BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF027E18

Length=686
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006354957.1|  PREDICTED: polyadenylate-binding protein RBP...    249   2e-76   Solanum tuberosum [potatoes]
ref|XP_009629702.1|  PREDICTED: polyadenylate-binding protein RBP...    248   8e-76   Nicotiana tomentosiformis
ref|XP_009765294.1|  PREDICTED: polyadenylate-binding protein RBP...    247   1e-75   Nicotiana sylvestris
ref|XP_004238180.1|  PREDICTED: polyadenylate-binding protein RBP...    246   2e-75   Solanum lycopersicum
ref|XP_007222286.1|  hypothetical protein PRUPE_ppa005903mg             238   4e-72   Prunus persica
gb|KDO35910.1|  hypothetical protein CISIN_1g029152mg                   228   1e-71   Citrus sinensis [apfelsine]
ref|XP_008220171.1|  PREDICTED: polyadenylate-binding protein RBP...    235   4e-71   Prunus mume [ume]
emb|CBI19566.3|  unnamed protein product                                228   1e-69   Vitis vinifera
ref|XP_008220170.1|  PREDICTED: polyadenylate-binding protein RBP...    231   2e-69   Prunus mume [ume]
ref|XP_007017329.1|  RNA-binding protein 47C isoform 1                  229   4e-69   
ref|XP_006473363.1|  PREDICTED: polyadenylate-binding protein RBP...    229   8e-69   Citrus sinensis [apfelsine]
ref|XP_006434827.1|  hypothetical protein CICLE_v10001214mg             229   8e-69   Citrus clementina [clementine]
ref|XP_003634360.1|  PREDICTED: polyadenylate-binding protein RBP...    227   2e-68   Vitis vinifera
gb|KDP38389.1|  hypothetical protein JCGZ_04314                         228   2e-68   Jatropha curcas
ref|XP_009605325.1|  PREDICTED: polyadenylate-binding protein RBP...    227   3e-68   Nicotiana tomentosiformis
ref|XP_009370172.1|  PREDICTED: polyadenylate-binding protein RBP...    227   6e-68   Pyrus x bretschneideri [bai li]
ref|XP_009764865.1|  PREDICTED: polyadenylate-binding protein RBP...    226   9e-68   Nicotiana sylvestris
ref|XP_008361011.1|  PREDICTED: polyadenylate-binding protein RBP...    225   2e-67   
ref|XP_007017331.1|  RNA-binding protein 47C isoform 3                  225   3e-67   
gb|KDO35914.1|  hypothetical protein CISIN_1g029152mg                   217   4e-67   Citrus sinensis [apfelsine]
ref|XP_008357395.1|  PREDICTED: polyadenylate-binding protein RBP...    224   4e-67   
emb|CAC69852.1|  nucleic acid binding protein                           224   7e-67   Nicotiana tabacum [American tobacco]
gb|KJB58432.1|  hypothetical protein B456_009G209600                    223   1e-66   Gossypium raimondii
gb|KJB59840.1|  hypothetical protein B456_009G275200                    223   1e-66   Gossypium raimondii
gb|EYU25396.1|  hypothetical protein MIMGU_mgv1a006186mg                223   2e-66   Erythranthe guttata [common monkey flower]
ref|XP_006374988.1|  RNA-binding protein 47                             223   2e-66   
ref|XP_009370171.1|  PREDICTED: polyadenylate-binding protein RBP...    223   2e-66   Pyrus x bretschneideri [bai li]
ref|XP_008357394.1|  PREDICTED: polyadenylate-binding protein RBP...    221   2e-66   
ref|XP_002302445.2|  RNA-binding protein 47                             222   4e-66   
ref|XP_010268853.1|  PREDICTED: polyadenylate-binding protein RBP...    221   4e-66   Nelumbo nucifera [Indian lotus]
ref|XP_009367486.1|  PREDICTED: polyadenylate-binding protein RBP...    221   4e-66   Pyrus x bretschneideri [bai li]
ref|XP_004141245.1|  PREDICTED: polyadenylate-binding protein RBP...    221   8e-66   Cucumis sativus [cucumbers]
ref|XP_008393835.1|  PREDICTED: polyadenylate-binding protein RBP...    221   9e-66   
emb|CDP01376.1|  unnamed protein product                                219   2e-65   Coffea canephora [robusta coffee]
ref|XP_010098709.1|  Polyadenylate-binding protein RBP47C               219   3e-65   Morus notabilis
ref|XP_011013053.1|  PREDICTED: polyadenylate-binding protein RBP...    219   5e-65   Populus euphratica
ref|XP_002510266.1|  nuclear acid binding protein, putative             219   8e-65   Ricinus communis
ref|XP_011017227.1|  PREDICTED: polyadenylate-binding protein RBP...    218   8e-65   Populus euphratica
ref|XP_008452518.1|  PREDICTED: polyadenylate-binding protein RBP...    218   1e-64   Cucumis melo [Oriental melon]
emb|CAN81343.1|  hypothetical protein VITISV_008697                     221   1e-64   Vitis vinifera
ref|XP_004291135.1|  PREDICTED: polyadenylate-binding protein RBP...    217   4e-64   Fragaria vesca subsp. vesca
gb|KJB63805.1|  hypothetical protein B456_010G017300                    216   8e-64   Gossypium raimondii
ref|XP_010268845.1|  PREDICTED: polyadenylate-binding protein RBP...    215   8e-64   Nelumbo nucifera [Indian lotus]
ref|XP_011030480.1|  PREDICTED: polyadenylate-binding protein RBP...    216   9e-64   Populus euphratica
ref|XP_011030472.1|  PREDICTED: polyadenylate-binding protein RBP...    216   9e-64   Populus euphratica
ref|XP_011030463.1|  PREDICTED: polyadenylate-binding protein RBP...    216   9e-64   Populus euphratica
gb|KHN12758.1|  Polyadenylate-binding protein RBP47C                    207   7e-62   Glycine soja [wild soybean]
ref|XP_007160823.1|  hypothetical protein PHAVU_001G019600g             210   9e-62   Phaseolus vulgaris [French bean]
gb|AGV54251.1|  RNA binding post-transcriptional regulator csx1 l...    210   1e-61   Phaseolus vulgaris [French bean]
ref|XP_011083821.1|  PREDICTED: polyadenylate-binding protein RBP...    210   1e-61   Sesamum indicum [beniseed]
ref|XP_010275609.1|  PREDICTED: polyadenylate-binding protein RBP...    209   3e-61   Nelumbo nucifera [Indian lotus]
gb|KHN46301.1|  Polyadenylate-binding protein RBP47C                    205   8e-61   Glycine soja [wild soybean]
ref|XP_003549410.2|  PREDICTED: polyadenylate-binding protein RBP...    207   1e-60   Glycine max [soybeans]
ref|XP_010275610.1|  PREDICTED: polyadenylate-binding protein RBP...    207   2e-60   Nelumbo nucifera [Indian lotus]
gb|KHN04518.1|  Polyadenylate-binding protein RBP47C                    204   6e-60   Glycine soja [wild soybean]
ref|XP_003523906.1|  PREDICTED: polyadenylate-binding protein RBP...    204   1e-59   Glycine max [soybeans]
ref|XP_010668311.1|  PREDICTED: polyadenylate-binding protein RBP...    206   2e-59   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003544447.1|  PREDICTED: polyadenylate-binding protein RBP...    204   2e-59   Glycine max [soybeans]
gb|KDO35911.1|  hypothetical protein CISIN_1g029152mg                   195   8e-59   Citrus sinensis [apfelsine]
gb|ABY75165.1|  RNA binding protein                                     193   2e-58   Arachis diogoi
ref|XP_007136663.1|  hypothetical protein PHAVU_009G063200g             201   3e-58   Phaseolus vulgaris [French bean]
gb|KHN22302.1|  Polyadenylate-binding protein RBP47C                    200   5e-58   Glycine soja [wild soybean]
ref|XP_004501589.1|  PREDICTED: polyadenylate-binding protein RBP...    198   3e-57   Cicer arietinum [garbanzo]
gb|KCW68770.1|  hypothetical protein EUGRSUZ_F02369                     197   4e-57   Eucalyptus grandis [rose gum]
ref|XP_010061775.1|  PREDICTED: polyadenylate-binding protein RBP...    197   1e-56   Eucalyptus grandis [rose gum]
ref|XP_006393576.1|  hypothetical protein EUTSA_v10011476mg             197   2e-56   
ref|XP_003603009.1|  RNA-binding protein                                196   2e-56   Medicago truncatula
gb|EPS64859.1|  nucleic acid binding protein                            194   5e-56   Genlisea aurea
ref|XP_008444645.1|  PREDICTED: polyadenylate-binding protein RBP...    193   4e-55   Cucumis melo [Oriental melon]
ref|XP_004499084.1|  PREDICTED: polyadenylate-binding protein RBP...    193   4e-55   Cicer arietinum [garbanzo]
ref|XP_004152729.1|  PREDICTED: polyadenylate-binding protein RBP...    192   9e-55   Cucumis sativus [cucumbers]
gb|KDO35913.1|  hypothetical protein CISIN_1g029152mg                   184   9e-55   Citrus sinensis [apfelsine]
ref|XP_006423054.1|  hypothetical protein CICLE_v10028454mg             190   6e-54   Citrus clementina [clementine]
ref|XP_006480131.1|  PREDICTED: polyadenylate-binding protein RBP...    190   6e-54   Citrus sinensis [apfelsine]
ref|XP_010500273.1|  PREDICTED: polyadenylate-binding protein RBP...    189   2e-53   Camelina sativa [gold-of-pleasure]
gb|EYU20972.1|  hypothetical protein MIMGU_mgv1a018561mg                179   3e-53   Erythranthe guttata [common monkey flower]
gb|KEH40058.1|  polyadenylate-binding protein RBP47C                    186   3e-52   Medicago truncatula
gb|KDO49116.1|  hypothetical protein CISIN_1g013061mg                   186   3e-52   Citrus sinensis [apfelsine]
gb|AFK35123.1|  unknown                                                 185   5e-52   Medicago truncatula
ref|XP_009391347.1|  PREDICTED: polyadenylate-binding protein RBP...    184   6e-52   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010461546.1|  PREDICTED: polyadenylate-binding protein RBP...    185   7e-52   Camelina sativa [gold-of-pleasure]
ref|XP_003528246.1|  PREDICTED: polyadenylate-binding protein RBP...    184   1e-51   
ref|XP_009417617.1|  PREDICTED: polyadenylate-binding protein RBP...    182   2e-51   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010479152.1|  PREDICTED: polyadenylate-binding protein RBP...    184   2e-51   Camelina sativa [gold-of-pleasure]
ref|NP_175181.1|  RNA-binding protein 47C'                              183   3e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007017333.1|  RNA-binding protein 47C isoform 5                  180   1e-50   
ref|NP_175180.1|  RNA-binding protein 47C                               181   2e-50   Arabidopsis thaliana [mouse-ear cress]
gb|KDO35916.1|  hypothetical protein CISIN_1g029152mg                   173   2e-50   Citrus sinensis [apfelsine]
ref|XP_006845939.1|  hypothetical protein AMTR_s00157p00079360          172   4e-50   
ref|XP_007017330.1|  RNA-binding protein 47C isoform 2                  178   7e-50   
ref|XP_008782322.1|  PREDICTED: polyadenylate-binding protein RBP...    171   1e-49   
ref|XP_009794615.1|  PREDICTED: polyadenylate-binding protein RBP...    177   2e-49   Nicotiana sylvestris
ref|XP_009794616.1|  PREDICTED: polyadenylate-binding protein RBP...    177   4e-49   Nicotiana sylvestris
ref|XP_007017332.1|  RNA-binding protein 47C isoform 4                  176   5e-49   
sp|Q9LEB3.1|RBP47_NICPL  RecName: Full=Polyadenylate-binding prot...    177   5e-49   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
emb|CBI32444.3|  unnamed protein product                                175   5e-49   Vitis vinifera
ref|XP_009590296.1|  PREDICTED: polyadenylate-binding protein RBP47     177   7e-49   Nicotiana tomentosiformis
gb|AAB92518.1|  putative RNA binding protein                            176   2e-48   Nicotiana tabacum [American tobacco]
ref|XP_010647773.1|  PREDICTED: polyadenylate-binding protein RBP...    175   2e-48   Vitis vinifera
ref|XP_006442703.1|  hypothetical protein CICLE_v10022585mg             168   2e-48   Citrus clementina [clementine]
ref|XP_002285031.1|  PREDICTED: polyadenylate-binding protein RBP...    175   2e-48   Vitis vinifera
ref|XP_006346456.1|  PREDICTED: polyadenylate-binding protein RBP47     175   3e-48   Solanum tuberosum [potatoes]
ref|XP_008797245.1|  PREDICTED: polyadenylate-binding protein RBP...    174   3e-48   Phoenix dactylifera
ref|XP_009380242.1|  PREDICTED: polyadenylate-binding protein RBP...    174   4e-48   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB58433.1|  hypothetical protein B456_009G209600                    173   4e-48   Gossypium raimondii
emb|CAN74486.1|  hypothetical protein VITISV_029928                     174   6e-48   Vitis vinifera
ref|XP_004230808.1|  PREDICTED: polyadenylate-binding protein RBP47     173   8e-48   Solanum lycopersicum
ref|XP_010926371.1|  PREDICTED: leucine-rich repeat extensin-like...    177   9e-48   Elaeis guineensis
ref|XP_008813036.1|  PREDICTED: polyadenylate-binding protein RBP...    173   1e-47   Phoenix dactylifera
ref|XP_008782204.1|  PREDICTED: polyadenylate-binding protein RBP...    172   1e-47   Phoenix dactylifera
ref|XP_010525621.1|  PREDICTED: polyadenylate-binding protein RBP...    173   2e-47   Tarenaya hassleriana [spider flower]
gb|KDP23018.1|  hypothetical protein JCGZ_01681                         173   2e-47   Jatropha curcas
ref|XP_009390905.1|  PREDICTED: polyadenylate-binding protein RBP...    172   3e-47   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001275480.1|  DNA binding protein ACBF-like                      170   6e-47   Solanum tuberosum [potatoes]
gb|ABR25764.1|  nucleic acid binding protein                            164   7e-47   Oryza sativa Indica Group [Indian rice]
ref|XP_010907889.1|  PREDICTED: polyadenylate-binding protein RBP47     171   9e-47   Elaeis guineensis
ref|XP_002313840.2|  RNA-binding protein 47                             171   9e-47   Populus trichocarpa [western balsam poplar]
ref|XP_010540323.1|  PREDICTED: polyadenylate-binding protein RBP47B    170   1e-46   Tarenaya hassleriana [spider flower]
ref|NP_001275430.1|  DNA-binding protein-like                           171   1e-46   Solanum tuberosum [potatoes]
ref|XP_009404023.1|  PREDICTED: polyadenylate-binding protein RBP...    170   1e-46   
ref|XP_011000065.1|  PREDICTED: polyadenylate-binding protein RBP47     171   2e-46   Populus euphratica
gb|KFK36144.1|  hypothetical protein AALP_AA4G083000                    170   2e-46   Arabis alpina [alpine rockcress]
gb|AAC49850.1|  DNA binding protein ACBF                                170   2e-46   Nicotiana tabacum [American tobacco]
ref|XP_006384437.1|  hypothetical protein POPTR_0004s15080g             170   3e-46   Populus trichocarpa [western balsam poplar]
ref|XP_002518798.1|  nuclear acid binding protein, putative             169   4e-46   Ricinus communis
ref|XP_011088289.1|  PREDICTED: polyadenylate-binding protein RBP47     169   4e-46   Sesamum indicum [beniseed]
ref|XP_006406535.1|  hypothetical protein EUTSA_v10020763mg             169   4e-46   Eutrema salsugineum [saltwater cress]
ref|XP_010327390.1|  PREDICTED: DNA-binding protein isoform X2          169   5e-46   Solanum lycopersicum
ref|XP_006423626.1|  hypothetical protein CICLE_v10030115mg             162   7e-46   
ref|XP_011004995.1|  PREDICTED: polyadenylate-binding protein RBP...    169   8e-46   Populus euphratica
ref|XP_006349627.1|  PREDICTED: polyadenylate-binding protein RBP...    167   1e-45   Solanum tuberosum [potatoes]
ref|XP_006349628.1|  PREDICTED: polyadenylate-binding protein RBP...    167   2e-45   Solanum tuberosum [potatoes]
ref|XP_011461514.1|  PREDICTED: polyadenylate-binding protein RBP...    167   3e-45   Fragaria vesca subsp. vesca
gb|EEE69858.1|  hypothetical protein OsJ_29658                          164   3e-45   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009628458.1|  PREDICTED: polyadenylate-binding protein RBP...    167   3e-45   Nicotiana tomentosiformis
ref|XP_010327389.1|  PREDICTED: DNA-binding protein isoform X1          167   3e-45   
ref|XP_010539063.1|  PREDICTED: polyadenylate-binding protein RBP...    167   4e-45   Tarenaya hassleriana [spider flower]
gb|KFK39248.1|  hypothetical protein AALP_AA3G219800                    167   4e-45   Arabis alpina [alpine rockcress]
gb|KHN31058.1|  Polyadenylate-binding protein RBP47                     162   4e-45   Glycine soja [wild soybean]
dbj|BAD33940.1|  putative nucleic acid binding protein                  164   5e-45   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001234487.1|  DNA-binding protein                                166   6e-45   
ref|XP_009783555.1|  PREDICTED: polyadenylate-binding protein RBP...    166   7e-45   Nicotiana sylvestris
ref|XP_002446570.1|  hypothetical protein SORBIDRAFT_06g018280          166   9e-45   Sorghum bicolor [broomcorn]
ref|XP_006307520.1|  hypothetical protein CARUB_v10009143mg             165   2e-44   Capsella rubella
dbj|BAG87507.1|  unnamed protein product                                163   2e-44   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008236618.1|  PREDICTED: polyadenylate-binding protein RBP...    165   2e-44   Prunus mume [ume]
gb|EMT27298.1|  Putative RNA-binding protein                            162   2e-44   
gb|EEE61093.1|  hypothetical protein OsJ_14988                          163   2e-44   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006660711.1|  PREDICTED: polyadenylate-binding protein RBP...    162   3e-44   Oryza brachyantha
ref|NP_001052934.2|  Os04g0449900                                       163   4e-44   
gb|KFK39249.1|  hypothetical protein AALP_AA3G219800                    164   4e-44   Arabis alpina [alpine rockcress]
ref|XP_006297697.1|  hypothetical protein CARUB_v10013726mg             164   4e-44   Capsella rubella
ref|XP_010442131.1|  PREDICTED: polyadenylate-binding protein RBP...    164   5e-44   Camelina sativa [gold-of-pleasure]
ref|XP_006487135.1|  PREDICTED: uncharacterized protein LOC102626638    165   5e-44   
gb|EAY94326.1|  hypothetical protein OsI_16094                          163   6e-44   Oryza sativa Indica Group [Indian rice]
emb|CAH67097.1|  H0818E04.14                                            163   6e-44   Oryza sativa [red rice]
ref|XP_006653468.1|  PREDICTED: polyadenylate-binding protein RBP...    163   6e-44   
gb|EEC84714.1|  hypothetical protein OsI_31675                          162   7e-44   Oryza sativa Indica Group [Indian rice]
ref|XP_007156541.1|  hypothetical protein PHAVU_003G294800g             162   8e-44   Phaseolus vulgaris [French bean]
ref|XP_006297696.1|  hypothetical protein CARUB_v10013726mg             163   8e-44   Capsella rubella
gb|KCW68769.1|  hypothetical protein EUGRSUZ_F02369                     163   8e-44   Eucalyptus grandis [rose gum]
ref|XP_010481964.1|  PREDICTED: polyadenylate-binding protein RBP...    163   8e-44   Camelina sativa [gold-of-pleasure]
gb|KCW63816.1|  hypothetical protein EUGRSUZ_G01492                     163   9e-44   Eucalyptus grandis [rose gum]
dbj|BAJ85933.1|  predicted protein                                      155   9e-44   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007199852.1|  hypothetical protein PRUPE_ppa005661mg             163   1e-43   Prunus persica
ref|XP_010494212.1|  PREDICTED: polyadenylate-binding protein RBP...    163   1e-43   Camelina sativa [gold-of-pleasure]
ref|XP_010066047.1|  PREDICTED: polyadenylate-binding protein RBP47     163   1e-43   
ref|XP_008236617.1|  PREDICTED: polyadenylate-binding protein RBP...    163   1e-43   Prunus mume [ume]
gb|KDO38218.1|  hypothetical protein CISIN_1g038175mg                   155   1e-43   Citrus sinensis [apfelsine]
ref|NP_001047180.1|  Os02g0567900                                       159   1e-43   
ref|NP_001063403.1|  Os09g0462700                                       163   1e-43   
ref|XP_003579863.1|  PREDICTED: polyadenylate-binding protein RBP...    162   2e-43   Brachypodium distachyon [annual false brome]
ref|XP_003529385.1|  PREDICTED: polyadenylate-binding protein RBP...    162   2e-43   Glycine max [soybeans]
ref|XP_004975779.1|  PREDICTED: polyadenylate-binding protein RBP...    162   2e-43   Setaria italica
ref|XP_009114049.1|  PREDICTED: polyadenylate-binding protein RBP...    162   2e-43   Brassica rapa
gb|EMS68577.1|  Uncharacterized RNA-binding protein C23E6.01c           159   2e-43   Triticum urartu
emb|CDY52067.1|  BnaA09g53390D                                          162   3e-43   Brassica napus [oilseed rape]
ref|XP_007156542.1|  hypothetical protein PHAVU_003G294800g             160   3e-43   Phaseolus vulgaris [French bean]
emb|CDX95176.1|  BnaC09g16940D                                          161   4e-43   
gb|EEC73442.1|  hypothetical protein OsI_07730                          159   4e-43   Oryza sativa Indica Group [Indian rice]
ref|XP_002885294.1|  RNA-binding protein 47B                            161   4e-43   
ref|XP_010487839.1|  PREDICTED: polyadenylate-binding protein RBP...    161   5e-43   Camelina sativa [gold-of-pleasure]
ref|XP_003608019.1|  RNA Binding Protein                                161   6e-43   Medicago truncatula
gb|AAM67293.1|  nuclear acid binding protein, putative                  160   8e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010487840.1|  PREDICTED: polyadenylate-binding protein RBP...    160   9e-43   Camelina sativa [gold-of-pleasure]
ref|NP_188544.1|  RNA-binding protein 47B                               160   1e-42   Arabidopsis thaliana [mouse-ear cress]
emb|CDX95462.1|  BnaC01g33540D                                          160   1e-42   
gb|AFK40720.1|  unknown                                                 160   1e-42   Medicago truncatula
gb|EMS62393.1|  Uncharacterized RNA-binding protein C23E6.01c           159   1e-42   Triticum urartu
ref|XP_009112131.1|  PREDICTED: polyadenylate-binding protein RBP...    160   1e-42   Brassica rapa
ref|XP_009358068.1|  PREDICTED: polyadenylate-binding protein RBP...    159   1e-42   Pyrus x bretschneideri [bai li]
ref|XP_003578248.1|  PREDICTED: polyadenylate-binding protein RBP...    160   1e-42   Brachypodium distachyon [annual false brome]
emb|CDY18570.1|  BnaA01g26250D                                          160   2e-42   Brassica napus [oilseed rape]
gb|ABR25993.1|  nucleic acid binding protein                            151   2e-42   Oryza sativa Indica Group [Indian rice]
ref|XP_003575198.1|  PREDICTED: polyadenylate-binding protein RBP...    159   2e-42   Brachypodium distachyon [annual false brome]
ref|XP_010466046.1|  PREDICTED: polyadenylate-binding protein RBP...    159   2e-42   Camelina sativa [gold-of-pleasure]
gb|KHN37491.1|  Polyadenylate-binding protein RBP47                     156   3e-42   Glycine soja [wild soybean]
ref|XP_006393234.1|  hypothetical protein EUTSA_v10011485mg             159   3e-42   Eutrema salsugineum [saltwater cress]
gb|ACF83065.1|  unknown                                                 156   5e-42   Zea mays [maize]
ref|XP_009356988.1|  PREDICTED: polyadenylate-binding protein RBP...    159   5e-42   Pyrus x bretschneideri [bai li]
gb|EMT16295.1|  Putative RNA-binding protein                            159   6e-42   
ref|XP_010507446.1|  PREDICTED: polyadenylate-binding protein RBP...    158   6e-42   Camelina sativa [gold-of-pleasure]
ref|XP_004168889.1|  PREDICTED: polyadenylate-binding protein RBP...    158   7e-42   
ref|XP_004145357.1|  PREDICTED: polyadenylate-binding protein RBP...    158   8e-42   
dbj|BAJ85879.1|  predicted protein                                      159   8e-42   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAD17764.1|  putative nucleic acid binding protein                  157   8e-42   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004957051.1|  PREDICTED: polyadenylate-binding protein RBP...    157   1e-41   Setaria italica
gb|ACN40970.1|  unknown                                                 157   1e-41   Picea sitchensis
ref|XP_010507452.1|  PREDICTED: polyadenylate-binding protein RBP...    158   1e-41   Camelina sativa [gold-of-pleasure]
gb|EEE57226.1|  hypothetical protein OsJ_07197                          158   1e-41   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006279885.1|  hypothetical protein CARUB_v100264670mg            154   1e-41   
ref|XP_009406503.1|  PREDICTED: polyadenylate-binding protein RBP...    157   1e-41   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009406502.1|  PREDICTED: polyadenylate-binding protein RBP...    157   1e-41   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004952707.1|  PREDICTED: polyadenylate-binding protein RBP...    157   1e-41   Setaria italica
gb|ACN39849.1|  unknown                                                 157   1e-41   Picea sitchensis
ref|XP_009112124.1|  PREDICTED: polyadenylate-binding protein RBP...    157   2e-41   
gb|ACG32072.1|  nucleic acid binding protein                            155   2e-41   Zea mays [maize]
ref|XP_006648763.1|  PREDICTED: polyadenylate-binding protein RBP...    155   3e-41   
ref|XP_009420609.1|  PREDICTED: polyadenylate-binding protein RBP45     156   3e-41   
ref|XP_003518846.1|  PREDICTED: polyadenylate-binding protein RBP...    156   4e-41   Glycine max [soybeans]
ref|XP_008392304.1|  PREDICTED: polyadenylate-binding protein RBP47     156   4e-41   Malus domestica [apple tree]
gb|ACF85767.1|  unknown                                                 155   4e-41   Zea mays [maize]
emb|CDY22988.1|  BnaC03g40810D                                          155   5e-41   Brassica napus [oilseed rape]
ref|XP_008459212.1|  PREDICTED: polyadenylate-binding protein RBP47     156   5e-41   Cucumis melo [Oriental melon]
ref|NP_001150649.1|  nucleic acid binding protein                       155   5e-41   Zea mays [maize]
ref|XP_010523211.1|  PREDICTED: polyadenylate-binding protein RBP...    156   6e-41   Tarenaya hassleriana [spider flower]
