BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF027G07

Length=713
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009776400.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     170   9e-46   Nicotiana sylvestris
ref|XP_004251644.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     169   2e-45   Solanum lycopersicum
ref|XP_009628676.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     168   3e-45   Nicotiana tomentosiformis
ref|NP_001275363.1|  glucan endo-1,3-beta-glucosidase 13-like pre...    168   6e-45   Solanum tuberosum [potatoes]
ref|XP_002283473.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     167   9e-45   Vitis vinifera
ref|XP_010249473.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     163   4e-43   Nelumbo nucifera [Indian lotus]
ref|XP_007012990.1|  O-Glycosyl hydrolases family 17 protein isof...    162   4e-43   
ref|XP_007012989.1|  O-Glycosyl hydrolases family 17 protein isof...    162   9e-43   
ref|XP_011078239.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    161   1e-42   Sesamum indicum [beniseed]
gb|KJB27172.1|  hypothetical protein B456_004G282300                    161   2e-42   Gossypium raimondii
emb|CDP03239.1|  unnamed protein product                                161   2e-42   Coffea canephora [robusta coffee]
ref|XP_002514201.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    160   4e-42   Ricinus communis
ref|XP_008242469.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    160   4e-42   Prunus mume [ume]
ref|XP_008242470.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    160   5e-42   
ref|XP_007204831.1|  hypothetical protein PRUPE_ppa1027206mg            160   5e-42   Prunus persica
ref|XP_011009861.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     159   7e-42   Populus euphratica
gb|KHG26459.1|  hypothetical protein F383_04538                         159   8e-42   Gossypium arboreum [tree cotton]
ref|XP_009352572.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     159   9e-42   Pyrus x bretschneideri [bai li]
ref|XP_008337610.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     159   9e-42   
ref|XP_010267108.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     159   1e-41   Nelumbo nucifera [Indian lotus]
ref|XP_008795501.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     159   1e-41   Phoenix dactylifera
ref|XP_004287489.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     158   2e-41   Fragaria vesca subsp. vesca
ref|XP_006371969.1|  glycosyl hydrolase family 17 family protein        157   3e-41   Populus trichocarpa [western balsam poplar]
ref|XP_006451337.1|  hypothetical protein CICLE_v10008080mg             157   4e-41   Citrus clementina [clementine]
gb|AIR93910.1|  glucanase                                               156   5e-41   Cicer arietinum [garbanzo]
gb|EYU30694.1|  hypothetical protein MIMGU_mgv1a005031mg                157   5e-41   Erythranthe guttata [common monkey flower]
ref|XP_007160277.1|  hypothetical protein PHAVU_002G307800g             157   5e-41   Phaseolus vulgaris [French bean]
gb|KHG04832.1|  hypothetical protein F383_29565                         157   6e-41   Gossypium arboreum [tree cotton]
gb|AGV54422.1|  glucan endo-1,3-beta-glucosidase 13-like protein        157   6e-41   Phaseolus vulgaris [French bean]
gb|KJB65051.1|  hypothetical protein B456_010G078300                    157   6e-41   Gossypium raimondii
ref|XP_010914932.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    157   9e-41   Elaeis guineensis
ref|XP_008799775.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    157   9e-41   Phoenix dactylifera
ref|XP_010545323.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     156   1e-40   Tarenaya hassleriana [spider flower]
gb|AET05176.2|  glucan endo-1,3-beta-glucosidase-like protein           155   2e-40   Medicago truncatula
ref|XP_006584807.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    155   2e-40   Glycine max [soybeans]
gb|KHN16652.1|  Glucan endo-1,3-beta-glucosidase 13                     155   2e-40   Glycine soja [wild soybean]
gb|KDP33779.1|  hypothetical protein JCGZ_07350                         155   3e-40   Jatropha curcas
ref|XP_003620800.1|  Glucan endo-1,3-beta-glucosidase                   154   3e-40   
ref|XP_010049602.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     154   6e-40   Eucalyptus grandis [rose gum]
ref|XP_006580483.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     154   9e-40   Glycine max [soybeans]
gb|ABD91577.1|  beta-1,3-glucanase                                      153   1e-39   Medicago sativa [alfalfa]
gb|ABD91576.1|  beta-1,3-glucanase                                      153   1e-39   Medicago sativa [alfalfa]
gb|KEH27229.1|  glucan endo-1,3-beta-glucosidase-like protein           153   2e-39   Medicago truncatula
ref|XP_008450796.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     152   3e-39   Cucumis melo [Oriental melon]
ref|XP_010446151.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    151   5e-39   
ref|XP_010476823.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    151   6e-39   
ref|XP_010483135.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     151   6e-39   Camelina sativa [gold-of-pleasure]
ref|XP_010924450.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     150   9e-39   Elaeis guineensis
dbj|BAJ85556.1|  predicted protein                                      150   9e-39   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY64970.1|  BnaAnng19910D                                          150   1e-38   Brassica napus [oilseed rape]
ref|XP_009120169.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     150   1e-38   Brassica rapa
emb|CDY32869.1|  BnaC09g33160D                                          150   1e-38   Brassica napus [oilseed rape]
gb|EEC71452.1|  hypothetical protein OsI_03677                          150   2e-38   Oryza sativa Indica Group [Indian rice]
ref|NP_001044198.1|  Os01g0739700                                       150   2e-38   
ref|XP_009394832.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    150   2e-38   Musa acuminata subsp. malaccensis [pisang utan]
gb|EAZ13481.1|  hypothetical protein OsJ_03397                          149   2e-38   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006280336.1|  hypothetical protein CARUB_v10026261mg             150   2e-38   Capsella rubella
ref|XP_010110871.1|  Glucan endo-1,3-beta-glucosidase 13                153   3e-38   
emb|CDM84006.1|  unnamed protein product                                149   3e-38   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004135678.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    149   3e-38   Cucumis sativus [cucumbers]
ref|NP_200470.1|  O-Glycosyl hydrolases family 17 protein               149   3e-38   Arabidopsis thaliana [mouse-ear cress]
gb|EMT15518.1|  Glucan endo-1,3-beta-glucosidase 13                     149   3e-38   
ref|XP_002864470.1|  glycosyl hydrolase family 17 protein               149   3e-38   Arabidopsis lyrata subsp. lyrata
ref|XP_006644680.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    149   3e-38   Oryza brachyantha
gb|EMS49856.1|  Glucan endo-1,3-beta-glucosidase 13                     149   4e-38   Triticum urartu
ref|XP_003569762.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    148   8e-38   Brachypodium distachyon [annual false brome]
ref|XP_010232285.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    148   8e-38   Brachypodium distachyon [annual false brome]
ref|XP_007012991.1|  O-Glycosyl hydrolases family 17 protein isof...    147   1e-37   
ref|XP_004513066.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    147   1e-37   Cicer arietinum [garbanzo]
ref|XP_008672638.1|  PREDICTED: uncharacterized protein LOC100278...    147   1e-37   
gb|KJB27173.1|  hypothetical protein B456_004G282300                    147   1e-37   Gossypium raimondii
ref|XP_007012993.1|  O-Glycosyl hydrolases family 17 protein isof...    146   2e-37   
ref|XP_004969893.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    147   2e-37   Setaria italica
ref|XP_006401304.1|  hypothetical protein EUTSA_v10013309mg             147   2e-37   Eutrema salsugineum [saltwater cress]
ref|XP_007012992.1|  O-Glycosyl hydrolases family 17 protein isof...    146   3e-37   
ref|XP_008672637.1|  PREDICTED: uncharacterized protein LOC100278...    147   4e-37   
gb|EPS73640.1|  hypothetical protein M569_01113                         145   6e-37   Genlisea aurea
ref|XP_010688353.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    145   9e-37   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002456331.1|  hypothetical protein SORBIDRAFT_03g034100          145   1e-36   Sorghum bicolor [broomcorn]
ref|XP_006853717.1|  hypothetical protein AMTR_s00056p00158530          145   1e-36   
ref|XP_010541008.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     144   2e-36   Tarenaya hassleriana [spider flower]
gb|ACU24280.1|  unknown                                                 140   6e-36   Glycine max [soybeans]
gb|KDO55852.1|  hypothetical protein CISIN_1g010782mg                   142   9e-36   Citrus sinensis [apfelsine]
ref|XP_003630700.1|  Glucan endo-1,3-beta-glucosidase                   140   3e-35   
gb|KHM99816.1|  Glucan endo-1,3-beta-glucosidase 13                     140   4e-35   Glycine soja [wild soybean]
ref|XP_009394833.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    138   2e-34   
ref|NP_001144992.1|  uncharacterized protein LOC100278152 precursor     136   1e-33   
ref|XP_006412850.1|  hypothetical protein EUTSA_v10024870mg             135   3e-33   Eutrema salsugineum [saltwater cress]
emb|CDY62033.1|  BnaC03g77660D                                          134   1e-32   Brassica napus [oilseed rape]
gb|KFK29497.1|  hypothetical protein AALP_AA7G142000                    133   2e-32   Arabis alpina [alpine rockcress]
ref|XP_009109043.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    133   2e-32   Brassica rapa
emb|CAB79694.1|  beta-1, 3-glucanase-like protein                       131   7e-32   Arabidopsis thaliana [mouse-ear cress]
gb|KJB54309.1|  hypothetical protein B456_009G028300                    131   7e-32   Gossypium raimondii
ref|XP_010438307.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     131   7e-32   Camelina sativa [gold-of-pleasure]
ref|XP_010433104.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    131   8e-32   Camelina sativa [gold-of-pleasure]
ref|NP_849556.1|  glucan endo-1,3-beta-glucosidase 12                   131   8e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010447863.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    131   8e-32   Camelina sativa [gold-of-pleasure]
emb|CDY68826.1|  BnaA01g34890D                                          130   1e-31   Brassica napus [oilseed rape]
ref|XP_006285688.1|  hypothetical protein CARUB_v10007158mg             131   1e-31   Capsella rubella
ref|XP_009128829.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     130   1e-31   Brassica rapa
ref|XP_002867412.1|  glycosyl hydrolase family 17 protein               129   3e-31   
emb|CDY14214.1|  BnaA08g13450D                                          129   3e-31   Brassica napus [oilseed rape]
emb|CDY06818.1|  BnaC01g09170D                                          128   9e-31   
ref|XP_010905435.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    121   5e-30   
ref|XP_008784816.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    120   5e-30   
ref|XP_008784817.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    120   6e-30   
ref|XP_006579395.1|  PREDICTED: uncharacterized protein LOC100778...    120   1e-29   
ref|XP_003531315.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    120   1e-29   Glycine max [soybeans]
gb|KEH20727.1|  carbohydrate-binding X8 domain protein                  119   2e-29   Medicago truncatula
gb|KHG29271.1|  hypothetical protein F383_14120                         124   3e-29   Gossypium arboreum [tree cotton]
ref|NP_001242238.1|  uncharacterized protein LOC100778330 precursor     119   3e-29   Glycine max [soybeans]
ref|XP_003630021.1|  Glucan endo-1,3-beta-glucosidase                   118   4e-29   Medicago truncatula
ref|XP_004504153.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    118   4e-29   Cicer arietinum [garbanzo]
gb|KJB54307.1|  hypothetical protein B456_009G028200                    123   8e-29   Gossypium raimondii
gb|KHN06522.1|  Glucan endo-1,3-beta-glucosidase 13                     117   1e-28   Glycine soja [wild soybean]
ref|XP_010319704.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    117   1e-28   
ref|XP_009628793.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    117   2e-28   Nicotiana tomentosiformis
ref|XP_009784559.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    116   3e-28   Nicotiana sylvestris
ref|XP_004306417.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    116   3e-28   Fragaria vesca subsp. vesca
gb|AFU52644.1|  beta-1,3-glucanase 9                                    116   4e-28   Solanum tuberosum [potatoes]
ref|XP_009402144.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    115   4e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004135538.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    115   5e-28   Cucumis sativus [cucumbers]
ref|XP_007159617.1|  hypothetical protein PHAVU_002G252400g             115   6e-28   Phaseolus vulgaris [French bean]
gb|KJB54308.1|  hypothetical protein B456_009G028300                    120   8e-28   Gossypium raimondii
emb|CBI30973.3|  unnamed protein product                                121   2e-27   Vitis vinifera
ref|XP_007041111.1|  Carbohydrate-binding X8 domain superfamily p...    113   2e-27   
ref|XP_002274294.2|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     114   2e-27   Vitis vinifera
ref|XP_007041109.1|  Carbohydrate-binding X8 domain superfamily p...    114   2e-27   
ref|XP_008444815.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     113   4e-27   Cucumis melo [Oriental melon]
ref|NP_567828.3|  glucan endo-1,3-beta-glucosidase 12                   118   4e-27   
ref|XP_007041110.1|  Carbohydrate-binding X8 domain superfamily p...    114   4e-27   
gb|KJB47942.1|  hypothetical protein B456_008G047800                    113   4e-27   Gossypium raimondii
gb|KJB47941.1|  hypothetical protein B456_008G047800                    113   4e-27   Gossypium raimondii
ref|XP_010244529.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     112   7e-27   Nelumbo nucifera [Indian lotus]
gb|EAZ38703.1|  hypothetical protein OsJ_23103                          111   8e-27   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009362262.1|  PREDICTED: PLASMODESMATA CALLOSE-BINDING PRO...    112   9e-27   
emb|CDP05643.1|  unnamed protein product                                112   1e-26   Coffea canephora [robusta coffee]
ref|XP_009362261.1|  PREDICTED: PLASMODESMATA CALLOSE-BINDING PRO...    112   1e-26   Pyrus x bretschneideri [bai li]
ref|XP_006657446.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    110   2e-26   Oryza brachyantha
ref|XP_006836305.1|  hypothetical protein AMTR_s00092p00035570          111   2e-26   
ref|NP_001058896.1|  Os07g0149900                                       109   3e-26   
gb|EAZ02781.1|  hypothetical protein OsI_24906                          110   5e-26   Oryza sativa Indica Group [Indian rice]
gb|KDP34967.1|  hypothetical protein JCGZ_09255                         110   6e-26   Jatropha curcas
ref|XP_011096658.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     110   8e-26   Sesamum indicum [beniseed]
ref|XP_008372208.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    110   8e-26   
ref|XP_008372207.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    110   9e-26   
ref|XP_007212537.1|  hypothetical protein PRUPE_ppa019395mg             108   1e-25   
ref|XP_009381292.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    109   1e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008383434.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    108   2e-25   
ref|XP_008225549.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     108   2e-25   Prunus mume [ume]
ref|XP_009377467.1|  PREDICTED: PLASMODESMATA CALLOSE-BINDING PRO...    108   2e-25   Pyrus x bretschneideri [bai li]
ref|XP_009402145.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    107   3e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010027320.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 2      109   3e-25   
ref|XP_011023010.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    108   3e-25   Populus euphratica
ref|XP_010687021.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     108   3e-25   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006396600.1|  hypothetical protein EUTSA_v10029156mg             107   3e-25   
ref|XP_006289337.1|  hypothetical protein CARUB_v10002833mg             107   3e-25   
ref|NP_001144702.1|  uncharacterized protein LOC100277738               108   3e-25   
ref|XP_011023011.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    108   3e-25   Populus euphratica
ref|XP_006448957.1|  hypothetical protein CICLE_v10018075mg             105   5e-25   
ref|XP_010422431.1|  PREDICTED: major pollen allergen Ole e 10-li...    107   5e-25   Camelina sativa [gold-of-pleasure]
ref|XP_002461458.1|  hypothetical protein SORBIDRAFT_02g002990          107   6e-25   Sorghum bicolor [broomcorn]
ref|XP_004955451.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    108   6e-25   
ref|XP_010431286.1|  PREDICTED: major pollen allergen Ole e 10-li...    107   6e-25   Camelina sativa [gold-of-pleasure]
ref|XP_010431291.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    106   7e-25   
ref|NP_192452.2|  carbohydrate-binding X8 domain-containing protein     106   8e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006380364.1|  hypothetical protein POPTR_0007s03690g             107   9e-25   
gb|EMT14401.1|  hypothetical protein F775_20218                         107   1e-24   
ref|XP_010455870.1|  PREDICTED: major pollen allergen Ole e 10-like     106   1e-24   Camelina sativa [gold-of-pleasure]
gb|KCW62163.1|  hypothetical protein EUGRSUZ_H04823                     105   1e-24   Eucalyptus grandis [rose gum]
ref|XP_003561463.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    106   1e-24   Brachypodium distachyon [annual false brome]
emb|CDY48582.1|  BnaA09g01780D                                          105   2e-24   Brassica napus [oilseed rape]
ref|XP_002872756.1|  hypothetical protein ARALYDRAFT_327458             105   2e-24   
ref|XP_009121635.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     105   2e-24   Brassica rapa
ref|XP_006370995.1|  hypothetical protein POPTR_0019s02460g             105   3e-24   
ref|XP_011012004.1|  PREDICTED: major pollen allergen Ole e 10-like     104   7e-24   Populus euphratica
ref|XP_002526606.1|  hydrolase, hydrolyzing O-glycosyl compounds,...    102   8e-24   
ref|XP_010537797.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 1      105   8e-24   Tarenaya hassleriana [spider flower]
emb|CDY56715.1|  BnaC01g38720D                                          102   9e-24   Brassica napus [oilseed rape]
gb|EMS45499.1|  hypothetical protein TRIUR3_12202                       103   1e-23   Triticum urartu
gb|KGN65891.1|  hypothetical protein Csa_1G537410                       103   2e-23   Cucumis sativus [cucumbers]
dbj|BAJ87686.1|  predicted protein                                      103   2e-23   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABK26650.1|  unknown                                                 102   2e-23   Picea sitchensis
ref|XP_011002947.1|  PREDICTED: major pollen allergen Ole e 10-like     102   4e-23   Populus euphratica
ref|XP_006388214.1|  hypothetical protein POPTR_0280s002301g            100   5e-23   
gb|EYU19143.1|  hypothetical protein MIMGU_mgv1a026756mg              99.4    2e-22   Erythranthe guttata [common monkey flower]
ref|XP_002969476.1|  hypothetical protein SELMODRAFT_231287             102   2e-21   
emb|CAB81085.1|  putative protein                                     96.7    2e-21   Arabidopsis thaliana [mouse-ear cress]
emb|CDY54368.1|  BnaC03g74560D                                        95.5    4e-21   Brassica napus [oilseed rape]
ref|NP_001059752.1|  Os07g0510200                                       101   6e-21   
ref|XP_002961242.1|  hypothetical protein SELMODRAFT_402967             100   6e-21   
gb|EEC82125.1|  hypothetical protein OsI_26155                          101   6e-21   Oryza sativa Indica Group [Indian rice]
ref|XP_010511589.1|  PREDICTED: major pollen allergen Ole e 10-like   94.0    2e-20   Camelina sativa [gold-of-pleasure]
ref|XP_008449814.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  99.8    2e-20   Cucumis melo [Oriental melon]
ref|XP_008449819.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  99.4    2e-20   Cucumis melo [Oriental melon]
ref|XP_008449817.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  99.8    2e-20   Cucumis melo [Oriental melon]
ref|XP_006657748.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  99.8    2e-20   Oryza brachyantha
ref|XP_010470560.1|  PREDICTED: major pollen allergen Ole e 10-like   93.2    3e-20   Camelina sativa [gold-of-pleasure]
ref|XP_006445640.1|  hypothetical protein CICLE_v10015028mg           97.8    8e-20   
ref|XP_006488904.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  97.8    8e-20   Citrus sinensis [apfelsine]
emb|CDP01635.1|  unnamed protein product                              97.4    9e-20   Coffea canephora [robusta coffee]
ref|XP_009150785.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  91.7    1e-19   
ref|XP_004959661.1|  PREDICTED: extensin-like                         98.2    1e-19   
gb|EPS59666.1|  hypothetical protein M569_15139                       93.6    1e-19   Genlisea aurea
ref|XP_006407197.1|  hypothetical protein EUTSA_v10020572mg           97.4    1e-19   Eutrema salsugineum [saltwater cress]
ref|XP_004173668.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  95.9    1e-19   
ref|NP_176859.1|  carbohydrate-binding X8 domain-containing protein   91.7    1e-19   Arabidopsis thaliana [mouse-ear cress]
gb|KGN54064.1|  hypothetical protein Csa_4G280410                     97.4    1e-19   Cucumis sativus [cucumbers]
ref|XP_004142250.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  97.4    1e-19   
gb|AET00920.2|  carbohydrate-binding X8 domain protein                91.3    2e-19   Medicago truncatula
ref|XP_008813566.1|  PREDICTED: extensin-like                         95.1    2e-19   Phoenix dactylifera
ref|XP_004162024.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...  97.1    2e-19   
ref|XP_004142367.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  96.3    2e-19   Cucumis sativus [cucumbers]
ref|NP_001152289.1|  glucan endo-1,3-beta-glucosidase 3 precursor     96.7    2e-19   Zea mays [maize]
ref|XP_006297495.1|  hypothetical protein CARUB_v10013514mg           96.3    2e-19   Capsella rubella
ref|XP_008452394.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  95.9    2e-19   Cucumis melo [Oriental melon]
ref|XP_006448191.1|  hypothetical protein CICLE_v10014990mg           96.3    2e-19   Citrus clementina [clementine]
ref|XP_002975458.1|  hypothetical protein SELMODRAFT_415534           95.9    3e-19   Selaginella moellendorffii
tpg|DAA62863.1|  TPA: putative O-Glycosyl hydrolase superfamily p...  97.1    3e-19   
ref|XP_008452393.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  96.3    3e-19   Cucumis melo [Oriental melon]
ref|XP_009384878.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  95.5    3e-19   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007142501.1|  hypothetical protein PHAVU_008G285900g           90.5    3e-19   Phaseolus vulgaris [French bean]
ref|XP_007215258.1|  hypothetical protein PRUPE_ppa004534mg           95.9    4e-19   Prunus persica
gb|KDO64566.1|  hypothetical protein CISIN_1g0108331mg                95.1    5e-19   Citrus sinensis [apfelsine]
gb|EPS65276.1|  hypothetical protein M569_09504                       90.1    6e-19   Genlisea aurea
dbj|BAB01763.1|  beta-1,3-glucanase-like protein                      94.7    7e-19   Arabidopsis thaliana [mouse-ear cress]
gb|AIR93909.1|  glucanase                                             94.7    7e-19   Cicer arietinum [garbanzo]
ref|XP_003563040.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  95.1    8e-19   Brachypodium distachyon [annual false brome]
ref|XP_011096571.1|  PREDICTED: PLASMODESMATA CALLOSE-BINDING PRO...  92.4    8e-19   Sesamum indicum [beniseed]
gb|AFK40693.1|  unknown                                               89.4    8e-19   Lotus japonicus
ref|XP_003519665.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  89.4    8e-19   Glycine max [soybeans]
ref|XP_003544378.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  89.4    8e-19   Glycine max [soybeans]
ref|XP_010539571.1|  PREDICTED: leucine-rich repeat extensin-like...  92.8    9e-19   Tarenaya hassleriana [spider flower]
ref|XP_004503372.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  94.7    9e-19   Cicer arietinum [garbanzo]
ref|NP_187965.1|  glucan endo-1,3-beta-glucosidase 4                  94.7    1e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002520569.1|  hydrolase, hydrolyzing O-glycosyl compounds,...  92.0    1e-18   Ricinus communis
gb|KHN46919.1|  Glucan endo-1,3-beta-glucosidase 12                   89.4    1e-18   Glycine soja [wild soybean]
ref|NP_001049413.1|  Os03g0221500                                     94.7    1e-18   
ref|XP_010542461.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  94.7    1e-18   Tarenaya hassleriana [spider flower]
ref|XP_002884972.1|  glycosyl hydrolase family 17 protein             94.4    1e-18   
ref|XP_004959695.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  94.7    1e-18   
gb|KJB15378.1|  hypothetical protein B456_002G174100                  93.6    1e-18   Gossypium raimondii
ref|XP_002888553.1|  predicted protein                                88.6    2e-18   Arabidopsis lyrata subsp. lyrata
ref|XP_010935257.1|  PREDICTED: extensin-like                         92.4    2e-18   Elaeis guineensis
ref|XP_010915581.1|  PREDICTED: PLASMODESMATA CALLOSE-BINDING PRO...  90.5    2e-18   Elaeis guineensis
ref|XP_009363375.1|  PREDICTED: proline-rich receptor-like protei...  92.0    2e-18   Pyrus x bretschneideri [bai li]
gb|KJB15376.1|  hypothetical protein B456_002G174100                  94.0    2e-18   Gossypium raimondii
ref|XP_010670126.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  94.0    2e-18   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010915580.1|  PREDICTED: PLASMODESMATA CALLOSE-BINDING PRO...  90.9    2e-18   
ref|XP_008670382.1|  PREDICTED: extensin-like isoform X2              94.0    2e-18   Zea mays [maize]
ref|XP_006391444.1|  hypothetical protein EUTSA_v10019456mg           88.6    2e-18   Eutrema salsugineum [saltwater cress]
ref|XP_008670381.1|  PREDICTED: extensin-like isoform X1              94.0    2e-18   
ref|XP_010500722.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4    93.6    2e-18   Camelina sativa [gold-of-pleasure]
ref|XP_008349221.1|  PREDICTED: extensin-like                         91.7    2e-18   Malus domestica [apple tree]
gb|EYU45799.1|  hypothetical protein MIMGU_mgv1a004953mg              93.6    2e-18   Erythranthe guttata [common monkey flower]
ref|XP_010479435.1|  PREDICTED: major pollen allergen Ole e 10-like   88.2    2e-18   Camelina sativa [gold-of-pleasure]
ref|XP_010500533.1|  PREDICTED: major pollen allergen Ole e 10-like   88.2    2e-18   Camelina sativa [gold-of-pleasure]
ref|XP_006372566.1|  glycosyl hydrolase family 17 family protein      93.2    3e-18   
gb|KDO78272.1|  hypothetical protein CISIN_1g010394mg                 93.6    3e-18   Citrus sinensis [apfelsine]
ref|XP_006596503.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  92.8    3e-18   
ref|XP_006467418.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  93.2    3e-18   Citrus sinensis [apfelsine]
ref|XP_011001568.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 2    93.2    3e-18   Populus euphratica
ref|XP_006449751.1|  hypothetical protein CICLE_v10014440mg           94.0    3e-18   
dbj|BAJ93567.1|  predicted protein                                    93.6    3e-18   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT25818.1|  Glucan endo-1,3-beta-glucosidase 12                   93.2    3e-18   
ref|XP_002300880.2|  hypothetical protein POPTR_0002s06050g           90.5    3e-18   Populus trichocarpa [western balsam poplar]
gb|KJB66065.1|  hypothetical protein B456_010G126400                  92.8    3e-18   Gossypium raimondii
ref|XP_009394429.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  90.1    4e-18   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY04078.1|  BnaC02g37930D                                        87.8    4e-18   
ref|XP_002964062.1|  hypothetical protein SELMODRAFT_28916            87.0    4e-18   
ref|XP_002305879.1|  glycosyl hydrolase family 17 family protein      92.8    4e-18   
ref|XP_007212991.1|  hypothetical protein PRUPE_ppa022594mg           91.3    4e-18   Prunus persica
ref|XP_011007238.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  92.8    4e-18   Populus euphratica
ref|XP_004297451.2|  PREDICTED: glucan endo-1,3-beta-glucosidase 3    92.8    4e-18   Fragaria vesca subsp. vesca
ref|XP_006580864.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  90.5    4e-18   
ref|XP_010052947.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  87.8    4e-18   Eucalyptus grandis [rose gum]
gb|ABK23522.1|  unknown                                               87.8    4e-18   Picea sitchensis
ref|XP_007141916.1|  hypothetical protein PHAVU_008G236700g           92.8    4e-18   Phaseolus vulgaris [French bean]
gb|AES63104.2|  carbohydrate-binding X8 domain protein                91.3    4e-18   Medicago truncatula
ref|XP_003519328.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  92.8    4e-18   
ref|XP_010097806.1|  Glucan endo-1,3-beta-glucosidase 4               92.8    4e-18   
ref|XP_004961104.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  90.5    4e-18   
ref|XP_006389885.1|  hypothetical protein EUTSA_v10019651mg           91.3    4e-18   
gb|KJB66066.1|  hypothetical protein B456_010G126400                  92.8    4e-18   
gb|EMS51674.1|  Glucan endo-1,3-beta-glucosidase 13                   93.2    5e-18   
ref|XP_003544983.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  92.8    5e-18   
ref|XP_010552278.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  92.8    5e-18   
ref|XP_006661539.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...  87.0    5e-18   
ref|XP_006575486.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  92.8    5e-18   
dbj|BAC83956.1|  putative beta-1,3-glucanase                          92.8    5e-18   
ref|XP_010108988.1|  Glucan endo-1,3-beta-glucosidase 2               92.4    5e-18   
ref|XP_004288596.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 2    92.4    5e-18   
ref|XP_001761806.1|  predicted protein                                92.4    5e-18   
dbj|BAJ97463.1|  predicted protein                                    90.5    6e-18   
ref|XP_004135574.1|  PREDICTED: uncharacterized protein LOC101217178  90.9    6e-18   
ref|XP_002516415.1|  conserved hypothetical protein                   90.1    6e-18   
ref|XP_009129295.1|  PREDICTED: major pollen allergen Ole e 10-like   87.0    7e-18   
ref|XP_006584863.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  92.0    7e-18   
ref|XP_010465199.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4    92.4    7e-18   
ref|XP_009416739.1|  PREDICTED: PLASMODESMATA CALLOSE-BINDING PRO...  88.6    7e-18   
ref|XP_010657137.1|  PREDICTED: major pollen allergen Ole e 10-li...  89.4    7e-18   
emb|CDP00829.1|  unnamed protein product                              92.0    7e-18   
ref|XP_008361481.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  92.0    7e-18   
gb|KHN38251.1|  Glucan endo-1,3-beta-glucosidase 12                   90.9    7e-18   
ref|XP_003616282.1|  Glucan endo-1,3-beta-glucosidase                 92.8    7e-18   
ref|XP_010461223.1|  PREDICTED: major pollen allergen Ole e 10-like   86.7    7e-18   
ref|XP_009771299.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  89.4    7e-18   
gb|KDP40391.1|  hypothetical protein JCGZ_04210                       86.3    7e-18   
ref|XP_002527772.1|  Glucan endo-1,3-beta-glucosidase precursor, ...  92.4    8e-18   
ref|XP_006580439.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  92.0    8e-18   
emb|CDY59252.1|  BnaA05g36990D                                        90.9    8e-18   
ref|XP_010066584.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  92.0    8e-18   
ref|XP_003599873.1|  Glucan endo-1,3-beta-glucosidase                 89.0    8e-18   
ref|XP_006584862.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  91.7    8e-18   
ref|XP_002283721.1|  PREDICTED: PLASMODESMATA CALLOSE-BINDING PRO...  89.4    8e-18   
gb|KEH28239.1|  glucan endo-1,3-beta-glucosidase-like protein         92.4    8e-18   
gb|AAO42272.1|  unknown protein                                       90.1    8e-18   
ref|XP_010924311.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  89.7    8e-18   
ref|XP_002888551.1|  glycosyl hydrolase family protein 17             86.7    8e-18   
ref|XP_010275848.1|  PREDICTED: PLASMODESMATA CALLOSE-BINDING PRO...  89.4    9e-18   
ref|XP_003532507.2|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  92.0    9e-18   
gb|KDP29903.1|  hypothetical protein JCGZ_18472                       86.7    9e-18   
gb|EPS65983.1|  hypothetical protein M569_08793                       91.3    9e-18   
ref|XP_010246970.1|  PREDICTED: extensin-like                         90.1    9e-18   
gb|EYU42763.1|  hypothetical protein MIMGU_mgv1a016537mg              86.7    1e-17   
ref|XP_004169896.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  87.4    1e-17   
ref|XP_006838228.1|  hypothetical protein AMTR_s00217p00027050        86.7    1e-17   
ref|XP_011014521.1|  PREDICTED: extensin-like                         90.1    1e-17   
ref|XP_008650070.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  89.4    1e-17   
ref|XP_011026266.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  89.4    1e-17   
ref|XP_008650071.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  89.4    1e-17   
ref|XP_010460010.1|  PREDICTED: major pollen allergen Ole e 10-like   86.3    1e-17   
gb|KHN41343.1|  Glucan endo-1,3-beta-glucosidase 7                    89.7    1e-17   
ref|XP_008460530.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  91.3    1e-17   
ref|XP_009400648.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  88.2    1e-17   
ref|XP_006587123.1|  PREDICTED: DNA-directed RNA polymerase II su...  89.7    1e-17   
ref|XP_011021801.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  91.3    1e-17   
ref|XP_009106673.1|  PREDICTED: leucine-rich repeat extensin-like...  90.1    1e-17   
ref|XP_009106672.1|  PREDICTED: leucine-rich repeat extensin-like...  90.1    1e-17   
ref|XP_010459998.1|  PREDICTED: major pollen allergen Ole e 10-like   85.9    1e-17   
emb|CDX88545.1|  BnaC06g39890D                                        90.1    1e-17   
ref|XP_009106670.1|  PREDICTED: leucine-rich repeat extensin-like...  90.1    1e-17   
emb|CDY31214.1|  BnaC08g15090D                                        91.7    1e-17   
emb|CDY23618.1|  BnaC05g39760D                                        90.5    1e-17   
ref|XP_008460531.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  91.3    1e-17   
ref|XP_004293456.2|  PREDICTED: PLASMODESMATA CALLOSE-BINDING PRO...  86.7    1e-17   
gb|KHG17836.1|  hypothetical protein F383_07126                       91.3    1e-17   
ref|XP_002316740.2|  hypothetical protein POPTR_0011s02870g           89.4    1e-17   
ref|XP_010276546.1|  PREDICTED: LOW QUALITY PROTEIN: G8 domain-co...  91.7    1e-17   
ref|XP_010276339.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  90.9    1e-17   
ref|XP_003519593.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  90.9    1e-17   
ref|XP_011021800.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  91.3    2e-17   
ref|XP_011021799.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  91.3    2e-17   
ref|XP_011045314.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  89.0    2e-17   
ref|XP_002962275.1|  hypothetical protein SELMODRAFT_76256            90.1    2e-17   
emb|CDX87377.1|  BnaA07g34960D                                        89.7    2e-17   
ref|XP_006369883.1|  hypothetical protein POPTR_0001s34420g           89.4    2e-17   
ref|XP_011096055.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 1    91.3    2e-17   
ref|XP_002965189.1|  hypothetical protein SELMODRAFT_82513            90.1    2e-17   
ref|XP_007050033.1|  Plasmodesmata callose-binding protein 5          87.4    2e-17   
ref|XP_010478822.1|  PREDICTED: major pollen allergen Ole e 10-like   85.9    2e-17   
ref|XP_006649652.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  91.3    2e-17   
ref|XP_007014685.1|  O-Glycosyl hydrolases family 17 protein isof...  90.9    2e-17   
gb|KHG04684.1|  hypothetical protein F383_28886                       87.4    2e-17   
gb|EPS63184.1|  hypothetical protein M569_11605                       88.2    2e-17   
ref|XP_002462835.1|  hypothetical protein SORBIDRAFT_02g032805        85.1    2e-17   
gb|EPS62842.1|  hypothetical protein M569_11948                       85.9    2e-17   
gb|EYU29594.1|  hypothetical protein MIMGU_mgv1a019020mg              88.2    2e-17   
gb|KJB71452.1|  hypothetical protein B456_011G124300                  87.0    2e-17   
gb|KJB22745.1|  hypothetical protein B456_004G064200                  90.9    2e-17   
ref|XP_008450517.1|  PREDICTED: flocculation protein FLO11            89.4    2e-17   
gb|KHN06460.1|  Glucan endo-1,3-beta-glucosidase 7                    88.6    2e-17   
ref|XP_010276332.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  90.9    2e-17   
ref|XP_004504416.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  85.9    2e-17   
ref|XP_010542117.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  85.9    2e-17   
ref|XP_011098085.1|  PREDICTED: PLASMODESMATA CALLOSE-BINDING PRO...  88.2    2e-17   
ref|XP_010243683.1|  PREDICTED: PLASMODESMATA CALLOSE-BINDING PRO...  88.6    2e-17   
ref|XP_006580863.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  88.2    2e-17   
ref|XP_004497480.1|  PREDICTED: extensin-like                         90.1    2e-17   
ref|XP_011095753.1|  PREDICTED: leucine-rich repeat extensin-like...  88.6    2e-17   
ref|XP_011005841.1|  PREDICTED: PLASMODESMATA CALLOSE-BINDING PRO...  88.6    2e-17   
ref|NP_001048260.1|  Os02g0771700                                     90.5    2e-17   
ref|XP_011045313.1|  PREDICTED: probable glucan endo-1,3-beta-glu...  88.6    2e-17   
ref|XP_011005840.1|  PREDICTED: mucin-2-like isoform X1               89.0    2e-17   
ref|XP_009397776.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  90.9    2e-17   
gb|KHG14816.1|  hypothetical protein F383_17797                       90.5    2e-17   
gb|KHN37471.1|  Glucan endo-1,3-beta-glucosidase 7                    89.0    2e-17   
ref|XP_009377448.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  88.2    2e-17   
ref|XP_006597938.1|  PREDICTED: DNA-directed RNA polymerase II su...  89.0    2e-17   
ref|XP_008783928.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  87.4    2e-17   
ref|XP_003562972.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  90.9    2e-17   
ref|XP_010499944.1|  PREDICTED: major pollen allergen Ole e 10-like   85.5    2e-17   
ref|XP_006430586.1|  hypothetical protein CICLE_v10011549mg           90.5    2e-17   
ref|XP_004140301.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  90.5    2e-17   
gb|KHG04722.1|  hypothetical protein F383_29074                       90.5    3e-17   
ref|XP_011460394.1|  PREDICTED: carbohydrate-binding X8 domain-co...  88.6    3e-17   
ref|XP_009589790.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  88.2    3e-17   
gb|KEH40580.1|  glucan endo-1,3-beta-glucosidase-like protein         90.5    3e-17   
ref|XP_002312452.2|  glucan endo-1 family protein                     90.1    3e-17   
ref|XP_009394228.1|  PREDICTED: PLASMODESMATA CALLOSE-BINDING PRO...  88.2    3e-17   
ref|NP_001184967.1|  O-glycosyl hydrolases family 17 protein          90.5    3e-17   
ref|XP_008342358.1|  PREDICTED: major pollen allergen Ole e 10-li...  87.4    3e-17   
gb|KJB10512.1|  hypothetical protein B456_001G204900                  90.9    3e-17   
ref|XP_002315076.2|  hypothetical protein POPTR_0010s18070g           88.2    3e-17   
ref|XP_006647977.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  90.1    3e-17   
gb|KEH40581.1|  glucan endo-1,3-beta-glucosidase-like protein         90.5    3e-17   
ref|XP_010102154.1|  hypothetical protein L484_021388                 87.8    3e-17   
ref|XP_009392476.1|  PREDICTED: PLASMODESMATA CALLOSE-BINDING PRO...  87.0    3e-17   
ref|XP_011023912.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  90.1    3e-17   
ref|NP_001117561.1|  carbohydrate-binding X8 domain-containing pr...  84.7    3e-17   
gb|KHG18393.1|  hypothetical protein F383_22096                       90.1    3e-17   
ref|XP_006378440.1|  hypothetical protein POPTR_0010s11880g           90.1    3e-17   
ref|XP_011070588.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 3    90.1    3e-17   
ref|XP_010557705.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  85.1    3e-17   
ref|XP_010236896.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  90.1    3e-17   
ref|XP_002314794.2|  hypothetical protein POPTR_0010s11880g           90.1    3e-17   
ref|XP_006828511.1|  hypothetical protein AMTR_s00060p00188740        90.1    3e-17   
gb|KJB30775.1|  hypothetical protein B456_005G159100                  89.7    4e-17   
emb|CDP17320.1|  unnamed protein product                              88.2    4e-17   
ref|XP_004308227.2|  PREDICTED: extensin                              88.6    4e-17   
dbj|BAJ87688.1|  predicted protein                                    89.7    4e-17   
ref|XP_006575649.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  87.8    4e-17   
ref|XP_010513892.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  90.1    4e-17   
ref|XP_008342357.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  87.8    4e-17   
ref|XP_007160409.1|  hypothetical protein PHAVU_002G319500g           90.1    4e-17   
gb|KHN00662.1|  Glucan endo-1,3-beta-glucosidase 3                    89.7    4e-17   
gb|KDP21203.1|  hypothetical protein JCGZ_21674                       87.8    4e-17   
ref|NP_974558.1|  carbohydrate-binding X8 domain-containing protein   84.7    4e-17   
ref|XP_009407040.1|  PREDICTED: PLASMODESMATA CALLOSE-BINDING PRO...  86.7    4e-17   
ref|XP_008464181.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  84.7    4e-17   
ref|XP_007045239.1|  O-Glycosyl hydrolases family 17 protein          89.7    4e-17   
ref|XP_008670470.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  90.5    4e-17   
ref|XP_010424935.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 3    89.7    4e-17   
ref|XP_011014137.1|  PREDICTED: extensin-like                         88.2    4e-17   
ref|XP_010926435.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  87.8    4e-17   
ref|XP_003577202.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  89.7    4e-17   
ref|XP_004984251.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  89.7    4e-17   
ref|XP_006395869.1|  hypothetical protein EUTSA_v10004013mg           89.7    4e-17   
gb|KJB30776.1|  hypothetical protein B456_005G159100                  89.7    4e-17   
ref|XP_006394298.1|  hypothetical protein EUTSA_v10005350mg           84.7    4e-17   
ref|XP_008780692.1|  PREDICTED: major pollen allergen Ole e 10-like   84.7    4e-17   
gb|KHN38331.1|  Glucan endo-1,3-beta-glucosidase 1                    88.2    4e-17   
ref|XP_010502143.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  89.7    4e-17   
ref|XP_006855931.1|  hypothetical protein AMTR_s00037p00209440        89.7    4e-17   
ref|XP_006417308.1|  hypothetical protein EUTSA_v10006713mg           90.9    4e-17   
ref|XP_003518194.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  89.7    5e-17   
ref|XP_006395867.1|  hypothetical protein EUTSA_v10004013mg           89.7    5e-17   
ref|XP_009110702.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 1    89.7    5e-17   
gb|AAK85402.2|  beta-1,3-glucanase                                    89.7    5e-17   
ref|XP_010689202.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12   87.0    5e-17   
ref|XP_003552878.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  89.7    5e-17   
ref|XP_004140010.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  84.7    5e-17   
ref|XP_007225735.1|  hypothetical protein PRUPE_ppa005356mg           89.4    5e-17   
gb|KHN07542.1|  Glucan endo-1,3-beta-glucosidase 2                    89.7    5e-17   
gb|KHN03485.1|  Glucan endo-1,3-beta-glucosidase 1                    87.8    5e-17   
ref|XP_007151812.1|  hypothetical protein PHAVU_004G077000g           89.7    5e-17   
ref|XP_010458590.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  89.7    5e-17   
ref|XP_010476119.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  89.7    5e-17   
ref|XP_002531922.1|  Glucan endo-1,3-beta-glucosidase precursor, ...  89.7    5e-17   
ref|XP_010100650.1|  Glucan endo-1,3-beta-glucosidase 3               89.4    5e-17   
ref|XP_011085624.1|  PREDICTED: PLASMODESMATA CALLOSE-BINDING PRO...  87.4    5e-17   
ref|XP_002876767.1|  hypothetical protein ARALYDRAFT_484077           89.7    5e-17   
ref|XP_008221445.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 3    89.7    5e-17   
ref|XP_006302576.1|  hypothetical protein CARUB_v10020684mg           87.8    5e-17   
ref|XP_006293165.1|  hypothetical protein CARUB_v10019481mg           89.7    5e-17   
ref|XP_010458589.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  89.7    5e-17   
ref|XP_010493346.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 1    89.7    5e-17   
ref|XP_010476120.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  89.7    5e-17   
ref|XP_006837267.1|  hypothetical protein AMTR_s00112p00108890        89.4    5e-17   
ref|XP_008464180.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  84.3    5e-17   
gb|KDP25782.1|  hypothetical protein JCGZ_22504                       89.7    5e-17   
gb|KHG04965.1|  hypothetical protein F383_30444                       89.4    5e-17   
gb|KFK43454.1|  hypothetical protein AALP_AA1G127200                  89.7    5e-17   
ref|XP_006301393.1|  hypothetical protein CARUB_v10021806mg           84.3    6e-17   
ref|XP_010458588.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  89.7    6e-17   
ref|XP_006422258.1|  hypothetical protein CICLE_v10005428mg           87.4    6e-17   
gb|AAO64485.1|  putative beta 1-3-glucanase                           87.0    6e-17   
ref|XP_006394296.1|  hypothetical protein EUTSA_v10005544mg           84.7    6e-17   
ref|XP_007032975.1|  Glucan endo-1,3-beta-glucosidase, putative i...  89.4    6e-17   
ref|NP_001118954.1|  carbohydrate-binding X8 domain-containing pr...  84.3    6e-17   
gb|KHN23902.1|  Glucan endo-1,3-beta-glucosidase 12                   89.0    6e-17   
gb|EAZ24771.1|  hypothetical protein OsJ_08544                        89.0    6e-17   
ref|XP_006306488.1|  hypothetical protein CARUB_v10012467mg           90.5    6e-17   
gb|KDP22732.1|  hypothetical protein JCGZ_02520                       85.5    6e-17   
ref|XP_007146346.1|  hypothetical protein PHAVU_006G032800g           87.0    6e-17   
ref|XP_011026260.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  87.0    6e-17   
ref|XP_006841134.1|  hypothetical protein AMTR_s00086p00121550        86.7    6e-17   
ref|XP_009146477.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4    89.4    7e-17   
ref|XP_003579226.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  85.5    7e-17   
ref|XP_009402844.1|  PREDICTED: pollen-specific leucine-rich repe...  87.8    7e-17   
gb|KJB15377.1|  hypothetical protein B456_002G174100                  89.0    7e-17   
gb|ABK28115.1|  unknown                                               84.0    7e-17   
ref|XP_006482110.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  89.4    7e-17   
ref|XP_006469049.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  85.9    7e-17   
ref|XP_007034399.1|  Carbohydrate-binding X8 domain superfamily p...  87.4    7e-17   
ref|XP_003544773.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  89.0    7e-17   
ref|NP_565269.1|  glucan endo-1,3-beta-glucosidase 3                  89.4    7e-17   
ref|XP_008800687.1|  PREDICTED: uncharacterized protein PB18E9.04...  87.4    7e-17   
gb|KJB23365.1|  hypothetical protein B456_004G094500                  89.0    7e-17   
ref|XP_008806478.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...  89.4    7e-17   



