLGVLRTLTKTTFDSEMADLKTWLSAALTDGYTCL  156

Query  84   DGFAYSKKHVRRIIEKRLVQISHHVSNA  1
            DGF   K    ++++K + +++H  SNA
Sbjct  157  DGFEGQKGKQVKLLQKTVSKVTHITSNA  184



>ref|XP_009335681.1| PREDICTED: 21 kDa protein-like [Pyrus x bretschneideri]
Length=202

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 53/148 (36%), Positives = 81/148 (55%), Gaps = 5/148 (3%)
 Frame = -1

Query  435  EACEGTLYPELCVSTLATALPDRRAKTIPEIIA-ATVNVTVDEVKASAANCSGIRRKLPR  259
            EAC  T Y +LC+ +LA+      AK  P   A A V+V++ E K++A     +++   R
Sbjct  39   EACSVTRYRDLCIHSLASF--STSAKNSPSRWARAGVSVSLSETKSAAHYLVTLKKHRRR  96

Query  258  LGPLEKRALDDCLELFSETRDELRKVLSDLATTASSS--KHYVDLQTFFSAAMTNQATCL  85
            +    K AL DC+E F    DEL K L  L T   ++      DL+T+ SAA+T+  TCL
Sbjct  97   MQGRNKVALSDCIECFGNAIDELHKSLGVLRTLTKTTFDSEMADLKTWLSAALTDGYTCL  156

Query  84   DGFAYSKKHVRRIIEKRLVQISHHVSNA  1
            DGF   K    ++++K + +++H  SNA
Sbjct  157  DGFEGQKGKQVKLLQKTVSKVTHITSNA  184



>gb|AAO85706.1| pectin methyl-esterase [Nicotiana benthamiana]
Length=579

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 58/163 (36%), Positives = 84/163 (52%), Gaps = 9/163 (6%)
 Frame = -1

Query  462  QKLLQVAHT---EACEGTLYPELCVSTLATALP-DRRAKTIPEIIAATVNVTVDEVKASA  295
            Q +   AH     ACE TL+PELC ST+A+     ++  +  ++I  ++N+T   V+ + 
Sbjct  52   QAITSAAHAIVKSACENTLHPELCYSTIASVSDFSKKVTSQKDVIELSLNITCRAVQHNF  111

Query  294  ANCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQT  124
                 + +    L P EK AL DCLE   ET DEL   + DL       S   H   L+T
Sbjct  112  FKVEKLIKTRKGLKPREKVALHDCLETIDETLDELHTAIKDLELYPNKKSLKAHADGLKT  171

Query  123  FFSAAMTNQATCLDGFAY--SKKHVRRIIEKRLVQISHHVSNA  1
              S+A+TNQ TCLDGF++  + K VR+ + K    +    SNA
Sbjct  172  LISSAITNQETCLDGFSHDDADKKVRKALLKGQKHVEKMCSNA  214



>ref|XP_010656074.1| PREDICTED: pectinesterase-like [Vitis vinifera]
Length=578

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 75/134 (56%), Gaps = 6/134 (4%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPDRRAKTIP-EIIAATVNVTVDEVKASAANCSGIRRKLPRL  256
            +C  TLYPELC S +++   +    T P ++I A +N T+  V+ +      I +    L
Sbjct  61   SCSATLYPELCFSAVSSREGEEAKITKPKDVIEAVLNFTITTVQHNYFTLQHIIKTRLGL  120

Query  255  GPLEKRALDDCLELFSETRDELRKV---LSDLATTASSSKHYVDLQTFFSAAMTNQATCL  85
             P EK AL DCLE+  +T DEL K    L D +   S S+   DL T  SAAMTNQ TC+
Sbjct  121  SPREKAALHDCLEMVDDTLDELHKSALDLQDYSLNKSISQQADDLITLLSAAMTNQETCI  180

Query  84   DGFAY--SKKHVRR  49
            DGF++  + K +R+
Sbjct  181  DGFSHDGADKKIRK  194



>ref|XP_002532944.1| Pectinesterase-3 precursor, putative [Ricinus communis]
 gb|EEF29428.1| Pectinesterase-3 precursor, putative [Ricinus communis]
Length=577

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 56/151 (37%), Positives = 84/151 (56%), Gaps = 9/151 (6%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPDRRAK--TIPEIIAATVNVTVDEVKASAANCSGIRRKLPR  259
            +C  T YP+LC S +A+A P   +K  ++ ++I  ++N+T   V+ +      + ++   
Sbjct  67   SCSTTRYPDLCFSAVASA-PGATSKLVSLKDVIEVSLNLTTTAVEHNFFTVEKLAKR-KG  124

Query  258  LGPLEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTFFSAAMTNQATC  88
            L   EK AL DCLE   ET DEL K + DL       S S+H  DL+T  S+A+TNQ TC
Sbjct  125  LTKREKTALHDCLETIDETLDELHKAMDDLKEYPNKKSLSQHADDLKTLLSSAITNQETC  184

Query  87   LDGFAY--SKKHVRRIIEKRLVQISHHVSNA  1
            LDGF++  + KH+R  +    V +    SNA
Sbjct  185  LDGFSHDGADKHIREALLAGQVHVEKMCSNA  215



>ref|XP_008460358.1| PREDICTED: pectinesterase-like [Cucumis melo]
Length=559

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 55/141 (39%), Positives = 80/141 (57%), Gaps = 9/141 (6%)
 Frame = -1

Query  429  CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGP  250
            C  TLYPELC +T++TA+      +  E I A+VN+T+  V  +      + +    L  
Sbjct  46   CAMTLYPELCETTISTAV----GSSSKEAIEASVNITIGAVGDNYRRVKKLLKTENSLTK  101

Query  249  LEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTFFSAAMTNQATCLDG  79
             EK AL DCLE   ET  EL +V+ D+       S S++  DL+T  S+A+TNQ TCLDG
Sbjct  102  REKIALHDCLETGEETLRELYEVVEDVNEYPNKKSLSRYADDLKTLLSSAITNQETCLDG  161

Query  78   FAYSK--KHVRRIIEKRLVQI  22
            F++ K  K VR  +++ L+ I
Sbjct  162  FSHDKADKKVRESLKEGLIHI  182



>ref|XP_002264167.1| PREDICTED: 21 kDa protein [Vitis vinifera]
Length=200

 Score = 81.3 bits (199),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 49/149 (33%), Positives = 94/149 (63%), Gaps = 8/149 (5%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAAT-VNVTVDEVKASAANCSGIRRKLPRL  256
            AC  T YP+LC ++LA        +T P+++A+T ++VT+   ++++++ S + ++   L
Sbjct  43   ACGTTTYPQLCFTSLAAHA--SVIQTNPKLLASTALSVTLATARSTSSDMSTLLKR-HGL  99

Query  255  GPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYV--DLQTFFSAAMTNQATCLD  82
             P E  A+ DC+E  S++ D+L+K + +++   SS+   +  D+QT+ SAA+T++ TC +
Sbjct  100  TPREVSAMRDCVEELSDSVDQLKKSMGEMSQIKSSNFGLMINDIQTWVSAALTDEDTCAN  159

Query  81   GFAYSK--KHVRRIIEKRLVQISHHVSNA  1
            GF  +   ++VR ++  R+V I+H  SNA
Sbjct  160  GFTENAMTENVRTVVNARIVNIAHMTSNA  188



>ref|XP_010939846.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=591

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 51/150 (34%), Positives = 80/150 (53%), Gaps = 6/150 (4%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPDRRAKTIP-EIIAATVNVTVDEVKASAANCSGIRRKLPRL  256
            +C  T YP+LC S +A      +  + P ++I A++N+T+  ++ S  +   +    P L
Sbjct  65   SCRSTRYPDLCYSAVAATPALIQTISKPKDVIHASINLTITAIQRSFRHVERLSASYPNL  124

Query  255  GPLEKRALDDCLELFSETRDELRKVLSDLATTASSS---KHYVDLQTFFSAAMTNQATCL  85
               E+ AL DCLE+F E+ DEL    +DL    +     +H +DL+   SAAMTNQ +C 
Sbjct  125  TTRERTALHDCLEMFDESLDELNLTDADLRAYPAGKPLRRHALDLEILVSAAMTNQESCS  184

Query  84   DGFAYS--KKHVRRIIEKRLVQISHHVSNA  1
            DGF+Y   +  +RR I   L  ++    NA
Sbjct  185  DGFSYEDIEGRLRREIRSELTHVTRMCRNA  214



>ref|XP_002304257.2| pectinesterase family protein [Populus trichocarpa]
 gb|EEE79236.2| pectinesterase family protein [Populus trichocarpa]
Length=584

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 61/171 (36%), Positives = 90/171 (53%), Gaps = 16/171 (9%)
 Frame = -1

Query  480  NLNIHRQKLLQVAHT---EACEGTLYPELCVSTLATALPDRRAK--TIPEIIAATVNVTV  316
             +N H+    +  H     +C  TLYPELC S +AT +P   +   +  ++I  ++N+T 
Sbjct  52   GVNSHKSSKNEGTHAILKSSCSSTLYPELCYSAVAT-VPGATSNLASQKDVIELSINLTT  110

Query  315  DEVKASAANCSGIRRKLP--RLGPLEKRALDDCLELFSETRDELRKVLSDL---ATTASS  151
               KA   N   + + +   +L   EK AL DCLE+  ET DEL + L DL       S 
Sbjct  111  ---KAVQHNFFTVEKLIATKKLTKREKTALHDCLEIIDETLDELHEALVDLNDYPNNKSL  167

Query  150  SKHYVDLQTFFSAAMTNQATCLDGFAYSK--KHVRRIIEKRLVQISHHVSN  4
             KH  DL+T  S+A+TNQ TCLDGF++ +  K VR+ + K  + +    SN
Sbjct  168  KKHADDLKTLLSSAITNQETCLDGFSHDEADKKVRKALLKGQIHVEKMCSN  218



>ref|XP_006369078.1| hypothetical protein POPTR_0001s162502g, partial [Populus trichocarpa]
 gb|ERP65647.1| hypothetical protein POPTR_0001s162502g, partial [Populus trichocarpa]
Length=349

 Score = 82.0 bits (201),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 61/169 (36%), Positives = 89/169 (53%), Gaps = 12/169 (7%)
 Frame = -1

Query  477  LNIHRQKLLQVAHT---EACEGTLYPELCVSTLATALPDRRAK--TIPEIIAATVNVTVD  313
            +N H+    + AH     AC  TLYPELC S +AT +P   +   ++ ++I  ++N+T  
Sbjct  48   VNSHKNGKNEGAHAILKSACSSTLYPELCYSAIAT-VPGVTSNLASLKDVIELSINLTTK  106

Query  312  EVKASAANCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLAT--TASSSKHY  139
             V+ +      +  K  +L   EK AL DCLE   ET DEL + L D+       S K  
Sbjct  107  TVQQNYFTVEKLIAK-TKLTKREKTALHDCLETIDETLDELHEALVDINGYPDKKSLKEQ  165

Query  138  VD-LQTFFSAAMTNQATCLDGFAY--SKKHVRRIIEKRLVQISHHVSNA  1
             D L+T  S+A+TNQ TCLDGF++  + K VR+ + K    +    SNA
Sbjct  166  ADNLKTLLSSAITNQETCLDGFSHDGADKKVRKALLKGQTHVEKMCSNA  214



>gb|ADE76337.1| unknown [Picea sitchensis]
Length=204

 Score = 80.5 bits (197),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 46/146 (32%), Positives = 84/146 (58%), Gaps = 3/146 (2%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLG  253
            +C+ TLYP++CVS+L +     +A T  +I+ A V  ++   +  +   +G++ +   + 
Sbjct  42   SCKVTLYPQVCVSSLFSYAGSLKA-TQSDIVKAAVQASLVNARNISVWATGMKTRGATMS  100