ref|XP_002891364.1|  ATRBP47C                                           155   6e-41   
ref|XP_004505196.1|  PREDICTED: polyadenylate-binding protein RBP...    155   9e-41   Cicer arietinum [garbanzo]
ref|NP_001144988.1|  uncharacterized protein LOC100278143               155   9e-41   Zea mays [maize]
gb|ACF87959.1|  unknown                                                 155   9e-41   Zea mays [maize]
ref|XP_010519119.1|  PREDICTED: LOW QUALITY PROTEIN: polyadenylat...    154   1e-40   Tarenaya hassleriana [spider flower]
ref|XP_008782206.1|  PREDICTED: polyadenylate-binding protein RBP...    152   3e-40   
ref|XP_009412453.1|  PREDICTED: polyadenylate-binding protein RBP45     154   4e-40   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004294842.1|  PREDICTED: polyadenylate-binding protein RBP...    153   6e-40   Fragaria vesca subsp. vesca
emb|CDY50959.1|  BnaA06g37550D                                          153   6e-40   Brassica napus [oilseed rape]
ref|XP_009147873.1|  PREDICTED: polyadenylate-binding protein RBP47A    153   6e-40   Brassica rapa
ref|XP_009418782.1|  PREDICTED: polyadenylate-binding protein RBP...    153   6e-40   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO36653.1|  hypothetical protein CISIN_1g037126mg                   147   6e-40   Citrus sinensis [apfelsine]
ref|XP_002452313.1|  hypothetical protein SORBIDRAFT_04g023540          153   6e-40   Sorghum bicolor [broomcorn]
gb|ABK24911.1|  unknown                                                 152   9e-40   Picea sitchensis
ref|XP_009145825.1|  PREDICTED: polyadenylate-binding protein RBP...    152   9e-40   Brassica rapa
ref|XP_011092726.1|  PREDICTED: polyadenylate-binding protein RBP...    152   9e-40   Sesamum indicum [beniseed]
ref|XP_002894197.1|  hypothetical protein ARALYDRAFT_474095             152   1e-39   
dbj|BAB02953.1|  DNA/RNA binding protein-like                           153   1e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010500505.1|  PREDICTED: polyadenylate-binding protein RBP...    152   1e-39   Camelina sativa [gold-of-pleasure]
ref|XP_010479396.1|  PREDICTED: polyadenylate-binding protein RBP...    152   2e-39   Camelina sativa [gold-of-pleasure]
emb|CDX92304.1|  BnaA05g21030D                                          151   2e-39   
emb|CDY28101.1|  BnaC06g02820D                                          151   2e-39   Brassica napus [oilseed rape]
ref|XP_010461802.1|  PREDICTED: polyadenylate-binding protein RBP...    152   2e-39   Camelina sativa [gold-of-pleasure]
emb|CDY16528.1|  BnaA08g02390D                                          150   3e-39   Brassica napus [oilseed rape]
ref|NP_175383.1|  RNA-binding protein 47A                               151   3e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009107272.1|  PREDICTED: polyadenylate-binding protein RBP...    150   4e-39   Brassica rapa
emb|CDX99265.1|  BnaC05g33800D                                          150   4e-39   
gb|EMT05029.1|  Putative RNA-binding protein                            148   5e-39   
gb|AAG13046.1|AC011807_5  Putative RNA binding protein                  150   6e-39   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001130489.1|  uncharacterized protein LOC100191587               150   7e-39   Zea mays [maize]
gb|KFK31830.1|  hypothetical protein AALP_AA6G163800                    149   8e-39   Arabis alpina [alpine rockcress]
gb|KFK31829.1|  hypothetical protein AALP_AA6G163800                    149   8e-39   Arabis alpina [alpine rockcress]
ref|XP_006307519.1|  hypothetical protein CARUB_v10009142mg             150   1e-38   Capsella rubella
gb|AEW68341.1|  putative nuclear acid binding protein                   148   2e-38   Medicago sativa [alfalfa]
ref|XP_003610417.1|  RNA-binding protein                                148   2e-38   Medicago truncatula
ref|XP_011092727.1|  PREDICTED: polyadenylate-binding protein RBP...    148   2e-38   Sesamum indicum [beniseed]
gb|AFK41944.1|  unknown                                                 148   2e-38   Medicago truncatula
gb|AFA36523.1|  nucleic acid binding protein                            142   2e-38   Lolium perenne [perennial ryegrass]
emb|CDY06734.1|  BnaA10g05130D                                          145   3e-38   
emb|CDY68866.1|  BnaCnng60840D                                          147   4e-38   Brassica napus [oilseed rape]
gb|ACL54800.1|  unknown                                                 145   4e-38   Zea mays [maize]
emb|CDO97156.1|  unnamed protein product                                148   4e-38   Coffea canephora [robusta coffee]
ref|XP_008678713.1|  PREDICTED: polyadenylate-binding protein RBP...    147   5e-38   Zea mays [maize]
emb|CDY32840.1|  BnaC08g02620D                                          147   5e-38   Brassica napus [oilseed rape]
emb|CDY29341.1|  BnaA05g16080D                                          147   6e-38   Brassica napus [oilseed rape]
ref|XP_008796097.1|  PREDICTED: polyadenylate-binding protein RBP45     147   7e-38   Phoenix dactylifera
ref|XP_010930147.1|  PREDICTED: polyadenylate-binding protein RBP45     146   1e-37   Elaeis guineensis
ref|XP_009783557.1|  PREDICTED: polyadenylate-binding protein RBP...    145   2e-37   Nicotiana sylvestris
ref|XP_010923889.1|  PREDICTED: polyadenylate-binding protein RBP...    146   2e-37   
ref|XP_008792645.1|  PREDICTED: polyadenylate-binding protein RBP...    145   2e-37   Phoenix dactylifera
ref|XP_008667171.1|  PREDICTED: uncharacterized protein LOC100193...    145   3e-37   Zea mays [maize]
gb|EPS57677.1|  hypothetical protein M569_17140                         145   3e-37   Genlisea aurea
ref|XP_009135617.1|  PREDICTED: polyadenylate-binding protein RBP...    145   3e-37   Brassica rapa
ref|XP_008813039.1|  PREDICTED: polyadenylate-binding protein RBP...    143   7e-37   
ref|XP_008813037.1|  PREDICTED: polyadenylate-binding protein RBP...    143   9e-37   
ref|XP_009145104.1|  PREDICTED: polyadenylate-binding protein RBP...    144   1e-36   
ref|XP_004982540.1|  PREDICTED: polyadenylate-binding protein RBP...    142   3e-36   
emb|CAC85246.1|  salt tolerance protein 6                               140   4e-36   
gb|ADE77364.1|  unknown                                                 139   4e-36   
gb|EAZ27535.1|  hypothetical protein OsJ_11490                          136   4e-36   
ref|XP_011097972.1|  PREDICTED: polyadenylate-binding protein RBP...    141   7e-36   
ref|XP_006446580.1|  hypothetical protein CICLE_v10017127mg             135   7e-36   
gb|ABK25253.1|  unknown                                                 142   7e-36   
gb|ABR18422.1|  unknown                                                 141   7e-36   
gb|EYU37704.1|  hypothetical protein MIMGU_mgv1a006826mg                141   8e-36   
gb|KFK35996.1|  hypothetical protein AALP_AA4G064500                    140   2e-35   
ref|XP_010665562.1|  PREDICTED: polyadenylate-binding protein RBP...    140   2e-35   
ref|XP_004153241.1|  PREDICTED: polyadenylate-binding protein RBP...    133   4e-35   
gb|EMS47480.1|  Uncharacterized RNA-binding protein C23E6.01c           136   4e-35   
ref|XP_007042377.1|  RNA-binding protein 47A                            139   5e-35   
ref|XP_006468021.1|  PREDICTED: polyadenylate-binding protein RBP...    139   6e-35   
ref|XP_006449038.1|  hypothetical protein CICLE_v10015407mg             139   6e-35   
ref|XP_007153936.1|  hypothetical protein PHAVU_003G077700g             139   6e-35   
gb|EEE68172.1|  hypothetical protein OsJ_26296                          136   1e-34   
gb|KJB79289.1|  hypothetical protein B456_013G042300                    138   2e-34   
ref|XP_001784132.1|  predicted protein                                  137   3e-34   
ref|XP_011025522.1|  PREDICTED: polyadenylate-binding protein RBP...    137   3e-34   
gb|KDO35912.1|  hypothetical protein CISIN_1g029152mg                   131   3e-34   
gb|EEC75600.1|  hypothetical protein OsI_12307                          137   3e-34   
gb|KHN33037.1|  Polyadenylate-binding protein RBP45                     135   3e-34   
ref|XP_006468022.1|  PREDICTED: polyadenylate-binding protein RBP...    137   4e-34   
ref|XP_006449039.1|  hypothetical protein CICLE_v10015407mg             136   4e-34   
gb|KHN37596.1|  Polyadenylate-binding protein RBP45B                    135   5e-34   
ref|XP_002285479.1|  PREDICTED: polyadenylate-binding protein RBP...    137   5e-34   
emb|CBI16387.3|  unnamed protein product                                137   5e-34   
gb|KJB47423.1|  hypothetical protein B456_008G025400                    136   6e-34   
ref|XP_007209154.1|  hypothetical protein PRUPE_ppa005940mg             136   7e-34   
ref|XP_010911059.1|  PREDICTED: polyadenylate-binding protein RBP...    133   7e-34   
emb|CDP05748.1|  unnamed protein product                                134   7e-34   
ref|NP_001132004.1|  uncharacterized protein LOC100193409               136   8e-34   
ref|XP_003573391.1|  PREDICTED: polyadenylate-binding protein RBP...    136   8e-34   
ref|XP_003542872.1|  PREDICTED: polyadenylate-binding protein RBP...    135   8e-34   
gb|EYU42664.1|  hypothetical protein MIMGU_mgv1a008163mg                135   9e-34   
ref|XP_006858185.1|  hypothetical protein AMTR_s00062p00161920          136   1e-33   
gb|ABF97193.1|  RNA recognition motif family protein, expressed         135   1e-33   
ref|XP_003546146.1|  PREDICTED: polyadenylate-binding protein RBP...    135   1e-33   
dbj|BAD05744.1|  putative RNA Binding Protein 45                        135   1e-33   
gb|AAG59664.1|AC084319_22  putative RNA binding protein                 135   1e-33   
ref|XP_002313332.2|  hypothetical protein POPTR_0009s05920g             135   1e-33   
ref|XP_008437079.1|  PREDICTED: polyadenylate-binding protein RBP...    135   1e-33   
ref|XP_004164285.1|  PREDICTED: LOW QUALITY PROTEIN: polyadenylat...    135   1e-33   
ref|XP_004152401.1|  PREDICTED: polyadenylate-binding protein RBP...    135   1e-33   
ref|XP_002513488.1|  nuclear acid binding protein, putative             135   2e-33   
ref|XP_004294372.1|  PREDICTED: polyadenylate-binding protein RBP45C    135   2e-33   
ref|XP_006659900.1|  PREDICTED: polyadenylate-binding protein RBP...    135   2e-33   
ref|NP_001050516.1|  Os03g0569900                                       135   2e-33   
gb|KJB47422.1|  hypothetical protein B456_008G025400                    134   2e-33   
ref|XP_010108648.1|  Polyadenylate-binding protein RBP47B'              135   2e-33   
ref|XP_006348103.1|  PREDICTED: polyadenylate-binding protein RBP...    135   2e-33   
ref|NP_001141359.1|  uncharacterized protein LOC100273450               135   2e-33   
gb|EMS60206.1|  RNA-binding post-transcriptional regulator csx1         133   2e-33   
gb|KJB32435.1|  hypothetical protein B456_005G240800                    134   3e-33   
gb|EMS68789.1|  Uncharacterized RNA-binding protein C23E6.01c           134   3e-33   
dbj|BAJ93453.1|  predicted protein                                      134   3e-33   
gb|EPS67039.1|  hypothetical protein M569_07737                         134   3e-33   
ref|XP_004232721.1|  PREDICTED: polyadenylate-binding protein RBP45     134   4e-33   
emb|CDP04387.1|  unnamed protein product                                129   4e-33   
ref|XP_010265752.1|  PREDICTED: polyadenylate-binding protein RBP...    134   4e-33   
ref|XP_010265753.1|  PREDICTED: polyadenylate-binding protein RBP...    134   5e-33   
ref|XP_004145109.1|  PREDICTED: polyadenylate-binding protein RBP...    134   5e-33   
ref|XP_004288602.1|  PREDICTED: polyadenylate-binding protein RBP...    134   5e-33   
gb|KJB22074.1|  hypothetical protein B456_004G028000                    134   5e-33   
ref|XP_001777334.1|  predicted protein                                  133   6e-33   
ref|XP_006434824.1|  hypothetical protein CICLE_v10001214mg             132   6e-33   
ref|XP_008676816.1|  PREDICTED: uncharacterized protein LOC100273...    134   6e-33   
gb|AFW61056.1|  hypothetical protein ZEAMMB73_234884                    134   7e-33   
dbj|BAK03410.1|  predicted protein                                      133   7e-33   
emb|CDP18029.1|  unnamed protein product                                133   8e-33   
ref|XP_007147735.1|  hypothetical protein PHAVU_006G150400g             133   9e-33   
ref|XP_007020874.1|  RNA-binding family protein                         133   9e-33   
gb|KHG09232.1|  Polyadenylate-binding RBP47B' -like protein             133   9e-33   
gb|AGV54881.1|  RNA-binding post-transcriptional regulator csx1-l...    132   1e-32   
emb|CBI26626.3|  unnamed protein product                                129   1e-32   
ref|XP_002863750.1|  hypothetical protein ARALYDRAFT_331131             132   1e-32   
ref|XP_008437078.1|  PREDICTED: polyadenylate-binding protein RBP...    133   1e-32   
ref|XP_008238181.1|  PREDICTED: polyadenylate-binding protein RBP...    132   1e-32   
ref|XP_008437076.1|  PREDICTED: polyadenylate-binding protein RBP...    132   1e-32   
ref|XP_010276065.1|  PREDICTED: polyadenylate-binding protein RBP...    132   1e-32   
gb|EYU46265.1|  hypothetical protein MIMGU_mgv1a007107mg                132   1e-32   
ref|XP_007015034.1|  RNA-binding family protein isoform 2               132   2e-32   
ref|XP_007015033.1|  RNA-binding family protein isoform 1               132   2e-32   
ref|XP_004507695.1|  PREDICTED: polyadenylate-binding protein RBP...    132   2e-32   
ref|XP_007015035.1|  RNA-binding family protein isoform 3               132   2e-32   
gb|KJB09397.1|  hypothetical protein B456_001G139100                    132   2e-32   
ref|XP_008806741.1|  PREDICTED: polyadenylate-binding protein RBP45     132   2e-32   
gb|KJB09398.1|  hypothetical protein B456_001G139100                    131   2e-32   
dbj|BAE71244.1|  putative DNA binding protein                           132   2e-32   
gb|KJB09396.1|  hypothetical protein B456_001G139100                    132   2e-32   
ref|XP_008441139.1|  PREDICTED: polyadenylate-binding protein RBP...    131   3e-32   
gb|KJB13664.1|  hypothetical protein B456_002G088100                    131   3e-32   
gb|KJB13665.1|  hypothetical protein B456_002G088100                    131   4e-32   
ref|XP_008377253.1|  PREDICTED: polyadenylate-binding protein RBP...    131   4e-32   
ref|XP_009376881.1|  PREDICTED: polyadenylate-binding protein RBP...    131   4e-32   
gb|KJB13666.1|  hypothetical protein B456_002G088100                    131   4e-32   
ref|XP_004486120.1|  PREDICTED: polyadenylate-binding protein RBP...    130   5e-32   
ref|XP_008345010.1|  PREDICTED: polyadenylate-binding protein RBP...    131   5e-32   
ref|XP_002460777.1|  hypothetical protein SORBIDRAFT_02g034736          125   7e-32   
ref|XP_009375056.1|  PREDICTED: polyadenylate-binding protein RBP...    130   7e-32   
ref|XP_009772575.1|  PREDICTED: polyadenylate-binding protein RBP...    130   7e-32   
ref|XP_006452313.1|  hypothetical protein CICLE_v10008440mg             130   9e-32   
ref|XP_004972674.1|  PREDICTED: polyadenylate-binding protein RBP...    130   1e-31   
ref|XP_004972673.1|  PREDICTED: polyadenylate-binding protein RBP...    130   1e-31   
ref|XP_002518499.1|  nuclear acid binding protein, putative             130   1e-31   
ref|XP_008441138.1|  PREDICTED: polyadenylate-binding protein RBP...    130   1e-31   
gb|KJB79291.1|  hypothetical protein B456_013G042300                    130   1e-31   
ref|XP_002973844.1|  hypothetical protein SELMODRAFT_100454             129   1e-31   
ref|XP_006452314.1|  hypothetical protein CICLE_v10008440mg             130   1e-31   
ref|XP_009772574.1|  PREDICTED: polyadenylate-binding protein RBP...    129   1e-31   
ref|XP_003549897.1|  PREDICTED: polyadenylate-binding protein RBP...    129   2e-31   
ref|XP_010031800.1|  PREDICTED: polyadenylate-binding protein RBP...    129   2e-31   
ref|XP_010240455.1|  PREDICTED: polyadenylate-binding protein RBP...    129   2e-31   
ref|XP_008224810.1|  PREDICTED: polyadenylate-binding protein RBP...    129   2e-31   
ref|XP_009768585.1|  PREDICTED: polyadenylate-binding protein RBP...    129   2e-31   
gb|KDP22083.1|  hypothetical protein JCGZ_25914                         129   2e-31   
ref|XP_002280601.1|  PREDICTED: polyadenylate-binding protein RBP...    129   2e-31   
ref|XP_008441163.1|  PREDICTED: polyadenylate-binding protein RBP...    129   3e-31   
emb|CAN83958.1|  hypothetical protein VITISV_039907                     129   3e-31   
dbj|BAJ87828.1|  predicted protein                                      128   3e-31   
ref|XP_010278711.1|  PREDICTED: polyadenylate-binding protein RBP...    129   4e-31   
gb|KHG01774.1|  Polyadenylate-binding RBP45C -like protein              128   4e-31   
ref|XP_003580589.1|  PREDICTED: polyadenylate-binding protein RBP...    128   4e-31   
ref|XP_004295261.2|  PREDICTED: polyadenylate-binding protein RBP45B    128   4e-31   
ref|XP_008441150.1|  PREDICTED: polyadenylate-binding protein RBP...    128   5e-31   
ref|XP_004957865.1|  PREDICTED: polyadenylate-binding protein RBP...    128   6e-31   
ref|XP_010545222.1|  PREDICTED: polyadenylate-binding protein RBP...    128   6e-31   
ref|XP_009615947.1|  PREDICTED: polyadenylate-binding protein RBP...    128   6e-31   
ref|XP_004145107.1|  PREDICTED: polyadenylate-binding protein RBP...    127   7e-31   
ref|XP_008365193.1|  PREDICTED: polyadenylate-binding protein RBP...    127   7e-31   
ref|XP_003529629.1|  PREDICTED: polyadenylate-binding protein RBP45     127   7e-31   
ref|XP_007211969.1|  hypothetical protein PRUPE_ppa006617mg             127   7e-31   
gb|AGV54456.1|  RNA-binding post-transcriptional regulator csx1-l...    127   7e-31   
gb|KHN35750.1|  Polyadenylate-binding protein RBP45                     127   7e-31   
ref|XP_004957864.1|  PREDICTED: polyadenylate-binding protein RBP...    128   7e-31   
ref|XP_011080284.1|  PREDICTED: polyadenylate-binding protein RBP...    127   7e-31   
ref|XP_008385660.1|  PREDICTED: polyadenylate-binding protein RBP...    127   7e-31   
ref|XP_009352469.1|  PREDICTED: polyadenylate-binding protein RBP...    127   7e-31   
ref|XP_009372712.1|  PREDICTED: polyadenylate-binding protein RBP...    127   8e-31   
ref|XP_008441142.1|  PREDICTED: polyadenylate-binding protein RBP...    127   9e-31   
dbj|BAJ85753.1|  predicted protein                                      127   9e-31   
gb|EMT04468.1|  RNA-binding post-transcriptional regulator csx1         126   1e-30   
ref|XP_003558701.1|  PREDICTED: polyadenylate-binding protein RBP...    127   1e-30   
ref|XP_006652855.1|  PREDICTED: polyadenylate-binding protein RBP...    126   1e-30   
ref|XP_002468416.1|  hypothetical protein SORBIDRAFT_01g045570          127   1e-30   
ref|XP_004250947.1|  PREDICTED: polyadenylate-binding protein RBP...    127   1e-30   
ref|XP_010313279.1|  PREDICTED: polyadenylate-binding protein RBP...    127   1e-30   
ref|XP_009414748.1|  PREDICTED: polyadenylate-binding protein RBP...    127   2e-30   
ref|XP_007150369.1|  hypothetical protein PHAVU_005G147800g             127   2e-30   
ref|XP_006361746.1|  PREDICTED: polyadenylate-binding protein RBP...    126   2e-30   
ref|XP_002464324.1|  hypothetical protein SORBIDRAFT_01g016170          126   2e-30   
ref|XP_006361747.1|  PREDICTED: polyadenylate-binding protein RBP...    126   2e-30   
ref|XP_010276064.1|  PREDICTED: polyadenylate-binding protein RBP...    126   2e-30   
gb|ACR34003.1|  unknown                                                 126   2e-30   
ref|NP_001152183.1|  LOC100285821                                       126   2e-30   
gb|KEH36836.1|  polyadenylate-binding protein RBP47B                    126   2e-30   
ref|XP_004985527.1|  PREDICTED: polyadenylate-binding protein RBP...    126   3e-30   
emb|CAE04743.3|  OSJNBb0060E08.6                                        126   3e-30   
gb|EAY95645.1|  hypothetical protein OsI_17510                          126   3e-30   
ref|NP_001053941.1|  Os04g0625800                                       126   3e-30   
gb|KJB63806.1|  hypothetical protein B456_010G017300                    125   4e-30   
ref|XP_008651136.1|  PREDICTED: hypothetical protein isoform X1         126   4e-30   
ref|XP_010938882.1|  PREDICTED: polyadenylate-binding protein RBP...    125   4e-30   
gb|KDP20762.1|  hypothetical protein JCGZ_21233                         125   4e-30   
ref|NP_001142233.1|  hypothetical protein                               125   5e-30   
tpg|DAA62918.1|  TPA: hypothetical protein ZEAMMB73_604225              125   5e-30   
ref|XP_008226922.1|  PREDICTED: polyadenylate-binding protein RBP45C    125   5e-30   
ref|XP_008349306.1|  PREDICTED: polyadenylate-binding protein RBP...    125   5e-30   
gb|KDP39118.1|  hypothetical protein JCGZ_00875                         125   5e-30   
gb|EMS52025.1|  RNA-binding post-transcriptional regulator csx1         125   6e-30   
gb|KCW76953.1|  hypothetical protein EUGRSUZ_D01313                     122   6e-30   
gb|KJB32438.1|  hypothetical protein B456_005G240800                    125   6e-30   
ref|XP_006850190.1|  hypothetical protein AMTR_s00022p00247520          125   7e-30   
gb|EEE61728.1|  hypothetical protein OsJ_16246                          126   7e-30   
ref|XP_010476097.1|  PREDICTED: polyadenylate-binding protein RBP...    124   8e-30   
ref|XP_010476096.1|  PREDICTED: polyadenylate-binding protein RBP...    124   8e-30   
ref|XP_002988285.1|  hypothetical protein SELMODRAFT_447249             124   9e-30   
ref|NP_001168324.1|  hypothetical protein                               124   1e-29   
ref|XP_008812246.1|  PREDICTED: polyadenylate-binding protein RBP...    124   1e-29   
gb|EYU36286.1|  hypothetical protein MIMGU_mgv1a005576mg                124   1e-29   
ref|XP_002447134.1|  hypothetical protein SORBIDRAFT_06g029180          124   2e-29   
ref|XP_011096084.1|  PREDICTED: polyadenylate-binding protein RBP...    124   2e-29   
ref|XP_010278708.1|  PREDICTED: polyadenylate-binding protein RBP...    124   2e-29   
gb|AAM64532.1|  putative DNA binding protein                            124   2e-29   
ref|XP_010092144.1|  Polyadenylate-binding protein RBP45                124   2e-29   
ref|NP_001168401.1|  hypothetical protein                               124   2e-29   
ref|XP_011030800.1|  PREDICTED: polyadenylate-binding protein RBP...    123   2e-29   
ref|NP_172630.1|  polyadenylate-binding protein RBP45B                  124   2e-29   
ref|XP_010493089.1|  PREDICTED: polyadenylate-binding protein RBP...    123   2e-29   
ref|XP_006307499.1|  hypothetical protein CARUB_v10009124mg             124   2e-29   
ref|XP_010458570.1|  PREDICTED: polyadenylate-binding protein RBP45B    123   2e-29   
ref|XP_007213954.1|  hypothetical protein PRUPE_ppa006577mg             123   3e-29   
ref|XP_002522953.1|  nuclear acid binding protein, putative             123   3e-29   
gb|KDO61275.1|  hypothetical protein CISIN_1g014513mg                   123   3e-29   
gb|KDO61276.1|  hypothetical protein CISIN_1g014513mg                   123   3e-29   
ref|XP_010052832.1|  PREDICTED: polyadenylate-binding protein RBP...    123   4e-29   
ref|XP_006352618.1|  PREDICTED: polyadenylate-binding protein RBP...    122   4e-29   
ref|XP_006446110.1|  hypothetical protein CICLE_v10015576mg             122   4e-29   
gb|KHG22988.1|  Polyadenylate-binding RBP45C -like protein              122   5e-29   
ref|XP_006370698.1|  hypothetical protein POPTR_0001s45000g             122   5e-29   
ref|XP_006470600.1|  PREDICTED: polyadenylate-binding protein RBP...    122   5e-29   
ref|XP_011010322.1|  PREDICTED: polyadenylate-binding protein RBP...    122   6e-29   
ref|XP_011010320.1|  PREDICTED: polyadenylate-binding protein RBP...    122   6e-29   
gb|EYU33637.1|  hypothetical protein MIMGU_mgv1a007175mg                122   6e-29   
ref|XP_004248403.1|  PREDICTED: polyadenylate-binding protein RBP...    122   7e-29   
ref|XP_006343293.1|  PREDICTED: polyadenylate-binding protein RBP...    122   7e-29   
ref|XP_009614215.1|  PREDICTED: polyadenylate-binding protein RBP...    122   7e-29   
ref|XP_004234481.1|  PREDICTED: polyadenylate-binding protein RBP...    122   7e-29   
ref|XP_002316998.2|  RNA-binding protein 45                             122   8e-29   
ref|XP_006417333.1|  hypothetical protein EUTSA_v10007819mg             122   8e-29   
ref|XP_004507696.1|  PREDICTED: polyadenylate-binding protein RBP...    121   9e-29   
ref|XP_009631416.1|  PREDICTED: polyadenylate-binding protein RBP...    121   1e-28   
ref|XP_009776437.1|  PREDICTED: polyadenylate-binding protein RBP...    121   1e-28   
gb|KJB81764.1|  hypothetical protein B456_013G160200                    121   1e-28   
ref|XP_010054589.1|  PREDICTED: LOW QUALITY PROTEIN: polyadenylat...    119   1e-28   
gb|KJB81761.1|  hypothetical protein B456_013G160200                    121   2e-28   