>ref|XP_009776400.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Nicotiana sylvestris]
Length=496

 Score =   170 bits (430),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 77/84 (92%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            CIASS+ASEADL+NAL+WACGSGNVDCSAIQPSQPCFEPDN+ SHAS+AFNSYYQQNGAT
Sbjct  367  CIASSSASEADLQNALSWACGSGNVDCSAIQPSQPCFEPDNIASHASYAFNSYYQQNGAT  426

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
            D+ACSFGGVGVRTNKNPSYDNCLY
Sbjct  427  DIACSFGGVGVRTNKNPSYDNCLY  450



>ref|XP_004251644.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Solanum lycopersicum]
Length=496

 Score =   169 bits (428),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 77/84 (92%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            CIASS+ASEA+L+NAL+WACGSGNVDCSAIQPSQPCFEPDNL SHASFAFNSYYQQNGAT
Sbjct  366  CIASSSASEAELQNALSWACGSGNVDCSAIQPSQPCFEPDNLASHASFAFNSYYQQNGAT  425

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
            D+AC+FGGVGVRTNKNPSYDNCLY
Sbjct  426  DIACTFGGVGVRTNKNPSYDNCLY  449



>ref|XP_009628676.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Nicotiana tomentosiformis]
Length=496

 Score =   168 bits (426),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 77/84 (92%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            CIASS+ASEADL+NAL+WACGSGNVDCSAIQPSQPCFEPDN  SHAS+AFNSYYQQNGAT
Sbjct  367  CIASSSASEADLQNALSWACGSGNVDCSAIQPSQPCFEPDNTASHASYAFNSYYQQNGAT  426

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
            D+ACSFGGVGVRTNKNPSYDNCLY
Sbjct  427  DIACSFGGVGVRTNKNPSYDNCLY  450



>ref|NP_001275363.1| glucan endo-1,3-beta-glucosidase 13-like precursor [Solanum tuberosum]
 gb|AFU52637.1| beta-1,3-glucanase 2 [Solanum tuberosum]
Length=496

 Score =   168 bits (425),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 76/84 (90%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            CIASS+ASEA+L+NAL+WACGSGNVDCSAIQPSQPCFEPDN  SHASFAFNSYYQQNGAT
Sbjct  366  CIASSSASEAELQNALSWACGSGNVDCSAIQPSQPCFEPDNFASHASFAFNSYYQQNGAT  425

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
            D+AC+FGGVGVRTNKNPSYDNCLY
Sbjct  426  DIACTFGGVGVRTNKNPSYDNCLY  449



>ref|XP_002283473.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Vitis vinifera]
 emb|CBI27983.3| unnamed protein product [Vitis vinifera]
Length=494

 Score =   167 bits (423),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 75/85 (88%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            CIASSTASE DL+NAL+WACG GNVDCSAIQPSQPCFEPDN+VSHASFAFNSYYQQNGAT
Sbjct  366  CIASSTASEMDLQNALDWACGPGNVDCSAIQPSQPCFEPDNVVSHASFAFNSYYQQNGAT  425

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
            D+ACSFGG G++ NKNPSYDNCLYM
Sbjct  426  DIACSFGGSGIKVNKNPSYDNCLYM  450



>ref|XP_010249473.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Nelumbo nucifera]
Length=495

 Score =   163 bits (412),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 74/85 (87%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            CIASSTASE DL+NAL+W CG GNVDCSAIQPSQ C++PD LVSHASFAFNSYYQQNGAT
Sbjct  367  CIASSTASELDLQNALDWTCGPGNVDCSAIQPSQACYQPDTLVSHASFAFNSYYQQNGAT  426

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
            DVACSFGG GV+TNKNPSYDNCLYM
Sbjct  427  DVACSFGGTGVKTNKNPSYDNCLYM  451



>ref|XP_007012990.1| O-Glycosyl hydrolases family 17 protein isoform 2 [Theobroma 
cacao]
 gb|EOY30609.1| O-Glycosyl hydrolases family 17 protein isoform 2 [Theobroma 
cacao]
Length=430

 Score =   162 bits (409),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 73/85 (86%), Positives = 82/85 (96%), Gaps = 0/85 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            CIASS ASE+DL+NAL+WACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGA+
Sbjct  292  CIASSKASESDLQNALDWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAS  351