Query  252  PLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHY--VDLQTFFSAAMTNQATCLDG  79
              EK AL DC+E F  T D++R+ LS+L     ++  +   +++T+ SAA+TN+ +CLDG
Sbjct  101  KREKAALVDCIENFGVTTDQIRESLSELKKLQRNTFKFQMSNVKTWMSAALTNENSCLDG  160

Query  78   FAYSKKHVRRIIEKRLVQISHHVSNA  1
            F   K  V  ++  R+  +   +SNA
Sbjct  161  FQVVKGRVEAMVTARVHYMCKLISNA  186



>ref|XP_009767827.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=593

 Score = 83.6 bits (205),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 53/151 (35%), Positives = 83/151 (55%), Gaps = 7/151 (5%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPD--RRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPR  259
            +C  TL+ +LC ST+A  +P+  ++     ++I  ++N+T   V+ +      + +    
Sbjct  76   SCSITLHQQLCYSTIANNIPNFSKKVTNQKDVIELSLNITTKAVQRNYYAIDKLIKTRKG  135

Query  258  LGPLEKRALDDCLELFSETRDELRKVLSDLATTASSS---KHYVDLQTFFSAAMTNQATC  88
            L   EK AL DCLE   ET DEL   + DL    ++    +H  DL+T  SAA+TNQ TC
Sbjct  136  LTEREKIALHDCLETIDETIDELHTAVEDLEKYPNAKALRQHADDLKTLISAAITNQETC  195

Query  87   LDGFAYSK--KHVRRIIEKRLVQISHHVSNA  1
            LDGF++ +  K VR+++ K  V +    SNA
Sbjct  196  LDGFSHDEADKKVRKVLLKGQVYVEKLCSNA  226



>ref|XP_010047424.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=564

 Score = 83.6 bits (205),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 57/172 (33%), Positives = 93/172 (54%), Gaps = 9/172 (5%)
 Frame = -1

Query  489  LDLNLNIHRQKLLQVAHTEACEGTLYPELCVSTLATA--LPDRRAKTIPEIIAATVNVTV  316
            L L ++ +R +  +     +C  TLYP+LC+S L ++  L     KT  +++A  +N+T+
Sbjct  25   LALAIDDNRHREARSLIKSSCSSTLYPDLCLSQLTSSPSLTSDAMKTPKDVVALALNLTI  84

Query  315  DEVKASAANCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDL-----ATTASS  151
              V+ +      +      L   E+ AL DCLE+  ET DE+R+ L+DL       + S 
Sbjct  85   TSVQHNYFTIKKVAATRSGLTVRERTALHDCLEMVDETLDEVRETLADLLAYPNGGSKSV  144

Query  150  SKHYVDLQTFFSAAMTNQATCLDGFAY--SKKHVRRIIEKRLVQISHHVSNA  1
            S+   D++T  SAAMTNQ +CLDGF++  + K VR  +    + + H  S+A
Sbjct  145  SELAEDMKTLLSAAMTNQESCLDGFSHDSADKKVREALLGGQMHVFHLCSHA  196



>ref|XP_010458855.1| PREDICTED: 21 kDa protein-like [Camelina sativa]
Length=195

 Score = 80.1 bits (196),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 49/149 (33%), Positives = 89/149 (60%), Gaps = 9/149 (6%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPDRRAKTIPEIIA-ATVNVTVDEVKASAANCSGIRRKLPRL  256
            +C  T YP LC ++L+T       +T P+++A A +N+T+   KA++A    +R    RL
Sbjct  39   SCTFTTYPRLCFTSLSTQAS--LIQTSPKLMAHAALNITLASAKATSAMM--VRLSSSRL  94

Query  255  GPLEKRALDDCLELFSETRDELRKVLSDLATTASSSK--HYVDLQTFFSAAMTNQATCLD  82
             P E  A+ DC+E  ++T DELRK + ++   +SS+   +  D+QT+ SAA+T++ TC +
Sbjct  95   NPREAAAMRDCVEELADTLDELRKSIGEMCRLSSSNYEVYMSDMQTWVSAALTDENTCTE  154

Query  81   GFAYSKKH--VRRIIEKRLVQISHHVSNA  1
            GF   + +   + ++  +++ ++H  SNA
Sbjct  155  GFDRDEMNGKTKVLVRGKILVVAHLTSNA  183



>ref|XP_002516186.1| Pectinesterase-3 precursor, putative [Ricinus communis]
 gb|EEF46188.1| Pectinesterase-3 precursor, putative [Ricinus communis]
Length=589

 Score = 83.6 bits (205),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 53/130 (41%), Positives = 73/130 (56%), Gaps = 8/130 (6%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPDRRAKTIP---EIIAATVNVTVDEVKASAANCSGIRRKLP  262
            +C  TLYP+LC ST+ +ALP     TI    ++I  ++NVT   V  +     G+     
Sbjct  71   SCSSTLYPDLCFSTI-SALPADATSTIKTTKDVIILSLNVTESSVYQTYLKIQGLTLARR  129

Query  261  RLGPLEKRALDDCLELFSETRDELRKVLSDL----ATTASSSKHYVDLQTFFSAAMTNQA  94
               P E  AL DCL+  SET DE+RKV+  L    +   S S+H  +L+   SAAMTNQ 
Sbjct  130  SYTPREVTALKDCLQTLSETVDEIRKVVQLLKEYPSLKNSISEHADELKILISAAMTNQE  189

Query  93   TCLDGFAYSK  64
            TCLDGF++ +
Sbjct  190  TCLDGFSHDR  199



>ref|XP_010273801.1| PREDICTED: pectinesterase [Nelumbo nucifera]
Length=580

 Score = 83.6 bits (205),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 59/153 (39%), Positives = 82/153 (54%), Gaps = 13/153 (8%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPD--RRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLP-  262
            +C  TLYP+LC S +AT +P       T  ++I  ++N+T   V+    N   I++ L  
Sbjct  68   SCSSTLYPDLCYSAIAT-VPGAADNLSTQKDVIEISLNITTTAVEH---NYFTIKKLLAH  123

Query  261  -RLGPLEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTFFSAAMTNQA  94
             +L   EK AL DCLE+  ET DEL +   DL       S  +H  DL+   SAAMTNQ 
Sbjct  124  EKLTEREKTALHDCLEMVDETLDELHETAEDLKQYPNKKSLDEHAEDLKILLSAAMTNQD  183

Query  93   TCLDGFAYSK--KHVRRIIEKRLVQISHHVSNA  1
            TC+DGF++ +  K VR  + K    + H  SNA
Sbjct  184  TCIDGFSHEQADKEVRNALLKGQEHVYHMCSNA  216



>gb|ABK22757.1| unknown [Picea sitchensis]
Length=199

 Score = 80.1 bits (196),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 48/164 (29%), Positives = 90/164 (55%), Gaps = 12/164 (7%)
 Frame = -1

Query  459  KLLQVAHTEA---------CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEV  307
            K+L   H++A         C  TLYP++CVS+L++     + K   +++ A V V++   
Sbjct  24   KVLNPVHSDAQMAEFIRTSCNVTLYPQVCVSSLSSYAGPLKPKQ-SDLVNAAVQVSLVNT  82

Query  306  KASAANCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSS--KHYVD  133
               +   +G++ +   +   EK AL DC+E F  T D++ + L++L     ++      +
Sbjct  83   HNVSVWAAGLKTRRATMSKREKAALKDCMENFGTTMDQIHQSLAELKHLRRNTFKIQMSN  142

Query  132  LQTFFSAAMTNQATCLDGFAYSKKHVRRIIEKRLVQISHHVSNA  1
            ++T+ SAA+TN+ +CLDGF  +K  V+ ++  R+  +S  +SNA
Sbjct  143  VETWMSAALTNEDSCLDGFQVAKGRVKAMVTGRVHYLSKLISNA  186



>ref|XP_004144447.1| PREDICTED: pectinesterase 3-like [Cucumis sativus]
Length=556

 Score = 83.2 bits (204),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 52/141 (37%), Positives = 80/141 (57%), Gaps = 9/141 (6%)
 Frame = -1

Query  429  CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGP  250
            C  TLYPELC +T++TA+      +  E I A+VN+T+  VK +      + + +  L  
Sbjct  46   CAMTLYPELCETTISTAV----GSSSKEAIEASVNITISAVKDNYKRVQKLLKTVKNLTK  101

Query  249  LEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTFFSAAMTNQATCLDG  79
             +K A  DCLE   ET  EL +V+ D+       S S++  DL+T  S+ +TNQ TC+DG
Sbjct  102  RQKIAFHDCLETGEETLRELYEVVEDVNEYPKKKSLSRYADDLKTLLSSTITNQETCVDG  161

Query  78   FAYSK--KHVRRIIEKRLVQI  22
            F++ K  K VR  +++ L+ I
Sbjct  162  FSHDKGDKKVRESLKEGLIHI  182



>ref|XP_004168887.1| PREDICTED: pectinesterase 3-like [Cucumis sativus]
 gb|KGN58477.1| hypothetical protein Csa_3G646640 [Cucumis sativus]
Length=561

 Score = 83.2 bits (204),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 52/141 (37%), Positives = 80/141 (57%), Gaps = 9/141 (6%)
 Frame = -1

Query  429  CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGP  250
            C  TLYPELC +T++TA+      +  E I A+VN+T+  VK +      + + +  L  
Sbjct  46   CAMTLYPELCETTISTAV----GSSSKEAIEASVNITISAVKDNYKRVQKLLKTVKNLTK  101

Query  249  LEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTFFSAAMTNQATCLDG  79
             +K A  DCLE   ET  EL +V+ D+       S S++  DL+T  S+ +TNQ TC+DG
Sbjct  102  RQKIAFHDCLETGEETLRELYEVVEDVNEYPKKKSLSRYADDLKTLLSSTITNQETCVDG  161

Query  78   FAYSK--KHVRRIIEKRLVQI  22
            F++ K  K VR  +++ L+ I
Sbjct  162  FSHDKGDKKVRESLKEGLIHI  182



>emb|CDX86901.1| BnaC03g51710D [Brassica napus]
Length=200

 Score = 80.1 bits (196),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 52/149 (35%), Positives = 86/149 (58%), Gaps = 8/149 (5%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPDRRAKTIPEIIA-ATVNVTVDEVKASAANCSGIRRKLPRL  256
            +C  T YP LCV++L+T       +T  ++IA A +N+T+   KA++A    +     RL
Sbjct  43   SCTFTTYPRLCVTSLST--QSSLIQTSHKLIAHAALNITLASAKATSAMMVRLSSS-SRL  99

Query  255  GPLEKRALDDCLELFSETRDELRKVLSDLATTASSSK--HYVDLQTFFSAAMTNQATCLD  82
             P E  A+ DC+E   +T +ELRK + ++   + S+   +  D+QT+ SAA+TN+ TC D
Sbjct  100  KPREVSAMRDCVEELGDTLEELRKSIGEMGQLSGSNYEVYMSDIQTWVSAALTNENTCSD  159

Query  81   GFAYSKKH--VRRIIEKRLVQISHHVSNA  1
            GF     +  V+ ++  R++ I+H  SNA
Sbjct  160  GFEGDDMNGKVKVLVRGRILVIAHLTSNA  188



>ref|XP_003521571.1| PREDICTED: 21 kDa protein-like [Glycine max]
Length=197

 Score = 80.1 bits (196),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 58/151 (38%), Positives = 81/151 (54%), Gaps = 12/151 (8%)
 Frame = -1

Query  435  EACEGTLYPELCVSTLATALPDRRAKTIPEIIA-ATVNVTVDEVKASAANCSGIRRKLPR  259
            +AC  T +  LCV TL      R A T P   A A V+V++ EVK   A  + ++R+   
Sbjct  35   DACSVTRFQSLCVQTLGHF--SRTAGTSPSKWARAGVSVSIGEVKNVEAYLAQVKRQ---  89