>ref|XP_006354957.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Solanum 
tuberosum]
Length=438

 Score =   249 bits (635),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 133/163 (82%), Positives = 140/163 (86%), Gaps = 1/163 (1%)
 Frame = -1

Query  686  SSGNQQQLPAQGGYSNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVS  507
            SSG  QQ  +QGGYSNG P  GSQ D DS+NTTIFVGGLDPNVSDEDLRQPF+QYGEIVS
Sbjct  277  SSGYPQQYSSQGGYSNGGPVQGSQPDADSTNTTIFVGGLDPNVSDEDLRQPFAQYGEIVS  336

Query  506  VKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAG  327
            VKIPVGKGCGFVQFANR DAEEALQKL G  IGKQTVRLSWGRNPA++QSRSDF NQW G
Sbjct  337  VKIPVGKGCGFVQFANRNDAEEALQKLNGTAIGKQTVRLSWGRNPANKQSRSDFGNQWTG  396

Query  326  AYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyGTHQQQVS  198
             YYGGHFYDGY YAFP PH+P     AAYGAYP+YGTHQQQVS
Sbjct  397  PYYGGHFYDGYGYAFPPPHDPG-MYAAAYGAYPVYGTHQQQVS  438



>ref|XP_009629702.1| PREDICTED: polyadenylate-binding protein RBP47-like [Nicotiana 
tomentosiformis]
Length=456

 Score =   248 bits (632),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 130/165 (79%), Positives = 136/165 (82%), Gaps = 2/165 (1%)
 Frame = -1

Query  686  SSGNQQQLPAQGGYSNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVS  507
            SSG QQQ  +QGGYSNG PA GSQ D DS+NTTIFVGGLDPNVSDEDLRQPF+QYGEIVS
Sbjct  292  SSGYQQQYSSQGGYSNGGPAQGSQPDADSTNTTIFVGGLDPNVSDEDLRQPFAQYGEIVS  351

Query  506  VKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAG  327
            VKIPVGKGCGFVQFANR DAEEALQKL G  IGKQTVRLSWGRNPA++QSR DF NQW G
Sbjct  352  VKIPVGKGCGFVQFANRNDAEEALQKLNGTAIGKQTVRLSWGRNPANKQSRGDFGNQWTG  411

Query  326  AYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyG--THQQQVS  198
             YYGGHFYDGY YAFP PH+P MYA AA          THQQQVS
Sbjct  412  PYYGGHFYDGYGYAFPPPHDPGMYAAAAAAYGAYPMYGTHQQQVS  456



>ref|XP_009765294.1| PREDICTED: polyadenylate-binding protein RBP47-like [Nicotiana 
sylvestris]
Length=456

 Score =   247 bits (631),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 129/165 (78%), Positives = 135/165 (82%), Gaps = 2/165 (1%)
 Frame = -1

Query  686  SSGNQQQLPAQGGYSNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVS  507
            SSG QQQ  +QGGYSNG PA GSQ D DS+NTTIFVGGLDPNVSDEDLRQPF+QYGEIVS
Sbjct  292  SSGYQQQYSSQGGYSNGGPAQGSQPDADSTNTTIFVGGLDPNVSDEDLRQPFAQYGEIVS  351

Query  506  VKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAG  327
            VKIPVGKGCGFVQFANR DAEEALQKL G  IGKQTVRLSWGRNPA++QSR DF NQW G
Sbjct  352  VKIPVGKGCGFVQFANRNDAEEALQKLNGTAIGKQTVRLSWGRNPANKQSRGDFGNQWTG  411

Query  326  AYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyG--THQQQVS  198
             YYGGHFYDGY YAFP  H+P MYA AA          THQQQVS
Sbjct  412  PYYGGHFYDGYGYAFPPQHDPGMYAAAAAAYGAYPIYGTHQQQVS  456



>ref|XP_004238180.1| PREDICTED: polyadenylate-binding protein RBP47-like [Solanum 
lycopersicum]
Length=451

 Score =   246 bits (628),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 139/163 (85%), Gaps = 1/163 (1%)
 Frame = -1

Query  686  SSGNQQQLPAQGGYSNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVS  507
            SSG  QQ  +QGGYSNG PA GSQ D DS+NTTIFVGGLDPNVSDEDLRQPF+QYGEIVS
Sbjct  290  SSGYPQQYSSQGGYSNGGPAQGSQPDADSTNTTIFVGGLDPNVSDEDLRQPFAQYGEIVS  349

Query  506  VKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAG  327
            VKIPVGKGCGFVQFA R DAEEALQKL G  IGKQTVRLSWGRNPA++Q RSDF NQW G
Sbjct  350  VKIPVGKGCGFVQFAKRNDAEEALQKLNGTAIGKQTVRLSWGRNPANKQPRSDFGNQWTG  409

Query  326  AYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyGTHQQQVS  198
             YYGGHFYDGY YAFP PH+P     AAYGAYP+YGTHQQQVS
Sbjct  410  PYYGGHFYDGYGYAFPQPHDPG-MYAAAYGAYPVYGTHQQQVS  451



>ref|XP_007222286.1| hypothetical protein PRUPE_ppa005903mg [Prunus persica]
 gb|EMJ23485.1| hypothetical protein PRUPE_ppa005903mg [Prunus persica]
Length=438

 Score =   238 bits (606),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 132/164 (80%), Positives = 143/164 (87%), Gaps = 1/164 (1%)
 Frame = -1

Query  686  SSGNQQQLPAQGGY-SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIV  510
            SSG QQQ  +QGGY SNG+P  G QSDGDS+NTTIFVGGLDPNV+DEDLR PFSQYGEIV
Sbjct  275  SSGYQQQYSSQGGYVSNGTPTQGFQSDGDSTNTTIFVGGLDPNVTDEDLRHPFSQYGEIV  334

Query  509  SVKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWA  330
            SVKIPVGKGCGFVQFANR +AEEAL KL G VIGKQTVRLSWGRNPA++Q R+DF NQWA
Sbjct  335  SVKIPVGKGCGFVQFANRNNAEEALPKLNGTVIGKQTVRLSWGRNPANKQFRTDFGNQWA  394

Query  329  GAYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyGTHQQQVS  198
            GAYYGG  YDGY YA P  H+P+MYA AAYGAYP+YGTHQQQVS
Sbjct  395  GAYYGGPVYDGYGYALPPHHDPSMYAAAAYGAYPVYGTHQQQVS  438



>gb|KDO35910.1| hypothetical protein CISIN_1g029152mg [Citrus sinensis]
Length=189

 Score =   228 bits (582),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 121/166 (73%), Positives = 136/166 (82%), Gaps = 3/166 (2%)
 Frame = -1

Query  686  SSGNQQQLPAQGGY-SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIV  510
            SSG QQQ  +QGGY SNG+P  G QS+GDSSNTTIFVGGLDPNV+DEDLRQPFSQYGEI 
Sbjct  24   SSGYQQQYSSQGGYASNGAPGQGPQSEGDSSNTTIFVGGLDPNVTDEDLRQPFSQYGEIA  83

Query  509  SVKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWA  330
            SVKIPVGKGCGFVQFANR +AEEAL KL G VIGKQ+VRLSWGRNPA++Q R+D+ NQW+
Sbjct  84   SVKIPVGKGCGFVQFANRENAEEALHKLNGTVIGKQSVRLSWGRNPANKQFRADYGNQWS  143

Query  329  GAYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyG--THQQQVS  198
            GAYYGG  YDGY YA P P++P+MYA AA          +HQQQVS
Sbjct  144  GAYYGGQVYDGYGYAIPPPNDPSMYAAAAAAYGAYPVYGSHQQQVS  189



>ref|XP_008220171.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X2 
[Prunus mume]
Length=441

 Score =   235 bits (599),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 126/166 (76%), Positives = 136/166 (82%), Gaps = 3/166 (2%)
 Frame = -1

Query  686  SSGNQQQLPAQGGY-SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIV  510
            SSG QQQ  +QGGY SNG+P  G QSDGDS+NTTIFVGGLDPNV+DEDLRQPFSQYGEIV
Sbjct  276  SSGYQQQYSSQGGYVSNGTPTQGFQSDGDSTNTTIFVGGLDPNVTDEDLRQPFSQYGEIV  335

Query  509  SVKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWA  330
            SVKIPVGKGCGFVQFANR +AEEAL KL G VIGKQTVRLSWGRNPA++Q R+DF NQWA
Sbjct  336  SVKIPVGKGCGFVQFANRNNAEEALPKLNGTVIGKQTVRLSWGRNPANKQFRTDFGNQWA  395

Query  329  GAYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyG--THQQQVS  198
            GAYYGG  YDGY YA P  H+P+MYA AA          THQQQVS
Sbjct  396  GAYYGGPVYDGYGYALPPHHDPSMYAAAAAAYGAYPVYGTHQQQVS  441



>emb|CBI19566.3| unnamed protein product [Vitis vinifera]
Length=324

 Score =   228 bits (581),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 127/164 (77%), Positives = 137/164 (84%), Gaps = 5/164 (3%)
 Frame = -1

Query  686  SSGNQQQLPAQGGY-SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIV  510
            SSG QQQ  + GGY SNG+     QSDGDS NTTIFVGGLDPNVSDEDLRQPFSQYGEIV
Sbjct  165  SSGYQQQYSSHGGYASNGASV---QSDGDSMNTTIFVGGLDPNVSDEDLRQPFSQYGEIV  221

Query  509  SVKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWA  330
            SVKIPVGKGCGFVQFANR +AE+ALQKL G VIGKQTVRLSWGRNPA++Q R+DF NQW+
Sbjct  222  SVKIPVGKGCGFVQFANRNNAEDALQKLNGTVIGKQTVRLSWGRNPANKQMRADFGNQWS  281

Query  329  GAYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyGTHQQQVS  198
            GAYYGG  YDGY YA P PH+P     AAYGAYP+YG HQQQVS
Sbjct  282  GAYYGGQVYDGYGYALPPPHDPT-MYAAAYGAYPVYGNHQQQVS  324



>ref|XP_008220170.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X1 
[Prunus mume]
Length=442

 Score =   231 bits (588),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 126/167 (75%), Positives = 136/167 (81%), Gaps = 4/167 (2%)
 Frame = -1

Query  686  SSGNQQQLPAQGGY-SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIV  510
            SSG QQQ  +QGGY SNG+P  G QSDGDS+NTTIFVGGLDPNV+DEDLRQPFSQYGEIV
Sbjct  276  SSGYQQQYSSQGGYVSNGTPTQGFQSDGDSTNTTIFVGGLDPNVTDEDLRQPFSQYGEIV  335

Query  509  SVKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQS-RSDFTNQW  333
            SVKIPVGKGCGFVQFANR +AEEAL KL G VIGKQTVRLSWGRNPA++Q  R+DF NQW
Sbjct  336  SVKIPVGKGCGFVQFANRNNAEEALPKLNGTVIGKQTVRLSWGRNPANKQQFRTDFGNQW  395

Query  332  AGAYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyG--THQQQVS  198
            AGAYYGG  YDGY YA P  H+P+MYA AA          THQQQVS
Sbjct  396  AGAYYGGPVYDGYGYALPPHHDPSMYAAAAAAYGAYPVYGTHQQQVS  442



>ref|XP_007017329.1| RNA-binding protein 47C isoform 1 [Theobroma cacao]
 gb|EOY14554.1| RNA-binding protein 47C isoform 1 [Theobroma cacao]
Length=435

 Score =   229 bits (585),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 126/166 (76%), Positives = 139/166 (84%), Gaps = 6/166 (4%)
 Frame = -1

Query  686  SSGNQQQLPAQGGY-SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIV  510
            SSG QQQ  +QGGY SNG+    +QSDGDSSNTTIFVGGLDPNV++EDLRQPFSQYGEIV
Sbjct  273  SSGYQQQYSSQGGYASNGA---SNQSDGDSSNTTIFVGGLDPNVTEEDLRQPFSQYGEIV  329

Query  509  SVKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWA  330
            SVKIPVGKGCGFVQFANR +AEEALQKL G VIGKQTVRLSWGRNPA++Q R+D+ NQW+
Sbjct  330  SVKIPVGKGCGFVQFANRNNAEEALQKLNGTVIGKQTVRLSWGRNPANKQFRADYGNQWS  389

Query  329  GAYYGGHFYDGYTYAFPAPHNPNmyapaaygaypm--yGTHQQQVS  198
            GAYYGG  YDGY YAFP PH+P MYA AA        YG+HQQQVS
Sbjct  390  GAYYGGQVYDGYGYAFPPPHDPGMYAAAAATYGAYPIYGSHQQQVS  435



>ref|XP_006473363.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Citrus 
sinensis]
Length=433

 Score =   229 bits (583),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 121/166 (73%), Positives = 136/166 (82%), Gaps = 3/166 (2%)
 Frame = -1

Query  686  SSGNQQQLPAQGGY-SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIV  510
            SSG QQQ  +QGGY SNG+P  G QS+GDSSNTTIFVGGLDPNV+DEDLRQPFSQYGEI 
Sbjct  268  SSGYQQQYSSQGGYASNGAPGQGPQSEGDSSNTTIFVGGLDPNVTDEDLRQPFSQYGEIA  327

Query  509  SVKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWA  330
            SVKIPVGKGCGFVQFANR +AEEAL KL G VIGKQ+VRLSWGRNPA++Q R+D+ NQW+
Sbjct  328  SVKIPVGKGCGFVQFANRENAEEALHKLNGTVIGKQSVRLSWGRNPANKQFRADYGNQWS  387

Query  329  GAYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyG--THQQQVS  198
            GAYYGG  YDGY YA P P++P+MYA AA          +HQQQVS
Sbjct  388  GAYYGGQVYDGYGYAIPPPNDPSMYAAAAAAYGAYPVYGSHQQQVS  433



>ref|XP_006434827.1| hypothetical protein CICLE_v10001214mg [Citrus clementina]
 gb|ESR48067.1| hypothetical protein CICLE_v10001214mg [Citrus clementina]
Length=432

 Score =   229 bits (583),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 121/166 (73%), Positives = 136/166 (82%), Gaps = 3/166 (2%)
 Frame = -1

Query  686  SSGNQQQLPAQGGY-SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIV  510
            SSG QQQ  +QGGY SNG+P  G QS+GDSSNTTIFVGGLDPNV+DEDLRQPFSQYGEI 
Sbjct  267  SSGYQQQYSSQGGYASNGAPGQGPQSEGDSSNTTIFVGGLDPNVTDEDLRQPFSQYGEIA  326

Query  509  SVKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWA  330
            SVKIPVGKGCGFVQFANR +AEEAL KL G VIGKQ+VRLSWGRNPA++Q R+D+ NQW+
Sbjct  327  SVKIPVGKGCGFVQFANRENAEEALHKLNGTVIGKQSVRLSWGRNPANKQFRADYGNQWS  386

Query  329  GAYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyG--THQQQVS  198
            GAYYGG  YDGY YA P P++P+MYA AA          +HQQQVS
Sbjct  387  GAYYGGQVYDGYGYAIPPPNDPSMYAAAAAAYGAYPVYGSHQQQVS  432