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
            DVACSFGG GV+ +K+PSYDNC+Y+
Sbjct  352  DVACSFGGNGVKVDKDPSYDNCIYL  376



>ref|XP_007012989.1| O-Glycosyl hydrolases family 17 protein isoform 1 [Theobroma 
cacao]
 gb|EOY30608.1| O-Glycosyl hydrolases family 17 protein isoform 1 [Theobroma 
cacao]
Length=505

 Score =   162 bits (409),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 73/85 (86%), Positives = 82/85 (96%), Gaps = 0/85 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            CIASS ASE+DL+NAL+WACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGA+
Sbjct  367  CIASSKASESDLQNALDWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAS  426

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
            DVACSFGG GV+ +K+PSYDNC+Y+
Sbjct  427  DVACSFGGNGVKVDKDPSYDNCIYL  451



>ref|XP_011078239.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Sesamum 
indicum]
Length=494

 Score =   161 bits (408),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 73/85 (86%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            CIAS TAS+ADL+N L+WAC SGNVDCSAIQPSQPCFEPDNL SHAS+AFNSYYQQNGAT
Sbjct  368  CIASPTASDADLKNGLDWACSSGNVDCSAIQPSQPCFEPDNLASHASYAFNSYYQQNGAT  427

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
            D+ACSFGG GVRTNKNPSYD+CLY+
Sbjct  428  DIACSFGGAGVRTNKNPSYDSCLYV  452



>gb|KJB27172.1| hypothetical protein B456_004G282300 [Gossypium raimondii]
Length=504

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/85 (85%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            CIASS ASEADL+NA++WACG GNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGA+
Sbjct  366  CIASSKASEADLQNAIDWACGPGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAS  425

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
            DVACSFGG GV+ +K+PSYDNC+Y+
Sbjct  426  DVACSFGGKGVKVDKDPSYDNCIYL  450



>emb|CDP03239.1| unnamed protein product [Coffea canephora]
Length=499

 Score =   161 bits (407),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 71/84 (85%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A+S AS+ADL+NAL+WACGSGNVDCSAIQPSQPCFEPDNL+SHAS+AFN YYQQNGAT
Sbjct  366  CVAASNASDADLQNALDWACGSGNVDCSAIQPSQPCFEPDNLISHASYAFNGYYQQNGAT  425

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
            D+ACSFGG G+RTNKNPSYDNC+Y
Sbjct  426  DIACSFGGNGLRTNKNPSYDNCIY  449



>ref|XP_002514201.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
 gb|EEF48155.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
Length=511

 Score =   160 bits (405),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 72/85 (85%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            CIAS+ AS+ DL+NAL+WACGSGNVDCSAIQPSQPCFEPD LVSHASFAFN YYQQNGAT
Sbjct  368  CIASNNASQLDLQNALDWACGSGNVDCSAIQPSQPCFEPDTLVSHASFAFNGYYQQNGAT  427

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
            DVACSFGG GV+ +K+PSYDNCLYM
Sbjct  428  DVACSFGGTGVKVDKDPSYDNCLYM  452



>ref|XP_008242469.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 isoform X1 [Prunus 
mume]
Length=497

 Score =   160 bits (404),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 70/85 (82%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            CIASS ASE DL+NAL+WACG GNVDC+AIQPSQPCFEPDN V+HASFAFN+YYQQNGAT
Sbjct  367  CIASSKASELDLQNALDWACGPGNVDCTAIQPSQPCFEPDNTVAHASFAFNNYYQQNGAT  426

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
            DVACSFGG G++ +KNPSYDNC+YM
Sbjct  427  DVACSFGGTGIKVDKNPSYDNCIYM  451



>ref|XP_008242470.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 isoform X2 [Prunus 
mume]
Length=491

 Score =   160 bits (404),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 70/85 (82%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            CIASS ASE DL+NAL+WACG GNVDC+AIQPSQPCFEPDN V+HASFAFN+YYQQNGAT
Sbjct  361  CIASSKASELDLQNALDWACGPGNVDCTAIQPSQPCFEPDNTVAHASFAFNNYYQQNGAT  420

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
            DVACSFGG G++ +KNPSYDNC+YM
Sbjct  421  DVACSFGGTGIKVDKNPSYDNCIYM  445



>ref|XP_007204831.1| hypothetical protein PRUPE_ppa1027206mg [Prunus persica]
 gb|EMJ06030.1| hypothetical protein PRUPE_ppa1027206mg [Prunus persica]
Length=497

 Score =   160 bits (404),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 70/85 (82%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            CIASS ASE DL+NAL+WACG GNVDC+AIQPSQPCFEPDN V+HASFAFN+YYQQNGAT
Sbjct  367  CIASSKASELDLQNALDWACGPGNVDCTAIQPSQPCFEPDNTVAHASFAFNNYYQQNGAT  426

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
            DVACSFGG G++ +KNPSYDNC+YM
Sbjct  427  DVACSFGGTGIKVDKNPSYDNCIYM  451



>ref|XP_011009861.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Populus euphratica]
Length=499

 Score =   159 bits (403),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 71/85 (84%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            CIAS+ AS+ DL+NAL+WACGSGNVDCSAIQPSQPCFEPD LVSHAS+AFNSYYQQNGA+
Sbjct  368  CIASNNASQLDLQNALDWACGSGNVDCSAIQPSQPCFEPDTLVSHASYAFNSYYQQNGAS  427

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
            DVACSFGG GV+ NK+PSYDNC+YM
Sbjct  428  DVACSFGGTGVKVNKDPSYDNCMYM  452



>gb|KHG26459.1| hypothetical protein F383_04538 [Gossypium arboreum]
Length=488

 Score =   159 bits (402),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 71/85 (84%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            CIASS ASEADL+NA++WACG GNVDCSAIQPSQPCFEPDNL SHASFAFNSYYQQNGA+
Sbjct  350  CIASSKASEADLQNAIDWACGPGNVDCSAIQPSQPCFEPDNLASHASFAFNSYYQQNGAS  409

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
            DVACSFGG GV+ +K+PSYDNC+Y+
Sbjct  410  DVACSFGGKGVKVDKDPSYDNCIYL  434



>ref|XP_009352572.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Pyrus x bretschneideri]
Length=502

 Score =   159 bits (402),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 69/85 (81%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            CIASS ASE DL+NAL+WACG GNVDC AIQPSQPCFEPDN V+HASFAFN+YYQQNGAT
Sbjct  371  CIASSKASELDLQNALDWACGPGNVDCRAIQPSQPCFEPDNTVAHASFAFNTYYQQNGAT  430

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
            D+ACSFGG G++ +KNPSYDNC+YM
Sbjct  431  DIACSFGGTGIKVDKNPSYDNCIYM  455



>ref|XP_008337610.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Malus domestica]
Length=503

 Score =   159 bits (402),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 69/85 (81%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            CIASS ASE DL+NAL+WACG GNVDC AIQPSQPCFEPDN V+HASFAFN+YYQQNGAT
Sbjct  372  CIASSKASELDLQNALDWACGPGNVDCRAIQPSQPCFEPDNTVAHASFAFNTYYQQNGAT  431

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
            D+ACSFGG G++ +KNPSYDNC+YM
Sbjct  432  DIACSFGGTGIKVDKNPSYDNCIYM  456



>ref|XP_010267108.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Nelumbo nucifera]
Length=495

 Score =   159 bits (401),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 72/85 (85%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            CIASSTASE DL+NAL+WACG GNVDCSAIQPSQ C++PD L+SHAS+AFNSYYQQ GAT
Sbjct  369  CIASSTASELDLQNALDWACGPGNVDCSAIQPSQACYQPDTLLSHASYAFNSYYQQTGAT  428

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
            DVACSFGG GV+TNKNPSYDNCLYM
Sbjct  429  DVACSFGGTGVKTNKNPSYDNCLYM  453



>ref|XP_008795501.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Phoenix dactylifera]
Length=502

 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/84 (83%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+ASS ASE DL+NALNWACG+GNVDCSAIQPSQPC++PD L+SHASFAFNSYYQQNGAT
Sbjct  372  CVASSNASELDLQNALNWACGAGNVDCSAIQPSQPCYQPDTLLSHASFAFNSYYQQNGAT  431

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
            DVACSFGG GV+T KNPSYD C+Y
Sbjct  432  DVACSFGGTGVKTTKNPSYDKCIY  455



>ref|XP_004287489.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Fragaria vesca 
subsp. vesca]
Length=498

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/85 (82%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            CIASS ASEADL+NAL+WACGSGNVDC+ IQPSQPCFEPDN VSHAS+AFN YYQQNGAT
Sbjct  367  CIASSKASEADLQNALDWACGSGNVDCTPIQPSQPCFEPDNTVSHASYAFNVYYQQNGAT  426

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
            D+ACSFGG G++ +KNPSYD+CLYM
Sbjct  427  DIACSFGGSGIKVDKNPSYDSCLYM  451



>ref|XP_006371969.1| glycosyl hydrolase family 17 family protein [Populus trichocarpa]
 gb|ERP49766.1| glycosyl hydrolase family 17 family protein [Populus trichocarpa]
Length=499

 Score =   157 bits (398),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 70/85 (82%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            CIAS+ AS+ DL+NAL+WACGSG+VDCSAIQPSQPCFEPD LVSHAS+AFNSYYQQNGA+
Sbjct  368  CIASNNASQLDLQNALDWACGSGDVDCSAIQPSQPCFEPDTLVSHASYAFNSYYQQNGAS  427

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
            DVACSFGG GV+ NK+PSYDNC+YM
Sbjct  428  DVACSFGGTGVKVNKDPSYDNCMYM  452



>ref|XP_006451337.1| hypothetical protein CICLE_v10008080mg [Citrus clementina]
 ref|XP_006475345.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Citrus sinensis]
 gb|ESR64577.1| hypothetical protein CICLE_v10008080mg [Citrus clementina]
 gb|KDO55851.1| hypothetical protein CISIN_1g010782mg [Citrus sinensis]
Length=501

 Score =   157 bits (398),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 70/85 (82%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            CIAS+ ASEADL+NAL+WACG GNVDCSAIQPSQPC+EPD L+SHASFA NSYYQQNGAT
Sbjct  368  CIASTKASEADLQNALDWACGPGNVDCSAIQPSQPCYEPDTLLSHASFAINSYYQQNGAT  427

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
            D+ACSFGG GV+ +KNPSYDNC+YM
Sbjct  428  DIACSFGGNGVKVDKNPSYDNCVYM  452



>gb|AIR93910.1| glucanase [Cicer arietinum]
Length=454

 Score =   156 bits (395),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 69/85 (81%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            CIAS+ ASE DL+NAL+WACG GNVDC AIQPSQPCFEPDNL SHASFAFNSYYQQNGA+
Sbjct  367  CIASTKASEIDLQNALDWACGPGNVDCRAIQPSQPCFEPDNLASHASFAFNSYYQQNGAS  426

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
            DVACSFGG GV+ +K+PSYD C+YM
Sbjct  427  DVACSFGGTGVKVDKDPSYDKCIYM  451



>gb|EYU30694.1| hypothetical protein MIMGU_mgv1a005031mg [Erythranthe guttata]
Length=500

 Score =   157 bits (397),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 69/85 (81%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+AS+ ASE+DL N L+WACG GNVDCSAIQPSQPCFEPD+L SHAS+AFNSYYQQNGAT
Sbjct  373  CVASNNASESDLRNGLDWACGPGNVDCSAIQPSQPCFEPDSLASHASYAFNSYYQQNGAT  432

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
            D+AC+FGG G RTNKNPSYDNC+YM
Sbjct  433  DIACTFGGAGFRTNKNPSYDNCMYM  457



>ref|XP_007160277.1| hypothetical protein PHAVU_002G307800g [Phaseolus vulgaris]
 gb|ESW32271.1| hypothetical protein PHAVU_002G307800g [Phaseolus vulgaris]
Length=501

 Score =   157 bits (396),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 68/85 (80%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            CIAS+ AS+ DL+NA++WACG GNVDC+AIQPSQPCFEPDNL SHASFAFNSYYQQNGA+
Sbjct  367  CIASTKASQIDLQNAIDWACGPGNVDCTAIQPSQPCFEPDNLASHASFAFNSYYQQNGAS  426

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
            DVACSFGG GV+ +K+PSYDNC+YM
Sbjct  427  DVACSFGGTGVKVDKDPSYDNCIYM  451



>gb|KHG04832.1| hypothetical protein F383_29565 [Gossypium arboreum]
Length=512

 Score =   157 bits (397),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 71/85 (84%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            CIASS ASEADL+NAL+WACG GNVDCS IQPSQPCFEPDN +SHASFAFNSYYQQNGAT
Sbjct  366  CIASSKASEADLQNALDWACGPGNVDCSPIQPSQPCFEPDNTLSHASFAFNSYYQQNGAT  425

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
            DVACSFGG GV+ +K+PSYDNC+Y+
Sbjct  426  DVACSFGGNGVKVDKDPSYDNCIYV  450



>gb|AGV54422.1| glucan endo-1,3-beta-glucosidase 13-like protein [Phaseolus vulgaris]
Length=503

 Score =   157 bits (396),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 68/85 (80%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            CIAS+ AS+ DL+NA++WACG GNVDC+AIQPSQPCFEPDNL SHASFAFNSYYQQNGA+
Sbjct  369  CIASTKASQIDLQNAIDWACGPGNVDCTAIQPSQPCFEPDNLASHASFAFNSYYQQNGAS  428

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
            DVACSFGG GV+ +K+PSYDNC+YM
Sbjct  429  DVACSFGGTGVKVDKDPSYDNCIYM  453



>gb|KJB65051.1| hypothetical protein B456_010G078300 [Gossypium raimondii]
Length=506

 Score =   157 bits (396),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 71/85 (84%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            CIASS ASEADL+NAL+WACG GNVDCS IQPSQPCFEPDN +SHASFAFNSYYQQNGAT
Sbjct  367  CIASSKASEADLQNALDWACGPGNVDCSPIQPSQPCFEPDNTLSHASFAFNSYYQQNGAT  426

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
            DVACSFGG GV+ +K+PSYDNC+Y+
Sbjct  427  DVACSFGGNGVKVDKDPSYDNCIYV  451



>ref|XP_010914932.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Elaeis guineensis]
Length=527

 Score =   157 bits (396),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 69/84 (82%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+AS+ ASE DL+NAL+WACG GNVDCSAIQPSQPC++PD LVSHAS+AFNSYYQQNGAT
Sbjct  396  CVASTNASELDLQNALDWACGPGNVDCSAIQPSQPCYQPDTLVSHASYAFNSYYQQNGAT  455

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
            DVACSFGG GVRT K+PSYDNC+Y
Sbjct  456  DVACSFGGTGVRTTKDPSYDNCIY  479



>ref|XP_008799775.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Phoenix 
dactylifera]
Length=526

 Score =   157 bits (396),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 69/84 (82%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+ASS ASE DL+NALNWACGSGNVDCSAIQPSQPC++PD L SHAS+AFNSYYQQNGAT
Sbjct  396  CVASSNASELDLQNALNWACGSGNVDCSAIQPSQPCYQPDTLASHASYAFNSYYQQNGAT  455

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
            DVACSFGG G+RT K+PSY+NC+Y
Sbjct  456  DVACSFGGAGLRTRKDPSYENCIY  479



>ref|XP_010545323.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Tarenaya hassleriana]
Length=501

 Score =   156 bits (394),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 70/85 (82%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            CIASS ASE DL +AL+WACG GNVDC+AIQPSQPCFEPD LVSHASF FNSY+QQNGAT
Sbjct  367  CIASSKASEKDLRSALDWACGPGNVDCTAIQPSQPCFEPDTLVSHASFVFNSYFQQNGAT  426

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
            DVACSFGG GV+ NK+PSYDNCLY+
Sbjct  427  DVACSFGGAGVKVNKDPSYDNCLYV  451



>gb|AET05176.2| glucan endo-1,3-beta-glucosidase-like protein [Medicago truncatula]
Length=480

 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/85 (80%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            CIASS ASE DL+NAL+WACG GNVDC+A+QPSQPCFEPDNL SHAS+ FNSYYQQNGA+
Sbjct  335  CIASSKASEIDLQNALDWACGPGNVDCTAVQPSQPCFEPDNLASHASYVFNSYYQQNGAS  394

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
            DVACSFGG GV+ +K+PSYDNC+YM
Sbjct  395  DVACSFGGTGVKIDKDPSYDNCIYM  419



>ref|XP_006584807.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Glycine 
max]
Length=498

 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/85 (80%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            CIASS AS+ DL+NA++WACG GNVDC+AIQPSQPCFEPDNL SHASFAFNSYYQQNGA+
Sbjct  367  CIASSKASQIDLQNAIDWACGPGNVDCTAIQPSQPCFEPDNLASHASFAFNSYYQQNGAS  426

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
            DVACSFGG GV+ +K+PSYD C+YM
Sbjct  427  DVACSFGGTGVKVDKDPSYDKCIYM  451



>gb|KHN16652.1| Glucan endo-1,3-beta-glucosidase 13 [Glycine soja]
Length=498

 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/85 (80%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            CIASS AS+ DL+NA++WACG GNVDC+AIQPSQPCFEPDNL SHASFAFNSYYQQNGA+
Sbjct  367  CIASSKASQIDLQNAIDWACGPGNVDCTAIQPSQPCFEPDNLASHASFAFNSYYQQNGAS  426

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
            DVACSFGG GV+ +K+PSYD C+YM
Sbjct  427  DVACSFGGTGVKVDKDPSYDKCIYM  451



>gb|KDP33779.1| hypothetical protein JCGZ_07350 [Jatropha curcas]
Length=499

 Score =   155 bits (391),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 69/85 (81%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            CIASS AS+ DL++AL+WACG GNVDCSAIQPSQPCFEPD L+SHAS+AFNSYYQQNGA+
Sbjct  367  CIASSNASQLDLQSALDWACGPGNVDCSAIQPSQPCFEPDTLLSHASYAFNSYYQQNGAS  426

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
            DVACSFGG GV+ +K+PSYDNCLYM
Sbjct  427  DVACSFGGAGVKVDKDPSYDNCLYM  451



>ref|XP_003620800.1| Glucan endo-1,3-beta-glucosidase, partial [Medicago truncatula]
Length=411

 Score =   154 bits (388),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 69/86 (80%), Positives = 80/86 (93%), Gaps = 1/86 (1%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACG-SGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGA  535
            CIASS A++ DL+NA+NWACG SGNVDC+AIQPSQPCFEPDNLVSHAS+AFNSYYQQNGA
Sbjct  274  CIASSNATQLDLQNAINWACGTSGNVDCTAIQPSQPCFEPDNLVSHASYAFNSYYQQNGA  333

Query  534  TDVACSFGGVGVRTNKNPSYDNCLYM  457
            +DVACSFGG GV  +K+P+YDNC+YM
Sbjct  334  SDVACSFGGTGVLVDKDPTYDNCIYM  359



>ref|XP_010049602.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Eucalyptus grandis]
 gb|KCW82303.1| hypothetical protein EUGRSUZ_C03710 [Eucalyptus grandis]
Length=500

 Score =   154 bits (389),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 68/85 (80%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            CIAS+ ASE +L+  L+WACGSGNVDCSAIQPSQPC+EPD LVSHASFAFN YYQQNGAT
Sbjct  367  CIASANASEIELQKGLDWACGSGNVDCSAIQPSQPCYEPDTLVSHASFAFNGYYQQNGAT  426

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
            DVACSFGG G++ +KNPSYD CLYM
Sbjct  427  DVACSFGGAGLKVDKNPSYDKCLYM  451



>ref|XP_006580483.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Glycine max]
Length=499

 Score =   154 bits (388),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 68/84 (81%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            CIASS AS+ DL+NA++WACG GNVDC+AIQPSQPCFEPDNL SHASFAFNSYYQQNGA+
Sbjct  367  CIASSKASQIDLQNAIDWACGPGNVDCTAIQPSQPCFEPDNLASHASFAFNSYYQQNGAS  426

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
            DVACSFGG GV  +K+PSYDNC+Y
Sbjct  427  DVACSFGGTGVTVDKDPSYDNCIY  450



>gb|ABD91577.1| beta-1,3-glucanase [Medicago sativa]
Length=507

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/86 (80%), Positives = 80/86 (93%), Gaps = 1/86 (1%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACG-SGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGA  535
            CIASS A++ DL+NA+NWACG SGNVDC+AIQPSQPCFEPDNLVSHAS+AFNSYYQQNGA
Sbjct  370  CIASSNATQLDLQNAINWACGTSGNVDCTAIQPSQPCFEPDNLVSHASYAFNSYYQQNGA  429

Query  534  TDVACSFGGVGVRTNKNPSYDNCLYM  457
            +DVACSFGG GV  +K+P+YDNC+YM
Sbjct  430  SDVACSFGGTGVLVDKDPTYDNCIYM  455



>gb|ABD91576.1| beta-1,3-glucanase [Medicago sativa]
Length=507

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/86 (80%), Positives = 80/86 (93%), Gaps = 1/86 (1%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACG-SGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGA  535
            CIASS A++ DL+NA+NWACG SGNVDC+AIQPSQPCFEPDNLVSHAS+AFNSYYQQNGA
Sbjct  370  CIASSNATQLDLQNAINWACGTSGNVDCTAIQPSQPCFEPDNLVSHASYAFNSYYQQNGA  429

Query  534  TDVACSFGGVGVRTNKNPSYDNCLYM  457
            +DVACSFGG GV  +K+P+YDNC+YM
Sbjct  430  SDVACSFGGTGVLVDKDPTYDNCIYM  455



>gb|KEH27229.1| glucan endo-1,3-beta-glucosidase-like protein [Medicago truncatula]
Length=507

 Score =   153 bits (386),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/86 (80%), Positives = 80/86 (93%), Gaps = 1/86 (1%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACG-SGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGA  535
            CIASS A++ DL+NA+NWACG SGNVDC+AIQPSQPCFEPDNLVSHAS+AFNSYYQQNGA
Sbjct  370  CIASSNATQLDLQNAINWACGTSGNVDCTAIQPSQPCFEPDNLVSHASYAFNSYYQQNGA  429

Query  534  TDVACSFGGVGVRTNKNPSYDNCLYM  457
            +DVACSFGG GV  +K+P+YDNC+YM
Sbjct  430  SDVACSFGGTGVLVDKDPTYDNCIYM  455



>ref|XP_008450796.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Cucumis melo]
Length=501

 Score =   152 bits (385),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 68/84 (81%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            CIASS AS+ DL+NAL+WACGSGNVDC+ IQPSQPCFEPD L+SHAS+AFNSY+QQNGAT
Sbjct  370  CIASSKASDMDLQNALDWACGSGNVDCTPIQPSQPCFEPDTLLSHASYAFNSYFQQNGAT  429

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
            DVAC FGG GVR N++PSYDNCLY
Sbjct  430  DVACGFGGNGVRVNQDPSYDNCLY  453



>ref|XP_010446151.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Camelina 
sativa]
Length=473

 Score =   151 bits (382),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 67/85 (79%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            CIASS ASE DL+ AL+WACG GNVDC+AIQPSQPCF+PDNLVSHASF FNSY+QQN AT
Sbjct  373  CIASSKASERDLKGALDWACGPGNVDCTAIQPSQPCFQPDNLVSHASFVFNSYFQQNRAT  432

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
            DVACSFGG GV+ NK+PSYD C+Y+
Sbjct  433  DVACSFGGAGVKVNKDPSYDKCIYI  457



>ref|XP_010476823.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Camelina 
sativa]
Length=503

 Score =   151 bits (382),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 67/85 (79%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            CIASS ASE DL+ AL+WACG GNVDC+AIQPSQPCF+PDNLVSHASF FNSY+QQN AT
Sbjct  373  CIASSKASERDLKGALDWACGPGNVDCTAIQPSQPCFQPDNLVSHASFVFNSYFQQNRAT  432

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
            DVACSFGG GV+ NK+PSYD C+Y+
Sbjct  433  DVACSFGGAGVKVNKDPSYDKCIYI  457



>ref|XP_010483135.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Camelina sativa]
Length=509

 Score =   151 bits (382),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 67/85 (79%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            CIASS ASE DL+ AL+WACG GNVDC+AIQPSQPCF+PDNLVSHASF FNSY+QQN AT
Sbjct  373  CIASSKASERDLKGALDWACGPGNVDCTAIQPSQPCFQPDNLVSHASFVFNSYFQQNRAT  432

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
            DVACSFGG GV+ NK+PSYD C+Y+
Sbjct  433  DVACSFGGAGVKVNKDPSYDKCIYI  457



>ref|XP_010924450.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Elaeis guineensis]
Length=496

 Score =   150 bits (380),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+ASS ASE DL+NAL+WACG GNVDCSAIQPSQPC++PD L+SHAS+AFNSYYQQNGAT
Sbjct  366  CVASSNASELDLQNALDWACGPGNVDCSAIQPSQPCYQPDTLLSHASYAFNSYYQQNGAT  425

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
            DVACSFGG GV+  K+PSYD C+Y
Sbjct  426  DVACSFGGTGVKITKDPSYDKCVY  449



>dbj|BAJ85556.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=496

 Score =   150 bits (380),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 66/85 (78%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+AS+  SE  L+N LNWACG GNVDCSAIQPSQPC++PD LVSHAS+AFNSYYQQNGAT
Sbjct  367  CVASTNVSETALQNGLNWACGPGNVDCSAIQPSQPCYQPDTLVSHASYAFNSYYQQNGAT  426