Query  258  LGPLEKR---ALDDCLELFSETRDELRKVLSDLATTASS--SKHYVDLQTFFSAAMTNQA  94
             G L+ R   AL DC+E F    DEL K L  L + + S  S    DL T+ SAA+T++ 
Sbjct  90   -GQLKGRNSVALSDCVETFGYAIDELHKSLGVLRSLSKSKFSTQMGDLNTWISAALTDEV  148

Query  93   TCLDGFAYSKKHVRRIIEKRLVQISHHVSNA  1
            TCLDGF  SK    ++++ R+   S+  SNA
Sbjct  149  TCLDGFEGSKGTNVKLLQNRVQNASYITSNA  179



>gb|ACN40648.1| unknown [Picea sitchensis]
Length=199

 Score = 80.1 bits (196),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 48/164 (29%), Positives = 90/164 (55%), Gaps = 12/164 (7%)
 Frame = -1

Query  459  KLLQVAHTEA---------CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEV  307
            K+L   H++A         C  TLYP++CVS+L++     + K   +++ A V V++   
Sbjct  24   KVLNPVHSDAQMAEFIRTSCNVTLYPQVCVSSLSSYAGPLKPKQ-SDLVNAAVQVSLVNT  82

Query  306  KASAANCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSS--KHYVD  133
               +   +G++ +   +   EK AL DC+E F  T D++ + L++L     ++      +
Sbjct  83   HNVSVWAAGLKTRRATMSKREKAALKDCMENFGTTMDQIHQSLAELKHLRRNTFKIQMSN  142

Query  132  LQTFFSAAMTNQATCLDGFAYSKKHVRRIIEKRLVQISHHVSNA  1
            ++T+ SAA+TN+ +CLDGF  +K  V+ ++  R+  +S  +SNA
Sbjct  143  VETWMSAALTNEDSCLDGFEVAKGRVKAMVTGRVHYLSKLISNA  186



>ref|XP_010483948.1| PREDICTED: 21 kDa protein-like isoform X1 [Camelina sativa]
 ref|XP_010483950.1| PREDICTED: 21 kDa protein-like isoform X2 [Camelina sativa]
Length=195

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 49/149 (33%), Positives = 89/149 (60%), Gaps = 9/149 (6%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPDRRAKTIPEIIA-ATVNVTVDEVKASAANCSGIRRKLPRL  256
            +C  T YP LC ++L+T       +T P+++A A +N+T+   KA++A    +R    RL
Sbjct  39   SCTFTTYPRLCFTSLSTQAS--LIQTSPKLMAHAALNITLASAKATSAMM--VRLSSSRL  94

Query  255  GPLEKRALDDCLELFSETRDELRKVLSDLATTASSSK--HYVDLQTFFSAAMTNQATCLD  82
             P E  A+ DC+E  ++T DELRK + ++   +SS+   +  D+QT+ SAA+T++ TC +
Sbjct  95   KPREAAAMRDCVEELADTLDELRKSIGEMCRLSSSNYEVYMSDMQTWVSAALTDENTCTE  154

Query  81   GFAYSKKH--VRRIIEKRLVQISHHVSNA  1
            GF   + +   + ++  +++ ++H  SNA
Sbjct  155  GFDRDEMNGKTKVLVRGKILVVAHLTSNA  183



>ref|XP_004141734.1| PREDICTED: pectinesterase 3-like [Cucumis sativus]
 gb|KGN45437.1| hypothetical protein Csa_7G447990 [Cucumis sativus]
Length=595

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 53/151 (35%), Positives = 86/151 (57%), Gaps = 11/151 (7%)
 Frame = -1

Query  429  CEGTLYPELCVSTLATALPDR-RAKTIPEIIAATVNVTVDEVKASAANCSGIRR--KLPR  259
            C  TLYP++C S ++ +     + K   ++I  ++N+TV   KA   N   +++   L  
Sbjct  75   CSSTLYPDMCYSAISRSEGAMLKVKNQKDVIEISINITV---KAVEENYFRVKKLCGLKN  131

Query  258  LGPLEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTFFSAAMTNQATC  88
            +   E+ AL DCLE   ET DEL K + DL       S ++H  DL+T  S+A+TNQ TC
Sbjct  132  ISHRERIALHDCLETIDETLDELHKAIVDLNEYPNKKSLNQHADDLKTLLSSAITNQETC  191

Query  87   LDGFAY--SKKHVRRIIEKRLVQISHHVSNA  1
            LDGF++  + K++R  +++  +++ H  SNA
Sbjct  192  LDGFSHDDADKNLRDKLKEGQMEVEHMCSNA  222



>emb|CBI27756.3| unnamed protein product [Vitis vinifera]
Length=537

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 67/210 (32%), Positives = 103/210 (49%), Gaps = 32/210 (15%)
 Frame = -1

Query  576  IVLLAFLSVTS---FNSLFTKDG----ISSSTGPTHLDLNLNIHRQKLLQVAHTEACEGT  418
            IVL  FL++ +   F S   ++G    + SST P  L          L++     AC  T
Sbjct  22   IVLGVFLTLPTLILFASFLNEEGDQELVRSSTQPQPL--------HPLIK----NACTNT  69

Query  417  LYPELCVSTLATA-LPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGPLEK  241
            LYP LC +TL++A    +   T+  I+   VN TV  V  S ++   +      L   EK
Sbjct  70   LYPSLCFTTLSSAPATSKNTTTLHHILEIAVNATVSSVMDSGSDIKALF-TYQDLNSQEK  128

Query  240  RALDDCLELFSETRDELRKVLSDL----ATTASSSKHYVDLQTFFSAAMTNQATCLDGF-  76
             AL+DC+E+  +T  EL + + DL     +     + Y +L+T  SAAMTN+ TC+DGF 
Sbjct  129  NALNDCMEMTDQTLYELGQAIDDLHAFPPSIGDPHRLYTNLKTLLSAAMTNENTCIDGFT  188

Query  75   ------AYSKKHVRRIIEKRLVQISHHVSN  4
                  + S+K ++  ++  L  IS  +SN
Sbjct  189  DLEEADSESQKGLKGHLQSVLTPISGMISN  218



>ref|XP_010444081.1| PREDICTED: 21 kDa protein-like [Camelina sativa]
Length=195

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 48/149 (32%), Positives = 89/149 (60%), Gaps = 9/149 (6%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPDRRAKTIPEIIA-ATVNVTVDEVKASAANCSGIRRKLPRL  256
            +C  T YP LC ++L+T       +T P+++A A +N+T+   KA++A    +R    RL
Sbjct  39   SCTFTTYPRLCFTSLSTQAS--LIQTSPKLMAHAALNITLASAKATSAMM--VRLSSSRL  94

Query  255  GPLEKRALDDCLELFSETRDELRKVLSDLA--TTASSSKHYVDLQTFFSAAMTNQATCLD  82
             P E  A+ DC+E  ++T DELRK + ++   +T++   +  D+QT+ SAA+T++ TC +
Sbjct  95   NPREAAAMRDCVEELADTLDELRKSIGEMCRLSTSNYEVYMSDMQTWVSAALTDENTCTE  154

Query  81   GFAYSKKH--VRRIIEKRLVQISHHVSNA  1
            GF   + +   + ++  +++ ++H  SNA
Sbjct  155  GFDRDEMNGKTKVLVRGKILVVAHLTSNA  183



>ref|XP_004172115.1| PREDICTED: pectinesterase 3-like, partial [Cucumis sativus]
Length=592

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 53/151 (35%), Positives = 86/151 (57%), Gaps = 11/151 (7%)
 Frame = -1

Query  429  CEGTLYPELCVSTLATALPDR-RAKTIPEIIAATVNVTVDEVKASAANCSGIRR--KLPR  259
            C  TLYP++C S ++ +     + K   ++I  ++N+TV   KA   N   +++   L  
Sbjct  72   CSSTLYPDMCYSAISRSEGAMLKVKNQKDVIEISINITV---KAVEENYFRVKKLCGLKN  128

Query  258  LGPLEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTFFSAAMTNQATC  88
            +   E+ AL DCLE   ET DEL K + DL       S ++H  DL+T  S+A+TNQ TC
Sbjct  129  ISHRERIALHDCLETIDETLDELHKAIVDLNEYPNKKSLNQHADDLKTLLSSAITNQETC  188

Query  87   LDGFAY--SKKHVRRIIEKRLVQISHHVSNA  1
            LDGF++  + K++R  +++  +++ H  SNA
Sbjct  189  LDGFSHDDADKNLRDKLKEGQMEVEHMCSNA  219



>ref|XP_006281048.1| hypothetical protein CARUB_v10027064mg [Capsella rubella]
 gb|EOA13946.1| hypothetical protein CARUB_v10027064mg [Capsella rubella]
Length=228

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 51/149 (34%), Positives = 87/149 (58%), Gaps = 9/149 (6%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPDRRAKTIPEIIA-ATVNVTVDEVKASAANCSGIRRKLPRL  256
            +C  T YP LC ++LAT       +T P+++A A +N+T+   KA++A    +R    RL
Sbjct  72   SCTFTTYPRLCFTSLAT--QASLIQTSPKLMAHAALNITLASAKATSAMM--VRLSNTRL  127

Query  255  GPLEKRALDDCLELFSETRDELRKVLSDLATTASSSK--HYVDLQTFFSAAMTNQATCLD  82
             P E  A+ DC+E   +T DELRK + ++   ++S+   +  D+QT+ SAA+T++ TC +
Sbjct  128  KPREVAAMRDCVEELGDTLDELRKSIGEMCRLSNSNYEVYMSDIQTWVSAALTDENTCTE  187

Query  81   GFAYSKKH--VRRIIEKRLVQISHHVSNA  1
            GF     +   + ++  R++ I+H  SNA
Sbjct  188  GFEGDDMNGKAKVLVRGRILVIAHLTSNA  216



>emb|CDX87244.1| BnaC09g05590D [Brassica napus]
Length=199

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 51/149 (34%), Positives = 85/149 (57%), Gaps = 8/149 (5%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPDRRAKTIPEIIA-ATVNVTVDEVKASAANCSGIRRKLPRL  256
            +C  T YP LCV++L+T       +T P+++A A +N+T+   KA++     +     +L
Sbjct  42   SCTVTTYPRLCVASLST--HASLIQTSPKLMAHAALNITLASAKATSVMMVRLSSS-SQL  98

Query  255  GPLEKRALDDCLELFSETRDELRKVLSDLATTASSSK--HYVDLQTFFSAAMTNQATCLD  82
             P E  A+ DC+E   +T DELRK + ++     SS   +  D+QT+ SAA+T++ TC D
Sbjct  99   KPREVSAMRDCVEELGDTLDELRKSIGEMGQLIGSSYEVYMSDIQTWVSAALTDENTCTD  158

Query  81   GFAYSKKH--VRRIIEKRLVQISHHVSNA  1
            GF     +  V+  + +R++ I+H  SNA
Sbjct  159  GFEGDDMNGKVKVFVRERILVIAHLTSNA  187



>ref|XP_007039951.1| Plant invertase/pectin methylesterase inhibitor superfamily protein, 
putative [Theobroma cacao]
 gb|EOY24452.1| Plant invertase/pectin methylesterase inhibitor superfamily protein, 
putative [Theobroma cacao]
Length=204

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 61/199 (31%), Positives = 104/199 (52%), Gaps = 29/199 (15%)
 Frame = -1

Query  573  VLLAFLSVTSFNSLFTKDGISSSTGPTHLDLNLNIHRQKLLQVAHTEACEGTLYPELCVS  394
            +LL  L  T++ +L      SS+  P H   N+   +          +C  T YP LC  
Sbjct  12   ILLIILQFTTYTAL------SSADTPFHSQRNIEYIK---------SSCSTTTYPRLCYR  56

Query  393  TLATALPDRRAKTIPEIIAAT-VNVTVDEVKASAANCSGIRRKLPRLGPLEKR---ALDD  226
            +L+  +   +  T P ++  T +NVT+   K++    S +  K+ R+  L  R   A+ D
Sbjct  57   SLS--IYASKINTSPRLLVHTALNVTLKASKST----SRLMIKISRIHGLRPRVAAAMAD  110