>ref|XP_003634360.1| PREDICTED: polyadenylate-binding protein RBP47-like [Vitis vinifera]
Length=418

 Score =   227 bits (579),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 127/164 (77%), Positives = 137/164 (84%), Gaps = 5/164 (3%)
 Frame = -1

Query  686  SSGNQQQLPAQGGY-SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIV  510
            SSG QQQ  + GGY SNG+     QSDGDS NTTIFVGGLDPNVSDEDLRQPFSQYGEIV
Sbjct  259  SSGYQQQYSSHGGYASNGASV---QSDGDSMNTTIFVGGLDPNVSDEDLRQPFSQYGEIV  315

Query  509  SVKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWA  330
            SVKIPVGKGCGFVQFANR +AE+ALQKL G VIGKQTVRLSWGRNPA++Q R+DF NQW+
Sbjct  316  SVKIPVGKGCGFVQFANRNNAEDALQKLNGTVIGKQTVRLSWGRNPANKQMRADFGNQWS  375

Query  329  GAYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyGTHQQQVS  198
            GAYYGG  YDGY YA P PH+P     AAYGAYP+YG HQQQVS
Sbjct  376  GAYYGGQVYDGYGYALPPPHDPT-MYAAAYGAYPVYGNHQQQVS  418



>gb|KDP38389.1| hypothetical protein JCGZ_04314 [Jatropha curcas]
Length=437

 Score =   228 bits (580),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 124/166 (75%), Positives = 139/166 (84%), Gaps = 7/166 (4%)
 Frame = -1

Query  686  SSGNQQQLPAQGGY-SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIV  510
            SSG QQQ    GGY SNG+   G QSDGDS+NTTIFVGGLDPNV+DEDL+QPFSQYGEIV
Sbjct  276  SSGYQQQ----GGYASNGATGQGFQSDGDSTNTTIFVGGLDPNVTDEDLKQPFSQYGEIV  331

Query  509  SVKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWA  330
            SVKIP+GKGCGFVQFANR++AEEALQKL G VIGKQTVRLSWGRNPA++Q R+DF NQW+
Sbjct  332  SVKIPLGKGCGFVQFANRSNAEEALQKLNGTVIGKQTVRLSWGRNPANKQFRADFGNQWS  391

Query  329  GAYYGGHFYDGYTYAFPAPHNPNmyapaaygayp--myGTHQQQVS  198
            GAYYGG  YDGY YA P PH+P+MYA AA       +YG+HQQQVS
Sbjct  392  GAYYGGQVYDGYGYALPPPHDPSMYAAAAAAYGAYPVYGSHQQQVS  437



>ref|XP_009605325.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Nicotiana 
tomentosiformis]
Length=422

 Score =   227 bits (578),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 122/163 (75%), Positives = 134/163 (82%), Gaps = 0/163 (0%)
 Frame = -1

Query  686  SSGNQQQLPAQGGYSNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVS  507
            SSG  Q   + GGYSN +   GSQ D DS+NTTIFVGGLDP VSDEDLR PF+QYGEI S
Sbjct  260  SSGYLQYYSSLGGYSNSASPQGSQPDVDSTNTTIFVGGLDPIVSDEDLRHPFAQYGEIAS  319

Query  506  VKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAG  327
            VKIPVGKGCGFVQFA R DAE+ALQKL G  IGKQTVRLSWGRNPA++QSR+DF  QW G
Sbjct  320  VKIPVGKGCGFVQFAKRNDAEKALQKLNGTAIGKQTVRLSWGRNPANKQSRADFMKQWTG  379

Query  326  AYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyGTHQQQVS  198
             YYGGHFY+ Y YAFP PH+P+MYA AAYG YP+YGTHQQQVS
Sbjct  380  PYYGGHFYNAYGYAFPPPHDPSMYAAAAYGTYPIYGTHQQQVS  422



>ref|XP_009370172.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X2 
[Pyrus x bretschneideri]
Length=440

 Score =   227 bits (578),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 135/167 (81%), Gaps = 4/167 (2%)
 Frame = -1

Query  686  SSGNQQQLPAQGGY-SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIV  510
            SSG QQQ  +QGGY SNG+P  G QSDGDS+NTTIFVGGLDPNV+DEDLRQPFSQYGEIV
Sbjct  274  SSGYQQQYSSQGGYVSNGTPTQGFQSDGDSTNTTIFVGGLDPNVTDEDLRQPFSQYGEIV  333

Query  509  SVKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWA  330
            SVKIPVGKGCGFVQFANR +AEEAL KL G VIGKQTVRLSWGRNPA++Q RSDF NQW 
Sbjct  334  SVKIPVGKGCGFVQFANRNNAEEALPKLNGTVIGKQTVRLSWGRNPANKQFRSDFGNQWG  393

Query  329  G-AYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyG--THQQQVS  198
            G AYYGG  Y+GY YA P  H+P+MYA A+          THQQQVS
Sbjct  394  GAAYYGGPVYEGYGYALPPHHDPSMYAAASAAYGAYPVYGTHQQQVS  440



>ref|XP_009764865.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Nicotiana 
sylvestris]
Length=423

 Score =   226 bits (576),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 123/163 (75%), Positives = 136/163 (83%), Gaps = 0/163 (0%)
 Frame = -1

Query  686  SSGNQQQLPAQGGYSNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVS  507
            SSG  Q   + GGYSN +   GSQ D DS+NTTIFVGGLDP+VSDEDLRQ F+QYGEI S
Sbjct  261  SSGYLQHYSSLGGYSNSASPQGSQPDVDSTNTTIFVGGLDPHVSDEDLRQLFAQYGEIAS  320

Query  506  VKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAG  327
            VKIPVGKGCGFVQFA R DAE+ALQKL G  IGKQTVRLSWGRNPA++QSR+DF  QW G
Sbjct  321  VKIPVGKGCGFVQFAKRNDAEKALQKLNGTAIGKQTVRLSWGRNPANKQSRADFMKQWTG  380

Query  326  AYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyGTHQQQVS  198
             YYGGHFY+ Y YAFP PH+P+MYA AAYGAYP+YGTHQQQVS
Sbjct  381  PYYGGHFYNAYGYAFPPPHDPSMYAAAAYGAYPIYGTHQQQVS  423



>ref|XP_008361011.1| PREDICTED: polyadenylate-binding protein RBP47-like [Malus domestica]
Length=443

 Score =   225 bits (574),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 134/167 (80%), Gaps = 4/167 (2%)
 Frame = -1

Query  686  SSGNQQQLPAQGGY-SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIV  510
            SS  QQQ  +QGGY SNG+P  G QSDGDS+NTTIFVGGLDPNV+DEDLRQPFSQYGEIV
Sbjct  277  SSAYQQQYSSQGGYVSNGTPTQGFQSDGDSTNTTIFVGGLDPNVTDEDLRQPFSQYGEIV  336

Query  509  SVKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWA  330
            SVKIPVGKGCGFVQFANR +AEEAL KL G VIGKQTVRLSWGRNPA++Q RSDF NQW 
Sbjct  337  SVKIPVGKGCGFVQFANRNNAEEALPKLNGTVIGKQTVRLSWGRNPANKQFRSDFGNQWG  396

Query  329  GA-YYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyG--THQQQVS  198
            GA YYGG  Y+GY YA P  H+P+MYA AA          THQQQVS
Sbjct  397  GAXYYGGPVYEGYGYALPPHHDPSMYAAAAAAYGAYPVYGTHQQQVS  443



>ref|XP_007017331.1| RNA-binding protein 47C isoform 3 [Theobroma cacao]
 gb|EOY14556.1| RNA-binding protein 47C isoform 3 [Theobroma cacao]
Length=436

 Score =   225 bits (573),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 137/167 (82%), Gaps = 7/167 (4%)
 Frame = -1

Query  686  SSGNQQQLPAQ-GGY-SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEI  513
            SSG QQQ  +Q GGY SNG+    +QSDGDSSNTTIFVGGLDPNV++EDLRQPFSQYGEI
Sbjct  273  SSGYQQQYSSQEGGYASNGA---SNQSDGDSSNTTIFVGGLDPNVTEEDLRQPFSQYGEI  329

Query  512  VSVKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQW  333
            VSVKIPVGKGCGFVQFANR +AEEALQKL G VIGKQTVRLSWGRNPA++Q R+D+ NQW
Sbjct  330  VSVKIPVGKGCGFVQFANRNNAEEALQKLNGTVIGKQTVRLSWGRNPANKQFRADYGNQW  389

Query  332  AGAYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyG--THQQQVS  198
            +GAYYGG  YDGY YAFP PH+P MYA AA          +HQQQVS
Sbjct  390  SGAYYGGQVYDGYGYAFPPPHDPGMYAAAAATYGAYPIYGSHQQQVS  436



>gb|KDO35914.1| hypothetical protein CISIN_1g029152mg [Citrus sinensis]
 gb|KDO35915.1| hypothetical protein CISIN_1g029152mg [Citrus sinensis]
Length=198

 Score =   217 bits (553),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 115/159 (72%), Positives = 129/159 (81%), Gaps = 3/159 (2%)
 Frame = -1

Query  665  LPAQGGY-SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVG  489
            L   GGY SNG+P  G QS+GDSSNTTIFVGGLDPNV+DEDLRQPFSQYGEI SVKIPVG
Sbjct  40   LVLIGGYASNGAPGQGPQSEGDSSNTTIFVGGLDPNVTDEDLRQPFSQYGEIASVKIPVG  99

Query  488  KGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGH  309
            KGCGFVQFANR +AEEAL KL G VIGKQ+VRLSWGRNPA++Q R+D+ NQW+GAYYGG 
Sbjct  100  KGCGFVQFANRENAEEALHKLNGTVIGKQSVRLSWGRNPANKQFRADYGNQWSGAYYGGQ  159

Query  308  FYDGYTYAFPAPHNPNmyapaaygaypmyG--THQQQVS  198
             YDGY YA P P++P+MYA AA          +HQQQVS
Sbjct  160  VYDGYGYAIPPPNDPSMYAAAAAAYGAYPVYGSHQQQVS  198



>ref|XP_008357395.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X2 
[Malus domestica]
Length=444

 Score =   224 bits (572),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 134/167 (80%), Gaps = 4/167 (2%)
 Frame = -1

Query  686  SSGNQQQLPAQGGY-SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIV  510
            SSG QQQ  +QGGY SNG+P  G Q DGDS+NTTIFVGGLDPNV+DEDLRQPFSQYGEIV
Sbjct  278  SSGYQQQYSSQGGYVSNGTPTQGFQFDGDSTNTTIFVGGLDPNVTDEDLRQPFSQYGEIV  337

Query  509  SVKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWA  330
            SVKIPVGKGCGFVQFANR +AEEAL KL G VIGKQTVRLSWGRNPA++Q RSDF NQW 
Sbjct  338  SVKIPVGKGCGFVQFANRNNAEEALPKLNGTVIGKQTVRLSWGRNPANKQFRSDFGNQWG  397

Query  329  G-AYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyG--THQQQVS  198
            G AYYGG  Y+GY YA P  H+P+MYA A+          THQQQVS
Sbjct  398  GAAYYGGPVYEGYGYALPPHHDPSMYAAASAAYGAYPVYGTHQQQVS  444



>emb|CAC69852.1| nucleic acid binding protein [Nicotiana tabacum]
Length=456

 Score =   224 bits (572),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 127/165 (77%), Gaps = 2/165 (1%)
 Frame = -1

Query  686  SSGNQQQLPAQGGYSNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVS  507
            SSG QQQ  +QGGYSNG PA GSQ D DS+NTTIFVGGLDPNVSDEDLRQPF QYGEIVS
Sbjct  292  SSGYQQQYSSQGGYSNGGPAQGSQPDADSTNTTIFVGGLDPNVSDEDLRQPFVQYGEIVS  351

Query  506  VKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAG  327
            VKIPV +     QFANR DAEEALQKL G  IGKQTVRL WGRNPA++QSR DF NQW G
Sbjct  352  VKIPVEERVWVWQFANRNDAEEALQKLNGTFIGKQTVRLFWGRNPANKQSRGDFGNQWTG  411

Query  326  AYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyG--THQQQVS  198
             YYGGHFYDGY YAFP  H+P MYA AA          THQQQVS
Sbjct  412  PYYGGHFYDGYGYAFPPQHDPGMYAAAAAAYGAYPIYGTHQQQVS  456



>gb|KJB58432.1| hypothetical protein B456_009G209600 [Gossypium raimondii]
Length=432

 Score =   223 bits (569),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 120/141 (85%), Gaps = 2/141 (1%)
 Frame = -1

Query  686  SSGNQQQLPAQGGYSNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVS  507
            SS  QQQ   QGGY++ S +  SQSDGDSSNTTIFVGGLDPNV++EDLRQPFSQYGEIVS
Sbjct  273  SSSYQQQYSLQGGYASNSAS--SQSDGDSSNTTIFVGGLDPNVTEEDLRQPFSQYGEIVS  330

Query  506  VKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAG  327
            VKIPVGKGCGFVQFA R +AEEALQKL G +IGKQTVRLSWGRNP ++Q R+D+ NQW G
Sbjct  331  VKIPVGKGCGFVQFAGRNNAEEALQKLNGTIIGKQTVRLSWGRNPTNKQFRADYGNQWGG  390

Query  326  AYYGGHFYDGYTYAFPAPHNP  264
            AYYGG  YDGY YAFP PHNP
Sbjct  391  AYYGGAVYDGYGYAFPPPHNP  411



>gb|KJB59840.1| hypothetical protein B456_009G275200 [Gossypium raimondii]
 gb|KJB59841.1| hypothetical protein B456_009G275200 [Gossypium raimondii]
Length=419

 Score =   223 bits (568),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 122/163 (75%), Positives = 136/163 (83%), Gaps = 3/163 (2%)
 Frame = -1

Query  686  SSGNQQQLPAQGGYSNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVS  507
            SSG QQQ   QGGY+  S  + +QSDGDSSNTTIFVGGLDPNV++EDLRQ FSQYGEIVS
Sbjct  260  SSGYQQQYSLQGGYA--SNGNSTQSDGDSSNTTIFVGGLDPNVTEEDLRQSFSQYGEIVS  317

Query  506  VKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAG  327
            VKIPVGKGCGFVQ+ANR +AEEALQKL G+VIGKQTVRLSWGRNPA++Q R D+ NQW G
Sbjct  318  VKIPVGKGCGFVQYANRKNAEEALQKLNGMVIGKQTVRLSWGRNPANKQFRGDYGNQWGG  377

Query  326  AYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyGTHQQQVS  198
            AYYGG  YDGY YA P PH+P     AAYG YP+YG+HQQQVS
Sbjct  378  AYYGGQVYDGYRYAVPPPHDPG-MYAAAYGTYPIYGSHQQQVS  419



>gb|EYU25396.1| hypothetical protein MIMGU_mgv1a006186mg [Erythranthe guttata]
Length=454

 Score =   223 bits (569),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 125/165 (76%), Positives = 138/165 (84%), Gaps = 3/165 (2%)
 Frame = -1

Query  686  SSGNQQQLPAQGGYSNGSPAHGSQ-SDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIV  510
            SSG QQQ   QGGYSNG  AHGSQ SDGDS NTTIFVGGLDP+V+DE+LRQPFS+YGEIV
Sbjct  291  SSGYQQQYSPQGGYSNGFSAHGSQLSDGDSVNTTIFVGGLDPSVTDEELRQPFSEYGEIV  350

Query  509  SVKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWA  330
            SVKIPVGKGCGFVQF NR DAEEALQ+L G  IGKQTVRLSWG +PA++QSR D+ +QW 
Sbjct  351  SVKIPVGKGCGFVQFVNRNDAEEALQQLSGKTIGKQTVRLSWGHSPANKQSRVDYAHQWT  410

Query  329  G-AYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyGTHQQQVS  198
            G AYYGG ++DGY YA P PH+PN    AAYGAYP YGTHQQQVS
Sbjct  411  GAAYYGGPYFDGYGYALPPPHDPN-MYAAAYGAYPFYGTHQQQVS  454



>ref|XP_006374988.1| RNA-binding protein 47 [Populus trichocarpa]
 gb|ERP52785.1| RNA-binding protein 47 [Populus trichocarpa]
Length=429

 Score =   223 bits (567),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 122/166 (73%), Positives = 134/166 (81%), Gaps = 7/166 (4%)
 Frame = -1

Query  686  SSGNQQQLPAQGGY-SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIV  510
            SSG QQQ    GGY SNG+ A G QSDGDS+NTTIFVGGLDPNV+DEDL+QPFSQYGEIV
Sbjct  268  SSGYQQQ----GGYGSNGASAQGFQSDGDSNNTTIFVGGLDPNVTDEDLKQPFSQYGEIV  323

Query  509  SVKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWA  330
            SVKIPVGKGCGFVQFANR +AEEALQKL G VIGKQTVRLSWGRNPA++Q R+DF + W 
Sbjct  324  SVKIPVGKGCGFVQFANRDNAEEALQKLNGTVIGKQTVRLSWGRNPANKQFRADFGSPWN  383

Query  329  GAYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyG--THQQQVS  198
            GAYYGG  YDGY YA P PH+P+MYA AA          +HQQQVS
Sbjct  384  GAYYGGQVYDGYGYALPPPHDPSMYAAAAAAYGAYPIYGSHQQQVS  429



>ref|XP_009370171.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X1 
[Pyrus x bretschneideri]
Length=441

 Score =   223 bits (567),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 135/168 (80%), Gaps = 5/168 (3%)
 Frame = -1

Query  686  SSGNQQQLPAQGGY-SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIV  510
            SSG QQQ  +QGGY SNG+P  G QSDGDS+NTTIFVGGLDPNV+DEDLRQPFSQYGEIV
Sbjct  274  SSGYQQQYSSQGGYVSNGTPTQGFQSDGDSTNTTIFVGGLDPNVTDEDLRQPFSQYGEIV  333

Query  509  SVKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQS-RSDFTNQW  333
            SVKIPVGKGCGFVQFANR +AEEAL KL G VIGKQTVRLSWGRNPA++Q  RSDF NQW
Sbjct  334  SVKIPVGKGCGFVQFANRNNAEEALPKLNGTVIGKQTVRLSWGRNPANKQQFRSDFGNQW  393

Query  332  AG-AYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyG--THQQQVS  198
             G AYYGG  Y+GY YA P  H+P+MYA A+          THQQQVS
Sbjct  394  GGAAYYGGPVYEGYGYALPPHHDPSMYAAASAAYGAYPVYGTHQQQVS  441



>ref|XP_008357394.1| PREDICTED: polyadenylate-binding protein RBP47C-like isoform 
X1 [Malus domestica]
Length=382

 Score =   221 bits (563),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 123/168 (73%), Positives = 134/168 (80%), Gaps = 5/168 (3%)
 Frame = -1

Query  686  SSGNQQQLPAQGGY-SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIV  510
            SSG QQQ  +QGGY SNG+P  G Q DGDS+NTTIFVGGLDPNV+DEDLRQPFSQYGEIV
Sbjct  215  SSGYQQQYSSQGGYVSNGTPTQGFQFDGDSTNTTIFVGGLDPNVTDEDLRQPFSQYGEIV  274

Query  509  SVKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQS-RSDFTNQW  333
            SVKIPVGKGCGFVQFANR +AEEAL KL G VIGKQTVRLSWGRNPA++Q  RSDF NQW
Sbjct  275  SVKIPVGKGCGFVQFANRNNAEEALPKLNGTVIGKQTVRLSWGRNPANKQQFRSDFGNQW  334

Query  332  AG-AYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyG--THQQQVS  198
             G AYYGG  Y+GY YA P  H+P+MYA A+          THQQQVS
Sbjct  335  GGAAYYGGPVYEGYGYALPPHHDPSMYAAASAAYGAYPVYGTHQQQVS  382



>ref|XP_002302445.2| RNA-binding protein 47 [Populus trichocarpa]
 gb|EEE81718.2| RNA-binding protein 47 [Populus trichocarpa]
Length=429

 Score =   222 bits (565),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 125/164 (76%), Positives = 136/164 (83%), Gaps = 6/164 (4%)
 Frame = -1

Query  686  SSGNQQQLPAQGGY-SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIV  510
            SSG QQQ    GGY SNG+ + G QSDGDSSN TIFVGGLDPNV+DEDL+QPFSQYGEIV
Sbjct  271  SSGYQQQ----GGYGSNGASSQGFQSDGDSSNATIFVGGLDPNVTDEDLKQPFSQYGEIV  326

Query  509  SVKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWA  330
            SVKIPV KGCGFVQFANR +AEEALQKL G VIGKQTVRLSWGRNP H+Q R+DF++ W 
Sbjct  327  SVKIPVSKGCGFVQFANRNNAEEALQKLNGTVIGKQTVRLSWGRNPGHKQHRADFSSPWN  386

Query  329  GAYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyGTHQQQVS  198
            GAYYGG  YDGY YA P PH+P+    AAYGAYPMYG HQQQVS
Sbjct  387  GAYYGGQVYDGYGYALPPPHDPS-TYAAAYGAYPMYGNHQQQVS  429



>ref|XP_010268853.1| PREDICTED: polyadenylate-binding protein RBP47 isoform X2 [Nelumbo 
nucifera]
Length=408

 Score =   221 bits (563),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 135/165 (82%), Gaps = 3/165 (2%)
 Frame = -1

Query  686  SSGNQQQLPAQGGY-SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIV  510
            SS  QQQ  +QGGY SNG+ A G QSDGDS+NTTIFVGGLDP+V+DEDLRQPFSQYGEIV
Sbjct  245  SSAYQQQYSSQGGYASNGASALGGQSDGDSTNTTIFVGGLDPSVTDEDLRQPFSQYGEIV  304

Query  509  SVKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWA  330
            SVKIPVGKGCGFVQFANRT+AEEALQKL G VIGKQTVRLSWGRNPA++  R+D  NQW 
Sbjct  305  SVKIPVGKGCGFVQFANRTNAEEALQKLNGTVIGKQTVRLSWGRNPANKL-RADPVNQWN  363

Query  329  GAYYGGHFYDGYTYAFPAPHNPNmyapaaygayp-myGTHQQQVS  198
            GAYYGG  YDGY YA P P +P+MYA A       +YG HQQQVS
Sbjct  364  GAYYGGQVYDGYGYAVPPPQDPSMYAAATAYGAYPIYGNHQQQVS  408



>ref|XP_009367486.1| PREDICTED: polyadenylate-binding protein RBP47-like, partial 
[Pyrus x bretschneideri]
Length=410

 Score =   221 bits (563),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 134/168 (80%), Gaps = 5/168 (3%)
 Frame = -1

Query  686  SSGNQQQLPAQGGY-SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIV  510
            SS  QQQ  +QGGY SNG+P  G QSDGDS+NTTIFVGGLDPNV+DEDLRQPFSQYGEIV
Sbjct  243  SSAYQQQYSSQGGYVSNGTPTQGFQSDGDSTNTTIFVGGLDPNVTDEDLRQPFSQYGEIV  302