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
            DVAC FGG G+RT K+PSYD CLYM
Sbjct  427  DVACGFGGAGMRTTKDPSYDTCLYM  451



>emb|CDY64970.1| BnaAnng19910D [Brassica napus]
Length=503

 Score =   150 bits (380),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 66/85 (78%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            CIASS ASE +L  AL+WACG GNVDC+AIQPSQPCF+PD LVSHASF FNSY+QQNG T
Sbjct  367  CIASSKASEIELRGALDWACGPGNVDCTAIQPSQPCFQPDTLVSHASFVFNSYFQQNGGT  426

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
            DVACSFGGVGV+ NK+PSYD C+Y+
Sbjct  427  DVACSFGGVGVKVNKDPSYDKCVYI  451



>ref|XP_009120169.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Brassica rapa]
Length=503

 Score =   150 bits (380),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 66/85 (78%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            CIASS ASE +L  AL+WACG GNVDC+AIQPSQPCF+PD LVSHASF FNSY+QQNG T
Sbjct  367  CIASSKASEIELRGALDWACGPGNVDCTAIQPSQPCFQPDTLVSHASFVFNSYFQQNGGT  426

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
            DVACSFGGVGV+ NK+PSYD C+Y+
Sbjct  427  DVACSFGGVGVKVNKDPSYDKCVYI  451



>emb|CDY32869.1| BnaC09g33160D [Brassica napus]
Length=503

 Score =   150 bits (379),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 66/85 (78%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            CIASS ASE +L  AL+WACG GNVDC+AIQPSQPCF+PD LVSHASF FNSY+QQNG T
Sbjct  367  CIASSKASEIELRGALDWACGPGNVDCTAIQPSQPCFQPDTLVSHASFVFNSYFQQNGGT  426

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
            DVACSFGGVGV+ NK+PSYD C+Y+
Sbjct  427  DVACSFGGVGVKVNKDPSYDKCVYI  451



>gb|EEC71452.1| hypothetical protein OsI_03677 [Oryza sativa Indica Group]
Length=493

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/85 (78%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+AS+ ASE DL+N LNWACG GNVDCSAIQPSQPC++PD L SHAS+AFNSYYQQNGA 
Sbjct  364  CVASANASETDLQNGLNWACGPGNVDCSAIQPSQPCYQPDTLASHASYAFNSYYQQNGAN  423

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
            DVAC FGG GVRT K+PSYD C+YM
Sbjct  424  DVACDFGGTGVRTTKDPSYDTCVYM  448



>ref|NP_001044198.1| Os01g0739700 [Oryza sativa Japonica Group]
 dbj|BAD86947.1| putative elicitor inducible beta-1,3-glucanase NtEIG-E76 [Oryza 
sativa Japonica Group]
 dbj|BAF06112.1| Os01g0739700 [Oryza sativa Japonica Group]
 dbj|BAG88936.1| unnamed protein product [Oryza sativa Japonica Group]
Length=493

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/85 (78%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+AS+ ASE DL+N LNWACG GNVDCSAIQPSQPC++PD L SHAS+AFNSYYQQNGA 
Sbjct  364  CVASANASETDLQNGLNWACGPGNVDCSAIQPSQPCYQPDTLASHASYAFNSYYQQNGAN  423

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
            DVAC FGG GVRT K+PSYD C+YM
Sbjct  424  DVACDFGGTGVRTTKDPSYDTCVYM  448



>ref|XP_009394832.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=500

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+ASS AS+ADL+NALNWACGSGNVDCSAIQPSQPC++PD L SHAS+AFN YYQQNGAT
Sbjct  370  CVASSNASDADLQNALNWACGSGNVDCSAIQPSQPCYQPDTLASHASYAFNGYYQQNGAT  429

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
            DVAC+FGG G++T K+PSYD C+Y
Sbjct  430  DVACNFGGTGLKTTKDPSYDACVY  453



>gb|EAZ13481.1| hypothetical protein OsJ_03397 [Oryza sativa Japonica Group]
Length=474

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/85 (78%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+AS+ ASE DL+N LNWACG GNVDCSAIQPSQPC++PD L SHAS+AFNSYYQQNGA 
Sbjct  364  CVASANASETDLQNGLNWACGPGNVDCSAIQPSQPCYQPDTLASHASYAFNSYYQQNGAN  423

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
            DVAC FGG GVRT K+PSYD C+YM
Sbjct  424  DVACDFGGTGVRTTKDPSYDTCVYM  448



>ref|XP_006280336.1| hypothetical protein CARUB_v10026261mg [Capsella rubella]
 gb|EOA13234.1| hypothetical protein CARUB_v10026261mg [Capsella rubella]
Length=508

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/85 (78%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            CIASS ASE DL+ AL+WACG GNVDC+AIQPSQPCF+PD LVSHASF FNSY+QQN AT
Sbjct  372  CIASSKASERDLKGALDWACGPGNVDCTAIQPSQPCFQPDTLVSHASFVFNSYFQQNRAT  431

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
            DVACSFGG GV+ NK+PSYD C+Y+
Sbjct  432  DVACSFGGAGVKVNKDPSYDKCIYI  456



>ref|XP_010110871.1| Glucan endo-1,3-beta-glucosidase 13 [Morus notabilis]
 gb|EXC28690.1| Glucan endo-1,3-beta-glucosidase 13 [Morus notabilis]
Length=1369

 Score =   153 bits (387),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            CIAS+ + E DL+NAL+WACGSGNVDC+AIQPSQPCFEPDNL SHAS+AFNS+YQQNG T
Sbjct  869  CIASNKSLEMDLQNALDWACGSGNVDCTAIQPSQPCFEPDNLASHASYAFNSFYQQNGVT  928

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
            DVACSFGG G+R +++PSYD+C+YM
Sbjct  929  DVACSFGGAGIRVDRDPSYDSCIYM  953



>emb|CDM84006.1| unnamed protein product [Triticum aestivum]
Length=494

 Score =   149 bits (377),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+AS+  SE  L+N LNWACG GNVDCSAIQPSQPC++PD LVSHAS+AFNSYYQQNGAT
Sbjct  365  CVASTNVSETALQNGLNWACGPGNVDCSAIQPSQPCYQPDTLVSHASYAFNSYYQQNGAT  424

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
            DVAC FGG G+RT K+PSYD C+YM
Sbjct  425  DVACGFGGAGMRTTKDPSYDTCVYM  449



>ref|XP_004135678.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Cucumis 
sativus]
 ref|XP_004158423.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Cucumis 
sativus]
 gb|KGN66191.1| hypothetical protein Csa_1G575070 [Cucumis sativus]
Length=501

 Score =   149 bits (377),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            CIAS+ AS+ DL+NAL+WACGSGNVDC+ IQPSQPCFEPD LVSHAS+AFNSY+QQNGAT
Sbjct  370  CIASTKASDMDLQNALDWACGSGNVDCTPIQPSQPCFEPDTLVSHASYAFNSYFQQNGAT  429

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
            DVAC FGG GV+ N++PSYD CLY
Sbjct  430  DVACGFGGNGVKVNQDPSYDTCLY  453



>ref|NP_200470.1| O-Glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
 sp|Q9FJU9.1|E1313_ARATH RecName: Full=Glucan endo-1,3-beta-glucosidase 13; AltName: Full=(1->3)-beta-glucan 
endohydrolase 13; Short=(1->3)-beta-glucanase 
13; AltName: Full=Beta-1,3-endoglucanase 13; Short=Beta-1,3-glucanase 
13; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB09876.1| beta-1,3-glucanase-like protein [Arabidopsis thaliana]
 gb|AAL91612.1| AT5g56590/MIK19_3 [Arabidopsis thaliana]
 gb|AAM91467.1| AT5g56590/MIK19_3 [Arabidopsis thaliana]
 gb|AED96784.1| O-Glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
Length=506

 Score =   149 bits (377),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 66/85 (78%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            CIASS ASE DL+ AL+WACG GNVDC+AIQPSQPCF+PD LVSHASF FNSY+QQN AT
Sbjct  370  CIASSKASERDLKGALDWACGPGNVDCTAIQPSQPCFQPDTLVSHASFVFNSYFQQNRAT  429

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
            DVACSFGG GV+ NK+PSYD C+Y+
Sbjct  430  DVACSFGGAGVKVNKDPSYDKCIYI  454



>gb|EMT15518.1| Glucan endo-1,3-beta-glucosidase 13 [Aegilops tauschii]
Length=530

 Score =   149 bits (377),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+AS+  SE  L+N LNWACG GNVDCSAIQPSQPC++PD LVSHAS+AFNSYYQQNGAT
Sbjct  365  CVASTNVSETALQNGLNWACGPGNVDCSAIQPSQPCYQPDTLVSHASYAFNSYYQQNGAT  424

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
            DVAC FGG G+RT K+PSYD C+YM
Sbjct  425  DVACGFGGAGMRTTKDPSYDTCVYM  449



>ref|XP_002864470.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40729.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=506

 Score =   149 bits (376),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 66/85 (78%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            CIASS ASE DL+ AL+WACG GNVDC+AIQPSQPCF+PD LVSHASF FNSY+QQN AT
Sbjct  370  CIASSKASERDLKGALDWACGPGNVDCTAIQPSQPCFQPDTLVSHASFVFNSYFQQNRAT  429

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
            DVACSFGG GV+ NK+PSYD C+Y+
Sbjct  430  DVACSFGGAGVKVNKDPSYDKCIYI  454



>ref|XP_006644680.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Oryza brachyantha]
Length=493

 Score =   149 bits (376),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+AS+ ASE DL+N LNWACG GNVDCSAIQPSQPC++PD L SHAS+AFNSYYQQNGA 
Sbjct  364  CVASANASETDLQNGLNWACGPGNVDCSAIQPSQPCYQPDTLASHASYAFNSYYQQNGAN  423

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
            DVAC FGG G+RT K+PSYD C+YM
Sbjct  424  DVACDFGGTGMRTTKDPSYDTCVYM  448



>gb|EMS49856.1| Glucan endo-1,3-beta-glucosidase 13 [Triticum urartu]
Length=494

 Score =   149 bits (376),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+AS+  SE  L+N LNWACG GNVDCSAIQPSQPC++PD LVSHAS+AFNSYYQQNGAT
Sbjct  365  CVASTNVSETALQNGLNWACGPGNVDCSAIQPSQPCYQPDTLVSHASYAFNSYYQQNGAT  424

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
            DVAC FGG G+RT K+PSYD C+YM
Sbjct  425  DVACGFGGAGMRTTKDPSYDTCVYM  449



>ref|XP_003569762.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 isoform X1 [Brachypodium 
distachyon]
Length=498

 Score =   148 bits (374),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+AS+  SE  L+N LNWACG GNVDCSAIQPSQPC++PD LVSHAS+AFNSYYQQNGA 
Sbjct  369  CVASTNVSETALQNGLNWACGPGNVDCSAIQPSQPCYQPDTLVSHASYAFNSYYQQNGAN  428

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
            DVAC FGG GVRT K+PSYD C+YM
Sbjct  429  DVACGFGGAGVRTTKDPSYDTCVYM  453



>ref|XP_010232285.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 isoform X2 [Brachypodium 
distachyon]
Length=497

 Score =   148 bits (373),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+AS+  SE  L+N LNWACG GNVDCSAIQPSQPC++PD LVSHAS+AFNSYYQQNGA 
Sbjct  369  CVASTNVSETALQNGLNWACGPGNVDCSAIQPSQPCYQPDTLVSHASYAFNSYYQQNGAN  428

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
            DVAC FGG GVRT K+PSYD C+YM
Sbjct  429  DVACGFGGAGVRTTKDPSYDTCVYM  453



>ref|XP_007012991.1| O-Glycosyl hydrolases family 17 protein isoform 3 [Theobroma 
cacao]
 gb|EOY30610.1| O-Glycosyl hydrolases family 17 protein isoform 3 [Theobroma 
cacao]
Length=460

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/78 (87%), Positives = 75/78 (96%), Gaps = 0/78 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            CIASS ASE+DL+NAL+WACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGA+
Sbjct  367  CIASSKASESDLQNALDWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAS  426

Query  531  DVACSFGGVGVRTNKNPS  478
            DVACSFGG GV+ +K+PS
Sbjct  427  DVACSFGGNGVKVDKDPS  444



>ref|XP_004513066.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Cicer arietinum]
Length=506

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/85 (78%), Positives = 79/85 (93%), Gaps = 1/85 (1%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACG-SGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGA  535
            CIASS A++ DL+NA+NWACG SGNVDC+AIQPSQPCF+PDNLVSHAS+AFNSYYQQNGA
Sbjct  370  CIASSKATQMDLQNAINWACGTSGNVDCTAIQPSQPCFQPDNLVSHASYAFNSYYQQNGA  429

Query  534  TDVACSFGGVGVRTNKNPSYDNCLY  460
            +DVACSFGG GV  +K+P+YD+C+Y
Sbjct  430  SDVACSFGGTGVIVDKDPTYDDCIY  454



>ref|XP_008672638.1| PREDICTED: uncharacterized protein LOC100278152 isoform X2 [Zea 
mays]
 gb|ACN28065.1| unknown [Zea mays]
 tpg|DAA57721.1| TPA: putative O-glycosyl hydrolase family 17 protein [Zea mays]
 tpg|DAA57722.1| TPA: putative O-glycosyl hydrolase family 17 protein [Zea mays]
Length=496

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            CIAS+ ASE DL+NALNWACG GNVDCSAIQPSQPC++PD L SHAS+AFNSYYQQNGA 
Sbjct  367  CIASTNASETDLQNALNWACGPGNVDCSAIQPSQPCYQPDTLASHASYAFNSYYQQNGAN  426

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
             VAC FGG G+RT K+PSYD C+Y+
Sbjct  427  VVACDFGGAGIRTTKDPSYDTCVYL  451



>gb|KJB27173.1| hypothetical protein B456_004G282300 [Gossypium raimondii]
Length=481

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/78 (86%), Positives = 74/78 (95%), Gaps = 0/78 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            CIASS ASEADL+NA++WACG GNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGA+
Sbjct  366  CIASSKASEADLQNAIDWACGPGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAS  425

Query  531  DVACSFGGVGVRTNKNPS  478
            DVACSFGG GV+ +K+PS
Sbjct  426  DVACSFGGKGVKVDKDPS  443



>ref|XP_007012993.1| O-Glycosyl hydrolases family 17 protein isoform 5 [Theobroma 
cacao]
 gb|EOY30612.1| O-Glycosyl hydrolases family 17 protein isoform 5 [Theobroma 
cacao]
Length=400

 Score =   146 bits (368),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/77 (87%), Positives = 74/77 (96%), Gaps = 0/77 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            CIASS ASE+DL+NAL+WACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGA+
Sbjct  292  CIASSKASESDLQNALDWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAS  351

Query  531  DVACSFGGVGVRTNKNP  481
            DVACSFGG GV+ +K+P
Sbjct  352  DVACSFGGNGVKVDKDP  368



>ref|XP_004969893.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Setaria 
italica]
Length=496

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            CIAS+ ASE DL+NALNWACG GNVDCSAIQPSQPC++PD L SHAS+AFNSYYQQNGA 
Sbjct  367  CIASANASETDLQNALNWACGPGNVDCSAIQPSQPCYQPDTLASHASYAFNSYYQQNGAN  426

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
             VAC FGG G+RT K+PSYD C+Y+
Sbjct  427  VVACDFGGAGIRTTKDPSYDTCVYL  451



>ref|XP_006401304.1| hypothetical protein EUTSA_v10013309mg [Eutrema salsugineum]
 gb|ESQ42757.1| hypothetical protein EUTSA_v10013309mg [Eutrema salsugineum]
Length=506

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            CIASS ASE DL+ AL+WACG GNVDC+AIQPSQPCF+PD LVSHASF FNSY+Q N AT
Sbjct  370  CIASSKASERDLKGALDWACGPGNVDCTAIQPSQPCFQPDTLVSHASFVFNSYFQLNRAT  429

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
            DVACSFGG GV+ NK+PSYD C+Y+
Sbjct  430  DVACSFGGAGVKVNKDPSYDKCIYI  454



>ref|XP_007012992.1| O-Glycosyl hydrolases family 17 protein isoform 4 [Theobroma 
cacao]
 gb|EOY30611.1| O-Glycosyl hydrolases family 17 protein isoform 4 [Theobroma 
cacao]
Length=475

 Score =   146 bits (369),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 67/77 (87%), Positives = 74/77 (96%), Gaps = 0/77 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            CIASS ASE+DL+NAL+WACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGA+
Sbjct  367  CIASSKASESDLQNALDWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAS  426

Query  531  DVACSFGGVGVRTNKNP  481
            DVACSFGG GV+ +K+P
Sbjct  427  DVACSFGGNGVKVDKDP  443



>ref|XP_008672637.1| PREDICTED: uncharacterized protein LOC100278152 isoform X1 [Zea 
mays]
Length=653

 Score =   147 bits (371),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            CIAS+ ASE DL+NALNWACG GNVDCSAIQPSQPC++PD L SHAS+AFNSYYQQNGA 
Sbjct  524  CIASTNASETDLQNALNWACGPGNVDCSAIQPSQPCYQPDTLASHASYAFNSYYQQNGAN  583

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
             VAC FGG G+RT K+PSYD C+Y+
Sbjct  584  VVACDFGGAGIRTTKDPSYDTCVYL  608



>gb|EPS73640.1| hypothetical protein M569_01113 [Genlisea aurea]
Length=508

 Score =   145 bits (367),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            CIA   ASEADL++ L+WACGSGNVDC+ IQP QPCFEPDNL SHAS+AFNSYYQQNGA+
Sbjct  368  CIAVMGASEADLQHGLDWACGSGNVDCTPIQPKQPCFEPDNLASHASYAFNSYYQQNGAS  427

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
            +VAC+FGG G RT+KNPSYD+C+Y
Sbjct  428  EVACAFGGAGFRTSKNPSYDSCIY  451



>ref|XP_010688353.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Beta vulgaris 
subsp. vulgaris]
Length=496

 Score =   145 bits (366),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 64/85 (75%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            CIASS A+E DL NALNWACG GNVDC+ IQPSQPC+EP+  VSHASFAFNSYYQQNGAT
Sbjct  367  CIASSNATEEDLNNALNWACGPGNVDCTPIQPSQPCYEPNTPVSHASFAFNSYYQQNGAT  426

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
            D+AC FGG G++  K+PSYD CLY+
Sbjct  427  DIACGFGGAGLKVAKDPSYDKCLYL  451



>ref|XP_002456331.1| hypothetical protein SORBIDRAFT_03g034100 [Sorghum bicolor]
 gb|EES01451.1| hypothetical protein SORBIDRAFT_03g034100 [Sorghum bicolor]
Length=497

 Score =   145 bits (365),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 64/85 (75%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            CIAS+ ASE DL+NALNWACG GNVDCSAIQPSQPC++PD L SHAS+AFNSYYQQNGA 
Sbjct  368  CIASANASETDLQNALNWACGPGNVDCSAIQPSQPCYQPDTLASHASYAFNSYYQQNGAN  427

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
             VAC F G G+RT K+PSYD C+Y+
Sbjct  428  VVACDFSGAGIRTTKDPSYDTCVYL  452



>ref|XP_006853717.1| hypothetical protein AMTR_s00056p00158530 [Amborella trichopoda]
 gb|ERN15184.1| hypothetical protein AMTR_s00056p00158530 [Amborella trichopoda]
Length=548

 Score =   145 bits (365),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            CIAS  ASE DL+NAL+WACGSGNVDCSAIQPSQ CF+PD L SHAS+AFNSYYQQNGA+
Sbjct  354  CIASPNASERDLKNALDWACGSGNVDCSAIQPSQACFQPDTLASHASYAFNSYYQQNGAS  413

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
             +AC FGG G+ T KNPSYDNCLY
Sbjct  414  TIACDFGGTGMITTKNPSYDNCLY  437



>ref|XP_010541008.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12 [Tarenaya hassleriana]
Length=535

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 62/85 (73%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            CIASS ASE DL++ L+WACG GNVDCSAIQ SQPCFEPD ++SHAS+AFN+Y+QQNGAT
Sbjct  389  CIASSQASETDLQSGLDWACGPGNVDCSAIQESQPCFEPDTVLSHASYAFNTYFQQNGAT  448

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
            D+AC+F G+GV  +++PSYDNCLYM
Sbjct  449  DIACNFSGIGVLIDRDPSYDNCLYM  473



>gb|ACU24280.1| unknown [Glycine max]
Length=321

 Score =   140 bits (353),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 63/78 (81%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            CIASS AS+ DL+NA++WACG GNVDC+AIQPSQPCFEPDNL SHASFAFNSYYQQNGA+
Sbjct  233  CIASSKASQIDLQNAIDWACGPGNVDCTAIQPSQPCFEPDNLASHASFAFNSYYQQNGAS  292

Query  531  DVACSFGGVGVRTNKNPS  478
            DVACSFGG GV  +K+PS
Sbjct  293  DVACSFGGTGVTVDKDPS  310



>gb|KDO55852.1| hypothetical protein CISIN_1g010782mg [Citrus sinensis]
Length=446

 Score =   142 bits (358),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 64/78 (82%), Positives = 72/78 (92%), Gaps = 0/78 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            CIAS+ ASEADL+NAL+WACG GNVDCSAIQPSQPC+EPD L+SHASFA NSYYQQNGAT
Sbjct  368  CIASTKASEADLQNALDWACGPGNVDCSAIQPSQPCYEPDTLLSHASFAINSYYQQNGAT  427

Query  531  DVACSFGGVGVRTNKNPS  478
            D+ACSFGG GV+ +KNPS
Sbjct  428  DIACSFGGNGVKVDKNPS  445



>ref|XP_003630700.1| Glucan endo-1,3-beta-glucosidase [Medicago truncatula]
Length=492

 Score =   140 bits (354),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/78 (79%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            CIASS ASE DL+NAL+WACG GNVDC+A+QPSQPCFEPDNL SHAS+ FNSYYQQNGA+
Sbjct  335  CIASSKASEIDLQNALDWACGPGNVDCTAVQPSQPCFEPDNLASHASYVFNSYYQQNGAS  394

Query  531  DVACSFGGVGVRTNKNPS  478
            DVACSFGG GV+ +K+PS
Sbjct  395  DVACSFGGTGVKIDKDPS  412



>gb|KHM99816.1| Glucan endo-1,3-beta-glucosidase 13 [Glycine soja]
Length=455

 Score =   140 bits (353),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 63/78 (81%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            CIASS AS+ DL+NA++WACG GNVDC+AIQPSQPCFEPDNL SHASFAFNSYYQQNGA+
Sbjct  367  CIASSKASQIDLQNAIDWACGPGNVDCTAIQPSQPCFEPDNLASHASFAFNSYYQQNGAS  426

Query  531  DVACSFGGVGVRTNKNPS  478
            DVACSFGG GV  +K+PS
Sbjct  427  DVACSFGGTGVTVDKDPS  444



>ref|XP_009394833.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=469

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/77 (79%), Positives = 71/77 (92%), Gaps = 0/77 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+ASS AS+ADL+NALNWACGSGNVDCSAIQPSQPC++PD L SHAS+AFN YYQQNGAT
Sbjct  370  CVASSNASDADLQNALNWACGSGNVDCSAIQPSQPCYQPDTLASHASYAFNGYYQQNGAT  429

Query  531  DVACSFGGVGVRTNKNP  481
            DVAC+FGG G++T K+P
Sbjct  430  DVACNFGGTGLKTTKDP  446



>ref|NP_001144992.1| uncharacterized protein LOC100278152 precursor [Zea mays]
 gb|ACG44298.1| hypothetical protein [Zea mays]
Length=477

 Score =   136 bits (343),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            CIAS+ ASE DL+NALNWACG GNVDCSAIQPSQPC++PD L SHAS+AFNSYYQQNGA 
Sbjct  367  CIASTNASETDLQNALNWACGPGNVDCSAIQPSQPCYQPDTLTSHASYAFNSYYQQNGAN  426

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
             VAC FGG G+RT K+PS    L+
Sbjct  427  VVACDFGGAGIRTTKDPSKSPILF  450



>ref|XP_006412850.1| hypothetical protein EUTSA_v10024870mg [Eutrema salsugineum]
 gb|ESQ54303.1| hypothetical protein EUTSA_v10024870mg [Eutrema salsugineum]
Length=539

 Score =   135 bits (341),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 60/85 (71%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            CIASS AS  DL++AL+WACG GNVDCSA+QP+QPCFEPD + SHAS+AFN+YYQQ+GA+
Sbjct  395  CIASSQASVTDLQSALDWACGPGNVDCSAVQPNQPCFEPDTVQSHASYAFNTYYQQSGAS  454

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
             + CSFGGV V  +K+PSY NCLYM
Sbjct  455  SLDCSFGGVSVEVDKDPSYGNCLYM  479



>emb|CDY62033.1| BnaC03g77660D [Brassica napus]
Length=533

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+ASS AS  +L++AL+WACG GNVDCSA+QP+QPCFEPD ++SHAS+AFN+YYQQ+G +
Sbjct  388  CVASSRASVTELQSALDWACGPGNVDCSAVQPNQPCFEPDTVLSHASYAFNTYYQQSGGS  447

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
             + CSFGGV V  +K+PSY NCLYM
Sbjct  448  SLDCSFGGVSVEVDKDPSYGNCLYM  472