Query  225  CLELFSETRDELRKVLSDLATTASS--SKHYVDLQTFFSAAMTNQATCLDGFAYS--KKH  58
            C+E+  ++ DEL++ + +L    SS  S    D+QT+ SAA+T++ TC+DGFA      +
Sbjct  111  CIEVMGDSVDELQQSIGELGHIRSSNFSLTMSDIQTWVSAALTDEDTCMDGFAGKAMNGY  170

Query  57   VRRIIEKRLVQISHHVSNA  1
             + ++ KR+V+I+H  SNA
Sbjct  171  AKTMVRKRIVKIAHLTSNA  189



>ref|XP_002277473.1| PREDICTED: pectinesterase [Vitis vinifera]
Length=582

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 67/210 (32%), Positives = 103/210 (49%), Gaps = 32/210 (15%)
 Frame = -1

Query  576  IVLLAFLSVTS---FNSLFTKDG----ISSSTGPTHLDLNLNIHRQKLLQVAHTEACEGT  418
            IVL  FL++ +   F S   ++G    + SST P  L          L++     AC  T
Sbjct  25   IVLGVFLTLPTLILFASFLNEEGDQELVRSSTQPQPL--------HPLIK----NACTNT  72

Query  417  LYPELCVSTLATA-LPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGPLEK  241
            LYP LC +TL++A    +   T+  I+   VN TV  V  S ++   +      L   EK
Sbjct  73   LYPSLCFTTLSSAPATSKNTTTLHHILEIAVNATVSSVMDSGSDIKALF-TYQDLNSQEK  131

Query  240  RALDDCLELFSETRDELRKVLSDL----ATTASSSKHYVDLQTFFSAAMTNQATCLDGF-  76
             AL+DC+E+  +T  EL + + DL     +     + Y +L+T  SAAMTN+ TC+DGF 
Sbjct  132  NALNDCMEMTDQTLYELGQAIDDLHAFPPSIGDPHRLYTNLKTLLSAAMTNENTCIDGFT  191

Query  75   ------AYSKKHVRRIIEKRLVQISHHVSN  4
                  + S+K ++  ++  L  IS  +SN
Sbjct  192  DLEEADSESQKGLKGHLQSVLTPISGMISN  221



>ref|XP_002864788.1| invertase/pectin methylesterase inhibitor family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH41047.1| invertase/pectin methylesterase inhibitor family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=196

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 52/149 (35%), Positives = 86/149 (58%), Gaps = 9/149 (6%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPDRRAKTIPEIIA-ATVNVTVDEVKASAANCSGIRRKLPRL  256
            +C  T YP LC S+L+T       +T P+I+A A +N+T+   KA++A    +R    RL
Sbjct  40   SCTFTTYPRLCFSSLST--HASLIQTSPKIMAHAALNITLASAKATSAMM--VRLSNSRL  95

Query  255  GPLEKRALDDCLELFSETRDELRKVLSDLATTASSSK--HYVDLQTFFSAAMTNQATCLD  82
             P E  A+ DC+E   +T +ELRK + ++   + S+   +  D+QT+ SAA+T+  TC +
Sbjct  96   KPREISAMRDCVEELGDTLEELRKSIGEMCRLSGSNYEVYMSDIQTWVSAALTDVNTCTE  155

Query  81   GFAYSKKH--VRRIIEKRLVQISHHVSNA  1
            GF     +  V+ ++  R++ I+H  SNA
Sbjct  156  GFEGDDMNGKVKVLVRGRILVIAHLTSNA  184



>ref|XP_008462453.1| PREDICTED: pectinesterase-like [Cucumis melo]
Length=598

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 54/151 (36%), Positives = 85/151 (56%), Gaps = 11/151 (7%)
 Frame = -1

Query  429  CEGTLYPELCVSTLATALPDR-RAKTIPEIIAATVNVTVDEVKASAANCSGIRR--KLPR  259
            C  TLYP++C S ++ +     + K+  ++I  ++N+TV   KA   N   +++   L  
Sbjct  78   CSSTLYPDMCYSAISKSEGAMLKVKSQKDVIEVSINITV---KAVEENYFRVKKLCGLKN  134

Query  258  LGPLEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTFFSAAMTNQATC  88
            +   EK AL DCLE   ET DEL K + DL       S ++H  DL+T  S+A+TNQ TC
Sbjct  135  ISHREKIALHDCLETIDETLDELHKAIVDLNEYPNKKSLNQHADDLKTLLSSAITNQETC  194

Query  87   LDGFAY--SKKHVRRIIEKRLVQISHHVSNA  1
            LDGF++  + K +R  ++   +++ H  SNA
Sbjct  195  LDGFSHDNADKTLRDKLKAGQMEVEHMCSNA  225



>ref|XP_008340373.1| PREDICTED: pectinesterase 3-like [Malus domestica]
Length=573

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/152 (36%), Positives = 83/152 (55%), Gaps = 9/152 (6%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPD--RRAKTIPEIIAATVNVTVDEVKASAANCSGI-RRKLP  262
            +C  TLYPELC STLA   P+  ++  +  + I  ++N+T   V+ +      + + +  
Sbjct  70   SCSSTLYPELCFSTLALH-PEAAKKVSSQKDXIELSLNITTKAVQHNFFTVEKLLKSRKN  128

Query  261  RLGPLEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDLQTFFSAAMTNQAT  91
            +L   EK AL DCLE   ET DEL   + DL       + ++H  DL+T  S+A+TNQ T
Sbjct  129  KLTKREKGALHDCLETIDETLDELHDAVEDLHEYPNKKTLTQHADDLKTLISSAITNQET  188

Query  90   CLDGFAY--SKKHVRRIIEKRLVQISHHVSNA  1
            CLDGF++  + K VR++     V +    SNA
Sbjct  189  CLDGFSHDDADKKVRKVFLAGQVHVEKLCSNA  220



>gb|KFK27963.1| hypothetical protein AALP_AA8G454300 [Arabis alpina]
Length=199

 Score = 78.6 bits (192),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 51/149 (34%), Positives = 88/149 (59%), Gaps = 8/149 (5%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPDRRAKTIPEIIA-ATVNVTVDEVKASAANCSGIRRKLPRL  256
            AC  T YP LC+++L+T       +T P+++A A +N+T+   KA++A    +   + +L
Sbjct  42   ACTYTTYPRLCIASLST--HATLIQTSPKLMAHAALNITLASAKATSAMMVRLSSNV-QL  98

Query  255  GPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKH-YV-DLQTFFSAAMTNQATCLD  82
             P E  A+ DC+E   +T +ELRK + ++    SS+   Y+ D+QT+ SAA+T++ TC D
Sbjct  99   KPREVSAMRDCVEELGDTVEELRKSIGEMGQLNSSNYEVYISDIQTWVSAALTDENTCTD  158

Query  81   GFAYSKKH--VRRIIEKRLVQISHHVSNA  1
            GF   + +   +  +  R++ I+H  SNA
Sbjct  159  GFQGDEMNGKAKVFVRGRILFIAHLTSNA  187



>gb|KDP22409.1| hypothetical protein JCGZ_26240 [Jatropha curcas]
Length=203

 Score = 78.6 bits (192),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 48/149 (32%), Positives = 88/149 (59%), Gaps = 8/149 (5%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPDRRAKTIPEIIA-ATVNVTVDEVKASAANCSGIRRKLPRL  256
            +C  T YP+LC ++L+  +     +T P+++A A +NVT+   K+++A  S + +    +
Sbjct  46   SCSTTTYPKLCYTSLS--VHANTIQTSPKLLANAALNVTLGSAKSTSAMMSKLSQS-HGM  102

Query  255  GPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYV--DLQTFFSAAMTNQATCLD  82
             P+E  A+ DC+E  S+T + LRK + ++ T   S    +  D+QT+ SAA+T++ TC D
Sbjct  103  KPIEVEAMQDCVEELSDTVEGLRKSIGEMKTYKESDFKLMINDVQTWVSAALTDENTCSD  162

Query  81   GFAYS--KKHVRRIIEKRLVQISHHVSNA  1
            GFA      + + ++ + ++ I+H  SNA
Sbjct  163  GFAGKTMNGNTKTLVREMILNIAHLTSNA  191



>ref|XP_004307822.1| PREDICTED: 21 kDa protein-like [Fragaria vesca subsp. vesca]
Length=203

 Score = 78.2 bits (191),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 48/152 (32%), Positives = 94/152 (62%), Gaps = 14/152 (9%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPDRRAKTI---PEIIA-ATVNVTVDEVKASAANCSGIRRKL  265
            +C  T YP+LC+++L++     +A  I   P++IA A +NVT+   K+++A    +    
Sbjct  46   SCGATTYPKLCLASLSS-----QASVIQRSPKLIACAALNVTLSSAKSTSAMMLRLSHGY  100

Query  264  PRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYV--DLQTFFSAAMTNQAT  91
              + P E  A+ DC+E+ S++ DE+++ +S++    S+    +  D+QT+ SAA+T+++T
Sbjct  101  G-MKPREAAAMRDCVEMVSDSVDEIQRSISEMVNFRSAGFEMMISDVQTWVSAALTDEST  159

Query  90   CLDGFAYSK--KHVRRIIEKRLVQISHHVSNA  1
            C DGFA ++   +++ ++  R+V+I+   SNA
Sbjct  160  CSDGFAGNELNGNLKTVVRGRIVKIAQLTSNA  191



>ref|XP_010264195.1| PREDICTED: 21 kDa protein-like [Nelumbo nucifera]
Length=210

 Score = 78.6 bits (192),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 48/153 (31%), Positives = 93/153 (61%), Gaps = 14/153 (9%)
 Frame = -1

Query  432  ACEGTLYPELCVSTL---ATALPDRRAKTIPEIIAAT-VNVTVDEVKASAANCSGIRR-K  268
            +C  T+YP+LC STL   A+A+     +T P+++A T ++V++   ++S+A  S + + +
Sbjct  51   SCGTTMYPKLCFSTLSGYASAI-----QTDPKLLADTALSVSLTNARSSSAMISELSKSQ  105

Query  267  LPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHY--VDLQTFFSAAMTNQA  94
            L  + P E  A+ DC+E+  ++ DEL+K +++++        +   ++QT+ SAA+TN+ 
Sbjct  106  LATMKPREAAAMRDCVEMVGDSVDELQKSMAEMSHLGGPDLGFQISNIQTWVSAALTNED  165

Query  93   TCLDGFAYS--KKHVRRIIEKRLVQISHHVSNA  1
            TC+DGFA      +++  I  R++ ++   SNA
Sbjct  166  TCMDGFAGKAMDSNIKTSIRGRILNLAQLTSNA  198



>ref|XP_008238630.1| PREDICTED: 21 kDa protein [Prunus mume]
Length=200

 Score = 78.2 bits (191),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 51/153 (33%), Positives = 85/153 (56%), Gaps = 15/153 (10%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAAT-VNVTVDEVKASAANCSGIRRKLPR-  259
            +C  T+YP LC  +L+  +   + KT P+++A T +NVT+    A+    S I R+L   
Sbjct  39   SCSVTIYPRLCYHSLS--IYAGKIKTDPKVLAHTALNVTL----AATQESSVIMRRLSEI  92

Query  258  --LGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYV---DLQTFFSAAMTNQA  94
              L P+E  A+ DC+E   +  DEL++ L +L      S  +    D+QT+ SAA+T++ 
Sbjct  93   HGLKPIETAAVHDCMEEIGDAIDELQQSLDELGHVLRGSNFWFQMSDIQTWVSAALTDED  152

Query  93   TCLDGFA--YSKKHVRRIIEKRLVQISHHVSNA  1
            TC+DGF   + +  V  ++ +  V ++H  SNA
Sbjct  153  TCMDGFEEHHLRGRVEAVVRRYTVNVAHLTSNA  185