Query  509  SVKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQS-RSDFTNQW  333
            SVKIPVGKGCGFVQFANR +AEEAL KL G VIGKQTVRLSWGRNPA++Q  RSDF NQW
Sbjct  303  SVKIPVGKGCGFVQFANRNNAEEALPKLNGTVIGKQTVRLSWGRNPANKQQFRSDFGNQW  362

Query  332  AG-AYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyG--THQQQVS  198
             G AYYGG  Y+GY YA P  H+P+MYA AA          THQQQVS
Sbjct  363  GGAAYYGGPVYEGYGYALPPHHDPSMYAAAAAAYGAYPMYGTHQQQVS  410



>ref|XP_004141245.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Cucumis 
sativus]
 ref|XP_004160607.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Cucumis 
sativus]
Length=426

 Score =   221 bits (562),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 138/167 (83%), Gaps = 4/167 (2%)
 Frame = -1

Query  686  SSGNQQQLPAQGG-YS-NGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEI  513
            SSG QQQ  +QGG YS NG  + G QS+GDS+NTTIFVGGLDPNV+DEDLRQPFSQYGEI
Sbjct  259  SSGYQQQHSSQGGGYSTNGYFSQGLQSEGDSANTTIFVGGLDPNVTDEDLRQPFSQYGEI  318

Query  512  VSVKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQW  333
            VSVKIPVGKGCGFVQFANR DAEEALQKL G VIGKQTVRLSWGRNPA++Q R DF NQW
Sbjct  319  VSVKIPVGKGCGFVQFANRNDAEEALQKLNGTVIGKQTVRLSWGRNPANKQFR-DFGNQW  377

Query  332  AGAYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyGTHQQQVS*M  192
             GAYYGGH YDGY Y   +PH+P+    AAYGAY +YG HQQQV  M
Sbjct  378  NGAYYGGHIYDGYGYGLASPHDPS-MYHAAYGAYTVYGNHQQQVEQM  423



>ref|XP_008393835.1| PREDICTED: polyadenylate-binding protein RBP47-like [Malus domestica]
Length=444

 Score =   221 bits (564),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 134/168 (80%), Gaps = 5/168 (3%)
 Frame = -1

Query  686  SSGNQQQLPAQGGY-SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIV  510
            SS  QQQ  +QGGY SNG+P  G QSDGDS+NTTIFVGGLDPNV+DEDLRQPFSQYGEIV
Sbjct  277  SSAYQQQYSSQGGYVSNGTPTQGFQSDGDSTNTTIFVGGLDPNVTDEDLRQPFSQYGEIV  336

Query  509  SVKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQS-RSDFTNQW  333
            SVKIPVGKGCGFVQFANR +AEEAL KL G VIGKQTVRLSWGRNPA++Q  RSDF NQW
Sbjct  337  SVKIPVGKGCGFVQFANRNNAEEALPKLNGTVIGKQTVRLSWGRNPANKQQFRSDFGNQW  396

Query  332  AGA-YYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyG--THQQQVS  198
             GA YYGG  Y+GY YA P  H+P+MYA AA          THQQQVS
Sbjct  397  GGAXYYGGPVYEGYGYALPPHHDPSMYAAAAAAYGAYPVYGTHQQQVS  444



>emb|CDP01376.1| unnamed protein product [Coffea canephora]
Length=402

 Score =   219 bits (558),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 127/165 (77%), Positives = 133/165 (81%), Gaps = 2/165 (1%)
 Frame = -1

Query  686  SSGNQQQLPAQGGYSNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVS  507
            SSG QQQ  +QGGY N S   GSQSDGDS NTTIFVGGLDPNVSDEDLRQPF QYGEIVS
Sbjct  238  SSGYQQQYSSQGGYINSSSGQGSQSDGDSPNTTIFVGGLDPNVSDEDLRQPFLQYGEIVS  297

Query  506  VKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAG  327
            VKIPVGKGCGFVQFANR DAEEALQKL G  IGKQTVRLSWGRNPA++Q R++F NQW G
Sbjct  298  VKIPVGKGCGFVQFANRNDAEEALQKLNGTTIGKQTVRLSWGRNPANKQLRAEFGNQWTG  357

Query  326  AYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyG--THQQQVS  198
            AYYGGHFYDGY YA P PH+P MYA AA          THQQQVS
Sbjct  358  AYYGGHFYDGYGYAMPPPHDPGMYAAAAAAYGAYPMYGTHQQQVS  402



>ref|XP_010098709.1| Polyadenylate-binding protein RBP47C [Morus notabilis]
 gb|EXB75612.1| Polyadenylate-binding protein RBP47C [Morus notabilis]
Length=423

 Score =   219 bits (558),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 119/153 (78%), Positives = 130/153 (85%), Gaps = 2/153 (1%)
 Frame = -1

Query  653  GGY-SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCG  477
            GGY SNG+   G QSDGDSSNTTIFVGGLDP+V DEDLRQPFSQYGEIVSVKIP GKGCG
Sbjct  272  GGYASNGASTQGFQSDGDSSNTTIFVGGLDPSVIDEDLRQPFSQYGEIVSVKIPTGKGCG  331

Query  476  FVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDG  297
            FVQFANR +AEEALQKL G VIGKQTVRLSWGRNPA++Q R DF NQW GAYYGG  YDG
Sbjct  332  FVQFANRNNAEEALQKLNGTVIGKQTVRLSWGRNPANKQYRGDFGNQWGGAYYGGQVYDG  391

Query  296  YTYAFPAPHNPNmyapaaygaypmyGTHQQQVS  198
            Y YA P PH+P+    A+YGAYP+YG+HQQQV+
Sbjct  392  YGYALPPPHDPS-MYAASYGAYPLYGSHQQQVN  423



>ref|XP_011013053.1| PREDICTED: polyadenylate-binding protein RBP47-like [Populus 
euphratica]
Length=427

 Score =   219 bits (557),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 124/164 (76%), Positives = 136/164 (83%), Gaps = 6/164 (4%)
 Frame = -1

Query  686  SSGNQQQLPAQGGY-SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIV  510
            SSG QQQ    GGY SNG+ + G QSDGDSSN TIFVGGLDPNV+DEDL+QPFSQYGEIV
Sbjct  269  SSGYQQQ----GGYGSNGASSQGFQSDGDSSNATIFVGGLDPNVTDEDLKQPFSQYGEIV  324

Query  509  SVKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWA  330
            SVKIPV KGCGFVQFANR +AEEALQKL G VIGKQTVRLSWGRNP ++Q R+DF++ W 
Sbjct  325  SVKIPVSKGCGFVQFANRNNAEEALQKLNGTVIGKQTVRLSWGRNPGNKQHRADFSSPWN  384

Query  329  GAYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyGTHQQQVS  198
            GAYYGG  YDGY YA P PH+P+    AAYGAYPMYG HQQQVS
Sbjct  385  GAYYGGQVYDGYGYALPPPHDPS-TYAAAYGAYPMYGNHQQQVS  427



>ref|XP_002510266.1| nuclear acid binding protein, putative [Ricinus communis]
 gb|EEF52453.1| nuclear acid binding protein, putative [Ricinus communis]
Length=443

 Score =   219 bits (557),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 133/155 (86%), Gaps = 3/155 (2%)
 Frame = -1

Query  656  QGGY-SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGC  480
            QGGY SNG+     Q+DGDS+NTTIFVGGLDPNV+DEDL+QPFSQYGEIVSVKIPVGKGC
Sbjct  290  QGGYVSNGASGQAFQADGDSTNTTIFVGGLDPNVTDEDLKQPFSQYGEIVSVKIPVGKGC  349

Query  479  GFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQS-RSDFTNQWAGAYYGGHFY  303
            GFVQFA+R++AEEALQKL G VIGKQTVRLSWGRNPA++Q  RSDF NQW GAYYGG  Y
Sbjct  350  GFVQFASRSNAEEALQKLNGTVIGKQTVRLSWGRNPANKQQLRSDFGNQWGGAYYGGQIY  409

Query  302  DGYTYAFPAPHNPNmyapaaygaypmyGTHQQQVS  198
            DGY YA P PH+P+    A YGAYP+YG+HQQQVS
Sbjct  410  DGYGYALPPPHDPS-MYAAPYGAYPVYGSHQQQVS  443



>ref|XP_011017227.1| PREDICTED: polyadenylate-binding protein RBP47-like [Populus 
euphratica]
Length=427

 Score =   218 bits (556),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 124/164 (76%), Positives = 136/164 (83%), Gaps = 6/164 (4%)
 Frame = -1

Query  686  SSGNQQQLPAQGGY-SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIV  510
            SSG QQQ    GGY SNG+ + G QSDGDSSN TIFVGGLDPNV+DEDL+QPFSQYGEIV
Sbjct  269  SSGYQQQ----GGYGSNGASSQGFQSDGDSSNATIFVGGLDPNVNDEDLKQPFSQYGEIV  324

Query  509  SVKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWA  330
            SVKIPV KGCGFVQFANR +AEEALQKL G VIGKQTVRLSWGRNP ++Q R+DF++ W 
Sbjct  325  SVKIPVSKGCGFVQFANRNNAEEALQKLNGTVIGKQTVRLSWGRNPGNKQHRADFSSPWN  384

Query  329  GAYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyGTHQQQVS  198
            GAYYGG  YDGY YA P PH+P+    AAYGAYPMYG HQQQVS
Sbjct  385  GAYYGGQVYDGYGYALPPPHDPS-TYAAAYGAYPMYGNHQQQVS  427



>ref|XP_008452518.1| PREDICTED: polyadenylate-binding protein RBP47-like [Cucumis 
melo]
Length=426

 Score =   218 bits (555),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 125/167 (75%), Positives = 138/167 (83%), Gaps = 4/167 (2%)
 Frame = -1

Query  686  SSGNQQQLPAQGG-YS-NGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEI  513
            SSG QQQ  +QGG YS NG  + G QS+GDS+NTTIFVGGLDPNV+DEDLRQPFSQ+GEI
Sbjct  259  SSGYQQQHSSQGGGYSTNGYFSQGLQSEGDSANTTIFVGGLDPNVTDEDLRQPFSQHGEI  318

Query  512  VSVKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQW  333
            VSVKIPVGKGCGFVQFANR DAEEALQKL G VIGKQTVRLSWGRNPA++Q R +F NQW
Sbjct  319  VSVKIPVGKGCGFVQFANRNDAEEALQKLNGTVIGKQTVRLSWGRNPANKQFR-EFGNQW  377

Query  332  AGAYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyGTHQQQVS*M  192
             GAYYGGH YDGY Y   +PH+P+    AAYGAY +YG HQQQV  M
Sbjct  378  NGAYYGGHIYDGYGYGLASPHDPS-MYHAAYGAYTVYGNHQQQVEQM  423



>emb|CAN81343.1| hypothetical protein VITISV_008697 [Vitis vinifera]
Length=536

 Score =   221 bits (562),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 122/185 (66%), Positives = 135/185 (73%), Gaps = 9/185 (5%)
 Frame = -1

Query  686  SSGNQQQLPAQGGY-SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIV  510
            SSG QQQ  + GGY SNG+     QSDGDS NTTIFVGGLDPNVSDEDLRQPFSQYGEIV
Sbjct  147  SSGYQQQYSSHGGYASNGASV---QSDGDSMNTTIFVGGLDPNVSDEDLRQPFSQYGEIV  203

Query  509  SVKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQS-----RSDF  345
            SVKIPVGKGCGFVQFANR +AE+ALQKL G VIGKQTVRLSWGRNPA++Q+     R+DF
Sbjct  204  SVKIPVGKGCGFVQFANRNNAEDALQKLNGTVIGKQTVRLSWGRNPANKQANSLFMRADF  263

Query  344  TNQWAGAYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyGTHQQQVS*MSAQEDYLQL  165
             NQW+GAYYGG  YDGY YA P PH+P MYA A           QQ++   S  +    L
Sbjct  264  GNQWSGAYYGGQVYDGYGYALPPPHDPTMYAAAYGAYPVYGNHQQQKMFSGSIHDSNGFL  323

Query  164  RWHFW  150
             W  W
Sbjct  324  MWLIW  328



>ref|XP_004291135.1| PREDICTED: polyadenylate-binding protein RBP47-like [Fragaria 
vesca subsp. vesca]
Length=444

 Score =   217 bits (553),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 125/167 (75%), Positives = 136/167 (81%), Gaps = 8/167 (5%)
 Frame = -1

Query  686  SSGNQQQLPAQGGYS-NGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIV  510
            SSG QQQ    GGY+ NG+P  G QSDGD++NTTIFVGGLDPNV+DEDLRQPFSQYGEIV
Sbjct  282  SSGYQQQ----GGYALNGTPTQGFQSDGDATNTTIFVGGLDPNVTDEDLRQPFSQYGEIV  337

Query  509  SVKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQS-RSDFTNQW  333
            SVKIPVGKGCGFVQFANR +AEEAL KL G VIGKQTVRLSWGRNPA++Q  R DF NQW
Sbjct  338  SVKIPVGKGCGFVQFANRNNAEEALPKLNGSVIGKQTVRLSWGRNPANKQQFRMDFGNQW  397

Query  332  AG-AYYGGHFYDGYTYAFPAPHNPNmyapaaygayp-myGTHQQQVS  198
            AG AYYGG  YDGY YA P  H+P+MYA AA      +YGTHQQQVS
Sbjct  398  AGAAYYGGPVYDGYGYALPPQHDPSMYAAAAAYGAYPVYGTHQQQVS  444



>gb|KJB63805.1| hypothetical protein B456_010G017300 [Gossypium raimondii]
Length=431

 Score =   216 bits (549),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 107/141 (76%), Positives = 121/141 (86%), Gaps = 4/141 (3%)
 Frame = -1

Query  686  SSGNQQQLPAQGGY-SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIV  510
            SSG QQQ  +QGGY SNGS    +QSDGDSSNTTIFVGGLDPNV++EDLRQPFSQYGE+V
Sbjct  269  SSGYQQQYSSQGGYASNGS---STQSDGDSSNTTIFVGGLDPNVTEEDLRQPFSQYGELV  325

Query  509  SVKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWA  330
            SVKIPVGKGCGFV+FANR +AEEALQKL    IGKQTVRLSWGRNPA++Q R+D++NQW 
Sbjct  326  SVKIPVGKGCGFVRFANRNNAEEALQKLNETNIGKQTVRLSWGRNPANKQFRADYSNQWG  385

Query  329  GAYYGGHFYDGYTYAFPAPHN  267
            GAYYGG  YDGY YA P P++
Sbjct  386  GAYYGGQVYDGYGYALPPPNS  406



>ref|XP_010268845.1| PREDICTED: polyadenylate-binding protein RBP47 isoform X1 [Nelumbo 
nucifera]
Length=413

 Score =   215 bits (548),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 123/170 (72%), Positives = 135/170 (79%), Gaps = 8/170 (5%)
 Frame = -1

Query  686  SSGNQQQLPAQ-----GGY-SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQ  525
            SS  QQQ  +Q     GGY SNG+ A G QSDGDS+NTTIFVGGLDP+V+DEDLRQPFSQ
Sbjct  245  SSAYQQQYSSQALVLVGGYASNGASALGGQSDGDSTNTTIFVGGLDPSVTDEDLRQPFSQ  304

Query  524  YGEIVSVKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDF  345
            YGEIVSVKIPVGKGCGFVQFANRT+AEEALQKL G VIGKQTVRLSWGRNPA++  R+D 
Sbjct  305  YGEIVSVKIPVGKGCGFVQFANRTNAEEALQKLNGTVIGKQTVRLSWGRNPANKL-RADP  363

Query  344  TNQWAGAYYGGHFYDGYTYAFPAPHNPNmyapaaygayp-myGTHQQQVS  198
             NQW GAYYGG  YDGY YA P P +P+MYA A       +YG HQQQVS
Sbjct  364  VNQWNGAYYGGQVYDGYGYAVPPPQDPSMYAAATAYGAYPIYGNHQQQVS  413



>ref|XP_011030480.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X3 
[Populus euphratica]
Length=427

 Score =   216 bits (549),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 122/166 (73%), Positives = 135/166 (81%), Gaps = 8/166 (5%)
 Frame = -1

Query  686  SSGNQQQLPAQGGY-SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIV  510
            SSG QQQ    GGY SNG+ A G QSDGDS+NTTIFVGGLDPNV+DEDL+QPFSQYGEIV
Sbjct  267  SSGYQQQ----GGYASNGASAQGFQSDGDSNNTTIFVGGLDPNVTDEDLKQPFSQYGEIV  322

Query  509  SVKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWA  330
            SVKIPVGKGCGFVQFA R +AEEALQ+L G VIGKQTVRLSWGRNPA++Q R+DF + W 
Sbjct  323  SVKIPVGKGCGFVQFAKRDNAEEALQRLNGTVIGKQTVRLSWGRNPANKQFRADFGSPWN  382

Query  329  GAYYGGHFYDGYTYAFPAPHNPNmyapaaygaypm--yGTHQQQVS  198
            GAYYGG  YDGY YA P PH+P+MYA AA        YG+HQQQVS
Sbjct  383  GAYYGGQVYDGYGYALP-PHDPSMYAAAAAAYGAYPIYGSHQQQVS  427



>ref|XP_011030472.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X2 
[Populus euphratica]
Length=428

 Score =   216 bits (549),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 122/166 (73%), Positives = 135/166 (81%), Gaps = 8/166 (5%)
 Frame = -1

Query  686  SSGNQQQLPAQGGY-SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIV  510
            SSG QQQ    GGY SNG+ A G QSDGDS+NTTIFVGGLDPNV+DEDL+QPFSQYGEIV
Sbjct  268  SSGYQQQ----GGYASNGASAQGFQSDGDSNNTTIFVGGLDPNVTDEDLKQPFSQYGEIV  323

Query  509  SVKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWA  330
            SVKIPVGKGCGFVQFA R +AEEALQ+L G VIGKQTVRLSWGRNPA++Q R+DF + W 
Sbjct  324  SVKIPVGKGCGFVQFAKRDNAEEALQRLNGTVIGKQTVRLSWGRNPANKQFRADFGSPWN  383

Query  329  GAYYGGHFYDGYTYAFPAPHNPNmyapaaygaypm--yGTHQQQVS  198
            GAYYGG  YDGY YA P PH+P+MYA AA        YG+HQQQVS
Sbjct  384  GAYYGGQVYDGYGYALP-PHDPSMYAAAAAAYGAYPIYGSHQQQVS  428



>ref|XP_011030463.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X1 
[Populus euphratica]
Length=428

 Score =   216 bits (549),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 122/166 (73%), Positives = 135/166 (81%), Gaps = 8/166 (5%)
 Frame = -1

Query  686  SSGNQQQLPAQGGY-SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIV  510
            SSG QQQ    GGY SNG+ A G QSDGDS+NTTIFVGGLDPNV+DEDL+QPFSQYGEIV
Sbjct  268  SSGYQQQ----GGYASNGASAQGFQSDGDSNNTTIFVGGLDPNVTDEDLKQPFSQYGEIV  323

Query  509  SVKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWA  330
            SVKIPVGKGCGFVQFA R +AEEALQ+L G VIGKQTVRLSWGRNPA++Q R+DF + W 
Sbjct  324  SVKIPVGKGCGFVQFAKRDNAEEALQRLNGTVIGKQTVRLSWGRNPANKQFRADFGSPWN  383

Query  329  GAYYGGHFYDGYTYAFPAPHNPNmyapaaygaypm--yGTHQQQVS  198
            GAYYGG  YDGY YA P PH+P+MYA AA        YG+HQQQVS
Sbjct  384  GAYYGGQVYDGYGYALP-PHDPSMYAAAAAAYGAYPIYGSHQQQVS  428



>gb|KHN12758.1| Polyadenylate-binding protein RBP47C [Glycine soja]
Length=318

 Score =   207 bits (528),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 114/163 (70%), Positives = 126/163 (77%), Gaps = 9/163 (6%)
 Frame = -1

Query  686  SSGNQQQLPAQGGYSNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVS  507
            SSG+QQ     GG SNG+    +QS+ DS+NTTIFVGGLDPNVSDEDLRQPFSQYGEIVS
Sbjct  165  SSGHQQ-----GGLSNGT---ANQSEADSTNTTIFVGGLDPNVSDEDLRQPFSQYGEIVS  216

Query  506  VKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAG  327
            VKIPVGKGCGFVQFANR +AEEALQKL G  IGKQTVRLSWGRNPA++Q R DF + W G
Sbjct  217  VKIPVGKGCGFVQFANRNNAEEALQKLNGTTIGKQTVRLSWGRNPANKQFRMDFGSPWTG  276

Query  326  AYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyGTHQQQVS  198
            AYYG   YDGY YA P  H+P++YA A        G HQQQVS
Sbjct  277  AYYGAPMYDGYGYALPPRHDPSIYAAAYGAYPLYGG-HQQQVS  318



>ref|XP_007160823.1| hypothetical protein PHAVU_001G019600g [Phaseolus vulgaris]
 gb|ESW32817.1| hypothetical protein PHAVU_001G019600g [Phaseolus vulgaris]
Length=415

 Score =   210 bits (534),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 121/163 (74%), Positives = 131/163 (80%), Gaps = 9/163 (6%)
 Frame = -1

Query  686  SSGNQQQLPAQGGYSNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVS  507
            SSG+QQ     GG SNG+    SQS+ DS+NTTIFVGGLDPNVSDEDLRQPFSQYGEIVS
Sbjct  262  SSGHQQ-----GGQSNGT---SSQSEADSTNTTIFVGGLDPNVSDEDLRQPFSQYGEIVS  313

Query  506  VKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAG  327
            VKIPVGKGCGFVQFANR +AEEALQKL G  IGKQTVRLSWGRNPA++Q R DF N W G
Sbjct  314  VKIPVGKGCGFVQFANRNNAEEALQKLNGTTIGKQTVRLSWGRNPANKQFRMDFGNPWTG  373

Query  326  AYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyGTHQQQVS  198
            AYYG   YDGY YA P  H+P+    AAYGAYP+YG HQQQVS
Sbjct  374  AYYGAPIYDGYGYALPPRHDPS-IYAAAYGAYPLYGAHQQQVS  415



>gb|AGV54251.1| RNA binding post-transcriptional regulator csx1 like protein 
[Phaseolus vulgaris]
Length=416

 Score =   210 bits (534),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 121/163 (74%), Positives = 131/163 (80%), Gaps = 9/163 (6%)
 Frame = -1

Query  686  SSGNQQQLPAQGGYSNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVS  507
            SSG+QQ     GG SNG+    SQS+ DS+NTTIFVGGLDPNVSDEDLRQPFSQYGEIVS
Sbjct  263  SSGHQQ-----GGQSNGT---SSQSEADSTNTTIFVGGLDPNVSDEDLRQPFSQYGEIVS  314

Query  506  VKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAG  327
            VKIPVGKGCGFVQFANR +AEEALQKL G  IGKQTVRLSWGRNPA++Q R DF N W G
Sbjct  315  VKIPVGKGCGFVQFANRNNAEEALQKLNGTTIGKQTVRLSWGRNPANKQFRMDFGNPWTG  374

Query  326  AYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyGTHQQQVS  198
            AYYG   YDGY YA P  H+P+    AAYGAYP+YG HQQQVS
Sbjct  375  AYYGAPIYDGYGYALPPRHDPS-IYAAAYGAYPLYGAHQQQVS  416