>gb|KFK29497.1| hypothetical protein AALP_AA7G142000 [Arabis alpina]
Length=535

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            CIAS+ AS  +L+ AL+WACG GNVDCSA+QP+QPCF+PD ++SHAS+AFN+YYQQ+GA+
Sbjct  391  CIASTQASVTELQTALDWACGPGNVDCSAVQPNQPCFDPDTVLSHASYAFNTYYQQSGAS  450

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
             + CSFGGV V  +K+PSY NCLYM
Sbjct  451  SLDCSFGGVSVEVDKDPSYGNCLYM  475



>ref|XP_009109043.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Brassica 
rapa]
Length=534

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+ASS AS  +L++AL+WACG GNVDCSA+QP+QPCFEPD ++SHAS+AFN+YYQQ+G +
Sbjct  389  CVASSQASVTELQSALDWACGPGNVDCSAVQPNQPCFEPDTVLSHASYAFNTYYQQSGGS  448

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
             + CSFGGV V  +K+PSY NCLYM
Sbjct  449  SLDCSFGGVSVEVDKDPSYGNCLYM  473



>emb|CAB79694.1| beta-1, 3-glucanase-like protein [Arabidopsis thaliana]
Length=512

 Score =   131 bits (330),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            CIASS AS  +L+ AL+WACG GNVDCSA+QP QPCFEPD ++SHAS+AFN+YYQQ+GA+
Sbjct  370  CIASSQASVTELQTALDWACGPGNVDCSAVQPDQPCFEPDTVLSHASYAFNTYYQQSGAS  429

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
             + CSF G  V  +K+PSY NCLYM
Sbjct  430  SIDCSFNGASVEVDKDPSYGNCLYM  454



>gb|KJB54309.1| hypothetical protein B456_009G028300 [Gossypium raimondii]
Length=477

 Score =   131 bits (330),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            CIASS AS + L+NAL+WACG G  DCSAIQP Q CF+PD LVSHASFAFN+YYQ+NGAT
Sbjct  393  CIASSQASNSALQNALDWACGQGKADCSAIQPGQRCFQPDTLVSHASFAFNNYYQKNGAT  452

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
            D ACSFGG G++ + +PSY NC+Y
Sbjct  453  DDACSFGGTGIKVSTDPSYGNCIY  476



>ref|XP_010438307.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12 [Camelina sativa]
Length=540

 Score =   131 bits (330),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            CIASS AS  +L+ AL+WACG GNVDCSA+QP QPCFEPD ++SHAS+AFN+YYQQ+GA+
Sbjct  396  CIASSQASVTELQTALDWACGPGNVDCSAVQPDQPCFEPDTVLSHASYAFNTYYQQSGAS  455

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
             + CSF G  V  +K+PSY NCLYM
Sbjct  456  SIDCSFNGASVEVDKDPSYGNCLYM  480



>ref|XP_010433104.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Camelina 
sativa]
Length=541

 Score =   131 bits (330),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            CIASS AS  +L+ AL+WACG GNVDCSA+QP QPCFEPD ++SHAS+AFN+YYQQ+GA+
Sbjct  397  CIASSQASVTELQTALDWACGPGNVDCSAVQPDQPCFEPDTVLSHASYAFNTYYQQSGAS  456

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
             + CSF G  V  +K+PSY NCLYM
Sbjct  457  SIDCSFNGASVEVDKDPSYGNCLYM  481



>ref|NP_849556.1| glucan endo-1,3-beta-glucosidase 12 [Arabidopsis thaliana]
 sp|Q8VYE5.1|E1312_ARATH RecName: Full=Glucan endo-1,3-beta-glucosidase 12; AltName: Full=(1->3)-beta-glucan 
endohydrolase 12; Short=(1->3)-beta-glucanase 
12; AltName: Full=Beta-1,3-endoglucanase 12; Short=Beta-1,3-glucanase 
12; Flags: Precursor [Arabidopsis thaliana]
 gb|AAL59955.1| putative beta-1,3-glucanase [Arabidopsis thaliana]
 gb|AAM20105.1| putative beta-1,3-glucanase [Arabidopsis thaliana]
 gb|AEE85622.1| glucan endo-1,3-beta-glucosidase 12 [Arabidopsis thaliana]
Length=534

 Score =   131 bits (330),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            CIASS AS  +L+ AL+WACG GNVDCSA+QP QPCFEPD ++SHAS+AFN+YYQQ+GA+
Sbjct  392  CIASSQASVTELQTALDWACGPGNVDCSAVQPDQPCFEPDTVLSHASYAFNTYYQQSGAS  451

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
             + CSF G  V  +K+PSY NCLYM
Sbjct  452  SIDCSFNGASVEVDKDPSYGNCLYM  476



>ref|XP_010447863.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Camelina 
sativa]
Length=538

 Score =   131 bits (330),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            CIASS AS  +L+ AL+WACG GNVDCSA+QP QPCFEPD ++SHAS+AFN+YYQQ+GA+
Sbjct  396  CIASSQASVTELQTALDWACGPGNVDCSAVQPDQPCFEPDTVLSHASYAFNTYYQQSGAS  455

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
             + CSF G  V  +K+PSY NCLYM
Sbjct  456  SIDCSFNGASVEVDKDPSYGNCLYM  480



>emb|CDY68826.1| BnaA01g34890D [Brassica napus]
Length=424

 Score =   130 bits (328),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+ASS AS  +L+ AL+WACG G+VDCSA+QP QPCFEPD ++SHAS+AFN+YYQQ+GA 
Sbjct  280  CVASSQASVTELQTALDWACGPGSVDCSAVQPDQPCFEPDTVLSHASYAFNTYYQQSGAN  339

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
               CSFGGV V  +K+PSY NCLYM
Sbjct  340  SSDCSFGGVSVEVDKDPSYGNCLYM  364



>ref|XP_006285688.1| hypothetical protein CARUB_v10007158mg [Capsella rubella]
 gb|EOA18586.1| hypothetical protein CARUB_v10007158mg [Capsella rubella]
Length=538

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            CIASS AS  +L+ AL+WACG GNVDCSA+QP QPCFEPD ++SHAS+AFN+YYQQ+GA+
Sbjct  394  CIASSQASVTELQTALDWACGPGNVDCSAVQPDQPCFEPDTVLSHASYAFNTYYQQSGAS  453

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
             + CSF G  V  +K+PSY NCLYM
Sbjct  454  SIDCSFNGASVEVDKDPSYGNCLYM  478



>ref|XP_009128829.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12 [Brassica rapa]
Length=532

 Score =   130 bits (328),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+ASS AS  +L+ AL+WACG G+VDCSA+QP QPCFEPD ++SHAS+AFN+YYQQ+GA 
Sbjct  388  CVASSQASVTELQTALDWACGPGSVDCSAVQPDQPCFEPDTVLSHASYAFNTYYQQSGAN  447

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
               CSFGGV V  +K+PSY NCLYM
Sbjct  448  SSDCSFGGVSVEVDKDPSYGNCLYM  472



>ref|XP_002867412.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43671.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=536

 Score =   129 bits (325),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            CIASS A   +L+ AL+WACG GNVDCSA+QP QPCFEPD ++SHAS+AFN+YYQQ+GA+
Sbjct  393  CIASSQAPVTELQTALDWACGPGNVDCSAVQPDQPCFEPDTVLSHASYAFNTYYQQSGAS  452

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
             + CSF G  V  +K+PSY NCLYM
Sbjct  453  SIDCSFNGASVEVDKDPSYGNCLYM  477



>emb|CDY14214.1| BnaA08g13450D [Brassica napus]
Length=513

 Score =   129 bits (325),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+ASS AS  +L++AL+WACG GNVDCSA+QP+Q CFEPD ++SHAS+AFN+YYQQ+G +
Sbjct  368  CVASSQASVTELQSALDWACGPGNVDCSAVQPNQLCFEPDTVLSHASYAFNTYYQQSGGS  427

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
             + CSFGGV V  +K+PSY NCLYM
Sbjct  428  SLDCSFGGVSVEVDKDPSYGNCLYM  452



>emb|CDY06818.1| BnaC01g09170D [Brassica napus]
Length=502

 Score =   128 bits (322),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 55/85 (65%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+AS+ AS  +L+ AL+W CG G+VDCSA+QP+QPCFEPD ++SHAS+AFN+YYQQ+GA 
Sbjct  358  CVASTQASVTELQTALDWTCGPGSVDCSAVQPNQPCFEPDTVLSHASYAFNTYYQQSGAN  417

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
               CSFGGV V  +K+PSY NCLYM
Sbjct  418  SSDCSFGGVSVEVDKDPSYGNCLYM  442



>ref|XP_010905435.1| PREDICTED: LOW QUALITY PROTEIN: glucan endo-1,3-beta-glucosidase 
13 [Elaeis guineensis]
Length=173

 Score =   121 bits (303),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 67/85 (79%), Gaps = 0/85 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A    S+ DL+NAL+WACG G  DCSA+QP  PC++PD L+SHAS+AFNSYYQQNG +
Sbjct  55   CVAQPGVSQEDLQNALDWACGLGAADCSAVQPDGPCYQPDTLLSHASYAFNSYYQQNGNS  114

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
            D+AC+FGG    T +NPSY +C+Y+
Sbjct  115  DIACNFGGTAAITTRNPSYGSCVYL  139



>ref|XP_008784816.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 isoform X1 [Phoenix 
dactylifera]
Length=173

 Score =   120 bits (302),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A    S+ DL+NAL+WACG G  DCSA+QP  PC++PD L+SHAS+AFNSYYQQNG +
Sbjct  55   CVARPGVSQEDLQNALDWACGLGAADCSAVQPDGPCYQPDTLLSHASYAFNSYYQQNGNS  114

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
            D+AC+FGG    T+ NPSY++C+Y+
Sbjct  115  DIACNFGGTATITSSNPSYESCVYL  139



>ref|XP_008784817.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 isoform X2 [Phoenix 
dactylifera]
Length=172

 Score =   120 bits (302),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A    S+ DL+NAL+WACG G  DCSA+QP  PC++PD L+SHAS+AFNSYYQQNG +
Sbjct  55   CVARPGVSQEDLQNALDWACGLGAADCSAVQPDGPCYQPDTLLSHASYAFNSYYQQNGNS  114

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
            D+AC+FGG    T+ NPSY++C+Y+
Sbjct  115  DIACNFGGTATITSSNPSYESCVYL  139



>ref|XP_006579395.1| PREDICTED: uncharacterized protein LOC100778330 isoform X1 [Glycine 
max]
Length=175

 Score =   120 bits (300),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 64/84 (76%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A +  S+ADL+NAL+WACG G  DC+AIQ   PCFEPD LVSHASFAFNSYYQ NG +
Sbjct  55   CVALAGVSQADLQNALDWACGLGMADCTAIQHGGPCFEPDTLVSHASFAFNSYYQINGNS  114

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
            D+AC+FGG    T  NPSY  C+Y
Sbjct  115  DIACNFGGTAALTKHNPSYGKCVY  138



>ref|XP_003531315.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Glycine 
max]
 gb|KHN28999.1| Glucan endo-1,3-beta-glucosidase 13 [Glycine soja]
Length=175

 Score =   120 bits (300),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 64/84 (76%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A +  S+ADL+NAL+WACG G  DC+AIQ   PCFEPD LVSHASFAFNSYYQ NG +
Sbjct  55   CVALAGVSQADLQNALDWACGLGMADCTAIQHGGPCFEPDTLVSHASFAFNSYYQINGNS  114

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
            D+AC+FGG    T  NPSY  C+Y
Sbjct  115  DIACNFGGTAALTKHNPSYGKCVY  138



>gb|KEH20727.1| carbohydrate-binding X8 domain protein [Medicago truncatula]
Length=158

 Score =   119 bits (297),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 65/84 (77%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A +  S+ADL+NAL+WACG G  DC AIQ   PC++PD L+SHASFAFNSYYQ NG +
Sbjct  38   CVAQAGVSQADLQNALDWACGLGMADCKAIQKGGPCYDPDTLLSHASFAFNSYYQTNGNS  97

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
            D+AC+FGG    T +NPSY NC+Y
Sbjct  98   DIACNFGGTASLTKQNPSYGNCVY  121



>gb|KHG29271.1| hypothetical protein F383_14120 [Gossypium arboreum]
Length=545

 Score =   124 bits (311),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+ASS AS + L+NAL+WACG G  DCSA+QP Q CFEP+NLVSHASFAFN+YYQ+NG T
Sbjct  341  CVASSQASNSALQNALDWACGPGKADCSALQPDQQCFEPNNLVSHASFAFNNYYQKNGLT  400

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
            D ACSFGG G+    +PSY +C+Y
Sbjct  401  DQACSFGGTGIVVYNDPSYGSCIY  424


 Score =   113 bits (282),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 68/85 (80%), Gaps = 2/85 (2%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+ASS AS ++L+NAL+WACG G  DCS IQP+Q CF+PD L++HASFAFN+YYQ+NGAT
Sbjct  437  CVASSQASRSNLQNALDWACGPGKADCSEIQPNQKCFQPDTLLAHASFAFNNYYQKNGAT  496

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
            D +CSF G  ++ +++PS  N L M
Sbjct  497  DASCSFRGNAIKVDQDPS--NSLAM  519



>ref|NP_001242238.1| uncharacterized protein LOC100778330 precursor [Glycine max]
 gb|ACU17215.1| unknown [Glycine max]
Length=175

 Score =   119 bits (297),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 63/84 (75%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+  +  S+ADL+NAL+WACG G  DC+AIQ   PCFEPD LVSHASFAFNSYYQ NG +
Sbjct  55   CVVLAGVSQADLQNALDWACGLGMADCTAIQHGGPCFEPDTLVSHASFAFNSYYQINGNS  114

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
            D+AC+FGG    T  NPSY  C+Y
Sbjct  115  DIACNFGGTAALTKHNPSYGKCVY  138



>ref|XP_003630021.1| Glucan endo-1,3-beta-glucosidase [Medicago truncatula]
 gb|ACJ85566.1| unknown [Medicago truncatula]
 gb|AET04497.1| carbohydrate-binding X8 domain protein [Medicago truncatula]
 gb|AFK43114.1| unknown [Medicago truncatula]
Length=178

 Score =   118 bits (296),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 65/84 (77%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A +  S+ADL+NAL+WACG G  DC AIQ   PC++PD L+SHASFAFNSYYQ NG +
Sbjct  58   CVAQAGVSQADLQNALDWACGLGMADCKAIQKGGPCYDPDTLLSHASFAFNSYYQTNGNS  117

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
            D+AC+FGG    T +NPSY NC+Y
Sbjct  118  DIACNFGGTASLTKQNPSYGNCVY  141



>ref|XP_004504153.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like isoform X1 
[Cicer arietinum]
 ref|XP_004504154.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like isoform X2 
[Cicer arietinum]
Length=176

 Score =   118 bits (296),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 63/84 (75%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A +  S+ADL+NAL+WACG G+ DC AIQ   PCFEPD LVSHASFAFNSYYQ NG +
Sbjct  56   CVALAGVSQADLQNALDWACGLGSADCKAIQKDGPCFEPDTLVSHASFAFNSYYQTNGNS  115

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
            D+AC+FGG    T  +PSY  C Y
Sbjct  116  DIACNFGGTATLTKTDPSYGKCAY  139



>gb|KJB54307.1| hypothetical protein B456_009G028200 [Gossypium raimondii]
Length=542

 Score =   123 bits (308),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 66/84 (79%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+AS  AS + L+NAL+WACG G  DCSA+QP Q CFEP+NLVSHASFAFN+YYQ+NG T
Sbjct  362  CVASRQASNSALQNALDWACGPGKADCSALQPDQQCFEPNNLVSHASFAFNNYYQKNGLT  421

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
            D AC FGG G+    +PSY NC+Y
Sbjct  422  DQACRFGGTGIVVYNDPSYGNCIY  445


 Score =   120 bits (302),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A+S AS ++L+NAL+WACG G  DCS IQP+Q CF+PD L++HASFAFN+YY++NGAT
Sbjct  458  CVATSQASRSNLQNALDWACGPGKADCSEIQPNQRCFQPDTLLAHASFAFNNYYRKNGAT  517

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
            D +CSF G  ++ +++PSY NC+Y
Sbjct  518  DASCSFRGNAIKVDRDPSYGNCIY  541



>gb|KHN06522.1| Glucan endo-1,3-beta-glucosidase 13 [Glycine soja]
Length=175

 Score =   117 bits (293),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 63/84 (75%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A +  S+ADL+NAL+WACG G  DC+AIQ    CFEPD LVSHASFAFNSYYQ NG +
Sbjct  55   CVALAGVSQADLQNALDWACGLGMADCTAIQQGGRCFEPDTLVSHASFAFNSYYQINGNS  114

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
            D+AC+FGG    T  NPSY  C+Y
Sbjct  115  DIACNFGGTAALTKHNPSYGKCVY  138



>ref|XP_010319704.1| PREDICTED: LOW QUALITY PROTEIN: glucan endo-1,3-beta-glucosidase 
13 [Solanum lycopersicum]
Length=181

 Score =   117 bits (293),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 49/85 (58%), Positives = 65/85 (76%), Gaps = 0/85 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A + A + DL+NAL+WACG G  DC  IQ   PCFEP+ L+SHASFAFN+YYQQNG +
Sbjct  25   CVARAGARQFDLQNALDWACGLGMADCRPIQAGGPCFEPNTLLSHASFAFNTYYQQNGNS  84

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
            D+AC+FGG  + T  NPS++ C+Y+
Sbjct  85   DIACNFGGTAILTKTNPSHEKCIYV  109



>ref|XP_009628793.1| PREDICTED: LOW QUALITY PROTEIN: glucan endo-1,3-beta-glucosidase 
13 [Nicotiana tomentosiformis]
Length=191

 Score =   117 bits (293),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 63/84 (75%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A + A + DL+NAL+WACG G  DC  IQ   PCFEPD L+SHASFAFN YYQQNG +
Sbjct  50   CVARAGALQFDLQNALDWACGLGMADCRPIQAGGPCFEPDTLLSHASFAFNHYYQQNGNS  109

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
            D+AC+FGG  + T  NPS++ C+Y
Sbjct  110  DIACNFGGTAILTKTNPSHEKCIY  133



>ref|XP_009784559.1| PREDICTED: LOW QUALITY PROTEIN: glucan endo-1,3-beta-glucosidase 
13 [Nicotiana sylvestris]
Length=188

 Score =   116 bits (291),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 63/84 (75%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A + A + DL+NAL+WACG G  DC  IQ   PCFEPD L+SHASFAFN YYQQNG +
Sbjct  55   CVARAGAPQFDLQNALDWACGLGMADCRPIQAGGPCFEPDTLLSHASFAFNDYYQQNGNS  114

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
            D+AC+FGG  + T  NPS++ C+Y
Sbjct  115  DIACNFGGTAMLTKSNPSHEKCIY  138



>ref|XP_004306417.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Fragaria 
vesca subsp. vesca]
Length=173

 Score =   116 bits (290),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 63/84 (75%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A +  S+ DL+NAL+WACG G  DC AIQ   PC++PD L+SHASFAFNSYYQQNG +
Sbjct  56   CVALAGVSQVDLQNALDWACGLGMADCKAIQDGGPCYDPDTLLSHASFAFNSYYQQNGNS  115

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
            D+AC+FGG    T  NPSY  C+Y
Sbjct  116  DIACNFGGTAAVTKYNPSYGKCVY  139



>gb|AFU52644.1| beta-1,3-glucanase 9 [Solanum tuberosum]
Length=181

 Score =   116 bits (290),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 49/85 (58%), Positives = 65/85 (76%), Gaps = 0/85 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A + A + DL+NAL+WACG G  DC  IQ   PCFEP+ L+SHASFAFN+YYQQNG +
Sbjct  25   CVARAGARQFDLQNALDWACGLGMADCRPIQTGGPCFEPNTLLSHASFAFNTYYQQNGNS  84

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
            D+AC+FGG  + T  NPS++ C+Y+
Sbjct  85   DIACNFGGTAMLTKINPSHEKCIYV  109



>ref|XP_009402144.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=173

 Score =   115 bits (289),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 66/85 (78%), Gaps = 0/85 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A   AS+ DLENAL+WACG G  DCS++QP   C++PD L+SHAS+AFNSYYQ NG +
Sbjct  56   CVAHPGASQFDLENALDWACGVGGADCSSVQPGAACYQPDTLLSHASYAFNSYYQHNGNS  115

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
            DVAC+FGG    T+++PSY +C Y+
Sbjct  116  DVACNFGGTATITSRDPSYGSCKYL  140



>ref|XP_004135538.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Cucumis 
sativus]
 ref|XP_004170210.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Cucumis 
sativus]
Length=172

 Score =   115 bits (288),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 62/84 (74%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A +  S+ DL+NAL+WACG G  DC AIQ    C+EPD L+SHASFAFNSYYQQNG +
Sbjct  50   CVAKAGVSQIDLQNALDWACGMGKADCRAIQKGGRCYEPDTLLSHASFAFNSYYQQNGNS  109

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
            D+AC+FGG    T K+PSY  C Y
Sbjct  110  DIACNFGGCATLTKKDPSYGKCDY  133



>ref|XP_007159617.1| hypothetical protein PHAVU_002G252400g [Phaseolus vulgaris]
 gb|ESW31611.1| hypothetical protein PHAVU_002G252400g [Phaseolus vulgaris]
Length=175

 Score =   115 bits (288),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 62/84 (74%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A +  S+ DL+NAL+WACG G  +C AIQ   PCFEP  LVSHASFAFNSY+Q NG +
Sbjct  55   CVALAGVSQGDLQNALDWACGLGMANCKAIQQGGPCFEPQTLVSHASFAFNSYFQTNGNS  114

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
            D+AC+FGG    T +NPSY  C+Y
Sbjct  115  DIACNFGGTAALTKRNPSYGKCVY  138



>gb|KJB54308.1| hypothetical protein B456_009G028300 [Gossypium raimondii]
Length=489

 Score =   120 bits (300),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 54/77 (70%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            CIASS AS + L+NAL+WACG G  DCSAIQP Q CF+PD LVSHASFAFN+YYQ+NGAT
Sbjct  393  CIASSQASNSALQNALDWACGQGKADCSAIQPGQRCFQPDTLVSHASFAFNNYYQKNGAT  452

Query  531  DVACSFGGVGVRTNKNP  481
            D ACSFGG G++ + +P
Sbjct  453  DDACSFGGTGIKVSTDP  469



>emb|CBI30973.3| unnamed protein product [Vitis vinifera]
Length=722

 Score =   121 bits (303),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 51/84 (61%), Positives = 61/84 (73%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A    S+ DL+NAL+WACG G  DC AIQ    CFEPD LVSHAS+AFNSYYQQNG +
Sbjct  603  CVALPGVSQVDLQNALDWACGLGMADCGAIQAGGACFEPDTLVSHASYAFNSYYQQNGNS  662

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
            D+AC+FGG    + K+PSY  C Y
Sbjct  663  DIACNFGGTATLSKKDPSYGKCSY  686



>ref|XP_007041111.1| Carbohydrate-binding X8 domain superfamily protein isoform 3 
[Theobroma cacao]
 gb|EOX96942.1| Carbohydrate-binding X8 domain superfamily protein isoform 3 
[Theobroma cacao]
Length=154

 Score =   113 bits (283),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 62/84 (74%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A +  S+ DL+NAL+WACG G  DC AIQ    C+EPD LVSHAS+AFN+YYQQNG +
Sbjct  34   CVALAGVSQIDLQNALDWACGLGMADCIAIQEGGQCYEPDTLVSHASYAFNNYYQQNGNS  93

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
            D+AC+FGG    T  NPSY  CLY
Sbjct  94   DIACNFGGTATLTKNNPSYGKCLY  117



>ref|XP_002274294.2| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Vitis vinifera]
Length=177

 Score =   114 bits (284),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 61/84 (73%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A    S+ DL+NAL+WACG G  DC AIQ    CFEPD LVSHAS+AFNSYYQQNG +
Sbjct  58   CVALPGVSQVDLQNALDWACGLGMADCGAIQAGGACFEPDTLVSHASYAFNSYYQQNGNS  117

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
            D+AC+FGG    + K+PSY  C Y
Sbjct  118  DIACNFGGTATLSKKDPSYGKCSY  141



>ref|XP_007041109.1| Carbohydrate-binding X8 domain superfamily protein isoform 1 
[Theobroma cacao]
 gb|EOX96940.1| Carbohydrate-binding X8 domain superfamily protein isoform 1 
[Theobroma cacao]
Length=191

 Score =   114 bits (285),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 62/84 (74%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A +  S+ DL+NAL+WACG G  DC AIQ    C+EPD LVSHAS+AFN+YYQQNG +
Sbjct  71   CVALAGVSQIDLQNALDWACGLGMADCIAIQEGGQCYEPDTLVSHASYAFNNYYQQNGNS  130

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
            D+AC+FGG    T  NPSY  CLY
Sbjct  131  DIACNFGGTATLTKNNPSYGKCLY  154



>ref|XP_008444815.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Cucumis melo]
Length=170

 Score =   113 bits (282),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 61/84 (73%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A    S+ DL+NAL+WACG G  DC AIQ    C+EPD L+SHAS+AFNSYYQQNG +
Sbjct  49   CVAKPGVSQIDLQNALDWACGMGKADCRAIQKGGRCYEPDTLLSHASYAFNSYYQQNGNS  108

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
            D+AC+FGG    T K+PSY  C Y
Sbjct  109  DIACNFGGCATLTKKDPSYGKCDY  132