>ref|XP_004958677.1| PREDICTED: pectinesterase 3-like [Setaria italica]
Length=598

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 56/148 (38%), Positives = 84/148 (57%), Gaps = 6/148 (4%)
 Frame = -1

Query  429  CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGP  250
            C GTL+ E+C STLA+ +P+   K + ++I+  V      V+AS++NCS   R+   L  
Sbjct  90   CAGTLHREVCASTLAS-IPNLARKPLRDVISDVVARAAAAVRASSSNCSSYLRRPRGLRV  148

Query  249  LEKRALDDCLELFSETRDELRKVLSDL-ATTASSSKHYVDLQTFFSAAMTNQATCLDGF-  76
             ++ AL DCLELF  T  +L     +L A   ++ +    +QT  SAA+TNQ TCL+GF 
Sbjct  149  RDRLALSDCLELFGRTLGQLGTAADELSAGNRTAEESIAGVQTVLSAALTNQYTCLEGFA  208

Query  75   ---AYSKKHVRRIIEKRLVQISHHVSNA  1
               A     VR  I+ R+  ++H VSN+
Sbjct  209  GPSASEDGRVRPYIQGRIYHVAHLVSNS  236



>ref|NP_201042.2| plant invertase/pectin methylesterase inhibitor superfamily protein 
[Arabidopsis thaliana]
 dbj|BAA97200.1| ripening-related protein-like; contains similarity to pectinesterase 
[Arabidopsis thaliana]
 gb|AAO41999.1| putative DC1.2 homolog [Arabidopsis thaliana]
 gb|AED97600.1| plant invertase/pectin methylesterase inhibitor superfamily protein 
[Arabidopsis thaliana]
Length=203

 Score = 77.8 bits (190),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 52/149 (35%), Positives = 85/149 (57%), Gaps = 9/149 (6%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPDRRAKTIPEIIA-ATVNVTVDEVKASAANCSGIRRKLPRL  256
            +C  T YP LC S+L+T       +T P+++A A +N+T+   K ++A    +R    RL
Sbjct  47   SCTFTTYPRLCFSSLST--HASLIQTSPKLMAHAALNITLASAKVTSAMM--VRLSNSRL  102

Query  255  GPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKH-YV-DLQTFFSAAMTNQATCLD  82
             P E  A+ DC+E   +T +ELRK + ++   + S+   Y+ D+QT+ SAA+T+  TC D
Sbjct  103  KPKEVSAMRDCVEELGDTLEELRKSIGEMCQLSGSNYEVYISDIQTWVSAALTDVNTCTD  162

Query  81   GFAYS--KKHVRRIIEKRLVQISHHVSNA  1
            GF        V+ ++  R++ I+H  SNA
Sbjct  163  GFEGEDMDGKVKVLVRGRILVIAHLTSNA  191



>gb|AAN60276.1| unknown [Arabidopsis thaliana]
Length=204

 Score = 77.8 bits (190),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 52/149 (35%), Positives = 85/149 (57%), Gaps = 9/149 (6%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPDRRAKTIPEIIA-ATVNVTVDEVKASAANCSGIRRKLPRL  256
            +C  T YP LC S+L+T       +T P+++A A +N+T+   K ++A    +R    RL
Sbjct  48   SCTFTTYPRLCFSSLST--HASLIQTSPKLMAHAALNITLASAKVTSAMM--VRLSNSRL  103

Query  255  GPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKH-YV-DLQTFFSAAMTNQATCLD  82
             P E  A+ DC+E   +T +ELRK + ++   + S+   Y+ D+QT+ SAA+T+  TC D
Sbjct  104  KPKEVSAMRDCVEELGDTLEELRKSIGEMCQLSGSNYEVYISDIQTWVSAALTDVNTCTD  163

Query  81   GFAYS--KKHVRRIIEKRLVQISHHVSNA  1
            GF        V+ ++  R++ I+H  SNA
Sbjct  164  GFEGEDMDGKVKVLVRGRILVIAHLTSNA  192



>gb|KDP33984.1| hypothetical protein JCGZ_07555 [Jatropha curcas]
Length=583

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 52/148 (35%), Positives = 80/148 (54%), Gaps = 13/148 (9%)
 Frame = -1

Query  450  QVAHT---EACEGTLYPELCVSTLATALPD---RRAKTIPEIIAATVNVTVDEVKASAAN  289
            Q AH     +C  TLYP+LC ST++T LP+    + +   ++I  ++NVT + V  +   
Sbjct  56   QAAHAIIKSSCSATLYPDLCFSTIST-LPNAAISKVRNTRDVIGLSLNVTKESVTKAYLK  114

Query  288  CSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSK----HYVDLQTF  121
             + I   L +L P EK A  DC EL ++T  ++ KV   L +  S  K    H  + +  
Sbjct  115  INRISSGLKKLTPREKIAFGDCFELLNQTIVQINKVARKLHSYPSLKKSIAEHAEEFKIL  174

Query  120  FSAAMTNQATCLDGFAYSK--KHVRRII  43
             SAA+TNQ TC+DGF+  +  K VR++ 
Sbjct  175  LSAALTNQETCIDGFSSYEVDKKVRQLF  202



>ref|XP_004245727.1| PREDICTED: 21 kDa protein-like [Solanum lycopersicum]
Length=206

 Score = 77.8 bits (190),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 46/152 (30%), Positives = 89/152 (59%), Gaps = 10/152 (7%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLG  253
            +C+ TLYP LCV  L +A  +   ++  ++  A ++V++ + K++    S + R +  L 
Sbjct  42   SCKATLYPVLCVQCL-SAFANTVKQSEKQLAHAALSVSLSKAKSTIIFVSKLNR-MRGLK  99

Query  252  PLEKRALDDCLELFSETRDELRKVLSDLATTASSSK------HYVDLQTFFSAAMTNQAT  91
            P+EK+A+ DC++  S++ D++ K + +L  T   S       H  ++QT+ SAA+T+++T
Sbjct  100  PIEKQAVKDCMDTMSDSVDQINKSIPELGHTGQFSSGQDFMWHVSNVQTWVSAALTDEST  159

Query  90   CLDGFAYS--KKHVRRIIEKRLVQISHHVSNA  1
            CLDGF+      +V+  +  R++ ++   SNA
Sbjct  160  CLDGFSGPGVNVNVKAALRLRILHVAQVTSNA  191



>ref|XP_010096537.1| Pectinesterase 3 [Morus notabilis]
 gb|EXB64657.1| Pectinesterase 3 [Morus notabilis]
Length=362

 Score = 79.7 bits (195),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 75/137 (55%), Gaps = 13/137 (9%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPD---RRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLP  262
            AC  T YP+LC S +A +      ++   + ++I  +VN+T+  V+    N   I++   
Sbjct  68   ACSSTRYPDLCYSAVAASASSGGSKKVSNLKDVIGLSVNITITAVQE---NYFSIKKLTK  124

Query  261  RLG--PLEKRALDDCLELFSETRDELRKVLSDLA---TTASSSKHYVDLQTFFSAAMTNQ  97
            R G    EK AL DCLE   ET DEL +V  DL     T S  +H  D  T  S+A+TNQ
Sbjct  125  RKGLTKREKTALHDCLETIDETLDELHEVQDDLEQYPNTKSLKQHADDFLTLLSSAITNQ  184

Query  96   ATCLDGFAYSK--KHVR  52
             TCLDGF++ K  +HVR
Sbjct  185  ETCLDGFSHDKADEHVR  201



>ref|XP_010261668.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=576

 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 56/147 (38%), Positives = 77/147 (52%), Gaps = 10/147 (7%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPD--RRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPR  259
            +C  TLYP+LC S +AT +P       T  +II  ++N+T   V+ +      I      
Sbjct  66   SCRSTLYPDLCYSAIAT-VPGAMDNLSTQKDIIEMSLNITTTAVEHNYFTIEKIIGS-KN  123

Query  258  LGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSK----HYVDLQTFFSAAMTNQAT  91
            L   EK AL DCLE+  ET DEL K   DL    SS K    H  DL+   SAAMTNQ +
Sbjct  124  LTKREKTALHDCLEMVDETLDELHKTADDLKDYPSSKKSIFQHADDLKILVSAAMTNQES  183

Query  90   CLDGFAYSKKHVRRIIEKRLVQISHHV  10
            C+DGF++   +  + + K+L+    HV
Sbjct  184  CIDGFSHD--NADKDVRKKLLAGQEHV  208



>ref|XP_008451545.1| PREDICTED: pectinesterase-like [Cucumis melo]
Length=595

 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 56/142 (39%), Positives = 83/142 (58%), Gaps = 2/142 (1%)
 Frame = -1

Query  429  CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLP-RLG  253
            C GTL+P LC S L++  P   + +  ++  + +N T  EV  + ANC+ ++  L   L 
Sbjct  87   CNGTLFPNLCFSKLSS-FPQLASLSPEKLAGSALNFTTREVLLAYANCTNLKTHLYCGLN  145

Query  252  PLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDLQTFFSAAMTNQATCLDGFA  73
            P ++ ALDDCLEL  ++  EL+  + DL  + S+++H  DL T  SAAMTN  TC+DGF 
Sbjct  146  PTDRHALDDCLELLDDSIAELKASILDLGPSQSAARHSHDLLTLVSAAMTNHRTCVDGFY  205

Query  72   YSKKHVRRIIEKRLVQISHHVS  7
             S   VR  +E  L +I  H+S
Sbjct  206  NSSGTVRSRVELYLGKIGQHLS  227



>gb|KHN32444.1| 21 kDa protein [Glycine soja]
Length=202

 Score = 77.4 bits (189),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 86/152 (57%), Gaps = 14/152 (9%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPDRRAKTIPE----IIAATVNVTVDEVKASAANCSGIRRKL  265
            +C  T YP LC S+L      + A  I      +  A +NVT+  VK+++A  S + +K 
Sbjct  47   SCSSTTYPRLCYSSLV-----KHADLIQTNRVVLTGAALNVTLASVKSTSAMMSTLAKK-  100

Query  264  PRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYV--DLQTFFSAAMTNQAT  91
              L P E  A+ DC+E  S+T DELR+ +++++   +S+   +  D+QT+ SAA+T++ T
Sbjct  101  QGLKPREVAAMQDCVEQLSDTVDELRRSIAEMSDLRASNFEMIMSDVQTWVSAALTDETT  160

Query  90   CLDGFA--YSKKHVRRIIEKRLVQISHHVSNA  1
            C DGF    +   ++  + + ++Q++   SNA
Sbjct  161  CNDGFQEITAATDIKSTVRRLVIQVAQLTSNA  192



>gb|AAC05147.1| 21 kD protein precursor [Pinus radiata]
Length=211

 Score = 77.8 bits (190),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 77/131 (59%), Gaps = 3/131 (2%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLG  253
            +C+ + YP+LCVS+L+      +  T+ +++ A +NV++   +  +   +G++ +   + 
Sbjct  41   SCQVSRYPQLCVSSLSPYAGSLK-PTLCDLVKAAMNVSLVNARTVSVWAAGLKGRSAEMS  99

Query  252  PLEKRALDDCLELFSETRDELRKVLSDLATTASS--SKHYVDLQTFFSAAMTNQATCLDG  79
              E+ AL+DC++ F +T DE++K L +L     S  +    D+QTF SAA+T+Q +CL+G
Sbjct  100  ERERAALNDCIQNFDDTVDEIQKSLKELEQLQRSNFNPQMNDMQTFMSAALTDQGSCLNG  159