>ref|XP_011083821.1| PREDICTED: polyadenylate-binding protein RBP47-like [Sesamum 
indicum]
Length=432

 Score =   210 bits (535),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 116/163 (71%), Positives = 132/163 (81%), Gaps = 2/163 (1%)
 Frame = -1

Query  683  SGNQQQLPAQGG-YSNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVS  507
            SG QQQ  + GG YSN   + GS  DGDS NTTIFVGGLDPNV+DEDLRQPFSQYGEI+S
Sbjct  271  SGYQQQYSSPGGRYSNNVSSQGSWLDGDSLNTTIFVGGLDPNVTDEDLRQPFSQYGEILS  330

Query  506  VKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAG  327
            VKIPVGKGCGFVQFANR +AE ALQ+L G  IGKQ VRLSWGR+ A++Q R+D+ +QW+G
Sbjct  331  VKIPVGKGCGFVQFANRNNAEAALQRLSGTTIGKQIVRLSWGRSLANKQLRADYGHQWSG  390

Query  326  AYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyGTHQQQVS  198
            AYYGG F+DGY YA P  H+PN   PAAYGAY +Y THQQQVS
Sbjct  391  AYYGGTFFDGYGYALPPLHSPN-MYPAAYGAYSIYSTHQQQVS  432



>ref|XP_010275609.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X1 
[Nelumbo nucifera]
Length=418

 Score =   209 bits (532),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 113/157 (72%), Positives = 124/157 (79%), Gaps = 3/157 (2%)
 Frame = -1

Query  665  LPAQGGYS-NGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVG  489
            L   GGY+ N +   G QSDGDS+NTTIFVGGLDP+V+DEDLRQPFSQYGEI+SVKIPVG
Sbjct  264  LVLVGGYAPNNASGLGGQSDGDSTNTTIFVGGLDPSVTDEDLRQPFSQYGEIISVKIPVG  323

Query  488  KGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGH  309
            KGCGFVQFANRT+AEEALQKL G VIGKQTVRLSWGRNPA++  R D  NQW GAYYGG 
Sbjct  324  KGCGFVQFANRTNAEEALQKLNGTVIGKQTVRLSWGRNPANKM-RIDPVNQWNGAYYGGQ  382

Query  308  FYDGYTYAFPAPHNPNmyapaaygaypmyGTHQQQVS  198
             YDGY Y  P PH+P+MYA A        G HQQQVS
Sbjct  383  VYDGYGYVIPPPHDPSMYAAAYGAYPIYGG-HQQQVS  418



>gb|KHN46301.1| Polyadenylate-binding protein RBP47C [Glycine soja]
Length=318

 Score =   205 bits (521),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 114/163 (70%), Positives = 125/163 (77%), Gaps = 9/163 (6%)
 Frame = -1

Query  686  SSGNQQQLPAQGGYSNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVS  507
            SSG+QQ     GG SNG+    +QS+ DS+NTTIFVGGLDPNVSDEDLRQPFSQYGEIVS
Sbjct  165  SSGHQQ-----GGQSNGT---ANQSEADSTNTTIFVGGLDPNVSDEDLRQPFSQYGEIVS  216

Query  506  VKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAG  327
            VKIPVGKGCGFVQFANR +AEEALQKL G  IGKQTVRLSWGRNPA++Q R DF N W G
Sbjct  217  VKIPVGKGCGFVQFANRNNAEEALQKLNGTSIGKQTVRLSWGRNPANKQFRMDFGNPWTG  276

Query  326  AYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyGTHQQQVS  198
            AYYG   YDGY YA    H+P++YA A        G HQQQVS
Sbjct  277  AYYGAPMYDGYGYALTPRHDPSIYAAAYGAYPLYGG-HQQQVS  318



>ref|XP_003549410.2| PREDICTED: polyadenylate-binding protein RBP47C-like [Glycine 
max]
Length=413

 Score =   207 bits (527),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 114/163 (70%), Positives = 126/163 (77%), Gaps = 9/163 (6%)
 Frame = -1

Query  686  SSGNQQQLPAQGGYSNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVS  507
            SSG+QQ     GG SNG+    +QS+ DS+NTTIFVGGLDPNVSDEDLRQPFSQYGEIVS
Sbjct  260  SSGHQQ-----GGLSNGT---ANQSEADSTNTTIFVGGLDPNVSDEDLRQPFSQYGEIVS  311

Query  506  VKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAG  327
            VKIPVGKGCGFVQFANR +AEEALQKL G  IGKQTVRLSWGRNPA++Q R DF + W G
Sbjct  312  VKIPVGKGCGFVQFANRNNAEEALQKLNGTTIGKQTVRLSWGRNPANKQFRMDFGSPWTG  371

Query  326  AYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyGTHQQQVS  198
            AYYG   YDGY YA P  H+P++YA A        G HQQQVS
Sbjct  372  AYYGAPMYDGYGYALPPRHDPSIYAAAYGAYPLYGG-HQQQVS  413


 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 29/92 (32%), Positives = 48/92 (52%), Gaps = 8/92 (9%)
 Frame = -1

Query  632  PAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIP------VGKGCGFV  471
            P H  Q+     N TI++G L   + +  L + F+  GEI S+K+       + +G GFV
Sbjct  72   PQHQHQNGSGGENKTIWIGDLHHWMDENYLHRCFASTGEISSIKVIRNKQTGLSEGYGFV  131

Query  470  QFANRTDAEEALQKLKGLVI--GKQTVRLSWG  381
            +F +   AE+ LQ   G+++   +Q  RL+W 
Sbjct  132  EFYSHATAEKVLQNYAGILMPNAEQPFRLNWA  163



>ref|XP_010275610.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X2 
[Nelumbo nucifera]
Length=413

 Score =   207 bits (526),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 109/148 (74%), Positives = 119/148 (80%), Gaps = 2/148 (1%)
 Frame = -1

Query  641  NGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFA  462
            N +   G QSDGDS+NTTIFVGGLDP+V+DEDLRQPFSQYGEI+SVKIPVGKGCGFVQFA
Sbjct  268  NNASGLGGQSDGDSTNTTIFVGGLDPSVTDEDLRQPFSQYGEIISVKIPVGKGCGFVQFA  327

Query  461  NRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAF  282
            NRT+AEEALQKL G VIGKQTVRLSWGRNPA++  R D  NQW GAYYGG  YDGY Y  
Sbjct  328  NRTNAEEALQKLNGTVIGKQTVRLSWGRNPANKM-RIDPVNQWNGAYYGGQVYDGYGYVI  386

Query  281  PAPHNPNmyapaaygaypmyGTHQQQVS  198
            P PH+P+MYA A        G HQQQVS
Sbjct  387  PPPHDPSMYAAAYGAYPIYGG-HQQQVS  413



>gb|KHN04518.1| Polyadenylate-binding protein RBP47C, partial [Glycine soja]
Length=376

 Score =   204 bits (519),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 113/153 (74%), Positives = 131/153 (86%), Gaps = 2/153 (1%)
 Frame = -1

Query  650  GYSNGSPAHG--SQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCG  477
            GY  GS ++G  SQS+ DS+NTTIFVGGLDPNV+ EDL+QPFSQYGEIVSVKIPVGKGCG
Sbjct  224  GYQQGSQSNGTSSQSEADSTNTTIFVGGLDPNVTAEDLKQPFSQYGEIVSVKIPVGKGCG  283

Query  476  FVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDG  297
            FVQFANR +AEEALQKL G  IGKQ VRLSWGR+PA++Q R+DF N W+GAYYGG  YDG
Sbjct  284  FVQFANRNNAEEALQKLNGTTIGKQMVRLSWGRSPANKQFRADFGNAWSGAYYGGPVYDG  343

Query  296  YTYAFPAPHNPNmyapaaygaypmyGTHQQQVS  198
            Y YA P P++P++YA AAYGAYP+YG +QQQVS
Sbjct  344  YGYALPPPYDPSIYAAAAYGAYPIYGGYQQQVS  376



>ref|XP_003523906.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Glycine 
max]
Length=409

 Score =   204 bits (519),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 113/153 (74%), Positives = 131/153 (86%), Gaps = 2/153 (1%)
 Frame = -1

Query  650  GYSNGSPAHG--SQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCG  477
            GY  GS ++G  SQS+ DS+NTTIFVGGLDPNV+ EDL+QPFSQYGEIVSVKIPVGKGCG
Sbjct  257  GYQQGSQSNGTSSQSEADSTNTTIFVGGLDPNVTAEDLKQPFSQYGEIVSVKIPVGKGCG  316

Query  476  FVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDG  297
            FVQFANR +AEEALQKL G  IGKQ VRLSWGR+PA++Q R+DF N W+GAYYGG  YDG
Sbjct  317  FVQFANRNNAEEALQKLNGTTIGKQMVRLSWGRSPANKQFRADFGNAWSGAYYGGPVYDG  376

Query  296  YTYAFPAPHNPNmyapaaygaypmyGTHQQQVS  198
            Y YA P P++P++YA AAYGAYP+YG +QQQVS
Sbjct  377  YGYALPPPYDPSIYAAAAYGAYPIYGGYQQQVS  409



>ref|XP_010668311.1| PREDICTED: polyadenylate-binding protein RBP47-like [Beta vulgaris 
subsp. vulgaris]
Length=476

 Score =   206 bits (523),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 102/133 (77%), Positives = 114/133 (86%), Gaps = 1/133 (1%)
 Frame = -1

Query  656  QGGY-SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGC  480
            QGGY SNG+ A GSQS+ +SSNTTIFVGGLDP+V+DEDLRQPFSQYGEIVSVKIPVGKGC
Sbjct  322  QGGYGSNGNAAQGSQSEDNSSNTTIFVGGLDPSVTDEDLRQPFSQYGEIVSVKIPVGKGC  381

Query  479  GFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYD  300
            GFVQFANR++AEEAL KL G VIGKQTVRLSWGRNPA++QSR D+ NQW G YYGG  YD
Sbjct  382  GFVQFANRSNAEEALNKLNGTVIGKQTVRLSWGRNPANKQSRGDYGNQWNGGYYGGPMYD  441

Query  299  GYTYAFPAPHNPN  261
            G     P PH+P+
Sbjct  442  GGYGYVPHPHDPS  454



>ref|XP_003544447.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Glycine 
max]
Length=425

 Score =   204 bits (519),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 114/163 (70%), Positives = 125/163 (77%), Gaps = 9/163 (6%)
 Frame = -1

Query  686  SSGNQQQLPAQGGYSNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVS  507
            SSG+QQ     GG SNG+    +QS+ DS+NTTIFVGGLDPNVSDEDLRQPFSQYGEIVS
Sbjct  272  SSGHQQ-----GGQSNGT---ANQSEADSTNTTIFVGGLDPNVSDEDLRQPFSQYGEIVS  323

Query  506  VKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAG  327
            VKIPVGKGCGFVQFANR +AEEALQKL G  IGKQTVRLSWGRNPA++Q R DF N W G
Sbjct  324  VKIPVGKGCGFVQFANRNNAEEALQKLNGTSIGKQTVRLSWGRNPANKQFRMDFGNPWTG  383

Query  326  AYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyGTHQQQVS  198
            AYYG   YDGY YA    H+P++YA A        G HQQQVS
Sbjct  384  AYYGAPMYDGYGYALTPRHDPSIYAAAYGAYPLYGG-HQQQVS  425



>gb|KDO35911.1| hypothetical protein CISIN_1g029152mg [Citrus sinensis]
Length=176

 Score =   195 bits (495),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 110/166 (66%), Positives = 123/166 (74%), Gaps = 16/166 (10%)
 Frame = -1

Query  686  SSGNQQQLPAQGGY-SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIV  510
            SSG QQQ  +QGGY SNG+P  G QS+GDSSNTTIFVGGLDPNV+DEDLRQPFSQYGEI 
Sbjct  24   SSGYQQQYSSQGGYASNGAPGQGPQSEGDSSNTTIFVGGLDPNVTDEDLRQPFSQYGEIA  83

Query  509  SVKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWA  330
            SVKIPVGKGCGFVQFANR +AEEAL KL G VIGKQ+              R+D+ NQW+
Sbjct  84   SVKIPVGKGCGFVQFANRENAEEALHKLNGTVIGKQSF-------------RADYGNQWS  130

Query  329  GAYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyG--THQQQVS  198
            GAYYGG  YDGY YA P P++P+MYA AA          +HQQQVS
Sbjct  131  GAYYGGQVYDGYGYAIPPPNDPSMYAAAAAAYGAYPVYGSHQQQVS  176



>gb|ABY75165.1| RNA binding protein [Arachis diogoi]
Length=142

 Score =   193 bits (490),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/121 (77%), Positives = 103/121 (85%), Gaps = 1/121 (1%)
 Frame = -1

Query  620  SQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRTDAEE  441
            SQS+ DS+NTTIFVGGLDPNV+DEDLRQ FSQYGEIVSVK+PVGKGCGFVQFA R +AEE
Sbjct  2    SQSEADSTNTTIFVGGLDPNVTDEDLRQQFSQYGEIVSVKVPVGKGCGFVQFAIRNNAEE  61

Query  440  ALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDF-TNQWAGAYYGGHFYDGYTYAFPAPHNP  264
            ALQKL G VIGKQTVRLSWGRNPA++Q R DF  N W+G YYG   YDGY YA P PH+P
Sbjct  62   ALQKLNGTVIGKQTVRLSWGRNPANKQFRMDFGGNHWSGTYYGAPVYDGYGYALPPPHDP  121

Query  263  N  261
            +
Sbjct  122  S  122



>ref|XP_007136663.1| hypothetical protein PHAVU_009G063200g [Phaseolus vulgaris]
 gb|ESW08657.1| hypothetical protein PHAVU_009G063200g [Phaseolus vulgaris]
Length=420

 Score =   201 bits (511),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 107/153 (70%), Positives = 121/153 (79%), Gaps = 3/153 (2%)
 Frame = -1

Query  650  GYSNGSPAHGS--QSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCG  477
            GY  GS ++G+  QS+ DS+NTTIFVGGLDPNV+ EDLRQPFSQYGEIVSVKIPVGKGCG
Sbjct  269  GYQQGSQSNGTSNQSEADSTNTTIFVGGLDPNVTAEDLRQPFSQYGEIVSVKIPVGKGCG  328

Query  476  FVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDG  297
            FVQFA R +AEEALQKL G  IGKQ VRLSWGRNPA++Q R DF + W+GAYYGG  YDG
Sbjct  329  FVQFAIRNNAEEALQKLNGTTIGKQMVRLSWGRNPANKQFRGDFGSPWSGAYYGGPVYDG  388

Query  296  YTYAFPAPHNPNmyapaaygaypmyGTHQQQVS  198
            Y YA P PH+P++YA A        G HQQQVS
Sbjct  389  YGYALPPPHDPSIYAAAYGAYPIYGG-HQQQVS  420



>gb|KHN22302.1| Polyadenylate-binding protein RBP47C [Glycine soja]
Length=411

 Score =   200 bits (509),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 107/153 (70%), Positives = 121/153 (79%), Gaps = 3/153 (2%)
 Frame = -1

Query  650  GYSNGSPAHG--SQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCG  477
            GY  GS ++G  SQS+ DS+NTTIFVGGLD NV+ EDL+QPFSQYGEIVSVKIPVGKGCG
Sbjct  260  GYQQGSQSNGISSQSEADSTNTTIFVGGLDSNVTAEDLKQPFSQYGEIVSVKIPVGKGCG  319

Query  476  FVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDG  297
            FVQFANR +AEEALQKL G  IGKQ VRLSWGRNPA++Q R+DF N W+GAYYGG  YDG
Sbjct  320  FVQFANRNNAEEALQKLNGTTIGKQMVRLSWGRNPANKQFRADFGNAWSGAYYGGPVYDG  379

Query  296  YTYAFPAPHNPNmyapaaygaypmyGTHQQQVS  198
            Y YA P  H+P++YA A        G HQQQVS
Sbjct  380  YGYALPPSHDPSIYAAAYGAYPIYGG-HQQQVS  411



>ref|XP_004501589.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Cicer arietinum]
Length=413

 Score =   198 bits (504),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 109/154 (71%), Positives = 121/154 (79%), Gaps = 5/154 (3%)
 Frame = -1

Query  656  QGGYSNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCG  477
            QGG SNG+    SQS+ DS+NTTIFVGGLDPN + EDLR+PFS+YGEIVSVKIPVGKGCG
Sbjct  264  QGGQSNGT---SSQSEADSTNTTIFVGGLDPNATAEDLREPFSEYGEIVSVKIPVGKGCG  320

Query  476  FVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDG  297
            FVQFANR +AEEALQKL G  IGKQTVRLSWGRNPA++Q R DF + W GAYYGG  YDG
Sbjct  321  FVQFANRNNAEEALQKLNGATIGKQTVRLSWGRNPANKQFRMDFGSPWNGAYYGGPVYDG  380

Query  296  YTY-AFPAPHNPNmyapaaygaypmyGTHQQQVS  198
            Y Y A P PH+P+MYA A        G HQQQVS
Sbjct  381  YGYAALPHPHDPSMYAAAYGAYPIYGG-HQQQVS  413



>gb|KCW68770.1| hypothetical protein EUGRSUZ_F02369 [Eucalyptus grandis]
Length=399

 Score =   197 bits (502),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 106/149 (71%), Positives = 122/149 (82%), Gaps = 1/149 (1%)
 Frame = -1

Query  641  NGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFA  462
            NG+ +   QSDGDS+NTTIFVGGLDP+V+DEDLRQ FSQYGEIVSVKIP GKGCGFVQFA
Sbjct  251  NGASSQSFQSDGDSANTTIFVGGLDPSVNDEDLRQQFSQYGEIVSVKIPSGKGCGFVQFA  310

Query  461  NRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAF  282
            NR++AEEALQKL G VIGKQTVRLSWGRNPA++Q R+DF NQW   YYGG  YDGY Y  
Sbjct  311  NRSNAEEALQKLNGTVIGKQTVRLSWGRNPANKQFRADFGNQWGPVYYGGQVYDGYGYGV  370

Query  281  PAPHNPNmyapaaygayp-myGTHQQQVS  198
            P  ++P+MYA A   A   +YG+HQQQV+
Sbjct  371  PPHYDPSMYATATAYAAYPVYGSHQQQVN  399



>ref|XP_010061775.1| PREDICTED: polyadenylate-binding protein RBP47-like [Eucalyptus 
grandis]
 gb|KCW68768.1| hypothetical protein EUGRSUZ_F02369 [Eucalyptus grandis]
Length=452

 Score =   197 bits (502),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 106/149 (71%), Positives = 122/149 (82%), Gaps = 1/149 (1%)
 Frame = -1

Query  641  NGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFA  462
            NG+ +   QSDGDS+NTTIFVGGLDP+V+DEDLRQ FSQYGEIVSVKIP GKGCGFVQFA
Sbjct  304  NGASSQSFQSDGDSANTTIFVGGLDPSVNDEDLRQQFSQYGEIVSVKIPSGKGCGFVQFA  363

Query  461  NRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAF  282
            NR++AEEALQKL G VIGKQTVRLSWGRNPA++Q R+DF NQW   YYGG  YDGY Y  
Sbjct  364  NRSNAEEALQKLNGTVIGKQTVRLSWGRNPANKQFRADFGNQWGPVYYGGQVYDGYGYGV  423

Query  281  PAPHNPNmyapaaygayp-myGTHQQQVS  198
            P  ++P+MYA A   A   +YG+HQQQV+
Sbjct  424  PPHYDPSMYATATAYAAYPVYGSHQQQVN  452



>ref|XP_006393576.1| hypothetical protein EUTSA_v10011476mg [Eutrema salsugineum]
 gb|ESQ30862.1| hypothetical protein EUTSA_v10011476mg [Eutrema salsugineum]
Length=447

 Score =   197 bits (500),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 109/154 (71%), Positives = 123/154 (80%), Gaps = 4/154 (3%)
 Frame = -1

Query  656  QGGYS-NGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGC  480
            QGGY  NG+    ++ DGDS NTTIFVGGLD +V+DEDLRQPF+ YGEIVSVKIP+GKGC
Sbjct  297  QGGYMPNGA---MTRPDGDSLNTTIFVGGLDSSVTDEDLRQPFTAYGEIVSVKIPLGKGC  353

Query  479  GFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYD  300
            GFVQF NR DAEEAL+KL G VIGKQTVRLSWGR+PA++Q R  + NQW G YYGG FY+
Sbjct  354  GFVQFVNRPDAEEALEKLNGTVIGKQTVRLSWGRSPANKQPRDKYGNQWVGPYYGGQFYN  413

Query  299  GYTYAFPAPHNPNmyapaaygaypmyGTHQQQVS  198
            GY Y  P PH+P MYA   YG YPMYG HQQQVS
Sbjct  414  GYGYMVPQPHDPRMYAAGPYGGYPMYGGHQQQVS  447



>ref|XP_003603009.1| RNA-binding protein [Medicago truncatula]
 gb|AES73260.1| polyadenylate-binding protein RBP47C [Medicago truncatula]
Length=420

 Score =   196 bits (498),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 110/154 (71%), Positives = 122/154 (79%), Gaps = 8/154 (5%)
 Frame = -1

Query  656  QGGYSNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCG  477
            QGG SNG+P   SQSD DS+NTTIFVGGLDP+ + EDLRQPFSQYGEIVSVKIPVGKGCG
Sbjct  274  QGGQSNGTP---SQSDTDSTNTTIFVGGLDPSATAEDLRQPFSQYGEIVSVKIPVGKGCG  330

Query  476  FVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAG-AYYGGHFYD  300
            FVQFANR +AEEALQKL G  +GKQTVRLSWGRNPA++Q RS+F + W G AYYGG  YD
Sbjct  331  FVQFANRNNAEEALQKLNGTTVGKQTVRLSWGRNPANKQFRSEFGSPWNGPAYYGGPAYD  390

Query  299  GYTYAFPAPHNPNmyapaaygaypmyGTHQQQVS  198
            GY YA P P++          AYPMYG HQQQVS
Sbjct  391  GYGYAMPHPYD----QSMYAAAYPMYGGHQQQVS  420



>gb|EPS64859.1| nucleic acid binding protein, partial [Genlisea aurea]
Length=377

 Score =   194 bits (493),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 109/129 (84%), Gaps = 2/129 (2%)
 Frame = -1

Query  674  QQQLPAQGGYSNGSPAHGSQSDG-DSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKI  498
            QQQ  + GGYSNG   +GSQSDG D+ N+TIFVG LDP+V+DEDLRQPFSQYGEIVS+KI
Sbjct  248  QQQYSSYGGYSNGGSVNGSQSDGGDTLNSTIFVGRLDPSVTDEDLRQPFSQYGEIVSIKI  307

Query  497  PVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGA-Y  321
            P G+GCGFVQFANR DAEEAL+ L GL IG QTVRLSWGRNPA++QSRSD+ NQW GA Y
Sbjct  308  PPGRGCGFVQFANRGDAEEALKNLTGLTIGNQTVRLSWGRNPANKQSRSDYGNQWTGASY  367