>ref|NP_567828.3| glucan endo-1,3-beta-glucosidase 12 [Arabidopsis thaliana]
 gb|AAM65893.1| beta-1,3-glucanase-like protein [Arabidopsis thaliana]
 gb|AEE85621.1| glucan endo-1,3-beta-glucosidase 12 [Arabidopsis thaliana]
Length=488

 Score =   118 bits (295),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            CIASS AS  +L+ AL+WACG GNVDCSA+QP QPCFEPD ++SHAS+AFN+YYQQ+GA+
Sbjct  392  CIASSQASVTELQTALDWACGPGNVDCSAVQPDQPCFEPDTVLSHASYAFNTYYQQSGAS  451

Query  531  DVACSFGGVGVRTNKNPS  478
             + CSF G  V  +K+PS
Sbjct  452  SIDCSFNGASVEVDKDPS  469



>ref|XP_007041110.1| Carbohydrate-binding X8 domain superfamily protein isoform 2, 
partial [Theobroma cacao]
 gb|EOX96941.1| Carbohydrate-binding X8 domain superfamily protein isoform 2, 
partial [Theobroma cacao]
Length=220

 Score =   114 bits (286),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 62/84 (74%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A +  S+ DL+NAL+WACG G  DC AIQ    C+EPD LVSHAS+AFN+YYQQNG +
Sbjct  100  CVALAGVSQIDLQNALDWACGLGMADCIAIQEGGQCYEPDTLVSHASYAFNNYYQQNGNS  159

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
            D+AC+FGG    T  NPSY  CLY
Sbjct  160  DIACNFGGTATLTKNNPSYGKCLY  183



>gb|KJB47942.1| hypothetical protein B456_008G047800 [Gossypium raimondii]
Length=169

 Score =   113 bits (282),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 62/84 (74%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A +  S+ DL+NAL+WACG G  DC AIQ    C+EPD L+SHAS+AFN+YYQQNG +
Sbjct  50   CVALAGVSQIDLQNALDWACGLGMSDCGAIQEGGKCYEPDTLLSHASYAFNNYYQQNGNS  109

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
            D+AC+FGG    T  NPSY  CLY
Sbjct  110  DIACNFGGTATLTKNNPSYGKCLY  133



>gb|KJB47941.1| hypothetical protein B456_008G047800 [Gossypium raimondii]
Length=176

 Score =   113 bits (282),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 62/84 (74%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A +  S+ DL+NAL+WACG G  DC AIQ    C+EPD L+SHAS+AFN+YYQQNG +
Sbjct  57   CVALAGVSQIDLQNALDWACGLGMSDCGAIQEGGKCYEPDTLLSHASYAFNNYYQQNGNS  116

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
            D+AC+FGG    T  NPSY  CLY
Sbjct  117  DIACNFGGTATLTKNNPSYGKCLY  140



>ref|XP_010244529.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12 [Nelumbo nucifera]
Length=171

 Score =   112 bits (281),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 62/84 (74%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A   AS+ D++NAL+WACG G  DC  IQ    CFEPD L+SHAS+AFNSYYQQNG +
Sbjct  54   CVALPGASQIDVQNALDWACGLGMADCGPIQSGGVCFEPDTLLSHASYAFNSYYQQNGNS  113

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
            D+AC+FGG      +NPSY +CLY
Sbjct  114  DIACNFGGTATVVTRNPSYGSCLY  137



>gb|EAZ38703.1| hypothetical protein OsJ_23103 [Oryza sativa Japonica Group]
Length=129

 Score =   111 bits (277),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 62/85 (73%), Gaps = 0/85 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A    S+ DL+NAL+WACG G  DC+ +QP   C++PD L+SHAS+AFN +YQQNG +
Sbjct  10   CVARPGVSQEDLQNALDWACGQGGADCTPLQPGGRCYQPDTLLSHASYAFNIFYQQNGKS  69

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
            D+AC FGG G    +NPS+ +C ++
Sbjct  70   DIACKFGGAGTIIKRNPSFGSCKFL  94



>ref|XP_009362262.1| PREDICTED: PLASMODESMATA CALLOSE-BINDING PROTEIN 5-like isoform 
X2 [Pyrus x bretschneideri]
Length=153

 Score =   112 bits (279),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 62/84 (74%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A    S+ADL+NAL+WACG G  DC  IQ   PC+EPD L+SHAS+AFN+YYQQNG +
Sbjct  34   CVALPGVSQADLQNALDWACGLGMADCKPIQKGGPCYEPDTLLSHASYAFNNYYQQNGNS  93

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
            D+AC+FGG    T KNPS+  C Y
Sbjct  94   DIACNFGGTAGVTKKNPSHGKCDY  117



>emb|CDP05643.1| unnamed protein product [Coffea canephora]
Length=176

 Score =   112 bits (280),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 61/84 (73%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A +   + DL+NAL+WACG G  DCS IQ    CF+PD L++HASFAFNSYYQQNG +
Sbjct  57   CVALAGVPQMDLQNALDWACGPGRADCSPIQTGGRCFDPDTLLAHASFAFNSYYQQNGNS  116

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
            D+AC+FGG    T  NPSY+ C Y
Sbjct  117  DIACNFGGAATLTKSNPSYEECSY  140



>ref|XP_009362261.1| PREDICTED: PLASMODESMATA CALLOSE-BINDING PROTEIN 5-like isoform 
X1 [Pyrus x bretschneideri]
Length=178

 Score =   112 bits (279),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 62/84 (74%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A    S+ADL+NAL+WACG G  DC  IQ   PC+EPD L+SHAS+AFN+YYQQNG +
Sbjct  59   CVALPGVSQADLQNALDWACGLGMADCKPIQKGGPCYEPDTLLSHASYAFNNYYQQNGNS  118

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
            D+AC+FGG    T KNPS+  C Y
Sbjct  119  DIACNFGGTAGVTKKNPSHGKCDY  142



>ref|XP_006657446.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Oryza brachyantha]
Length=129

 Score =   110 bits (275),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 63/84 (75%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A    S+ADL+NAL+WACG G  DC+ +QP   C++PD L+SHASFAFN +YQQNG +
Sbjct  10   CVARPGVSQADLQNALDWACGQGGADCTPLQPGGRCYQPDTLLSHASFAFNIFYQQNGNS  69

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
            D+AC+FGG G    ++PS+ +C +
Sbjct  70   DIACNFGGAGTIIKRDPSFGSCKF  93



>ref|XP_006836305.1| hypothetical protein AMTR_s00092p00035570 [Amborella trichopoda]
 gb|ERM99158.1| hypothetical protein AMTR_s00092p00035570 [Amborella trichopoda]
Length=175

 Score =   111 bits (277),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 64/84 (76%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A + A + DL+NAL+WACG G  DCS IQP + CFEPDNLVSHAS+AFN+YYQQNG  
Sbjct  49   CVALAGAKQDDLQNALDWACGLGMADCSPIQPGEICFEPDNLVSHASYAFNNYYQQNGNA  108

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
             +AC+FGG     +++PSY +C Y
Sbjct  109  PIACNFGGTAGIISRDPSYGSCTY  132



>ref|NP_001058896.1| Os07g0149900 [Oryza sativa Japonica Group]
 dbj|BAC82904.1| putative glycosyl hydrolase [Oryza sativa Japonica Group]
 dbj|BAF20810.1| Os07g0149900 [Oryza sativa Japonica Group]
Length=129

 Score =   109 bits (273),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 63/85 (74%), Gaps = 0/85 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A    S+ DL+NAL+WACG G  DC+ +QP   C++PD L+SHAS+AFN +YQQNG +
Sbjct  10   CVARPGVSQEDLQNALDWACGQGGADCTPLQPGGRCYQPDTLLSHASYAFNIFYQQNGNS  69

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
            D+AC+FGG G    +NPS+ +C ++
Sbjct  70   DIACNFGGAGTIIKRNPSFGSCKFL  94



>gb|EAZ02781.1| hypothetical protein OsI_24906 [Oryza sativa Indica Group]
Length=176

 Score =   110 bits (275),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 63/85 (74%), Gaps = 0/85 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A    S+ DL+NAL+WACG G  DC+ +QP   C++PD L+SHAS+AFN +YQQNG +
Sbjct  57   CVARPGVSQEDLQNALDWACGQGGADCTPLQPGGRCYQPDTLLSHASYAFNIFYQQNGNS  116

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
            D+AC+FGG G    +NPS+ +C ++
Sbjct  117  DIACNFGGAGTIIKRNPSFGSCKFL  141



>gb|KDP34967.1| hypothetical protein JCGZ_09255 [Jatropha curcas]
Length=176

 Score =   110 bits (274),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 61/84 (73%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A +  S+ DL+NAL+WACG G  DC AIQ    CFEP+ L+SHAS+AFN+YYQQNG +
Sbjct  55   CVALAGVSQIDLQNALDWACGLGMADCRAIQEGGACFEPNTLLSHASYAFNNYYQQNGNS  114

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
            D+AC+FGG    T  NPSY  C Y
Sbjct  115  DIACNFGGTATLTKSNPSYGKCNY  138



>ref|XP_011096658.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12 [Sesamum indicum]
Length=176

 Score =   110 bits (274),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 60/84 (71%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A   AS  DL+ AL+WACG G  DC AIQ   PCF+PD L+SHAS+AFN+YYQQNG +
Sbjct  55   CVARPGASPTDLQIALDWACGLGKADCRAIQAGGPCFDPDTLLSHASYAFNNYYQQNGNS  114

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
            D+AC FGG    T  NPS+  C++
Sbjct  115  DIACYFGGTAALTQNNPSHGRCVF  138



>ref|XP_008372208.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like isoform X2 
[Malus domestica]
Length=179

 Score =   110 bits (274),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 61/84 (73%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A    S+ADL+NAL+WACG G VDC  IQ    C+EPD LVSHAS+AFN+YYQQNG +
Sbjct  60   CVALPGVSQADLQNALDWACGLGMVDCKPIQKGGACYEPDTLVSHASYAFNNYYQQNGNS  119

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
            D+AC+FGG      KNPS+  C Y
Sbjct  120  DIACNFGGTAGVAKKNPSHGKCNY  143



>ref|XP_008372207.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like isoform X1 
[Malus domestica]
Length=181

 Score =   110 bits (274),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 61/84 (73%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A    S+ADL+NAL+WACG G VDC  IQ    C+EPD LVSHAS+AFN+YYQQNG +
Sbjct  62   CVALPGVSQADLQNALDWACGLGMVDCKPIQKGGACYEPDTLVSHASYAFNNYYQQNGNS  121

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
            D+AC+FGG      KNPS+  C Y
Sbjct  122  DIACNFGGTAGVAKKNPSHGKCNY  145



>ref|XP_007212537.1| hypothetical protein PRUPE_ppa019395mg [Prunus persica]
 gb|EMJ13736.1| hypothetical protein PRUPE_ppa019395mg [Prunus persica]
Length=153

 Score =   108 bits (271),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 60/84 (71%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A    S+ DL+NAL+WACG G  +C AIQ    C+EPD L+SHASFAFN YYQQNG +
Sbjct  34   CVALPGVSQVDLQNALDWACGLGMANCKAIQEGGACYEPDTLLSHASFAFNDYYQQNGNS  93

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
            D+AC+FGG    T  NPSY  C++
Sbjct  94   DIACNFGGTAAVTKHNPSYGKCVF  117



>ref|XP_009381292.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Musa acuminata 
subsp. malaccensis]
Length=175

 Score =   109 bits (272),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 60/85 (71%), Gaps = 0/85 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A    S+ DL+NAL+WACG G  DCS +QP   C+ PD L+SHAS+ FNSYYQQNG +
Sbjct  56   CVARPGVSQLDLQNALDWACGLGGADCSLVQPGAACYHPDTLLSHASYVFNSYYQQNGNS  115

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
            D+AC FGG      ++PSY +C ++
Sbjct  116  DIACYFGGTAAVVRRDPSYGSCKFL  140



>ref|XP_008383434.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like [Malus domestica]
Length=178

 Score =   108 bits (271),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 61/84 (73%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A    S+ADL+NAL+WACG G  DC  IQ    C+EPD LVSHAS+AFN++YQQNG +
Sbjct  59   CVALPGVSQADLQNALDWACGLGMADCKPIQQGGACYEPDTLVSHASYAFNNFYQQNGNS  118

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
            D+AC+FGG    T  NPS+  C+Y
Sbjct  119  DIACNFGGTAAVTKTNPSHGKCVY  142



>ref|XP_008225549.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Prunus mume]
Length=176

 Score =   108 bits (271),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 60/84 (71%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A    S+ DL+NAL+WACG G  +C AIQ    C+EPD L+SHASFAFN YYQQNG +
Sbjct  57   CVALPGVSQVDLQNALDWACGLGMANCKAIQEGGACYEPDTLLSHASFAFNDYYQQNGNS  116

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
            D+AC+FGG    T  NPSY  C++
Sbjct  117  DIACNFGGTAAVTKHNPSYGKCVF  140



>ref|XP_009377467.1| PREDICTED: PLASMODESMATA CALLOSE-BINDING PROTEIN 5-like [Pyrus 
x bretschneideri]
Length=178

 Score =   108 bits (270),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 60/84 (71%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A    S+ADL+NAL+WACG G  DC  IQ    C+EPD LVSHAS+AFN+YYQQNG +
Sbjct  59   CVALPGVSQADLQNALDWACGLGMADCKPIQQGGACYEPDTLVSHASYAFNNYYQQNGNS  118

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
            D+AC+FGG    T  NPS   C+Y
Sbjct  119  DIACNFGGTAAVTKTNPSQGKCVY  142



>ref|XP_009402145.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=153

 Score =   107 bits (268),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A   AS+ DLENAL+WACG G  DCS++QP   C++PD L+SHAS+AFNSYYQ NG +
Sbjct  56   CVAHPGASQFDLENALDWACGVGGADCSSVQPGAACYQPDTLLSHASYAFNSYYQHNGNS  115

Query  531  DVACSFGGVGVRTNKNPS  478
            DVAC+FGG    T+++PS
Sbjct  116  DVACNFGGTATITSRDPS  133



>ref|XP_010027320.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2 [Eucalyptus grandis]
Length=210

 Score =   109 bits (272),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 61/84 (73%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A +   +ADL+NAL+WACG G  DC+ I+    CFEPD LVSHAS+AFN+YYQQNG +
Sbjct  60   CVALAGVPQADLQNALDWACGLGMADCNPIREGGRCFEPDTLVSHASYAFNNYYQQNGNS  119

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
            D+AC+FGG    T  +PSY  C Y
Sbjct  120  DIACNFGGTATLTRSDPSYGKCAY  143



>ref|XP_011023010.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like isoform X1 
[Populus euphratica]
Length=176

 Score =   108 bits (270),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 63/84 (75%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A S  S+ DL+NAL+WACG G VDCS IQ    CF+P+ LVSHAS+AFN+YYQQN  +
Sbjct  55   CVALSGVSQIDLQNALDWACGPGMVDCSPIQEGGACFDPETLVSHASYAFNNYYQQNENS  114

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
            ++AC+FGG  V T ++PS+  C Y
Sbjct  115  EIACNFGGTAVLTRRDPSHGKCSY  138



>ref|XP_010687021.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12 [Beta vulgaris 
subsp. vulgaris]
Length=174

 Score =   108 bits (270),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 60/84 (71%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A    ++ DL+ AL+WACG G  DCS I+   PC++P+ +VSHAS+AFN YYQQNG  
Sbjct  57   CVALPVVTQNDLQTALDWACGDGKADCSPIEAGGPCYDPNTVVSHASYAFNIYYQQNGNN  116

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
            D+AC+FGG    T K+PSY  C+Y
Sbjct  117  DIACNFGGTATLTKKDPSYGKCIY  140



>ref|XP_006396600.1| hypothetical protein EUTSA_v10029156mg, partial [Eutrema salsugineum]
 gb|ESQ38053.1| hypothetical protein EUTSA_v10029156mg, partial [Eutrema salsugineum]
Length=147

 Score =   107 bits (268),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 59/84 (70%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A  +AS+A+L+ AL+WACG G VDCS I+    C+EPD +VSHASFAFN+YYQ NG  
Sbjct  28   CVARPSASQAELQRALDWACGIGRVDCSVIERRGDCYEPDTIVSHASFAFNAYYQSNGNN  87

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
             +AC FGG    T  NPSY  C Y
Sbjct  88   LIACYFGGTATLTKINPSYGKCSY  111



>ref|XP_006289337.1| hypothetical protein CARUB_v10002833mg [Capsella rubella]
 gb|EOA22235.1| hypothetical protein CARUB_v10002833mg [Capsella rubella]
Length=155

 Score =   107 bits (268),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 58/84 (69%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A   AS+A+L+ AL+WACG G VDCS I+    C+EPD +VSHASFAFN+YYQ NG  
Sbjct  36   CVARPGASQAELQRALDWACGIGRVDCSVIERHGDCYEPDTIVSHASFAFNAYYQTNGNN  95

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
             +AC FGG    T  NPSY  C Y
Sbjct  96   RIACYFGGTAALTKINPSYGKCSY  119



>ref|NP_001144702.1| uncharacterized protein LOC100277738 [Zea mays]
 gb|ACG42466.1| hypothetical protein [Zea mays]
Length=177

 Score =   108 bits (270),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 64/85 (75%), Gaps = 0/85 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A   A++ DL++AL+WACG G  DCS +QP   C++PD L++HAS+AFN +YQQNG +
Sbjct  59   CVARPGATQEDLQSALDWACGPGGADCSQLQPGGRCYQPDTLLTHASYAFNIFYQQNGNS  118

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
            DVAC+FGG G    ++PS+ +C ++
Sbjct  119  DVACNFGGAGALVKRDPSFGSCKFL  143



>ref|XP_011023011.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like isoform X2 
[Populus euphratica]
Length=166

 Score =   108 bits (269),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 63/84 (75%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A S  S+ DL+NAL+WACG G VDCS IQ    CF+P+ LVSHAS+AFN+YYQQN  +
Sbjct  55   CVALSGVSQIDLQNALDWACGPGMVDCSPIQEGGACFDPETLVSHASYAFNNYYQQNENS  114

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
            ++AC+FGG  V T ++PS+  C Y
Sbjct  115  EIACNFGGTAVLTRRDPSHGKCSY  138



>ref|XP_006448957.1| hypothetical protein CICLE_v10018075mg, partial [Citrus clementina]
 gb|ESR62197.1| hypothetical protein CICLE_v10018075mg, partial [Citrus clementina]
Length=107

 Score =   105 bits (263),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A + AS+ DL+NAL+WACG G  DC AIQ    C+EPD LVSHAS+AFN+YYQQNG +
Sbjct  30   CVALAGASQIDLQNALDWACGLGKADCKAIQDGGLCYEPDTLVSHASYAFNNYYQQNGNS  89

Query  531  DVACSFGGVGVRTNKNPS  478
            D+AC+FGG    T  NPS
Sbjct  90   DIACNFGGTAAVTKHNPS  107



>ref|XP_010422431.1| PREDICTED: major pollen allergen Ole e 10-like isoform X1 [Camelina 
sativa]
 ref|XP_010422432.1| PREDICTED: major pollen allergen Ole e 10-like isoform X2 [Camelina 
sativa]
Length=170

 Score =   107 bits (268),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 58/84 (69%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A   AS+A+L+ AL+WACG G VDCS I+    C+EPD +VSHASFAFN+YYQ NG  
Sbjct  49   CVARPGASQAELQRALDWACGIGRVDCSVIERHGDCYEPDTIVSHASFAFNAYYQTNGNN  108

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
             +AC FGG    T  NPSY  C Y
Sbjct  109  RIACYFGGTATLTKINPSYGKCSY  132



>ref|XP_002461458.1| hypothetical protein SORBIDRAFT_02g002990 [Sorghum bicolor]
 gb|EER97979.1| hypothetical protein SORBIDRAFT_02g002990 [Sorghum bicolor]
Length=176

 Score =   107 bits (268),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 64/85 (75%), Gaps = 0/85 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A   A++ DL+NAL+WACG G  DCS +QP   C++P+ L++HAS+AFN +YQQNG +
Sbjct  58   CVARPGATQEDLQNALDWACGPGGADCSQLQPGGRCYQPNTLLTHASYAFNIFYQQNGNS  117

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
            D+AC+FGG G    ++PS+ +C ++
Sbjct  118  DIACNFGGAGALVKRDPSFGSCKFL  142



>ref|XP_004955451.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Setaria 
italica]
Length=224

 Score =   108 bits (271),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 64/85 (75%), Gaps = 0/85 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A   AS+ DL+NAL+WACG G  DCS +QP   C++P+ L++HAS+AFN +YQQNG +
Sbjct  108  CVARPGASQEDLQNALDWACGPGGADCSQLQPGGRCYQPNTLLTHASYAFNIFYQQNGNS  167

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
            D+AC+FGG G    ++PS+ +C ++
Sbjct  168  DIACNFGGAGALVKRDPSFGSCKFL  192



>ref|XP_010431286.1| PREDICTED: major pollen allergen Ole e 10-like isoform X1 [Camelina 
sativa]
 ref|XP_010431412.1| PREDICTED: major pollen allergen Ole e 10-like isoform X1 [Camelina 
sativa]
Length=168

 Score =   107 bits (267),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 58/84 (69%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A   AS+A+L+ AL+WACG G VDCS I+    C+EPD +VSHASFAFN+YYQ NG  
Sbjct  49   CVARPGASQAELQRALDWACGIGRVDCSVIERHGDCYEPDTIVSHASFAFNAYYQTNGNN  108

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
             +AC FGG    T  NPSY  C Y
Sbjct  109  RIACYFGGTATLTKINPSYGKCSY  132



>ref|XP_010431291.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like isoform X2 
[Camelina sativa]
 ref|XP_010431418.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like isoform X2 
[Camelina sativa]
Length=154

 Score =   106 bits (265),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 58/84 (69%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A   AS+A+L+ AL+WACG G VDCS I+    C+EPD +VSHASFAFN+YYQ NG  
Sbjct  49   CVARPGASQAELQRALDWACGIGRVDCSVIERHGDCYEPDTIVSHASFAFNAYYQTNGNN  108

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
             +AC FGG    T  NPSY  C Y
Sbjct  109  RIACYFGGTATLTKINPSYGKCSY  132



>ref|NP_192452.2| carbohydrate-binding X8 domain-containing protein [Arabidopsis 
thaliana]
 gb|AEE82519.1| carbohydrate-binding X8 domain-containing protein [Arabidopsis 
thaliana]
Length=143

 Score =   106 bits (264),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 58/84 (69%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A   A++A+L+ AL+WACG G VDCS I+    C+EPD +VSHASFAFN+YYQ NG  
Sbjct  24   CVARPGATQAELQRALDWACGIGRVDCSVIERHGDCYEPDTIVSHASFAFNAYYQTNGNN  83

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
             +AC FGG    T  NPSY  C Y
Sbjct  84   RIACYFGGTATFTKINPSYGKCSY  107



>ref|XP_006380364.1| hypothetical protein POPTR_0007s03690g [Populus trichocarpa]
 gb|ERP58161.1| hypothetical protein POPTR_0007s03690g [Populus trichocarpa]
Length=176

 Score =   107 bits (266),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 61/84 (73%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A S  S+ DL+NAL+W CG G  DCS IQ    CF+PD LVSHAS+AFN+YYQQN  +
Sbjct  55   CVALSGVSQIDLQNALDWTCGLGMADCSPIQEGGACFDPDTLVSHASYAFNNYYQQNENS  114

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
            ++AC+FGG  V T K+PS+  C Y
Sbjct  115  EIACNFGGTAVLTRKDPSHGKCSY  138



>gb|EMT14401.1| hypothetical protein F775_20218 [Aegilops tauschii]
Length=183

 Score =   107 bits (266),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 62/85 (73%), Gaps = 0/85 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A     + DL+NAL+WACG G  DCS +QP   C+EP+ L+ HAS+AFN +YQQNG +
Sbjct  64   CVARPGVPQEDLQNALDWACGQGAADCSPLQPGGHCYEPNTLLLHASYAFNIFYQQNGNS  123

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
            D+AC+FGG G  TN++PS+  C ++
Sbjct  124  DIACNFGGAGTITNRDPSFGPCKFL  148



>ref|XP_010455870.1| PREDICTED: major pollen allergen Ole e 10-like [Camelina sativa]
Length=170

 Score =   106 bits (265),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 58/84 (69%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A   AS+A+L+ AL+WACG G VDC+ I+    C+EPD +VSHASFAFN+YYQ NG  
Sbjct  49   CVARPGASQAELQRALDWACGIGRVDCTVIERHGDCYEPDTIVSHASFAFNAYYQTNGNN  108

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
             +AC FGG    T  NPSY  C Y
Sbjct  109  RIACYFGGTATLTKINPSYGKCSY  132



>gb|KCW62163.1| hypothetical protein EUGRSUZ_H04823 [Eucalyptus grandis]
Length=141

 Score =   105 bits (263),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 47/82 (57%), Positives = 60/82 (73%), Gaps = 0/82 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A +   +ADL+NAL+WACG G  DC+ I+    CFEPD LVSHAS+AFN+YYQQNG +
Sbjct  17   CVALAGVPQADLQNALDWACGLGMADCNPIREGGRCFEPDTLVSHASYAFNNYYQQNGNS  76

Query  531  DVACSFGGVGVRTNKNPSYDNC  466
            D+AC+FGG    T  +PSY  C
Sbjct  77   DIACNFGGTATLTRSDPSYGKC  98



>ref|XP_003561463.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Brachypodium 
distachyon]
Length=171