Query  78   FAYSKKHVRRI  46
            F   K    +I
Sbjct  160  FEDVKAAAGKI  170



>ref|XP_010420924.1| PREDICTED: 21 kDa protein-like [Camelina sativa]
Length=206

 Score = 77.4 bits (189),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 46/151 (30%), Positives = 81/151 (54%), Gaps = 8/151 (5%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLG  253
            +CE   YP LCV TL++  P        ++  A V +++   +++A   + +R  + +  
Sbjct  38   SCEHASYPSLCVRTLSS-YPGPTITNSRDLAQAAVKISLSHAQSAAKKLAAVRDSVGKKK  96

Query  252  PLEKRALDDCLELFSETRDELRK---VLSDLATTASSSKHY----VDLQTFFSAAMTNQA  94
             LEK AL DC+E+  ++ DEL +   VL  L  T  S+K +     + QT+ SAA+T+  
Sbjct  97   KLEKGALVDCVEMIGDSVDELSRTLGVLKHLRVTGGSAKEFRWQMSNAQTWASAALTDDD  156

Query  93   TCLDGFAYSKKHVRRIIEKRLVQISHHVSNA  1
            TCLDGF      ++  +++ + +++   SNA
Sbjct  157  TCLDGFQGIDGEIKTEVKQWMTKVARVTSNA  187



>ref|XP_009112019.1| PREDICTED: 21 kDa protein-like [Brassica rapa]
 emb|CDY16779.1| BnaA09g06030D [Brassica napus]
Length=199

 Score = 77.4 bits (189),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 50/149 (34%), Positives = 85/149 (57%), Gaps = 8/149 (5%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPDRRAKTIPEIIA-ATVNVTVDEVKASAANCSGIRRKLPRL  256
            +C  T YP LCV++L+T       +T P+++A A +N+T+   KA++     +     +L
Sbjct  42   SCTVTTYPRLCVASLST--HASLIQTSPKLMAHAALNITLASAKATSVMMVRLSSS-SQL  98

Query  255  GPLEKRALDDCLELFSETRDELRKVLSDLATTASSSK--HYVDLQTFFSAAMTNQATCLD  82
             P E  A+  C+E   +T DELRK + ++   + SS   +  D+QT+ SAA+T++ TC D
Sbjct  99   KPREVSAMRVCVEELGDTLDELRKSIGEMGQLSGSSYEVYMSDIQTWVSAALTDENTCTD  158

Query  81   GFAYSKKH--VRRIIEKRLVQISHHVSNA  1
            GF     +  V+  + +R++ I+H  SNA
Sbjct  159  GFGGDDMNGKVKIFVRERILVIAHLTSNA  187



>ref|XP_010546336.1| PREDICTED: 21 kDa protein-like [Tarenaya hassleriana]
Length=213

 Score = 77.4 bits (189),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 55/153 (36%), Positives = 84/153 (55%), Gaps = 13/153 (8%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLA--TALPDRRAKTIPEIIAAT-VNVTVDEVKASAANCSGI-RRKL  265
            +C  TLY  LC S L    +L D      PE +A T +N+T+ E K++      I RR+ 
Sbjct  51   SCNATLYQTLCYSCLYPYASLIDSD----PEKLAITALNLTLSETKSTQRLVKFISRRRH  106

Query  264  PRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYV--DLQTFFSAAMTNQAT  91
              LGP E  A+ DCLE  S++  EL+  ++++     SS   V  D+QT+ SAA+T+Q T
Sbjct  107  ASLGPGEAAAVKDCLEEMSDSVYELKDSIAEMKAINYSSFEMVVSDVQTWVSAALTDQVT  166

Query  90   CLDGF---AYSKKHVRRIIEKRLVQISHHVSNA  1
            C+DGF      K  V+ ++ K + +++   SNA
Sbjct  167  CMDGFEEAGGGKTEVKELVRKHIDRVTRMTSNA  199



>gb|KJB25638.1| hypothetical protein B456_004G201600 [Gossypium raimondii]
Length=206

 Score = 77.0 bits (188),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 50/152 (33%), Positives = 87/152 (57%), Gaps = 14/152 (9%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAAT-VNVTVDEVKASA---ANCSGIRRKL  265
            +C  T YP LC  +L+  +   + KT P ++  T +NVT+   K+++      S I    
Sbjct  46   SCSSTTYPRLCYRSLS--IYANKIKTSPRLLVDTALNVTLKASKSTSRLMVKISTIHGLR  103

Query  264  PRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYV--DLQTFFSAAMTNQAT  91
            PR+      A+ DC+E+  ++ DEL++ + +L   + S+      D+QT+ SAA+T++ T
Sbjct  104  PRVAA----AMADCIEVIGDSVDELQQSIEELGHISRSNFALTMSDIQTWVSAALTDEDT  159

Query  90   CLDGFAYS--KKHVRRIIEKRLVQISHHVSNA  1
            C+DGFA      +V+ ++ KR+V+I+H  SNA
Sbjct  160  CMDGFAGKSMNGNVKTMVRKRIVKIAHLTSNA  191



>gb|ABK96280.1| unknown [Populus trichocarpa x Populus deltoides]
Length=194

 Score = 77.0 bits (188),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 50/149 (34%), Positives = 86/149 (58%), Gaps = 8/149 (5%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPDRRAKTIPEIIA-ATVNVTVDEVKASAANCSGIRRKLPRL  256
            +C  T YP LC ++L+  +  R   T P++IA A +NVT+   K+++   S + +    L
Sbjct  38   SCSTTTYPRLCYTSLS--IHSRTIHTSPKLIANAALNVTLSSAKSTSTMMSKLSQS-HGL  94

Query  255  GPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYV--DLQTFFSAAMTNQATCLD  82
             P E  A+ DC+E  S+   ELR+ + ++     S+   +  D++T+ SAAMT+++TC D
Sbjct  95   KPKEVSAMKDCVEELSDAVYELRESIDEMGHAKQSNFEVMISDVRTWVSAAMTDESTCSD  154

Query  81   GFAYS--KKHVRRIIEKRLVQISHHVSNA  1
            GFA +    +++R I  R++ I+   SNA
Sbjct  155  GFAGNAMNGNLKRAIRGRIMNIAQLTSNA  183



>emb|CDY00279.1| BnaA06g21800D [Brassica napus]
Length=198

 Score = 77.0 bits (188),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 50/148 (34%), Positives = 86/148 (58%), Gaps = 8/148 (5%)
 Frame = -1

Query  429  CEGTLYPELCVSTLATALPDRRAKTIPEIIA-ATVNVTVDEVKASAANCSGIRRKLPRLG  253
            C  T YP LCV++L+T       +T  +++A A +N+T+   KA++A    +     RL 
Sbjct  42   CTFTTYPRLCVTSLST--QSSLIQTSHKLMAHAALNITLASAKATSAMMVRVSSS-SRLK  98

Query  252  PLEKRALDDCLELFSETRDELRKVLSDLATTASSSK--HYVDLQTFFSAAMTNQATCLDG  79
            P E  A+ DC+E   +T +ELRK + ++   + S+   +  D+QT+ SAA+T++ TC DG
Sbjct  99   PREVSAMRDCVEELGDTLEELRKSIGEMGQLSGSNYEVYMNDIQTWVSAALTDEYTCSDG  158

Query  78   FAYSKKH--VRRIIEKRLVQISHHVSNA  1
            F   + +  V+ ++  R++ I+H  SNA
Sbjct  159  FEGDEMNGKVKVLVRGRILIIAHLTSNA  186



>ref|XP_008800482.1| PREDICTED: pectinesterase-like isoform X1 [Phoenix dactylifera]
Length=585

 Score = 80.1 bits (196),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 50/150 (33%), Positives = 81/150 (54%), Gaps = 6/150 (4%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPDRRAKTIP-EIIAATVNVTVDEVKASAANCSGIRRKLPRL  256
            +C    YP+LC S +A      +  + P ++I A++N+T+  ++ S  +   +      L
Sbjct  65   SCLSARYPDLCYSAVAANPALVQTISKPKDVIHASINLTITAIQRSFRHVERLSASHANL  124

Query  255  GPLEKRALDDCLELFSETRDELRKVLSDLATTASSS---KHYVDLQTFFSAAMTNQATCL  85
               E+ AL DCLE+F E+ DELR   +DL    +     +H +DL+   SA+MTNQ +C 
Sbjct  125  TTRERTALHDCLEMFDESLDELRLTDADLRAYPAGKPLRRHALDLEILVSASMTNQESCS  184

Query  84   DGFAYS--KKHVRRIIEKRLVQISHHVSNA  1
            DGF+Y   ++ +RR I   L  ++H   NA
Sbjct  185  DGFSYEDVERRLRREILSGLTHVTHMCRNA  214



>ref|XP_011076332.1| PREDICTED: 21 kDa protein [Sesamum indicum]
Length=201

 Score = 77.0 bits (188),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 48/152 (32%), Positives = 87/152 (57%), Gaps = 14/152 (9%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPDRRAKTI---PEIIA-ATVNVTVDEVKASAANCSGIRRKL  265
            +C  T YP LC S LA+      A TI   P+++A A ++V++D  ++++ +   + R  
Sbjct  44   SCSATTYPRLCYSALAS-----HASTIQQDPKLLAHAALSVSLDTARSTSVDMVKLSRST  98

Query  264  PRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYV--DLQTFFSAAMTNQAT  91
              + P +  A+ DC+E  S++ ++LRK + ++     S+   +  D+QT+ SAA+T+  T
Sbjct  99   G-MTPRQVGAMRDCVEELSDSVEQLRKSVEEMNLMKGSNFGMMMSDIQTWVSAALTDDDT  157

Query  90   CLDGFA--YSKKHVRRIIEKRLVQISHHVSNA  1
            C+DGFA  +    V+  +  R+V ++H  SNA
Sbjct  158  CMDGFAGKFMNGAVKTAVRGRIVNVAHMTSNA  189



>ref|XP_010519346.1| PREDICTED: 21 kDa protein-like [Tarenaya hassleriana]
 ref|XP_010521000.1| PREDICTED: 21 kDa protein-like [Tarenaya hassleriana]
Length=189

 Score = 76.6 bits (187),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 59/151 (39%), Positives = 79/151 (52%), Gaps = 12/151 (8%)
 Frame = -1

Query  435  EACEGTLYPELCVSTLA--TALPDRRAKTIPEIIA-ATVNVTVDEVKASAANCSGIRRKL  265
             AC  TLY ELCV +L   +AL    AK  P   A A V VT+ + K +       RR  
Sbjct  33   NACSATLYKELCVRSLTPFSAL----AKNSPSKWARAGVAVTITDTKHALRRIVETRRS-  87

Query  264  PRLGPLEKRALDDCLELFSETRDELRK---VLSDLATTASSSKHYVDLQTFFSAAMTNQA  94
              +G  +  AL DC ELF +  DEL +   VL  L +TAS ++   D+ T+ S A+T+Q 
Sbjct  88   AVVGKRDGLALSDCRELFQDALDELHRSLGVLRTLNSTASQTQ-ISDMTTWVSTALTDQD  146

Query  93   TCLDGFAYSKKHVRRIIEKRLVQISHHVSNA  1
            TCLDGF  S     +II +R+    +  SNA
Sbjct  147  TCLDGFEGSSSSTAKIIRRRVTIAMYFTSNA  177



>ref|XP_008369014.1| PREDICTED: 21 kDa protein [Malus domestica]
Length=184

 Score = 76.6 bits (187),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 51/153 (33%), Positives = 80/153 (52%), Gaps = 15/153 (10%)
 Frame = -1

Query  435  EACEGTLYPELCV------STLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIR  274
            EAC  T Y +LC+      STLA   P R A+       A V+V++ E K++A     ++
Sbjct  21   EACSVTRYRDLCIHSLASFSTLAKDSPSRWAR-------AGVSVSLSETKSAAHYLVTLK  73

Query  273  RKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSS--KHYVDLQTFFSAAMTN  100
            +    +  + K AL DC+E F    DEL   L  L T   ++      DL+T+ SAA+T+
Sbjct  74   KHRRGMQGINKVALSDCIECFLNAIDELHXSLGVLRTLTKTTFGSEMADLKTWLSAALTD  133