Query  320  YGGHFYDGY  294
            YGG FYD Y
Sbjct  368  YGGGFYDPY  376



>ref|XP_008444645.1| PREDICTED: polyadenylate-binding protein RBP47-like [Cucumis 
melo]
Length=429

 Score =   193 bits (491),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 118/163 (72%), Positives = 136/163 (83%), Gaps = 0/163 (0%)
 Frame = -1

Query  686  SSGNQQQLPAQGGYSNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVS  507
            SSG QQQ  +QG  SNGS +HG QSDGD +NTTIF+GGLDPNV+DEDL+Q FSQ+GEIVS
Sbjct  267  SSGYQQQYSSQGYASNGSFSHGHQSDGDFTNTTIFIGGLDPNVTDEDLKQLFSQHGEIVS  326

Query  506  VKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAG  327
            VKIPVGKGCGF+QFANR +AEEALQKL G VIGKQTVRLSWGR+P ++Q R+D+ N W+G
Sbjct  327  VKIPVGKGCGFIQFANRKNAEEALQKLNGTVIGKQTVRLSWGRSPTNKQYRADYGNHWSG  386

Query  326  AYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyGTHQQQVS  198
            AYYGG  Y GY YA P P++P     AAYGAYPMYGTHQQQV+
Sbjct  387  AYYGGQMYGGYGYALPLPYDPPTMYAAAYGAYPMYGTHQQQVN  429



>ref|XP_004499084.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Cicer arietinum]
Length=426

 Score =   193 bits (490),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 109/153 (71%), Positives = 121/153 (79%), Gaps = 4/153 (3%)
 Frame = -1

Query  656  QGGYSNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCG  477
            QGG SNG+    SQS+ D++NTTIFVGGLDPNV+DEDLRQ FSQYGEI SVKIPVGKGCG
Sbjct  278  QGGQSNGT---SSQSEADNTNTTIFVGGLDPNVTDEDLRQAFSQYGEIASVKIPVGKGCG  334

Query  476  FVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDG  297
            FVQFANR +AEEALQKL G +IGKQTVRLSWGRNPA++Q R DF   WAG Y+    YDG
Sbjct  335  FVQFANRNNAEEALQKLNGTMIGKQTVRLSWGRNPANKQFRFDF-GSWAGPYFPSPIYDG  393

Query  296  YTYAFPAPHNPNmyapaaygaypmyGTHQQQVS  198
            Y YA P+PH+     P AYG YP YG HQQQVS
Sbjct  394  YGYAMPSPHHDPNMYPLAYGGYPFYGGHQQQVS  426



>ref|XP_004152729.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Cucumis 
sativus]
 ref|XP_004160013.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Cucumis 
sativus]
 gb|KGN62542.1| hypothetical protein Csa_2G360590 [Cucumis sativus]
Length=429

 Score =   192 bits (488),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 118/163 (72%), Positives = 135/163 (83%), Gaps = 0/163 (0%)
 Frame = -1

Query  686  SSGNQQQLPAQGGYSNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVS  507
            SSG QQQ  +QG  SNGS +HG QSDGD +NTTIF+GGLDPNV+DEDL+Q FSQ+GEIVS
Sbjct  267  SSGYQQQYSSQGYASNGSFSHGHQSDGDFTNTTIFIGGLDPNVTDEDLKQLFSQHGEIVS  326

Query  506  VKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAG  327
            VKIPVGKGCGF+QFANR +AEEALQKL G VIGKQTVRLSWGR+P ++Q R D+ N W+G
Sbjct  327  VKIPVGKGCGFIQFANRKNAEEALQKLNGTVIGKQTVRLSWGRSPTNKQYRGDYGNHWSG  386

Query  326  AYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyGTHQQQVS  198
            AYYGG  Y GY YA P P++P     AAYGAYPMYGTHQQQV+
Sbjct  387  AYYGGQVYGGYGYALPLPYDPPTMYAAAYGAYPMYGTHQQQVN  429



>gb|KDO35913.1| hypothetical protein CISIN_1g029152mg [Citrus sinensis]
Length=152

 Score =   184 bits (466),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 94/118 (80%), Positives = 103/118 (87%), Gaps = 2/118 (2%)
 Frame = -1

Query  686  SSGNQQQLPAQGGY-SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIV  510
            SSG QQQ  +QGGY SNG+P  G QS+GDSSNTTIFVGGLDPNV+DEDLRQPFSQYGEI 
Sbjct  24   SSGYQQQYSSQGGYASNGAPGQGPQSEGDSSNTTIFVGGLDPNVTDEDLRQPFSQYGEIA  83

Query  509  SVKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQ-SRSDFTN  339
            SVKIPVGKGCGFVQFANR +AEEAL KL G VIGKQ+VRLSWGRNPA++Q S S FT+
Sbjct  84   SVKIPVGKGCGFVQFANRENAEEALHKLNGTVIGKQSVRLSWGRNPANKQASLSPFTS  141



>ref|XP_006423054.1| hypothetical protein CICLE_v10028454mg [Citrus clementina]
 gb|ESR36294.1| hypothetical protein CICLE_v10028454mg [Citrus clementina]
Length=445

 Score =   190 bits (483),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 113/148 (76%), Gaps = 6/148 (4%)
 Frame = -1

Query  686  SSGNQQQLPAQ------GGYSNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQ  525
            +SG QQQ  +Q      G  SNG+   GSQSDG+S+N TIFVG LD +VSDEDLR+PFSQ
Sbjct  287  ASGYQQQYSSQALVLAGGPGSNGARVQGSQSDGESNNATIFVGALDSDVSDEDLREPFSQ  346

Query  524  YGEIVSVKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDF  345
            +GEI+SVKIPVGKGCGFVQFANR DAE ALQKL+G  IGKQTVRLSWGRNP ++Q R D 
Sbjct  347  FGEILSVKIPVGKGCGFVQFANRKDAEVALQKLQGTAIGKQTVRLSWGRNPGNKQWRGDH  406

Query  344  TNQWAGAYYGGHFYDGYTYAFPAPHNPN  261
            +N W GA+YGG  Y G  YAFP   +PN
Sbjct  407  SNHWNGAHYGGQGYSGNGYAFPPNQDPN  434



>ref|XP_006480131.1| PREDICTED: polyadenylate-binding protein RBP47B-like [Citrus 
sinensis]
 gb|KDO49117.1| hypothetical protein CISIN_1g013061mg [Citrus sinensis]
Length=449

 Score =   190 bits (483),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 113/148 (76%), Gaps = 6/148 (4%)
 Frame = -1

Query  686  SSGNQQQLPAQ------GGYSNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQ  525
            +SG QQQ  +Q      G  SNG+   GSQSDG+S+N TIFVG LD +VSDEDLR+PFSQ
Sbjct  291  ASGYQQQYSSQALVLAGGPGSNGARVQGSQSDGESNNATIFVGALDSDVSDEDLREPFSQ  350

Query  524  YGEIVSVKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDF  345
            +GEI+SVKIPVGKGCGFVQFANR DAE ALQKL+G  IGKQTVRLSWGRNP ++Q R D 
Sbjct  351  FGEILSVKIPVGKGCGFVQFANRKDAEVALQKLQGTAIGKQTVRLSWGRNPGNKQWRGDH  410

Query  344  TNQWAGAYYGGHFYDGYTYAFPAPHNPN  261
            +N W GA+YGG  Y G  YAFP   +PN
Sbjct  411  SNHWNGAHYGGQGYSGNGYAFPPNQDPN  438



>ref|XP_010500273.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Camelina 
sativa]
Length=444

 Score =   189 bits (480),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 106/154 (69%), Positives = 122/154 (79%), Gaps = 4/154 (3%)
 Frame = -1

Query  656  QGGYS-NGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGC  480
            QGGY  NG+ A   + +GD+ NTTIFVGGLD +V+DEDLRQPFS YGEIVSVKIPVGKGC
Sbjct  294  QGGYMPNGAMA---RPEGDTLNTTIFVGGLDSSVTDEDLRQPFSDYGEIVSVKIPVGKGC  350

Query  479  GFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYD  300
            GFVQF NR +AEEAL+KL G VIGKQTVRLSWGR+PA++Q R  + NQW   YYGG +++
Sbjct  351  GFVQFVNRPNAEEALEKLNGTVIGKQTVRLSWGRSPANKQPRDKYGNQWVVPYYGGQYFN  410

Query  299  GYTYAFPAPHNPNmyapaaygaypmyGTHQQQVS  198
            GY Y  P PH+P MY  A YG YPMYG HQQQVS
Sbjct  411  GYGYMAPQPHDPRMYPAAPYGGYPMYGGHQQQVS  444



>gb|EYU20972.1| hypothetical protein MIMGU_mgv1a018561mg, partial [Erythranthe 
guttata]
Length=125

 Score =   179 bits (454),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 107/126 (85%), Gaps = 1/126 (1%)
 Frame = -1

Query  575  GLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTV  396
            GLDPNVSDEDLRQPFSQYGEI+SVKIPVGKGCGFVQFANR +AEEALQ+L G  IGKQTV
Sbjct  1    GLDPNVSDEDLRQPFSQYGEIISVKIPVGKGCGFVQFANRNEAEEALQQLTGTTIGKQTV  60

Query  395  RLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyGT  216
            RLSWGRNPA++QSR D  NQW GAYYG   +DGY YA   PH+P+    AAYGAYPMYGT
Sbjct  61   RLSWGRNPANKQSRGDLGNQWTGAYYGPPSFDGYGYAVGPPHDPS-MYAAAYGAYPMYGT  119

Query  215  HQQQVS  198
            HQQQVS
Sbjct  120  HQQQVS  125



>gb|KEH40058.1| polyadenylate-binding protein RBP47C [Medicago truncatula]
Length=425

 Score =   186 bits (471),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 104/129 (81%), Gaps = 4/129 (3%)
 Frame = -1

Query  653  GGYSNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGF  474
            GG SNG+    SQS+ DS+NTTIFVGGLD NV+DEDL+Q FSQYGEI SVKIPVGKGCGF
Sbjct  278  GGQSNGT---SSQSEADSTNTTIFVGGLDSNVTDEDLKQTFSQYGEIASVKIPVGKGCGF  334

Query  473  VQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGY  294
            VQFANR +AEEALQKL G +IGKQTVRLSWGRNPA++Q R D    WAG Y+    YDGY
Sbjct  335  VQFANRNNAEEALQKLNGTMIGKQTVRLSWGRNPAYKQFRLD-VGSWAGPYFPSPIYDGY  393

Query  293  TYAFPAPHN  267
             YA P+PH+
Sbjct  394  GYAMPSPHH  402



>gb|KDO49116.1| hypothetical protein CISIN_1g013061mg [Citrus sinensis]
Length=450

 Score =   186 bits (471),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 98/149 (66%), Positives = 113/149 (76%), Gaps = 7/149 (5%)
 Frame = -1

Query  686  SSGNQQQLPAQ------GGYSNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQ  525
            +SG QQQ  +Q      G  SNG+   GSQSDG+S+N TIFVG LD +VSDEDLR+PFSQ
Sbjct  291  ASGYQQQYSSQALVLAGGPGSNGARVQGSQSDGESNNATIFVGALDSDVSDEDLREPFSQ  350

Query  524  YGEIVSVKIPVGKGCGFVQFAN-RTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSD  348
            +GEI+SVKIPVGKGCGFVQFAN R DAE ALQKL+G  IGKQTVRLSWGRNP ++Q R D
Sbjct  351  FGEILSVKIPVGKGCGFVQFANSRKDAEVALQKLQGTAIGKQTVRLSWGRNPGNKQWRGD  410

Query  347  FTNQWAGAYYGGHFYDGYTYAFPAPHNPN  261
             +N W GA+YGG  Y G  YAFP   +PN
Sbjct  411  HSNHWNGAHYGGQGYSGNGYAFPPNQDPN  439



>gb|AFK35123.1| unknown [Medicago truncatula]
Length=425

 Score =   185 bits (469),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 91/129 (71%), Positives = 104/129 (81%), Gaps = 4/129 (3%)
 Frame = -1

Query  653  GGYSNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGF  474
            GG +NG+    SQS+ DS+NTTIFVGGLD NV+DEDL+Q FSQYGEI SVKIPVGKGCGF
Sbjct  278  GGQTNGT---SSQSEADSTNTTIFVGGLDSNVTDEDLKQTFSQYGEIASVKIPVGKGCGF  334

Query  473  VQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGY  294
            VQFANR +AEEALQKL G +IGKQTVRLSWGRNPA++Q R D    WAG Y+    YDGY
Sbjct  335  VQFANRNNAEEALQKLNGTMIGKQTVRLSWGRNPAYKQFRLD-VGSWAGPYFPSPIYDGY  393

Query  293  TYAFPAPHN  267
             YA P+PH+
Sbjct  394  GYAMPSPHH  402



>ref|XP_009391347.1| PREDICTED: polyadenylate-binding protein RBP47-like [Musa acuminata 
subsp. malaccensis]
Length=406

 Score =   184 bits (467),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 87/123 (71%), Positives = 100/123 (81%), Gaps = 0/123 (0%)
 Frame = -1

Query  641  NGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFA  462
            +GS    +QSDGD +NTT+FVGGLDPNV+++DL Q FSQYGEI SVKIPVGK CGFVQF 
Sbjct  259  SGSNGLSAQSDGDLTNTTVFVGGLDPNVNEDDLNQTFSQYGEIASVKIPVGKQCGFVQFV  318

Query  461  NRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAF  282
             R +AEEALQ+L G VIG QTVRLSWGRNPA++Q RSD +NQW G YYGG FY+GY YA 
Sbjct  319  QRNNAEEALQRLNGTVIGNQTVRLSWGRNPANKQLRSDSSNQWNGMYYGGPFYNGYMYAA  378

Query  281  PAP  273
            P P
Sbjct  379  PVP  381



>ref|XP_010461546.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Camelina 
sativa]
Length=446

 Score =   185 bits (469),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 104/154 (68%), Positives = 121/154 (79%), Gaps = 4/154 (3%)
 Frame = -1

Query  656  QGGYS-NGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGC  480
            QGGY  NG+ A   + +G++ NTTIFVGGLD +V+DEDLRQPFS YGEIVSVKIPVGKGC
Sbjct  296  QGGYMPNGAMA---RPEGETLNTTIFVGGLDSSVTDEDLRQPFSDYGEIVSVKIPVGKGC  352

Query  479  GFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYD  300
            GFVQF NR +AEEAL+KL G VIGKQTVRLSWG +PA++Q R  + NQW   YYGG +++
Sbjct  353  GFVQFVNRPNAEEALEKLNGTVIGKQTVRLSWGHSPANKQPRDKYGNQWVVPYYGGQYFN  412

Query  299  GYTYAFPAPHNPNmyapaaygaypmyGTHQQQVS  198
            GY Y  P PH+P MY  A YG YPMYG HQQQVS
Sbjct  413  GYGYMAPQPHDPRMYPAAPYGGYPMYGGHQQQVS  446



>ref|XP_003528246.1| PREDICTED: polyadenylate-binding protein RBP47C'-like [Glycine 
max]
Length=410

 Score =   184 bits (466),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 102/157 (65%), Positives = 118/157 (75%), Gaps = 7/157 (4%)
 Frame = -1

Query  650  GYSNGSPAHG--SQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCG  477
            GY  GS ++G  SQS+ DS+NTTIFVGGLD NV+ EDL+QPFSQYGEIVSVKIPVGKGCG
Sbjct  255  GYQQGSQSNGISSQSEADSTNTTIFVGGLDSNVTAEDLKQPFSQYGEIVSVKIPVGKGCG  314

Query  476  FVQFANRT----DAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGH  309
            F    +R+    +AEEALQKL G  IGKQ VRLSWGRNPA++Q R+DF N W+GAYYGG 
Sbjct  315  FTICNSRSPGPKNAEEALQKLNGTTIGKQMVRLSWGRNPANKQFRADFGNAWSGAYYGGP  374

Query  308  FYDGYTYAFPAPHNPNmyapaaygaypmyGTHQQQVS  198
             YDGY YA P  H+P++YA A        G HQQQVS
Sbjct  375  VYDGYGYALPPSHDPSIYAAAYGAYPIYGG-HQQQVS  410



>ref|XP_009417617.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Musa acuminata 
subsp. malaccensis]
Length=399

 Score =   182 bits (463),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/116 (73%), Positives = 96/116 (83%), Gaps = 0/116 (0%)
 Frame = -1

Query  620  SQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRTDAEE  441
            +QSDGD +NTT+FVGGLDPNVS++DL++ FS YGEI SVKIPVGK CGFVQF  R +AEE
Sbjct  263  AQSDGDLTNTTVFVGGLDPNVSEDDLKRTFSLYGEIASVKIPVGKQCGFVQFVQRNNAEE  322

Query  440  ALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAP  273
            ALQ L G VIGKQTVRLSWGRNPA++Q RSD  NQW G YYGG FY+GY YA P P
Sbjct  323  ALQGLNGTVIGKQTVRLSWGRNPANKQLRSDLGNQWNGMYYGGQFYNGYVYAAPVP  378



>ref|XP_010479152.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Camelina 
sativa]
Length=446

 Score =   184 bits (466),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 103/154 (67%), Positives = 120/154 (78%), Gaps = 4/154 (3%)
 Frame = -1

Query  656  QGGYS-NGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGC  480
            QGGY  NG+ A   + +G++ NTTIFVGGLD +V+DEDLRQPFS YGEIVSVKIPVGKGC
Sbjct  296  QGGYMPNGAMA---RPEGETLNTTIFVGGLDSSVTDEDLRQPFSDYGEIVSVKIPVGKGC  352

Query  479  GFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYD  300
            GFVQF NR +AEEAL+KL G VIGKQTVRLSWGR+PA++Q R  + NQW   YYGG +++
Sbjct  353  GFVQFVNRPNAEEALEKLNGTVIGKQTVRLSWGRSPANKQPRDKYGNQWVVPYYGGQYFN  412

Query  299  GYTYAFPAPHNPNmyapaaygaypmyGTHQQQVS  198
            GY Y  P P +P MY    YG YPMYG HQQQVS
Sbjct  413  GYGYMAPQPLDPRMYPATPYGGYPMYGGHQQQVS  446



>ref|NP_175181.1| RNA-binding protein 47C' [Arabidopsis thaliana]
 sp|Q9SX80.1|R47CP_ARATH RecName: Full=Polyadenylate-binding protein RBP47C'; Short=Poly(A)-binding 
protein RBP47C'; AltName: Full=RNA-binding protein 
47C'; Short=AtRBP47C prime; Short=AtRBP47C' [Arabidopsis 
thaliana]
 gb|AAD46037.1|AC007519_22 Contains 3 PF|00076 RNA recognition motif domains. EST gb|T20424 
comes from this gene [Arabidopsis thaliana]
 dbj|BAE99410.1| hypothetical protein [Arabidopsis thaliana]
 gb|ABN04767.1| At1g47500 [Arabidopsis thaliana]
 gb|AEE32178.1| RNA-binding protein 47C' [Arabidopsis thaliana]
Length=434

 Score =   183 bits (464),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 83/116 (72%), Positives = 98/116 (84%), Gaps = 0/116 (0%)
 Frame = -1

Query  620  SQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRTDAEE  441
            ++S+GD+ NTTIFVGGLD +V+DEDL+QPFS++GEIVSVKIPVGKGCGFVQF NR +AEE
Sbjct  297  TRSEGDTINTTIFVGGLDSSVTDEDLKQPFSEFGEIVSVKIPVGKGCGFVQFVNRPNAEE  356

Query  440  ALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAP  273
            AL+KL G VIGKQTVRLSWGRNPA++Q R  + NQW   YYGG FY+GY Y  P P
Sbjct  357  ALEKLNGTVIGKQTVRLSWGRNPANKQPRDKYGNQWVDPYYGGQFYNGYGYMVPQP  412



>ref|XP_007017333.1| RNA-binding protein 47C isoform 5 [Theobroma cacao]
 gb|EOY14558.1| RNA-binding protein 47C isoform 5 [Theobroma cacao]
Length=380

 Score =   180 bits (457),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 100/111 (90%), Gaps = 4/111 (4%)
 Frame = -1

Query  686  SSGNQQQLPAQGGY-SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIV  510
            SSG QQQ  +QGGY SNG+    +QSDGDSSNTTIFVGGLDPNV++EDLRQPFSQYGEIV
Sbjct  273  SSGYQQQYSSQGGYASNGA---SNQSDGDSSNTTIFVGGLDPNVTEEDLRQPFSQYGEIV  329

Query  509  SVKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQS  357
            SVKIPVGKGCGFVQFANR +AEEALQKL G VIGKQTVRLSWGRNPA++QS
Sbjct  330  SVKIPVGKGCGFVQFANRNNAEEALQKLNGTVIGKQTVRLSWGRNPANKQS  380



>ref|NP_175180.1| RNA-binding protein 47C [Arabidopsis thaliana]
 sp|Q9SX79.1|RB47C_ARATH RecName: Full=Polyadenylate-binding protein RBP47C; Short=Poly(A)-binding 
protein RBP47C; AltName: Full=RNA-binding protein 
47C; Short=AtRBP47C [Arabidopsis thaliana]
 gb|AAD46038.1|AC007519_23 Contains 3 PF|00076 RNA recognition motif domains. ESTs gb|R30092, 
gb|R30093, gb|AA394338, gb|N65719 and gb|AA597577 come 
from this gene [Arabidopsis thaliana]
 gb|AAK06876.1|AF344325_1 putative DNA binding protein [Arabidopsis thaliana]
 gb|AAK59684.1| putative DNA binding protein [Arabidopsis thaliana]
 gb|AAL33806.1| putative DNA binding protein [Arabidopsis thaliana]
 gb|AEE32174.1| RNA-binding protein 47C [Arabidopsis thaliana]
Length=432

 Score =   181 bits (458),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 103/129 (80%), Gaps = 4/129 (3%)
 Frame = -1

Query  656  QGGY-SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGC  480
            QGGY  NG+    ++ +GD  NTTIFVGGLD +V+DEDL+QPF+++GEIVSVKIPVGKGC
Sbjct  285  QGGYMPNGT---LTRPEGDIMNTTIFVGGLDSSVTDEDLKQPFNEFGEIVSVKIPVGKGC  341

Query  479  GFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYD  300
            GFVQF NR +AEEAL+KL G VIGKQTVRLSWGRNPA++Q R  + NQW   YYGG FY+
Sbjct  342  GFVQFVNRPNAEEALEKLNGTVIGKQTVRLSWGRNPANKQPRDKYGNQWVDPYYGGQFYN  401

Query  299  GYTYAFPAP  273
            GY Y  P P
Sbjct  402  GYGYMVPQP  410



>gb|KDO35916.1| hypothetical protein CISIN_1g029152mg [Citrus sinensis]
Length=161

 Score =   173 bits (438),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 88/111 (79%), Positives = 96/111 (86%), Gaps = 2/111 (2%)
 Frame = -1

Query  665  LPAQGGY-SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVG  489
            L   GGY SNG+P  G QS+GDSSNTTIFVGGLDPNV+DEDLRQPFSQYGEI SVKIPVG
Sbjct  40   LVLIGGYASNGAPGQGPQSEGDSSNTTIFVGGLDPNVTDEDLRQPFSQYGEIASVKIPVG  99