 Score =   106 bits (265),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 62/85 (73%), Gaps = 0/85 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A     + DL+NAL+WACG G  DC+ +QP   C++PD L+SHAS+AFN +YQQNG +
Sbjct  55   CVARPGVPQEDLQNALDWACGQGAADCTPLQPGGHCYQPDTLLSHASYAFNIFYQQNGNS  114

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
            D+AC+FGG G    ++PS+ +C ++
Sbjct  115  DIACNFGGAGTIIKRDPSFGSCKFL  139



>emb|CDY48582.1| BnaA09g01780D [Brassica napus]
 emb|CDY21992.1| BnaC09g00980D [Brassica napus]
Length=142

 Score =   105 bits (262),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 58/84 (69%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A  +AS+A+L+ AL+WACG G VDCS I+    C+EPD + SHASFAFN+YYQ NG  
Sbjct  23   CVARPSASQAELQRALDWACGIGRVDCSVIEKHGDCYEPDTIWSHASFAFNAYYQTNGNN  82

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
             +AC FGG    T  NPSY  C Y
Sbjct  83   RIACYFGGTATLTKINPSYGTCSY  106



>ref|XP_002872756.1| hypothetical protein ARALYDRAFT_327458 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49015.1| hypothetical protein ARALYDRAFT_327458 [Arabidopsis lyrata subsp. 
lyrata]
Length=143

 Score =   105 bits (261),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 46/84 (55%), Positives = 58/84 (69%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A   A++A+L+ AL+WACG G VDCS I+    C+EPD ++SHASFAFN+YYQ NG  
Sbjct  24   CVARPGATQAELQRALDWACGIGRVDCSVIERHGDCYEPDTILSHASFAFNAYYQTNGNN  83

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
             +AC FGG    T  NPSY  C Y
Sbjct  84   RIACYFGGTATLTKINPSYGKCSY  107



>ref|XP_009121635.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12 [Brassica rapa]
Length=172

 Score =   105 bits (263),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 58/84 (69%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A  +AS+A+L+ AL+WACG G VDCS I+    C+EPD + SHASFAFN+YYQ NG  
Sbjct  53   CVARPSASQAELQRALDWACGIGRVDCSVIEKHGDCYEPDTIWSHASFAFNAYYQTNGNN  112

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
             +AC FGG    T  NPSY  C Y
Sbjct  113  RIACYFGGTATLTKINPSYGTCSY  136



>ref|XP_006370995.1| hypothetical protein POPTR_0019s02460g [Populus trichocarpa]
 gb|ERP48792.1| hypothetical protein POPTR_0019s02460g [Populus trichocarpa]
Length=174

 Score =   105 bits (263),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 47/82 (57%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A    S+ DL+NAL+WACG G  DC  IQ    CF+PD LVSHAS+AFN+YYQQNG +
Sbjct  55   CVALPGVSQIDLQNALDWACGLGMADCKPIQHGGACFDPDTLVSHASYAFNNYYQQNGNS  114

Query  531  DVACSFGGVGVRTNKNPSYDNC  466
            D+AC+FGG    TN +PS+  C
Sbjct  115  DIACNFGGTATLTNIDPSHGKC  136



>ref|XP_011012004.1| PREDICTED: major pollen allergen Ole e 10-like [Populus euphratica]
Length=174

 Score =   104 bits (260),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 47/82 (57%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A    S+ DL+NAL+WACG G  DC  IQ    CF+PD LVSHAS+AFN+YYQQNG +
Sbjct  55   CVALPGVSQIDLQNALDWACGLGMADCKPIQQGGACFDPDTLVSHASYAFNNYYQQNGNS  114

Query  531  DVACSFGGVGVRTNKNPSYDNC  466
            D+AC+FGG    TN +PS+  C
Sbjct  115  DIACNFGGTASVTNIDPSHGKC  136



>ref|XP_002526606.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus 
communis]
 gb|EEF35765.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus 
communis]
Length=114

 Score =   102 bits (255),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 58/79 (73%), Gaps = 0/79 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A +  S+ DL+NAL+WACG G  DC  IQ    C+EPD L+SHAS+AFN+YYQQNG +
Sbjct  35   CVALAGVSQIDLQNALDWACGLGLADCRPIQQGGACYEPDTLLSHASYAFNNYYQQNGNS  94

Query  531  DVACSFGGVGVRTNKNPSY  475
            D+AC+FGG  + T  NP +
Sbjct  95   DIACNFGGTAILTKSNPKF  113



>ref|XP_010537797.1| PREDICTED: glucan endo-1,3-beta-glucosidase 1 [Tarenaya hassleriana]
Length=192

 Score =   105 bits (261),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 58/84 (69%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A   +S+ DL+ AL+WACG+G  DCSAI+    C+EP+ LVSHASFAFNSYYQ NG  
Sbjct  72   CVARPGSSQMDLQRALDWACGTGMADCSAIEEGGDCYEPNTLVSHASFAFNSYYQTNGNN  131

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
             ++C FGG    T  NPSY  C Y
Sbjct  132  LISCHFGGTAALTKINPSYGKCSY  155



>emb|CDY56715.1| BnaC01g38720D [Brassica napus]
Length=113

 Score =   102 bits (255),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 46/84 (55%), Positives = 56/84 (67%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A  +AS+A+L+ AL+W CG G VDCS I+    C+EPD + SHASFAFN YYQ NG  
Sbjct  26   CVARPSASQAELQRALDWGCGIGRVDCSVIEKHGDCYEPDTIWSHASFAFNVYYQTNGNN  85

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
             +AC FGG    T  NPSY  C Y
Sbjct  86   RIACYFGGTATLTKINPSYGTCSY  109



>gb|EMS45499.1| hypothetical protein TRIUR3_12202 [Triticum urartu]
Length=173

 Score =   103 bits (258),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 61/85 (72%), Gaps = 0/85 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A     + DL+NAL+WACG G  DCS +QP   C++P+ L+ HAS+AFN +YQQNG +
Sbjct  54   CVARPGVPQEDLQNALDWACGQGAADCSPLQPGGHCYQPNTLLLHASYAFNIFYQQNGNS  113

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
            D+AC+FGG G  T ++PS+  C ++
Sbjct  114  DIACNFGGAGTITKRDPSFGPCKFL  138



>gb|KGN65891.1| hypothetical protein Csa_1G537410 [Cucumis sativus]
Length=162

 Score =   103 bits (257),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 55/70 (79%), Gaps = 0/70 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A +  S+ DL+NAL+WACG G  DC AIQ    C+EPD L+SHASFAFNSYYQQNG +
Sbjct  50   CVAKAGVSQIDLQNALDWACGMGKADCRAIQKGGRCYEPDTLLSHASFAFNSYYQQNGNS  109

Query  531  DVACSFGGVG  502
            D+AC+FGG G
Sbjct  110  DIACNFGGYG  119



>dbj|BAJ87686.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=173

 Score =   103 bits (257),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 61/85 (72%), Gaps = 0/85 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A     + DL+NAL+WACG G  DCS +QP   C++P+ L+ HAS+AFN +YQQNG +
Sbjct  54   CVARPGVPQEDLQNALDWACGQGAADCSPLQPGGHCYQPNTLLLHASYAFNIFYQQNGNS  113

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
            D+AC+FGG G  T ++PS+  C ++
Sbjct  114  DIACNFGGAGTITKRDPSFGLCKFL  138



>gb|ABK26650.1| unknown [Picea sitchensis]
Length=158

 Score =   102 bits (255),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 63/85 (74%), Gaps = 0/85 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+AS  A++ DL+ AL+WACG G  DCS IQP Q C++P NL+S AS+AFN YYQ NG +
Sbjct  25   CVASPAANQLDLQEALDWACGPGLADCSGIQPGQSCYQPSNLLSVASYAFNMYYQSNGNS  84

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
             VAC+FGG G+ T+ +PS+  C ++
Sbjct  85   PVACNFGGTGMITSSDPSHGICQFL  109



>ref|XP_011002947.1| PREDICTED: major pollen allergen Ole e 10-like [Populus euphratica]
Length=174

 Score =   102 bits (254),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 58/82 (71%), Gaps = 0/82 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A    S+ DL+NAL+WACG G  DC  IQ    CF+PD LV HAS+AFN+YYQQNG +
Sbjct  55   CVALPGVSQIDLQNALDWACGLGMADCKPIQQGGACFDPDTLVYHASYAFNNYYQQNGNS  114

Query  531  DVACSFGGVGVRTNKNPSYDNC  466
            D+AC+FGG    TN +PS+  C
Sbjct  115  DIACNFGGTASVTNIDPSHGKC  136



>ref|XP_006388214.1| hypothetical protein POPTR_0280s002301g, partial [Populus trichocarpa]
 gb|ERP47128.1| hypothetical protein POPTR_0280s002301g, partial [Populus trichocarpa]
Length=112

 Score =   100 bits (249),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 57/77 (74%), Gaps = 0/77 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A S  S+ DL+NAL+W CG G  DCS IQ    CF+PD LVSHAS+AFN+YYQQN  +
Sbjct  36   CVALSGVSQIDLQNALDWTCGLGMADCSPIQEGGACFDPDTLVSHASYAFNNYYQQNENS  95

Query  531  DVACSFGGVGVRTNKNP  481
            ++AC+FGG  V T K+P
Sbjct  96   EIACNFGGTAVLTRKDP  112



>gb|EYU19143.1| hypothetical protein MIMGU_mgv1a026756mg, partial [Erythranthe 
guttata]
Length=114

 Score = 99.4 bits (246),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 56/78 (72%), Gaps = 0/78 (0%)
 Frame = -3

Query  693  ASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSF  514
            +S+   + AL+WACG G  DC  IQP   CF+P+ L+SHAS+AFNSYYQ+NG  DVAC+F
Sbjct  1    SSQTGFQIALDWACGLGKSDCGPIQPGGACFQPNTLLSHASYAFNSYYQENGNNDVACNF  60

Query  513  GGVGVRTNKNPSYDNCLY  460
            GG  V T  NP+Y  CL+
Sbjct  61   GGAAVLTPNNPTYAKCLF  78



>ref|XP_002969476.1| hypothetical protein SELMODRAFT_231287 [Selaginella moellendorffii]
 gb|EFJ29564.1| hypothetical protein SELMODRAFT_231287 [Selaginella moellendorffii]
Length=478

 Score =   102 bits (254),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 62/84 (74%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A S AS+ADLE+ALNWACG GN DCSAIQ    C+ PD++ SHAS+AFNSY+Q+N   
Sbjct  349  CVARSGASDADLESALNWACGIGNADCSAIQQGGACYSPDSVASHASYAFNSYFQRNVQG  408

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
            +  C F G    T+ +PSY++C+Y
Sbjct  409  NGTCDFNGCATLTSTDPSYNSCIY  432



>emb|CAB81085.1| putative protein [Arabidopsis thaliana]
Length=119

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 54/77 (70%), Gaps = 0/77 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A   A++A+L+ AL+WACG G VDCS I+    C+EPD +VSHASFAFN+YYQ NG  
Sbjct  24   CVARPGATQAELQRALDWACGIGRVDCSVIERHGDCYEPDTIVSHASFAFNAYYQTNGNN  83

Query  531  DVACSFGGVGVRTNKNP  481
             +AC FGG    T  NP
Sbjct  84   RIACYFGGTATFTKINP  100



>emb|CDY54368.1| BnaC03g74560D [Brassica napus]
Length=115

 Score = 95.5 bits (236),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 54/84 (64%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+ S +A++A ++  ++W C  G+VDC  I+P  PCFEPDNL SH SF  N YYQ NG  
Sbjct  30   CVVSPSATDAQMQANIDWLCSRGHVDCIPIKPGGPCFEPDNLRSHVSFVMNQYYQFNGRA  89

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
            D AC F   G+   K+PSY +C Y
Sbjct  90   DKACYFDNTGIFVFKDPSYGDCEY  113



>ref|NP_001059752.1| Os07g0510200 [Oryza sativa Japonica Group]
 dbj|BAC83955.1| putative beta-1,3-glucanase [Oryza sativa Japonica Group]
 dbj|BAF21666.1| Os07g0510200 [Oryza sativa Japonica Group]
 dbj|BAG88935.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94977.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE67248.1| hypothetical protein OsJ_24399 [Oryza sativa Japonica Group]
Length=540

 Score =   101 bits (251),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 61/84 (73%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            CIAS  A E  ++ A++WACG G  DC+AIQP Q C+EP+++ SHASFAF+SYYQ  G  
Sbjct  393  CIASDDADEKAVQAAMDWACGPGRTDCTAIQPGQGCYEPNDVRSHASFAFDSYYQSQGKA  452

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
              +C F GVG+ T  +PS+D+C++
Sbjct  453  AGSCYFQGVGMVTTTDPSHDSCIF  476



>ref|XP_002961242.1| hypothetical protein SELMODRAFT_402967 [Selaginella moellendorffii]
 gb|EFJ38781.1| hypothetical protein SELMODRAFT_402967 [Selaginella moellendorffii]
Length=489

 Score =   100 bits (250),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 46/84 (55%), Positives = 61/84 (73%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A S AS+ DLE+ALNWACG GN DCSAIQ    C+ PD++ SHAS+AFNSY+Q+N   
Sbjct  359  CVARSGASDKDLESALNWACGIGNADCSAIQQGGACYSPDSVASHASYAFNSYFQRNVQG  418

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
            +  C F G    T+ +PSY++C+Y
Sbjct  419  NGTCDFNGCATLTSTDPSYNSCIY  442



>gb|EEC82125.1| hypothetical protein OsI_26155 [Oryza sativa Indica Group]
Length=538

 Score =   101 bits (251),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 61/84 (73%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            CIAS  A E  ++ A++WACG G  DC+AIQP Q C+EP+++ SHASFAF+SYYQ  G  
Sbjct  391  CIASDDADEKAVQAAMDWACGPGRTDCTAIQPGQGCYEPNDVRSHASFAFDSYYQSQGKA  450

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
              +C F GVG+ T  +PS+D+C++
Sbjct  451  AGSCYFQGVGMVTTTDPSHDSCIF  474



>ref|XP_010511589.1| PREDICTED: major pollen allergen Ole e 10-like [Camelina sativa]
Length=111

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 55/84 (65%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+++++A++A L+  ++WAC  G VDC  I P  PC+EP+ L SHASF  N YYQ +GAT
Sbjct  27   CVSAASATDAQLQANIDWACTIGTVDCVKINPGGPCYEPNTLTSHASFVMNEYYQLHGAT  86

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
            + AC F   G   N NPSY  C Y
Sbjct  87   EEACDFNHTGQIINANPSYGRCRY  110



>ref|XP_008449814.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X1 [Cucumis 
melo]
 ref|XP_008449815.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X1 [Cucumis 
melo]
 ref|XP_008449816.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X1 [Cucumis 
melo]
Length=525

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 55/84 (65%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A   A    L+N LNWACG G  +CSAIQP QPCF PDN+V+HAS+A+N YYQ+    
Sbjct  384  CVAKDGADPGKLQNGLNWACGQGGANCSAIQPGQPCFLPDNIVNHASYAYNDYYQKMQLN  443

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
               C+F G    TN NPS  +C+Y
Sbjct  444  GGTCNFDGTATLTNTNPSRGSCVY  467



>ref|XP_008449819.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X3 [Cucumis 
melo]
Length=498

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 55/84 (65%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A   A    L+N LNWACG G  +CSAIQP QPCF PDN+V+HAS+A+N YYQ+    
Sbjct  357  CVAKDGADPGKLQNGLNWACGQGGANCSAIQPGQPCFLPDNIVNHASYAYNDYYQKMQLN  416

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
               C+F G    TN NPS  +C+Y
Sbjct  417  GGTCNFDGTATLTNTNPSRGSCVY  440



>ref|XP_008449817.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X2 [Cucumis 
melo]
Length=522

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 55/84 (65%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A   A    L+N LNWACG G  +CSAIQP QPCF PDN+V+HAS+A+N YYQ+    
Sbjct  381  CVAKDGADPGKLQNGLNWACGQGGANCSAIQPGQPCFLPDNIVNHASYAYNDYYQKMQLN  440

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
               C+F G    TN NPS  +C+Y
Sbjct  441  GGTCNFDGTATLTNTNPSRGSCVY  464



>ref|XP_006657748.1| PREDICTED: glucan endo-1,3-beta-glucosidase 1-like [Oryza brachyantha]
Length=534

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 61/84 (73%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            CIAS  A E  ++ A++WACG G  DC+AIQP Q C+EP+++ SHAS+AF+SYYQ  G  
Sbjct  387  CIASDDADEKAVQAAMDWACGPGRTDCTAIQPGQGCYEPNDVRSHASYAFDSYYQLQGKA  446

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
              +C F GVG+ T  +PS+D+C++
Sbjct  447  AGSCYFQGVGMVTTTDPSHDSCIF  470



>ref|XP_010470560.1| PREDICTED: major pollen allergen Ole e 10-like [Camelina sativa]
Length=111

 Score = 93.2 bits (230),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 55/84 (65%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+++++A +A L+  ++WAC  G VDC+ I P  PC+EP+ L SHASF  N YYQ +GAT
Sbjct  27   CVSAASAVDAQLQANIDWACTIGTVDCAKIYPGGPCYEPNTLTSHASFVMNDYYQLHGAT  86

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
            + AC F   G   N NPSY  C Y
Sbjct  87   EEACDFNHTGQIINANPSYGRCRY  110



>ref|XP_006445640.1| hypothetical protein CICLE_v10015028mg [Citrus clementina]
 ref|XP_006445641.1| hypothetical protein CICLE_v10015028mg [Citrus clementina]
 gb|ESR58880.1| hypothetical protein CICLE_v10015028mg [Citrus clementina]
 gb|ESR58881.1| hypothetical protein CICLE_v10015028mg [Citrus clementina]
Length=493

 Score = 97.8 bits (242),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 57/84 (68%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A   A    L+N LNWACG G+ +CSAIQP QPC+ P+N+ SHAS+A+N YYQ+  + 
Sbjct  362  CVAKDDADSDKLQNGLNWACGQGHANCSAIQPGQPCYLPNNIKSHASYAYNDYYQKMRSV  421

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
               C+F G  + T K+PSY +C Y
Sbjct  422  GGTCNFDGTAMTTTKDPSYGSCTY  445



>ref|XP_006488904.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X1 
[Citrus sinensis]
 ref|XP_006488905.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X2 
[Citrus sinensis]
 ref|XP_006488906.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X3 
[Citrus sinensis]
 gb|KDO63056.1| hypothetical protein CISIN_1g011131mg [Citrus sinensis]
 gb|KDO63057.1| hypothetical protein CISIN_1g011131mg [Citrus sinensis]
Length=493

 Score = 97.8 bits (242),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 57/84 (68%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A   A    L+N LNWACG G+ +CSAIQP QPC+ P+N+ SHAS+A+N YYQ+  + 
Sbjct  362  CVAKDDADSDKLQNGLNWACGQGHANCSAIQPGQPCYLPNNIKSHASYAYNDYYQKMRSV  421

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
               C+F G  + T K+PSY +C Y
Sbjct  422  GGTCNFDGTAMTTTKDPSYGSCTY  445



>emb|CDP01635.1| unnamed protein product [Coffea canephora]
Length=495

 Score = 97.4 bits (241),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 58/85 (68%), Gaps = 0/85 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C A  +A    L+ AL+WACG G VDCS +   QPC+EPD + +HA++AF++YYQ+NG  
Sbjct  361  CAAKDSADSKMLQAALDWACGPGKVDCSPLLQGQPCYEPDTVSAHATYAFDAYYQKNGKA  420

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
             +AC F GV   T  NPS+ +CL++
Sbjct  421  PLACDFNGVAAITTTNPSHGSCLFL  445



>ref|XP_009150785.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Brassica rapa]
Length=113

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 54/84 (64%), Gaps = 2/84 (2%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+ S +A+ A ++  ++W CG  +VDC  I+P  PCFEPDNL SH SF  N YYQ NG T
Sbjct  30   CVVSPSATHAQMQANIDWMCG--HVDCIPIKPDGPCFEPDNLRSHVSFVMNQYYQYNGKT  87

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
            + AC F   G+   K+PSY +C Y
Sbjct  88   EKACYFSNTGIFVFKDPSYGDCEY  111



>ref|XP_004959661.1| PREDICTED: extensin-like [Setaria italica]
Length=596

 Score = 98.2 bits (243),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 58/85 (68%), Gaps = 1/85 (1%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A  +     ++ A+++ACGSG  DC +IQPS PCF PD ++SHASFAFNSY+Q+  A+
Sbjct  511  CVAKPSVPGPIVQQAMDYACGSG-ADCDSIQPSGPCFRPDTMLSHASFAFNSYWQRTKAS  569

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
               C FGG  +   K+PSYD C Y+
Sbjct  570  GATCDFGGTAMLITKDPSYDGCHYI  594



>gb|EPS59666.1| hypothetical protein M569_15139, partial [Genlisea aurea]
Length=191

 Score = 93.6 bits (231),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 60/85 (71%), Gaps = 1/85 (1%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A S A+EA L++AL++ACG G  DCS+IQP   CF PD+L +HAS AFN YYQ+N   
Sbjct  39   CVAKSGAAEAALQSALDYACGIGGADCSSIQPGAACFYPDDLQAHASVAFNGYYQRN-PV  97

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
              +C FGG  V T  NPS+ +C+++
Sbjct  98   LTSCDFGGTAVVTTVNPSFGSCVFL  122



>ref|XP_006407197.1| hypothetical protein EUTSA_v10020572mg [Eutrema salsugineum]
 ref|XP_006407198.1| hypothetical protein EUTSA_v10020572mg [Eutrema salsugineum]
 ref|XP_006407199.1| hypothetical protein EUTSA_v10020572mg [Eutrema salsugineum]
 gb|ESQ48650.1| hypothetical protein EUTSA_v10020572mg [Eutrema salsugineum]
 gb|ESQ48651.1| hypothetical protein EUTSA_v10020572mg [Eutrema salsugineum]
 gb|ESQ48652.1| hypothetical protein EUTSA_v10020572mg [Eutrema salsugineum]
Length=500

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 55/84 (65%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A + A E +LE  LNWACG G  +C+ IQP Q CF P+++ SHASFA+N YYQ+  +T
Sbjct  357  CVAKADAEEDELEGGLNWACGQGGANCALIQPGQACFFPNDIKSHASFAYNDYYQKKKST  416

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
               C F G  + T ++PSY  C Y
Sbjct  417  GGTCDFSGTAITTTRDPSYKTCAY  440



>ref|XP_004173668.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like, partial [Cucumis 
sativus]
Length=392

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 57/84 (68%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A   A    L+  L+WACG G VDCS +   QPC++PDN+++HA++AFN+YYQ+ G +
Sbjct  253  CVAKDGADRKLLQAGLDWACGPGRVDCSPLLQGQPCYQPDNVIAHATYAFNAYYQKMGKS  312

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
               C F GV + T  NPS+ +C++
Sbjct  313  SGTCDFKGVAIITTTNPSHSSCIF  336



>ref|NP_176859.1| carbohydrate-binding X8 domain-containing protein [Arabidopsis 
thaliana]
 gb|AAG60069.1|AC013288_3 unknown protein [Arabidopsis thaliana]
 gb|AAT41739.1| At1g66870 [Arabidopsis thaliana]
 gb|AAU29463.1| At1g66870 [Arabidopsis thaliana]
 gb|AEE34566.1| carbohydrate-binding X8 domain-containing protein [Arabidopsis 
thaliana]
Length=111

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 56/84 (67%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A+ +A+   L+  ++WAC  G VDC+ I P   CF+PD LVSHASF  N +YQ +G+T
Sbjct  27   CVANVSAASTQLQANIDWACSEGKVDCATINPGGSCFDPDTLVSHASFVMNDFYQNHGST  86

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
            + AC+F G G     +PSY +C+Y
Sbjct  87   EEACNFTGTGQVVTADPSYGSCVY  110



>gb|KGN54064.1| hypothetical protein Csa_4G280410 [Cucumis sativus]
Length=526

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 56/84 (67%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A   A    L+N LNWACG G  +CSAIQP QPCF PDN+++HAS+A+N YYQ+    
Sbjct  384  CVAKVGADPGKLQNGLNWACGQGGANCSAIQPGQPCFLPDNILNHASYAYNDYYQKMQLN  443

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
              +C+F G    T+ NPS  +C+Y
Sbjct  444  GGSCNFDGTATLTDTNPSRGSCIY  467



>ref|XP_004142250.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Cucumis sativus]
Length=535

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 56/84 (67%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A   A    L+N LNWACG G  +CSAIQP QPCF PDN+++HAS+A+N YYQ+    
Sbjct  384  CVAKVGADPGKLQNGLNWACGQGGANCSAIQPGQPCFLPDNILNHASYAYNDYYQKMQLN  443

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
              +C+F G    T+ NPS  +C+Y
Sbjct  444  GGSCNFDGTATLTDTNPSRGSCIY  467



>gb|AET00920.2| carbohydrate-binding X8 domain protein [Medicago truncatula]
Length=118

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 56/84 (67%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A    +++DL++ALNWACG G  DCS IQ  QPC+ P+ L  HAS+AFNSY+Q+    
Sbjct  31   CVADEQTTDSDLQDALNWACGKGGADCSKIQQDQPCYFPNTLKDHASYAFNSYFQKFKNN  90

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
              +C F G  + T  +PS+D+C Y
Sbjct  91   GGSCYFRGAAMTTEVDPSHDSCHY  114