Query  99   QATCLDGFAYSKKHVRRIIEKRLVQISHHVSNA  1
              TCLDGF   K    ++++ R+ +++H  +NA
Sbjct  134  GDTCLDGFEGHKGKQVKLLQNRVSKVTHITNNA  166



>ref|XP_008355483.1| PREDICTED: 21 kDa protein-like [Malus domestica]
Length=202

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 51/153 (33%), Positives = 80/153 (52%), Gaps = 15/153 (10%)
 Frame = -1

Query  435  EACEGTLYPELCV------STLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIR  274
            EAC  T Y +LC+      STLA   P R A+       A V+V++ E K++A     ++
Sbjct  39   EACSVTRYRDLCIHSLASFSTLAKDSPSRWAR-------AGVSVSLSETKSAAHYLVTLK  91

Query  273  RKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSS--KHYVDLQTFFSAAMTN  100
            +    +  + K AL DC+E F    DEL   L  L T   ++      DL+T+ SAA+T+
Sbjct  92   KHRRGMQGINKVALSDCIECFLNAIDELHXSLGVLRTLTKTTFGSEMADLKTWLSAALTD  151

Query  99   QATCLDGFAYSKKHVRRIIEKRLVQISHHVSNA  1
              TCLDGF   K    ++++ R+ +++H  +NA
Sbjct  152  GDTCLDGFEGHKGKQVKLLQNRVSKVTHITNNA  184



>ref|XP_006388348.1| hypothetical protein POPTR_0214s00200g [Populus trichocarpa]
 gb|ERP47262.1| hypothetical protein POPTR_0214s00200g [Populus trichocarpa]
Length=579

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 60/170 (35%), Positives = 88/170 (52%), Gaps = 12/170 (7%)
 Frame = -1

Query  480  NLNIHRQKLLQVAHT---EACEGTLYPELCVSTLATALPDRRAK--TIPEIIAATVNVTV  316
             +N H+    + AH     AC  TLYPELC S +AT +P   +   ++ ++I  ++N+T 
Sbjct  47   GVNSHKNGKNEGAHAILKSACSSTLYPELCYSAIAT-VPGVTSNLASLKDVIELSINLTT  105

Query  315  DEVKASAANCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLAT--TASSSKH  142
              V+ +      +  K  +L   EK AL DCLE   ET DEL +   D+       S K 
Sbjct  106  KTVQQNYFTVEKLIAKT-KLTKREKTALHDCLETIDETLDELHEAQVDINGYPNKKSLKE  164

Query  141  YVD-LQTFFSAAMTNQATCLDGFAY--SKKHVRRIIEKRLVQISHHVSNA  1
              D L+T  S+A+TNQ TCLDGF++  + K VR+ + K    +    SNA
Sbjct  165  QADNLKTLLSSAITNQETCLDGFSHDGADKKVRKALLKGQTHVEKMCSNA  214



>ref|XP_003541070.2| PREDICTED: 21 kDa protein-like [Glycine max]
Length=251

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 86/151 (57%), Gaps = 12/151 (8%)
 Frame = -1

Query  432  ACEGTLYPELCVSTL---ATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLP  262
            +C  T YP LC S+L   A  +   R      +  A +NVT+  VK+++A  S + +K  
Sbjct  96   SCSSTTYPRLCYSSLVKHADLIQTNRVV----LTGAALNVTLASVKSTSAMMSTLAKK-Q  150

Query  261  RLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYV--DLQTFFSAAMTNQATC  88
             L P E  A+ DC+E  S+T DELR+ +++++   +S+   +  D+QT+ SAA+T++ TC
Sbjct  151  GLKPREVAAMQDCVEQLSDTVDELRRSIAEMSDLRASNFEMIMSDVQTWVSAALTDETTC  210

Query  87   LDGFA--YSKKHVRRIIEKRLVQISHHVSNA  1
             DGF    +   ++  + + ++Q++   SNA
Sbjct  211  NDGFQEITAATDIKSTVRRLVIQVAQLTSNA  241



>gb|EYU21270.1| hypothetical protein MIMGU_mgv1a003278mg [Erythranthe guttata]
Length=594

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 59/159 (37%), Positives = 85/159 (53%), Gaps = 15/159 (9%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPD--RRAKTIPEIIAATVNVTVDEVKAS------AANCSGI  277
            +C  TLYPELC S +A +L     + K+  ++I  ++NVT   V+ +           G 
Sbjct  72   SCSNTLYPELCYSAIADSLDGGKEKVKSKKDVIILSLNVTTAAVRRNYFAIEKLLAGGGG  131

Query  276  RRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTAS---SSKHYVD-LQTFFSAA  109
              K   L   EK AL DCLE   ET DEL   + DL    S   S K++ D L+T  S+A
Sbjct  132  GAKSGNLTEREKSALHDCLETIGETLDELHAAVEDLKEYPSLKKSVKNHADYLKTLISSA  191

Query  108  MTNQATCLDGFAYSK--KHVRRI-IEKRLVQISHHVSNA  1
            +TNQ TCLDGF++ K  +H R I +  ++V++    SN+
Sbjct  192  ITNQETCLDGFSHGKTDRHAREILVGGQVVRVEKLCSNS  230



>ref|XP_004495957.1| PREDICTED: 21 kDa protein-like [Cicer arietinum]
Length=198

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 53/150 (35%), Positives = 80/150 (53%), Gaps = 10/150 (7%)
 Frame = -1

Query  435  EACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRL  256
            EAC+ T Y  LCV +LA    +   ++  +   A V+VT+ EV+    N       L R 
Sbjct  37   EACKVTRYQGLCVHSLA-PFSNSAGRSPSKWARAGVSVTIAEVE----NVQTYLANLNRH  91

Query  255  GPLEKR---ALDDCLELFSETRDELRKVLSDLATTASSS--KHYVDLQTFFSAAMTNQAT  91
            G L  R   AL DC+ELF++  DEL   L  L   + S+      DL T+ SAA+T++ T
Sbjct  92   GSLRGRDKLALLDCIELFADALDELHSSLGVLRKLSRSTFGTQMGDLNTWISAALTDEDT  151

Query  90   CLDGFAYSKKHVRRIIEKRLVQISHHVSNA  1
            CLDGF   K    ++++ R++++ +  SNA
Sbjct  152  CLDGFQGKKDRKIQLLQNRVLKVYYKTSNA  181



>ref|XP_006355502.1| PREDICTED: 21 kDa protein-like [Solanum tuberosum]
Length=206

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 47/152 (31%), Positives = 87/152 (57%), Gaps = 10/152 (7%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLG  253
            +C+ TLYP LCV  L +A  +   ++  ++  A ++V++ + K++    S + R +  L 
Sbjct  42   SCKATLYPVLCVQCL-SAFANTVKQSEQQLAHAALSVSLSKAKSTMIFVSKLNR-MRGLK  99

Query  252  PLEKRALDDCLELFSETRDELRKVLSDLATTASSS------KHYVDLQTFFSAAMTNQAT  91
            P EK+A+ DCL+  S++ D++ K + +L  T   S       H  ++QT+ SAA+T++ T
Sbjct  100  PREKQAVKDCLDTMSDSIDQINKSIPELGHTGQFSTGQDFMWHVSNVQTWVSAALTDENT  159

Query  90   CLDGFAYS--KKHVRRIIEKRLVQISHHVSNA  1
            CLDGF+      +V+  +  R++ ++   SNA
Sbjct  160  CLDGFSGRGMNGNVKAALRLRILHVAQVTSNA  191



>ref|XP_004307823.1| PREDICTED: 21 kDa protein-like [Fragaria vesca subsp. vesca]
Length=199

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 47/152 (31%), Positives = 90/152 (59%), Gaps = 14/152 (9%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPDRRAKTIPEIIA-ATVNVTVDEVKASAANCSGIRRKLPR-  259
            +C  T YP+LC+++LA+       +T P+++A A ++VT+   K++    S +   L   
Sbjct  42   SCSATTYPKLCLTSLAS--QATAIQTSPKLMASAALSVTLSSAKST----SNLMLSLSHG  95

Query  258  --LGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYV--DLQTFFSAAMTNQAT  91
              + P E  A+ DC+E+  ++ DEL++ +S++    SS    +  D+QT+ SAA+T+++T
Sbjct  96   HGMKPREVAAMRDCVEVLGDSVDELQRSISEMGNFKSSDYEMMISDVQTWVSAALTDEST  155

Query  90   CLDGFAYS--KKHVRRIIEKRLVQISHHVSNA  1
            C DGFA +    +++ ++  ++V I+   SNA
Sbjct  156  CADGFAGNGLNGNLKTVVRGKIVTIAQLTSNA  187



>ref|XP_009767669.1| PREDICTED: 21 kDa protein [Nicotiana sylvestris]
Length=210

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/152 (30%), Positives = 87/152 (57%), Gaps = 10/152 (7%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLG  253
            +C+ TLYP LCV  L +A  +   ++  ++  A ++V++ + K++    S +  K+  L 
Sbjct  41   SCKATLYPVLCVQCL-SAYANTVKQSEQQLARAALSVSLSKAKSTTIFVSKLT-KIRGLK  98

Query  252  PLEKRALDDCLELFSETRDELRKVLSDLATTASSSK------HYVDLQTFFSAAMTNQAT  91
            P EK+A+ DC +  S++ D++ K + +L  T   +       H  ++QT+ SAAMT++ T
Sbjct  99   PREKQAVKDCFDTMSDSVDQINKSIPELGQTGHFAAGQDFMWHVSNVQTWVSAAMTDENT  158

Query  90   CLDGFAYS--KKHVRRIIEKRLVQISHHVSNA  1
            CLDGF+      +V+ ++  R++ ++   SNA
Sbjct  159  CLDGFSGPGMNGNVKAVLRSRILHLAQVTSNA  190



>gb|KJB20850.1| hypothetical protein B456_003G168700 [Gossypium raimondii]
Length=203

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 51/152 (34%), Positives = 88/152 (58%), Gaps = 14/152 (9%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAAT-VNVTVDEVKASAANCSGIRRKLPRL  256
            +C  T YP+LC  +L+  +      T P+++  T +NVT+   KA+    S +  K+ R 
Sbjct  42   SCSTTTYPKLCYRSLS--VYASSINTSPKLLVHTALNVTLRASKAT----SRLMVKISRF  95

Query  255  GPLEKR---ALDDCLELFSETRDELRKVLSDLATTASS--SKHYVDLQTFFSAAMTNQAT  91
              LE R   A+ DC+E+  ++ DEL++ L +L   + S  S    D+QT+ SAA+T++ T
Sbjct  96   HGLEPRVAAAMADCIEVIGDSVDELQQSLGELGHISRSNISLTMSDVQTWVSAALTDEDT  155

Query  90   CLDGFAYS--KKHVRRIIEKRLVQISHHVSNA  1
            C+DGFA +    + + +  KR+++++H  SNA
Sbjct  156  CMDGFAGNNMNGYAKTMARKRIIKVAHLTSNA  187



>gb|AFK35257.1| unknown [Medicago truncatula]
 gb|KEH29362.1| plant invertase/pectin methylesterase inhibitor [Medicago truncatula]
Length=197

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 48/152 (32%), Positives = 85/152 (56%), Gaps = 14/152 (9%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPDRRAKTIPE----IIAATVNVTVDEVKASAANCSGIRRKL  265
            +C  T YP LC ++L      + A  I      +    +NVT+   K+++A  S +  K 
Sbjct  40   SCSSTTYPRLCYTSLV-----KHADFIQTNQMLLTGTALNVTLASAKSTSALMSTLS-KG  93

Query  264  PRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYV--DLQTFFSAAMTNQAT  91
             +L P E  A+ DC+E+ S++ DELR+ + +++   +S+      D+QT+ SAA+T+Q T
Sbjct  94   QQLNPREAAAMKDCVEVLSDSVDELRRSIDEMSRLRTSNFEITMSDVQTWVSAALTDQNT  153

Query  90   CLDGFA--YSKKHVRRIIEKRLVQISHHVSNA  1
            C DGF    + ++V+ ++   +VQ++   SNA
Sbjct  154  CTDGFQEINATENVKTLVRGSIVQVAQLTSNA  185



>ref|XP_006394407.1| hypothetical protein EUTSA_v10004950mg [Eutrema salsugineum]
 gb|ESQ31693.1| hypothetical protein EUTSA_v10004950mg [Eutrema salsugineum]
Length=198

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 49/149 (33%), Positives = 85/149 (57%), Gaps = 8/149 (5%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPDRRAKTIPEIIA-ATVNVTVDEVKASAANCSGIRRKLPRL  256
            +C  T Y  LCV++L+T       +T P+++A A +N+T+   KA++     + R  P L
Sbjct  41   SCNFTQYQRLCVASLST--QASLIQTSPKLMAHAALNITLASAKATSVMMVRLSRTSP-L  97

Query  255  GPLEKRALDDCLELFSETRDELRKVLSDLATTASSSK--HYVDLQTFFSAAMTNQATCLD  82
             P E  A+ DC+E   +T +ELRK + ++   + S+   +  D+QT+ SAA+T+  TC D
Sbjct  98   KPREASAMRDCVEELGDTLEELRKSIGEMGQLSGSNYELYMSDVQTWVSAALTDVTTCTD  157

Query  81   GFAYSKKH--VRRIIEKRLVQISHHVSNA  1
            GF     +  V+ ++ +R++ I+   SNA
Sbjct  158  GFEGDDMNGKVKVLVRRRILVITQLTSNA  186



>emb|CAC01624.1| putative pectin methylesterase [Populus tremula x Populus tremuloides]
Length=579

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 60/170 (35%), Positives = 88/170 (52%), Gaps = 12/170 (7%)
 Frame = -1

Query  480  NLNIHRQKLLQVAHT---EACEGTLYPELCVSTLATALPDRRAK--TIPEIIAATVNVTV  316
             +N H+    + AH     AC  TLYPELC S +AT +P       ++ ++I  ++N+T 
Sbjct  47   GVNSHKNGENEGAHAVLKSACSSTLYPELCYSAIAT-VPGVTGNLASLKDVIELSINLTT  105

Query  315  DEVKASAANCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTAS--SSKH  142
              V+ +      +  K  +L   EK AL DCLE   ET DEL +   D++   +  S K 
Sbjct  106  KTVQQNYFTVEKLIAKT-KLTKREKTALHDCLETIDETLDELHEAQVDISGYPNKKSLKE  164

Query  141  YVD-LQTFFSAAMTNQATCLDGFAY--SKKHVRRIIEKRLVQISHHVSNA  1
              D L T  S+A+TNQ TCLDGF++  + K VR+ + K    +    SNA
Sbjct  165  QADNLITLLSSAITNQETCLDGFSHDGADKKVRKALLKGQTHVEKMCSNA  214



>ref|XP_004139621.1| PREDICTED: pectinesterase/pectinesterase inhibitor U1-like [Cucumis 
sativus]
Length=553

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 55/165 (33%), Positives = 88/165 (53%), Gaps = 6/165 (4%)
 Frame = -1

Query  480  NLNIHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKA  301
            N N     +L V  T +C  TLYP+LC ST+++ L      ++ +I+  +++V +D  K 
Sbjct  27   NENGVMNNILSVIET-SCAITLYPQLCHSTISSILGTSNLLSLKDIVELSLSVAMDAAKL  85

Query  300  SAANCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLA---TTASSSKHYVDL  130
            +  N   +      +G  ++ AL DC++    T  EL K + D +      S + +  DL
Sbjct  86   NNENIKKLSMSGNIVGKRDRIALHDCVKTTDRTIYELDKAIQDFSEYPNKKSLASYADDL  145

Query  129  QTFFSAAMTNQATCLDGFAYSK--KHVRRIIEKRLVQISHHVSNA  1
            +TF S+A+TNQ TCLDG ++ K  K V R+IE    Q++   SNA
Sbjct  146  KTFLSSAITNQVTCLDGLSHDKTEKRVLRLIENTHNQVTKLCSNA  190



>gb|AAK69696.1|AF355057_1 putative pectin methylesterase LuPME5 [Linum usitatissimum]
Length=553

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 58/154 (38%), Positives = 82/154 (53%), Gaps = 15/154 (10%)
 Frame = -1

Query  432  ACEGTLYPELC---VSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLP  262
            +C  TLYPELC    S  A  L D   KT  +++  ++N T+  V+A   N   I++ + 
Sbjct  39   SCSTTLYPELCHSAASASAAVLSD--IKTTTDVVDLSLNATIAAVQA---NNQAIKKIIS  93

Query  261  R----LGPLEKRALDDCLELFSETRDELRKVLSDL-ATTASSSKHYVDLQTFFSAAMTNQ  97
                 L   EK AL DC+EL  ET DE  K + +L     S+++   DL+T  SAAMTNQ
Sbjct  94   SRSLSLTKREKAALADCIELCGETMDEPVKTIEELHGKKKSAAERGEDLKTLLSAAMTNQ  153

Query  96   ATCLDGFAYSK--KHVRRIIEKRLVQISHHVSNA  1
             TCLDGF++ K  K VR ++      +    SN+
Sbjct  154  ETCLDGFSHDKGDKKVRELLAAGQTNVGRMCSNS  187



>ref|XP_004154436.1| PREDICTED: pectinesterase/pectinesterase inhibitor U1-like [Cucumis 
sativus]
Length=553

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 55/165 (33%), Positives = 88/165 (53%), Gaps = 6/165 (4%)
 Frame = -1

Query  480  NLNIHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKA  301
            N N     +L V  T +C  TLYP+LC ST+++ L      ++ +I+  +++V +D  K 
Sbjct  27   NENGVMNNILSVIET-SCAITLYPQLCHSTISSILGTSNLLSLKDIVELSLSVAMDAAKL  85

Query  300  SAANCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLA---TTASSSKHYVDL  130
            +  N   +      +G  ++ AL DC++    T  EL K + D +      S + +  DL
Sbjct  86   NNENIKKLSMSGNIVGKRDRIALHDCVKTTDRTIYELDKAIQDFSEYPNKKSLASYADDL  145

Query  129  QTFFSAAMTNQATCLDGFAYSK--KHVRRIIEKRLVQISHHVSNA  1
            +TF S+A+TNQ TCLDG ++ K  K V R+IE    Q++   SNA
Sbjct  146  KTFLSSAITNQVTCLDGLSHDKTEKRVLRLIENTHNQVTKLCSNA  190



>gb|KGN44619.1| hypothetical protein Csa_7G343850 [Cucumis sativus]
Length=581

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 55/165 (33%), Positives = 88/165 (53%), Gaps = 6/165 (4%)
 Frame = -1

Query  480  NLNIHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKA  301
            N N     +L V  T +C  TLYP+LC ST+++ L      ++ +I+  +++V +D  K 
Sbjct  27   NENGVMNNILSVIET-SCAITLYPQLCHSTISSILGTSNLLSLKDIVELSLSVAMDAAKL  85

Query  300  SAANCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLA---TTASSSKHYVDL  130
            +  N   +      +G  ++ AL DC++    T  EL K + D +      S + +  DL
Sbjct  86   NNENIKKLSMSGNIVGKRDRIALHDCVKTTDRTIYELDKAIQDFSEYPNKKSLASYADDL  145

Query  129  QTFFSAAMTNQATCLDGFAYSK--KHVRRIIEKRLVQISHHVSNA  1
            +TF S+A+TNQ TCLDG ++ K  K V R+IE    Q++   SNA
Sbjct  146  KTFLSSAITNQVTCLDGLSHDKTEKRVLRLIENTHNQVTKLCSNA  190



>ref|XP_007135363.1| hypothetical protein PHAVU_010G123100g [Phaseolus vulgaris]
 gb|ESW07357.1| hypothetical protein PHAVU_010G123100g [Phaseolus vulgaris]
Length=1192

 Score = 79.3 bits (194),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 58/154 (38%), Positives = 81/154 (53%), Gaps = 15/154 (10%)
 Frame = -1

Query  432  ACEGTLYPELCVSTLATALPDRRAKTIP--EIIAATVNVTVDEVKASAANCSGIRRKLPR  259
            AC  T Y ELC S +A+  P+   K     ++I  ++ +T   V+ +        +KL  
Sbjct  86   ACSSTFYSELCFSAVASE-PNVTHKVTSHRDVIQLSLKITTRAVEHNYFTV----KKLST  140

Query  258  LGPLEKR---ALDDCLELFSETRDELRKVLSDLATTASSS---KHYVDLQTFFSAAMTNQ  97
             G L KR   AL DCLE   ET DELR+   DL    +     +H  DL+T  SAA+TNQ
Sbjct  141  KGGLTKREKTALHDCLETIDETLDELREAQHDLELYPNKKTLYQHADDLKTLISAAITNQ  200

Query  96   ATCLDGFAY--SKKHVRRIIEKRLVQISHHVSNA  1
             TCLDGF++  + K VR+ +E+  V +    SNA
Sbjct  201  VTCLDGFSHEDADKRVRKALEEGQVHVERMCSNA  234



>ref|XP_010049073.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 34 
[Eucalyptus grandis]
Length=589

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 50/149 (34%), Positives = 78/149 (52%), Gaps = 5/149 (3%)
 Frame = -1

Query  444  AHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKL  265
            A +  C  T YP LC+  LA A PD    +  +++  + NVT+     +    S I    
Sbjct  73   AISRTCGLTRYPALCLDALA-AFPDAEGASQQDLVHISFNVTLQRFSKALYVSSTIGHL-  130

Query  264  PRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYV--DLQTFFSAAMTNQAT  91
             ++ P  + A DDCLEL  +  D LR+ L+ +    + S  +   D+ T+ SAAMTNQ T
Sbjct  131  -QMEPRVRSAFDDCLELLDDAVDALRRSLNYVTPGGAKSASWSAQDVVTWLSAAMTNQDT  189

Query  90   CLDGFAYSKKHVRRIIEKRLVQISHHVSN  4
            C +GFA     V++++ +R+  +S  VSN
Sbjct  190  CAEGFADVSGGVKQLMAERMRDLSELVSN  218



>ref|XP_011012638.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=573

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 72/221 (33%), Positives = 109/221 (49%), Gaps = 32/221 (14%)
 Frame = -1

Query  630  HN-LKQKATLFFTISGCSAIVLLA-FLSVTSFNSLFTKDGISSSTGPTHLDLNLNIHRQK  457
            HN LK K  +F ++   S+I+L+A  +S+ +        G++SS   T  +   N H   
Sbjct  7    HNTLKNKKRVFLSL--FSSILLVAAIVSIVA--------GVTSSKNSTESN---NDH---  50

Query  456  LLQVAHT---EACEGTLYPELCVSTLATALPD--RRAKTIPEIIAATVNVTVDEVKASAA  292
              QVA+T    +C  TLYP LC S++ +A+PD   + K+  ++I  ++N T+   + S  
Sbjct  51   --QVAYTILKSSCSSTLYPHLCFSSI-SAVPDATSKIKSKKDVIDLSLNRTMSATRHSYF  107

Query  291  NCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSK----HYVDLQT  124
                +          E  AL DCL + +ET D+L K   +L    S  K    H  DL+ 
Sbjct  108  KIQKLTFTRRSFTERENTALHDCLVMLNETLDQLSKAYQELQDYPSLKKSLSVHADDLKI  167

Query  123  FFSAAMTNQATCLDGFAYSK--KHVRRIIEKRLVQISHHVS  7
              SA MTNQ TCLDGF++ K  K VR +     + + H  S
Sbjct  168  LLSATMTNQETCLDGFSHEKADKKVRELFIDEEMHVYHMSS  208



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1064095936780