>ref|XP_008813566.1| PREDICTED: extensin-like [Phoenix dactylifera]
Length=359

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 58/85 (68%), Gaps = 1/85 (1%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A  T  E  ++ A+N+ACGSG  DC +IQP+  C++PD L++HASFAFNSY+Q+   T
Sbjct  274  CVAKPTVPEPIIQEAMNYACGSG-ADCDSIQPNGSCYQPDTLIAHASFAFNSYWQRTKGT  332

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
               C FGG  +   K+PSYD C ++
Sbjct  333  GGTCDFGGTAMLVTKDPSYDGCRFI  357



>ref|XP_004162024.1| PREDICTED: LOW QUALITY PROTEIN: glucan endo-1,3-beta-glucosidase 
4-like [Cucumis sativus]
Length=623

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 56/84 (67%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A   A    L+N LNWACG G  +CSAIQP QPCF PDN+++HAS+A+N YYQ+    
Sbjct  472  CVAKVGADPGKLQNGLNWACGQGGANCSAIQPGQPCFLPDNILNHASYAYNDYYQKMQLN  531

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
              +C+F G    T+ NPS  +C+Y
Sbjct  532  GGSCNFDGTATLTDTNPSRGSCIY  555



>ref|XP_004142367.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like [Cucumis sativus]
 gb|KGN52361.1| hypothetical protein Csa_5G628660 [Cucumis sativus]
Length=500

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 57/84 (68%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A   A    L+  L+WACG G VDCS +   QPC++PDN+++HA++AFN+YYQ+ G +
Sbjct  361  CVAKDGADRKLLQAGLDWACGPGRVDCSPLLQGQPCYQPDNVIAHATYAFNAYYQKMGKS  420

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
               C F GV + T  NPS+ +C++
Sbjct  421  SGTCDFKGVAIITTTNPSHSSCIF  444



>ref|NP_001152289.1| glucan endo-1,3-beta-glucosidase 3 precursor [Zea mays]
 gb|ACG46824.1| glucan endo-1,3-beta-glucosidase 3 precursor [Zea mays]
Length=544

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 60/84 (71%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A+  A +  ++ A++WACG G  DC+AIQP Q C++PD++ SHASFAF++YYQ  G  
Sbjct  398  CVAADDADQKAVQAAMDWACGPGRADCTAIQPGQACYQPDDVRSHASFAFDAYYQSQGRA  457

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
              +C F G G+ T  +PS+D+CL+
Sbjct  458  AGSCYFQGAGMVTTVDPSHDSCLF  481



>ref|XP_006297495.1| hypothetical protein CARUB_v10013514mg [Capsella rubella]
 gb|EOA30393.1| hypothetical protein CARUB_v10013514mg [Capsella rubella]
Length=499

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 54/84 (64%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A + A +  L + LNWACG G  +C+AIQP  PC+ PDN+ SHASFA+N YYQ+  + 
Sbjct  363  CVAKADAEDDKLVDGLNWACGQGQANCAAIQPGHPCYLPDNIKSHASFAYNDYYQKMKSA  422

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
               C F G  + T ++PSY  C Y
Sbjct  423  GGTCDFSGTAITTTRDPSYKTCAY  446



>ref|XP_008452394.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3 isoform X2 [Cucumis 
melo]
Length=467

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 57/84 (68%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A   A    L+  L+WACG G VDCS +   QPC++PDN+++HA++AFN+YYQ+ G +
Sbjct  328  CVAKDGADRKLLQAGLDWACGPGRVDCSPLLQGQPCYQPDNVIAHATYAFNAYYQKMGKS  387

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
               C F GV + T  NPS+ +C++
Sbjct  388  PGTCDFKGVAIITTTNPSHSSCIF  411



>ref|XP_006448191.1| hypothetical protein CICLE_v10014990mg [Citrus clementina]
 ref|XP_006469226.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like [Citrus sinensis]
 gb|ESR61431.1| hypothetical protein CICLE_v10014990mg [Citrus clementina]
Length=499

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 57/84 (68%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A   A +  L+ AL+WACG G VDCSA+   QPC+EPDN++SH+++AFN+YYQQ    
Sbjct  362  CVAKDGADKKMLQAALDWACGPGKVDCSALLQGQPCYEPDNVISHSTYAFNAYYQQMAKA  421

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
               C F GV   T  +PS+ +C++
Sbjct  422  PGTCDFKGVATITTTDPSHGSCIF  445



>ref|XP_002975458.1| hypothetical protein SELMODRAFT_415534 [Selaginella moellendorffii]
 gb|EFJ23659.1| hypothetical protein SELMODRAFT_415534 [Selaginella moellendorffii]
Length=461

 Score = 95.9 bits (237),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 55/84 (65%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A +      L+ AL+WACG G  DCSAIQP + C+ P+ +++H+S+AFN+YYQ NG  
Sbjct  376  CVAKADTGVPQLQAALDWACGPGKADCSAIQPGKACYVPNTVLAHSSYAFNNYYQLNGRQ  435

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
               C FGG  + TN NPSY  C Y
Sbjct  436  ASDCVFGGTAIVTNTNPSYQGCAY  459



>tpg|DAA62863.1| TPA: putative O-Glycosyl hydrolase superfamily protein [Zea mays]
Length=658

 Score = 97.1 bits (240),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 60/84 (71%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A+  A +  ++ A++WACG G  DC+AIQP Q C++PD++ SHASFAF++YYQ  G  
Sbjct  512  CVAADDADQKAVQAAMDWACGPGRADCTAIQPGQACYQPDDVRSHASFAFDAYYQSQGRA  571

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
              +C F G G+ T  +PS+D+CL+
Sbjct  572  AGSCYFQGAGMVTTVDPSHDSCLF  595



>ref|XP_008452393.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3 isoform X1 [Cucumis 
melo]
Length=500

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 57/84 (68%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A   A    L+  L+WACG G VDCS +   QPC++PDN+++HA++AFN+YYQ+ G +
Sbjct  361  CVAKDGADRKLLQAGLDWACGPGRVDCSPLLQGQPCYQPDNVIAHATYAFNAYYQKMGKS  420

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
               C F GV + T  NPS+ +C++
Sbjct  421  PGTCDFKGVAIITTTNPSHSSCIF  444



>ref|XP_009384878.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Musa acuminata 
subsp. malaccensis]
Length=453

 Score = 95.5 bits (236),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 60/84 (71%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A++ AS A+L+N +++ACGSG  DC AIQ    CF+P+ L++HAS+A N+YYQ  G  
Sbjct  368  CVATADASLAELQNNIDYACGSGGADCGAIQNGGACFDPNTLLAHASYAMNAYYQAAGRH  427

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
            D  C FGG GV T+ +PSY NC Y
Sbjct  428  DFNCYFGGSGVLTSTDPSYGNCRY  451



>ref|XP_007142501.1| hypothetical protein PHAVU_008G285900g [Phaseolus vulgaris]
 gb|ESW14495.1| hypothetical protein PHAVU_008G285900g [Phaseolus vulgaris]
Length=119

 Score = 90.5 bits (223),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 57/84 (68%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A   A+E +L+ AL+WACG G  DC  IQ +QPC+ P+ L  HAS+AFNSYYQ+   +
Sbjct  31   CVADEQATENELQAALDWACGKGGADCGKIQVNQPCYFPNTLKDHASYAFNSYYQKFKHS  90

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
              +C+F G  + T  +PS+D+C Y
Sbjct  91   GGSCNFRGAAMTTEVDPSHDSCHY  114



>ref|XP_007215258.1| hypothetical protein PRUPE_ppa004534mg [Prunus persica]
 ref|XP_008227924.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like [Prunus mume]
 gb|EMJ16457.1| hypothetical protein PRUPE_ppa004534mg [Prunus persica]
Length=504

 Score = 95.9 bits (237),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 57/84 (68%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            CI    A    L+ AL+WACG G VDCSA+   +PC+EPDN+++HA++AF++YY + G T
Sbjct  369  CITKDGADPKMLQAALDWACGPGKVDCSALLQGEPCYEPDNVIAHATYAFDTYYHKMGKT  428

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
              AC F GV   T  +PS+ +C++
Sbjct  429  PAACDFNGVAAITTTDPSHGSCIF  452



>gb|KDO64566.1| hypothetical protein CISIN_1g0108331mg, partial [Citrus sinensis]
Length=478

 Score = 95.1 bits (235),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 56/84 (67%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A   A +  L+ AL+WACG G VDCSA+   QPC+EPDN++SH+ +AFN+YYQQ    
Sbjct  341  CVAKDGADKKMLQAALDWACGPGKVDCSALLQGQPCYEPDNVISHSMYAFNAYYQQMAKA  400

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
               C F GV   T  +PS+ +C++
Sbjct  401  PGTCDFKGVATITTTDPSHGSCIF  424



>gb|EPS65276.1| hypothetical protein M569_09504, partial [Genlisea aurea]
Length=130

 Score = 90.1 bits (222),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 56/84 (67%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A     E  L+ AL++ACG G VDCSAIQ   PC++PD L SHAS+AFNSY+Q++   
Sbjct  30   CVAKGGLPETSLQAALDYACGIGGVDCSAIQQGAPCYDPDTLQSHASYAFNSYFQRSTGQ  89

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
              +C FGG  V T+ NPS  +C +
Sbjct  90   LQSCDFGGTAVITHVNPSSGSCTF  113



>dbj|BAB01763.1| beta-1,3-glucanase-like protein [Arabidopsis thaliana]
Length=469

 Score = 94.7 bits (234),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 55/84 (65%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A + A +  L + LNWACG G  +C+AIQP QPC+ P+++ SHASFAFN YYQ+  + 
Sbjct  327  CVAKADADDDKLVDGLNWACGQGRANCAAIQPGQPCYLPNDVKSHASFAFNDYYQKMKSA  386

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
               C F G  + T ++PSY  C Y
Sbjct  387  GGTCDFDGTAITTTRDPSYRTCAY  410



>gb|AIR93909.1| glucanase [Cicer arietinum]
Length=454

 Score = 94.7 bits (234),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 57/84 (68%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+  S A    L+ AL+WACG G VDCS +   QPC+EPDN+V+HA++AFN+YYQ+   +
Sbjct  365  CVTKSNADTKMLQAALDWACGPGKVDCSPLLQGQPCYEPDNVVAHAAYAFNAYYQKMAKS  424

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
               C F GV V T  +PS+ +C++
Sbjct  425  PGTCDFKGVAVITTTDPSHGSCVF  448



>ref|XP_003563040.1| PREDICTED: glucan endo-1,3-beta-glucosidase 1-like [Brachypodium 
distachyon]
Length=538

 Score = 95.1 bits (235),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 60/84 (71%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            CIAS  A E  ++ A++WACG G  DC+AIQP + C++P+++ SHASFAF++YYQ  G  
Sbjct  392  CIASDDADEKAVQAAMDWACGPGRSDCTAIQPGEGCYQPNDVRSHASFAFDTYYQSQGKA  451

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
              +C F G G+ T  +PS+D+C++
Sbjct  452  GGSCYFQGAGMVTTTDPSHDSCIF  475



>ref|XP_011096571.1| PREDICTED: PLASMODESMATA CALLOSE-BINDING PROTEIN 3, partial [Sesamum 
indicum]
Length=240

 Score = 92.4 bits (228),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 58/84 (69%), Gaps = 1/84 (1%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A+ TAS+  L+ AL++ACG G  DCSAIQPS  C+EP+ +  HAS+AFN YYQ+N   
Sbjct  104  CVANPTASQTALQVALDYACGYGGADCSAIQPSGACYEPNTVRDHASYAFNDYYQKN-PI  162

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
              +C FGG    TN +PS+ NC Y
Sbjct  163  PTSCVFGGTAQLTNTDPSHGNCKY  186



>gb|AFK40693.1| unknown [Lotus japonicus]
Length=118

 Score = 89.4 bits (220),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 58/84 (69%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A    ++++L+ AL+WACG G  DCS IQ +QPC+ P+ L  HAS+AFNSY+Q++  +
Sbjct  31   CVADEQTTDSELQGALDWACGKGGADCSKIQENQPCYFPNTLKDHASYAFNSYFQKSKHS  90

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
              +C F G  + T ++PS+ +C Y
Sbjct  91   GGSCHFRGAAMTTEEDPSHGSCHY  114



>ref|XP_003519665.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Glycine 
max]
Length=118

 Score = 89.4 bits (220),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 56/84 (67%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A    ++++L+ AL+WACG G  DCS IQ +QPC+ P+ L  HAS+AFNSYYQ+   +
Sbjct  31   CVADEQTTDSELQAALDWACGKGGADCSKIQVNQPCYLPNTLKGHASYAFNSYYQKFKHS  90

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
              +C F G  + T  +PSY +C Y
Sbjct  91   GGSCYFRGASITTEVDPSYGSCHY  114



>ref|XP_003544378.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Glycine 
max]
Length=118

 Score = 89.4 bits (220),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 56/84 (67%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A    +E++L+ AL+WACG G  DCS IQ +QPC+ P+ L  HAS+AFNSYYQ+   +
Sbjct  31   CVADEQTTESELQAALDWACGKGGADCSKIQVNQPCYLPNTLKDHASYAFNSYYQKFKHS  90

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
              +C F G  + T  +PS+ +C Y
Sbjct  91   GGSCYFRGAAITTEVDPSHGSCHY  114



>ref|XP_010539571.1| PREDICTED: leucine-rich repeat extensin-like protein 5 [Tarenaya 
hassleriana]
Length=312

 Score = 92.8 bits (229),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 61/84 (73%), Gaps = 1/84 (1%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A  T  +  ++ A+N+ACGSG  DCS+IQP+ PCF+P+ L +HASFAFNSY+Q++  +
Sbjct  227  CVAKPTVPDPIMQEAMNYACGSG-ADCSSIQPNGPCFQPNILWAHASFAFNSYWQRSKGS  285

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
              +C+FGG G+    +PSYD C +
Sbjct  286  GGSCAFGGTGMLVTVDPSYDGCHF  309



>ref|XP_004503372.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like [Cicer arietinum]
Length=501

 Score = 94.7 bits (234),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 57/84 (68%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+  S A    L+ AL+WACG G VDCS +   QPC+EPDN+V+HA++AFN+YYQ+   +
Sbjct  365  CVTKSNADTKMLQAALDWACGPGKVDCSPLLQGQPCYEPDNVVAHAAYAFNAYYQKMAKS  424

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
               C F GV V T  +PS+ +C++
Sbjct  425  PGTCDFKGVAVITTTDPSHGSCVF  448



>ref|NP_187965.1| glucan endo-1,3-beta-glucosidase 4 [Arabidopsis thaliana]
 ref|NP_974302.1| glucan endo-1,3-beta-glucosidase 4 [Arabidopsis thaliana]
 ref|NP_974303.1| glucan endo-1,3-beta-glucosidase 4 [Arabidopsis thaliana]
 sp|Q94CD8.1|E134_ARATH RecName: Full=Glucan endo-1,3-beta-glucosidase 4; AltName: Full=(1->3)-beta-glucan 
endohydrolase 4; Short=(1->3)-beta-glucanase 
4; AltName: Full=Beta-1,3-endoglucanase 4; Short=Beta-1,3-glucanase 
4; Flags: Precursor [Arabidopsis thaliana]
 gb|AAK59446.1| putative glucan endo-1,3-beta-glucosidase precursor [Arabidopsis 
thaliana]
 gb|AAL34291.1| putative glucan endo-1,3-beta-glucosidase precursor [Arabidopsis 
thaliana]
 dbj|BAH19959.1| AT3G13560 [Arabidopsis thaliana]
 gb|AEE75372.1| glucan endo-1,3-beta-glucosidase 4 [Arabidopsis thaliana]
 gb|AEE75373.1| glucan endo-1,3-beta-glucosidase 4 [Arabidopsis thaliana]
 gb|AEE75374.1| glucan endo-1,3-beta-glucosidase 4 [Arabidopsis thaliana]
Length=505

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 55/84 (65%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A + A +  L + LNWACG G  +C+AIQP QPC+ P+++ SHASFAFN YYQ+  + 
Sbjct  363  CVAKADADDDKLVDGLNWACGQGRANCAAIQPGQPCYLPNDVKSHASFAFNDYYQKMKSA  422

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
               C F G  + T ++PSY  C Y
Sbjct  423  GGTCDFDGTAITTTRDPSYRTCAY  446



>ref|XP_002520569.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus 
communis]
 gb|EEF41802.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus 
communis]
Length=249

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 58/82 (71%), Gaps = 1/82 (1%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A  T  ++ ++ AL++ACGSG  DC +IQP+ PCF+P+ LVSHAS+AFNSY+Q+  A 
Sbjct  164  CVAKPTVPDSIVQEALDYACGSG-ADCKSIQPNGPCFQPNTLVSHASYAFNSYWQKAKAA  222

Query  531  DVACSFGGVGVRTNKNPSYDNC  466
               C FGG  +    +PS+DNC
Sbjct  223  GGTCDFGGTAMLVTNDPSFDNC  244



>gb|KHN46919.1| Glucan endo-1,3-beta-glucosidase 12 [Glycine soja]
Length=118

 Score = 89.4 bits (220),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 56/84 (67%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A    +E++L+ AL+WACG G  DCS IQ +QPC+ P+ L  HAS+AFNSYYQ+   +
Sbjct  31   CVADEQTTESELQAALDWACGKGGADCSKIQVNQPCYLPNTLKDHASYAFNSYYQKFKHS  90

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
              +C F G  + T  +PS+ +C Y
Sbjct  91   GGSCYFRGASITTEVDPSHGSCHY  114



>ref|NP_001049413.1| Os03g0221500 [Oryza sativa Japonica Group]
 gb|AAN05325.1| Putative beta-1,3-glucanase [Oryza sativa Japonica Group]
 gb|ABF94701.1| Glucan endo-1,3-beta-glucosidase 3 precursor, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF11327.1| Os03g0221500 [Oryza sativa Japonica Group]
 gb|EAY89076.1| hypothetical protein OsI_10562 [Oryza sativa Indica Group]
 gb|EAZ26099.1| hypothetical protein OsJ_09957 [Oryza sativa Japonica Group]
 dbj|BAG95914.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99718.1| unnamed protein product [Oryza sativa Japonica Group]
Length=504

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 56/84 (67%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A   A E  L+ AL+WACG G VDCSA+   QPC++PDN+ +HA++AFN+YY   G  
Sbjct  365  CVAREGADEKMLQAALDWACGPGKVDCSALMQGQPCYDPDNVEAHATYAFNAYYHGMGMG  424

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
               C F GV V T  +PS+ +C+Y
Sbjct  425  SGTCYFSGVAVITTTDPSHGSCVY  448



>ref|XP_010542461.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Tarenaya 
hassleriana]
 ref|XP_010542462.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Tarenaya 
hassleriana]
Length=509

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 53/84 (63%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A   A    L++ LNWACG G  +CSAIQP +PC+ PDNL SHASFA+N YYQ+    
Sbjct  363  CVAKDDADPEKLQDGLNWACGRGQANCSAIQPGRPCYLPDNLKSHASFAYNDYYQKMKNA  422

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
              +C F G    T ++PSY  C +
Sbjct  423  GGSCDFDGTATTTTRDPSYGTCRF  446



>ref|XP_002884972.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61231.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=501

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 55/84 (65%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A + A +  L + LNWACG G  +C+AIQP QPC+ P+++ SHASFAFN YYQ+  + 
Sbjct  363  CVAKADADDDKLIDGLNWACGQGRANCAAIQPGQPCYLPNDVKSHASFAFNDYYQKMKSA  422

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
               C F G  + T ++PSY  C Y
Sbjct  423  GGTCDFDGTAITTTRDPSYRTCAY  446



>ref|XP_004959695.1| PREDICTED: glucan endo-1,3-beta-glucosidase 1-like [Setaria italica]
Length=535

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 59/84 (70%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A+  A E  ++ A++WACG G  DC+AIQP Q C+ P+++ SHAS+AF++YYQ  G  
Sbjct  389  CVAADDADEKAVQAAMDWACGPGRADCTAIQPGQGCYLPNDVRSHASYAFDAYYQSQGRA  448

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
              +C F G G+ T  +PS+DNCL+
Sbjct  449  AGSCYFQGAGMVTTTDPSHDNCLF  472



>gb|KJB15378.1| hypothetical protein B456_002G174100 [Gossypium raimondii]
Length=465

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 57/84 (68%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A   A    L+ AL+WACG G VDCS +   QPC+EPDN+VSH+++AFN+Y+QQ G +
Sbjct  328  CVAKDGADPKMLQAALDWACGPGKVDCSPLLQGQPCYEPDNVVSHSTYAFNAYFQQMGKS  387

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
               C F GV   +  +PS+ +C++
Sbjct  388  TGTCDFKGVATISTTDPSHGSCIF  411



>ref|XP_002888553.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64812.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=111

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 55/84 (65%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A+ +A+   L+  ++WAC  GN+DC  I P  PCF+P+ +++HAS   N YYQ +G+T
Sbjct  27   CVANPSAAATQLQANIDWACSVGNIDCVIINPGGPCFDPNTVINHASVVMNDYYQTHGST  86

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
            + ACSF G G   + +PSY  C Y
Sbjct  87   EEACSFSGTGQIVSVDPSYGGCAY  110



>ref|XP_010935257.1| PREDICTED: extensin-like [Elaeis guineensis]
Length=356

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 58/85 (68%), Gaps = 1/85 (1%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A  T  +A ++ A+N+ACGSG  DC +IQP+  C++PD L++HASFAFNSY+Q+    
Sbjct  271  CVAKPTVPDAIVQEAMNYACGSG-ADCDSIQPNGSCYQPDTLIAHASFAFNSYWQRTKVA  329

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
               C FGG  +   K+PSYD C ++
Sbjct  330  GGTCDFGGTAMLVTKDPSYDGCRFI  354



>ref|XP_010915581.1| PREDICTED: PLASMODESMATA CALLOSE-BINDING PROTEIN 5 isoform X2 
[Elaeis guineensis]
 ref|XP_010915582.1| PREDICTED: PLASMODESMATA CALLOSE-BINDING PROTEIN 5 isoform X2 
[Elaeis guineensis]
Length=202

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 54/84 (64%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A + A +  L++AL+WACG G  DC  IQ    C+EP ++ SHASFAFN Y+  NG +
Sbjct  57   CVAKNNAEDGALQSALDWACGPGGADCRPIQEGGACYEPQDIQSHASFAFNDYFVHNGFS  116

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
              AC F G    T+ NPS+D C++
Sbjct  117  SSACDFSGTAALTSLNPSHDRCIF  140



>ref|XP_009363375.1| PREDICTED: proline-rich receptor-like protein kinase PERK8 [Pyrus 
x bretschneideri]
Length=316

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 59/84 (70%), Gaps = 1/84 (1%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A  +  +  ++ A+N+ACGSG  DC++IQP+ PCF PD+L++HAS+AFNSY+Q+    
Sbjct  231  CVAKPSVPDPIIQEAMNYACGSG-ADCASIQPNGPCFNPDSLLAHASYAFNSYWQRTKVA  289

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
              +CSFGG  +    +PSYD C +
Sbjct  290  GGSCSFGGTAILVTVDPSYDGCRF  313



>gb|KJB15376.1| hypothetical protein B456_002G174100 [Gossypium raimondii]
Length=498

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 57/84 (68%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A   A    L+ AL+WACG G VDCS +   QPC+EPDN+VSH+++AFN+Y+QQ G +
Sbjct  361  CVAKDGADPKMLQAALDWACGPGKVDCSPLLQGQPCYEPDNVVSHSTYAFNAYFQQMGKS  420

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
               C F GV   +  +PS+ +C++
Sbjct  421  TGTCDFKGVATISTTDPSHGSCIF  444



>ref|XP_010670126.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like [Beta vulgaris 
subsp. vulgaris]
Length=502

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 56/84 (67%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C A   A +  L+ AL+WACG G VDCSA+   +PC+EPDN+ +HA++AFN+YYQQ   +
Sbjct  363  CTARDGADKRMLQAALDWACGPGKVDCSALLQGEPCYEPDNVFAHATYAFNTYYQQTARS  422

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
              +C F GV   T  +PS+ NC Y
Sbjct  423  PGSCDFNGVAEITTTDPSHGNCTY  446



>ref|XP_010915580.1| PREDICTED: PLASMODESMATA CALLOSE-BINDING PROTEIN 5 isoform X1 
[Elaeis guineensis]
Length=219

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 54/84 (64%), Gaps = 0/84 (0%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A + A +  L++AL+WACG G  DC  IQ    C+EP ++ SHASFAFN Y+  NG +
Sbjct  74   CVAKNNAEDGALQSALDWACGPGGADCRPIQEGGACYEPQDIQSHASFAFNDYFVHNGFS  133

Query  531  DVACSFGGVGVRTNKNPSYDNCLY  460
              AC F G    T+ NPS+D C++
Sbjct  134  SSACDFSGTAALTSLNPSHDRCIF  157



>ref|XP_008670382.1| PREDICTED: extensin-like isoform X2 [Zea mays]
Length=552

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 57/85 (67%), Gaps = 1/85 (1%)
 Frame = -3

Query  711  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  532
            C+A  +   A ++ A+++ACGSG  DC +I PS PCF PD +++HAS+AFNSY+Q+  A 
Sbjct  467  CVAKPSVPGAIVQQAMDYACGSG-ADCDSILPSHPCFRPDTMLAHASYAFNSYWQRTKAN  525

Query  531  DVACSFGGVGVRTNKNPSYDNCLYM  457
               C FGG  +   K+PSYD C Y+
Sbjct  526  GATCDFGGTAMLITKDPSYDGCHYI  550



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1233376381380