Query  488  KGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQ-SRSDFTN  339
            KGCGFVQFANR +AEEAL KL G VIGKQ+VRLSWGRNPA++Q S S FT+
Sbjct  100  KGCGFVQFANRENAEEALHKLNGTVIGKQSVRLSWGRNPANKQASLSPFTS  150



>ref|XP_006845939.1| hypothetical protein AMTR_s00157p00079360 [Amborella trichopoda]
 gb|ERN07614.1| hypothetical protein AMTR_s00157p00079360 [Amborella trichopoda]
Length=176

 Score =   172 bits (437),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 97/149 (65%), Positives = 118/149 (79%), Gaps = 5/149 (3%)
 Frame = -1

Query  638  GSPAHGS--QSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQF  465
            G P++G   QS+GDS+NTTIFVGGLD +V+++DLR+ FS+YG+I SVKIPV KGCGFVQF
Sbjct  19   GFPSNGQNFQSEGDSNNTTIFVGGLDSSVTEDDLREAFSKYGDIASVKIPVNKGCGFVQF  78

Query  464  ANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYA  285
            ANR++AEEALQ L G VIGK T+RLSWGRNP ++Q R+D  NQW G+YYGG  YDGY YA
Sbjct  79   ANRSNAEEALQGLNGTVIGKVTIRLSWGRNPGNKQPRADAANQWNGSYYGGQVYDGYGYA  138

Query  284  FPAPHNPNmyapaaygaypmyGTHQQQVS  198
               P +P     AAYG YP+YG HQQQV+
Sbjct  139  -AQPQDP--AVYAAYGTYPVYGNHQQQVA  164



>ref|XP_007017330.1| RNA-binding protein 47C isoform 2 [Theobroma cacao]
 gb|EOY14555.1| RNA-binding protein 47C isoform 2 [Theobroma cacao]
Length=394

 Score =   178 bits (452),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 91/110 (83%), Positives = 99/110 (90%), Gaps = 4/110 (4%)
 Frame = -1

Query  686  SSGNQQQLPAQGGY-SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIV  510
            SSG QQQ  +QGGY SNG+    +QSDGDSSNTTIFVGGLDPNV++EDLRQPFSQYGEIV
Sbjct  273  SSGYQQQYSSQGGYASNGA---SNQSDGDSSNTTIFVGGLDPNVTEEDLRQPFSQYGEIV  329

Query  509  SVKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQ  360
            SVKIPVGKGCGFVQFANR +AEEALQKL G VIGKQTVRLSWGRNPA++Q
Sbjct  330  SVKIPVGKGCGFVQFANRNNAEEALQKLNGTVIGKQTVRLSWGRNPANKQ  379



>ref|XP_008782322.1| PREDICTED: polyadenylate-binding protein RBP47C'-like [Phoenix 
dactylifera]
Length=168

 Score =   171 bits (434),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/128 (64%), Positives = 100/128 (78%), Gaps = 1/128 (1%)
 Frame = -1

Query  644  SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQF  465
            SNG+ A   QSDGD +NTT+FVGGLDPNVS++DL+Q FSQYGE+ SVKIPVGK CGFVQF
Sbjct  23   SNGASAQSFQSDGDPTNTTVFVGGLDPNVSEDDLKQAFSQYGEVASVKIPVGKQCGFVQF  82

Query  464  ANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYA  285
             +R +AEEALQ+L G VIGKQ VRLSWGRNP ++Q R+     W G Y+GG  ++GY Y 
Sbjct  83   VHRNNAEEALQQLNGTVIGKQLVRLSWGRNPTNKQLRARPGGHWNGVYHGGQVHNGYGYV  142

Query  284  FPAPHNPN  261
             PA H+P+
Sbjct  143  LPA-HDPS  149



>ref|XP_009794615.1| PREDICTED: polyadenylate-binding protein RBP47 isoform X1 [Nicotiana 
sylvestris]
Length=402

 Score =   177 bits (449),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 88/135 (65%), Positives = 106/135 (79%), Gaps = 6/135 (4%)
 Frame = -1

Query  674  QQQLPAQ-----GGY-SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEI  513
            QQQ  +Q     GGY SNG+  HGSQSDGDSSNTTIFVGGLD  V+DE+LRQ F+Q+GE+
Sbjct  236  QQQYSSQAVILSGGYASNGAATHGSQSDGDSSNTTIFVGGLDSEVTDEELRQSFNQFGEV  295

Query  512  VSVKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQW  333
            VSVKIP GKGCGFVQF++R+ A+EA+QKL G +IGKQ VRLSWGR+PA++Q R+D  +QW
Sbjct  296  VSVKIPAGKGCGFVQFSDRSSAQEAIQKLSGAIIGKQAVRLSWGRSPANKQMRTDSGSQW  355

Query  332  AGAYYGGHFYDGYTY  288
             G Y G   Y GY Y
Sbjct  356  NGGYNGRQNYGGYGY  370



>ref|XP_009794616.1| PREDICTED: polyadenylate-binding protein RBP47 isoform X2 [Nicotiana 
sylvestris]
Length=431

 Score =   177 bits (450),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 88/135 (65%), Positives = 106/135 (79%), Gaps = 6/135 (4%)
 Frame = -1

Query  674  QQQLPAQ-----GGY-SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEI  513
            QQQ  +Q     GGY SNG+  HGSQSDGDSSNTTIFVGGLD  V+DE+LRQ F+Q+GE+
Sbjct  265  QQQYSSQAVILSGGYASNGAATHGSQSDGDSSNTTIFVGGLDSEVTDEELRQSFNQFGEV  324

Query  512  VSVKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQW  333
            VSVKIP GKGCGFVQF++R+ A+EA+QKL G +IGKQ VRLSWGR+PA++Q R+D  +QW
Sbjct  325  VSVKIPAGKGCGFVQFSDRSSAQEAIQKLSGAIIGKQAVRLSWGRSPANKQMRTDSGSQW  384

Query  332  AGAYYGGHFYDGYTY  288
             G Y G   Y GY Y
Sbjct  385  NGGYNGRQNYGGYGY  399



>ref|XP_007017332.1| RNA-binding protein 47C isoform 4, partial [Theobroma cacao]
 gb|EOY14557.1| RNA-binding protein 47C isoform 4, partial [Theobroma cacao]
Length=387

 Score =   176 bits (446),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 90/108 (83%), Positives = 97/108 (90%), Gaps = 4/108 (4%)
 Frame = -1

Query  686  SSGNQQQLPAQGGY-SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIV  510
            SSG QQQ  +QGGY SNG+    +QSDGDSSNTTIFVGGLDPNV++EDLRQPFSQYGEIV
Sbjct  273  SSGYQQQYSSQGGYASNGA---SNQSDGDSSNTTIFVGGLDPNVTEEDLRQPFSQYGEIV  329

Query  509  SVKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAH  366
            SVKIPVGKGCGFVQFANR +AEEALQKL G VIGKQTVRLSWGRNPA+
Sbjct  330  SVKIPVGKGCGFVQFANRNNAEEALQKLNGTVIGKQTVRLSWGRNPAN  377



>sp|Q9LEB3.1|RBP47_NICPL RecName: Full=Polyadenylate-binding protein RBP47; Short=Poly(A)-binding 
protein RBP47; AltName: Full=RNA-binding protein 
47; Short=NplRBP47 [Nicotiana plumbaginifolia]
 emb|CAC01238.1| RNA Binding Protein 47 [Nicotiana plumbaginifolia]
Length=428

 Score =   177 bits (449),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 103/129 (80%), Gaps = 1/129 (1%)
 Frame = -1

Query  671  QQLPAQGGY-SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIP  495
            Q +   GGY SNG+  HGSQSDGDSSNTTIFVGGLD  V+DE+LRQ F+Q+GE+VSVKIP
Sbjct  268  QAVILSGGYASNGAATHGSQSDGDSSNTTIFVGGLDSEVTDEELRQSFNQFGEVVSVKIP  327

Query  494  VGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYG  315
             GKGCGFVQF++R+ A+EA+QKL G +IGKQ VRLSWGR+PA++Q R+D  +QW G Y G
Sbjct  328  AGKGCGFVQFSDRSSAQEAIQKLSGAIIGKQAVRLSWGRSPANKQMRTDSGSQWNGGYNG  387

Query  314  GHFYDGYTY  288
               Y GY Y
Sbjct  388  RQNYGGYGY  396



>emb|CBI32444.3| unnamed protein product [Vitis vinifera]
Length=342

 Score =   175 bits (443),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 100/124 (81%), Gaps = 6/124 (5%)
 Frame = -1

Query  686  SSGNQQQLPAQ------GGYSNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQ  525
            +SG QQQ  +Q      G  SNG+ A GSQ++GDS+NTTIFVGGLD  V+DEDLRQ FSQ
Sbjct  184  ASGYQQQYSSQALVLAGGNASNGAVAQGSQANGDSTNTTIFVGGLDSEVTDEDLRQSFSQ  243

Query  524  YGEIVSVKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDF  345
            +GE+VSVKIPVGKGCGFVQFANR  AE+ALQ+L G VIGKQTVRLSWGRNPA +Q R+D 
Sbjct  244  FGEVVSVKIPVGKGCGFVQFANRNSAEDALQRLNGTVIGKQTVRLSWGRNPASKQWRNDS  303

Query  344  TNQW  333
             NQW
Sbjct  304  NNQW  307



>ref|XP_009590296.1| PREDICTED: polyadenylate-binding protein RBP47 [Nicotiana tomentosiformis]
Length=430

 Score =   177 bits (448),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 87/135 (64%), Positives = 107/135 (79%), Gaps = 6/135 (4%)
 Frame = -1

Query  674  QQQLPAQ-----GGY-SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEI  513
            QQQ  +Q     GGY SNG+  HGSQSDGD+SNTTIFVGGLD +V+DE+LRQ F+Q+GE+
Sbjct  264  QQQYSSQAVILSGGYASNGAATHGSQSDGDASNTTIFVGGLDSDVTDEELRQSFNQFGEV  323

Query  512  VSVKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQW  333
            VSVKIP GKGCGFVQF++R+ A+EA+QKL G +IGKQ VRLSWGR+PA++Q R+D  +QW
Sbjct  324  VSVKIPAGKGCGFVQFSDRSSAQEAIQKLSGAIIGKQAVRLSWGRSPANKQMRADSGSQW  383

Query  332  AGAYYGGHFYDGYTY  288
             G Y G   Y GY Y
Sbjct  384  NGGYNGRQNYGGYGY  398



>gb|AAB92518.1| putative RNA binding protein [Nicotiana tabacum]
Length=482

 Score =   176 bits (447),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 87/135 (64%), Positives = 107/135 (79%), Gaps = 6/135 (4%)
 Frame = -1

Query  674  QQQLPAQ-----GGY-SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEI  513
            QQQ  +Q     GGY SNG+  HGSQSDGD+SNTTIFVGGLD +V+DE+LRQ F+Q+GE+
Sbjct  316  QQQYSSQAVILSGGYASNGAATHGSQSDGDASNTTIFVGGLDSDVTDEELRQSFNQFGEV  375

Query  512  VSVKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQW  333
            VSVKIP GKGCGFVQF++R+ A+EA+QKL G +IGKQ VRLSWGR+PA++Q R+D  +QW
Sbjct  376  VSVKIPAGKGCGFVQFSDRSSAQEAIQKLSGAIIGKQAVRLSWGRSPANKQMRADSGSQW  435

Query  332  AGAYYGGHFYDGYTY  288
             G Y G   Y GY Y
Sbjct  436  NGGYNGRQNYGGYGY  450



>ref|XP_010647773.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X2 
[Vitis vinifera]
Length=414

 Score =   175 bits (444),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 100/124 (81%), Gaps = 6/124 (5%)
 Frame = -1

Query  686  SSGNQQQLPAQ------GGYSNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQ  525
            +SG QQQ  +Q      G  SNG+ A GSQ++GDS+NTTIFVGGLD  V+DEDLRQ FSQ
Sbjct  256  ASGYQQQYSSQALVLAGGNASNGAVAQGSQANGDSTNTTIFVGGLDSEVTDEDLRQSFSQ  315

Query  524  YGEIVSVKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDF  345
            +GE+VSVKIPVGKGCGFVQFANR  AE+ALQ+L G VIGKQTVRLSWGRNPA +Q R+D 
Sbjct  316  FGEVVSVKIPVGKGCGFVQFANRNSAEDALQRLNGTVIGKQTVRLSWGRNPASKQWRNDS  375

Query  344  TNQW  333
             NQW
Sbjct  376  NNQW  379



>ref|XP_006442703.1| hypothetical protein CICLE_v10022585mg [Citrus clementina]
 gb|ESR55943.1| hypothetical protein CICLE_v10022585mg [Citrus clementina]
Length=166

 Score =   168 bits (425),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 88/139 (63%), Positives = 103/139 (74%), Gaps = 4/139 (3%)
 Frame = -1

Query  686  SSGNQQQLPAQGGYSNGSPA-HGSQ---SDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYG  519
            +SG QQQ  +Q     G PA +G++   SDG S+N TIFVG LD NVSD+DLR+ FS +G
Sbjct  12   ASGYQQQCSSQALVLAGGPASNGARVQGSDGKSNNATIFVGALDSNVSDKDLRELFSHFG  71

Query  518  EIVSVKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTN  339
            EI+SVKIPVGKGCGFVQFANR DAE ALQKL+G  IGKQTVRLSWG NP ++Q R D  N
Sbjct  72   EILSVKIPVGKGCGFVQFANRKDAEVALQKLQGTAIGKQTVRLSWGHNPGNKQWRGDHIN  131

Query  338  QWAGAYYGGHFYDGYTYAF  282
             W GA+YGG  Y G  YA+
Sbjct  132  HWNGAHYGGQGYSGNGYAW  150



>ref|XP_002285031.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X1 
[Vitis vinifera]
Length=416

 Score =   175 bits (443),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 100/124 (81%), Gaps = 6/124 (5%)
 Frame = -1

Query  686  SSGNQQQLPAQ------GGYSNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQ  525
            +SG QQQ  +Q      G  SNG+ A GSQ++GDS+NTTIFVGGLD  V+DEDLRQ FSQ
Sbjct  258  ASGYQQQYSSQALVLAGGNASNGAVAQGSQANGDSTNTTIFVGGLDSEVTDEDLRQSFSQ  317

Query  524  YGEIVSVKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDF  345
            +GE+VSVKIPVGKGCGFVQFANR  AE+ALQ+L G VIGKQTVRLSWGRNPA +Q R+D 
Sbjct  318  FGEVVSVKIPVGKGCGFVQFANRNSAEDALQRLNGTVIGKQTVRLSWGRNPASKQWRNDS  377

Query  344  TNQW  333
             NQW
Sbjct  378  NNQW  381



>ref|XP_006346456.1| PREDICTED: polyadenylate-binding protein RBP47 [Solanum tuberosum]
Length=420

 Score =   175 bits (443),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 89/135 (66%), Positives = 106/135 (79%), Gaps = 8/135 (6%)
 Frame = -1

Query  674  QQQLPAQ-----GGY-SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEI  513
            QQQ  +Q     GGY SNGS  HGSQSDGDSSNTTIFVGGLD +V+DE+LRQ F+Q+GE+
Sbjct  261  QQQFSSQAVILSGGYASNGSATHGSQSDGDSSNTTIFVGGLDSDVTDEELRQSFTQFGEV  320

Query  512  VSVKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQW  333
            VSVKIP GKGCGFVQF++R+ A+EA+QKL G +IGKQ VRLSWGR+PA++Q R+D  N  
Sbjct  321  VSVKIPAGKGCGFVQFSDRSSAQEAIQKLSGAIIGKQAVRLSWGRSPANKQMRTDSGN--  378

Query  332  AGAYYGGHFYDGYTY  288
             G YYG   Y GY Y
Sbjct  379  GGGYYGRQNYGGYGY  393



>ref|XP_008797245.1| PREDICTED: polyadenylate-binding protein RBP47-like [Phoenix 
dactylifera]
Length=393

 Score =   174 bits (441),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 87/127 (69%), Positives = 96/127 (76%), Gaps = 3/127 (2%)
 Frame = -1

Query  653  GGYSNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGF  474
            GG  NG P    QS GDS+NTT+FVGGLD NVS++DLRQ FSQYGEI SVKIP GK CGF
Sbjct  248  GGSGNGVPG---QSHGDSTNTTVFVGGLDTNVSEDDLRQVFSQYGEIASVKIPSGKQCGF  304

Query  473  VQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGY  294
            VQF  R +AEEALQ L G VIGKQ VRLSWGRNPA++Q R D +N W G YYG  FY+GY
Sbjct  305  VQFVQRNNAEEALQALNGTVIGKQPVRLSWGRNPANKQLRGDPSNLWNGVYYGAQFYNGY  364

Query  293  TYAFPAP  273
             YA P P
Sbjct  365  GYAAPVP  371



>ref|XP_009380242.1| PREDICTED: polyadenylate-binding protein RBP47-like [Musa acuminata 
subsp. malaccensis]
Length=404

 Score =   174 bits (441),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 87/131 (66%), Positives = 104/131 (79%), Gaps = 4/131 (3%)
 Frame = -1

Query  653  GGY-SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCG  477
            GG+  NGSPA GSQSD DS+NTT+FVGGLDP+VS++DL++ FSQYGEI SVKIP GK CG
Sbjct  257  GGFGQNGSPAAGSQSDVDSANTTVFVGGLDPDVSEDDLKEAFSQYGEIASVKIPFGKQCG  316

Query  476  FVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDG  297
            FV F +R +AEEA+ +L G VIGKQTVRLSWGRNPA++QSR++   +W G YYGG  YDG
Sbjct  317  FVLFIHRNNAEEAMNQLNGTVIGKQTVRLSWGRNPANKQSRAERGKRWNGMYYGGQMYDG  376

Query  296  YTYAFPAPHNP  264
              Y  P PH P
Sbjct  377  --YGLP-PHYP  384



>gb|KJB58433.1| hypothetical protein B456_009G209600 [Gossypium raimondii]
Length=385

 Score =   173 bits (439),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 86/109 (79%), Positives = 95/109 (87%), Gaps = 2/109 (2%)
 Frame = -1

Query  686  SSGNQQQLPAQGGYSNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVS  507
            SS  QQQ   QGGY++ S +  SQSDGDSSNTTIFVGGLDPNV++EDLRQPFSQYGEIVS
Sbjct  273  SSSYQQQYSLQGGYASNSAS--SQSDGDSSNTTIFVGGLDPNVTEEDLRQPFSQYGEIVS  330

Query  506  VKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQ  360
            VKIPVGKGCGFVQFA R +AEEALQKL G +IGKQTVRLSWGRNP ++Q
Sbjct  331  VKIPVGKGCGFVQFAGRNNAEEALQKLNGTIIGKQTVRLSWGRNPTNKQ  379



>emb|CAN74486.1| hypothetical protein VITISV_029928 [Vitis vinifera]
Length=434

 Score =   174 bits (441),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 100/124 (81%), Gaps = 6/124 (5%)
 Frame = -1

Query  686  SSGNQQQLPAQ------GGYSNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQ  525
            +SG QQQ  +Q      G  SNG+ A GSQ++GDS+NTTIFVGGLD  V+DEDLRQ FSQ
Sbjct  276  ASGYQQQYSSQALVLAGGNASNGAVAQGSQANGDSTNTTIFVGGLDSEVTDEDLRQSFSQ  335

Query  524  YGEIVSVKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDF  345
            +GE+VSVKIPVGKGCGFVQFANR  AE+ALQ+L G VIGKQTVRLSWGRNPA +Q R+D 
Sbjct  336  FGEVVSVKIPVGKGCGFVQFANRNSAEDALQRLNGTVIGKQTVRLSWGRNPASKQWRNDS  395

Query  344  TNQW  333
             NQW
Sbjct  396  NNQW  399



>ref|XP_004230808.1| PREDICTED: polyadenylate-binding protein RBP47 [Solanum lycopersicum]
Length=413

 Score =   173 bits (439),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 89/135 (66%), Positives = 106/135 (79%), Gaps = 8/135 (6%)
 Frame = -1

Query  674  QQQLPAQ-----GGY-SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEI  513
            QQQ  +Q     GGY SNG+  HGSQSDGDSSNTTIFVGGLD +V+DE+LRQ F+Q+GE+
Sbjct  254  QQQFSSQAVILSGGYASNGAATHGSQSDGDSSNTTIFVGGLDSDVTDEELRQSFTQFGEV  313

Query  512  VSVKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQW  333
            VSVKIP GKGCGFVQF++R+ A+EA+QKL G VIGKQ VRLSWGR+P+++Q RSD  N  
Sbjct  314  VSVKIPAGKGCGFVQFSDRSSAQEAIQKLSGAVIGKQAVRLSWGRSPSNKQMRSDSGN--  371

Query  332  AGAYYGGHFYDGYTY  288
             G YYG   Y GY Y
Sbjct  372  GGGYYGRQNYGGYGY  386



>ref|XP_010926371.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Elaeis 
guineensis]
Length=791

 Score =   177 bits (450),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 86/133 (65%), Positives = 103/133 (77%), Gaps = 2/133 (2%)
 Frame = -1

Query  659  AQGGY-SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKG  483
              GG+ SN + A   QS+GD +NTT+FVGGLDPNVS+EDL+Q FSQYGE+ SVKIPVGK 
Sbjct  597  CSGGFGSNCASAQSFQSNGDPTNTTVFVGGLDPNVSEEDLKQAFSQYGELASVKIPVGKQ  656

Query  482  CGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFY  303
            CGFVQF +R +AEEALQ+L G  IGKQ VRLSWGRNP ++Q R+D  + W GAYYGG  Y
Sbjct  657  CGFVQFVHRNNAEEALQQLNGTAIGKQVVRLSWGRNPTNKQLRTDPGSHWNGAYYGGQVY  716

Query  302  DGYTYAFPAPHNP  264
            +GY Y  PA H+P
Sbjct  717  NGYGYVLPA-HDP  728



>ref|XP_008813036.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X1 
[Phoenix dactylifera]
Length=398

 Score =   173 bits (438),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 91/113 (81%), Gaps = 0/113 (0%)
 Frame = -1

Query  611  DGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRTDAEEALQ  432
            DGDS+NTT+FVGGLDPNVS++DLRQ FSQYGEI SVKIPVGK CGFVQF  R +A+EALQ
Sbjct  264  DGDSTNTTVFVGGLDPNVSEDDLRQAFSQYGEIASVKIPVGKQCGFVQFVQRNNAQEALQ  323

Query  431  KLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAP  273
             L G VIGKQ VRLSWGRNPA++Q R D  NQW   YYG  FY+GY YA P P
Sbjct  324  ALNGTVIGKQQVRLSWGRNPANKQLRGDHGNQWNNFYYGAPFYNGYGYAAPFP  376



>ref|XP_008782204.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X1 
[Phoenix dactylifera]
Length=409

 Score =   172 bits (437),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/132 (64%), Positives = 104/132 (79%), Gaps = 2/132 (2%)
 Frame = -1

Query  653  GGY-SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCG  477
            GG+ SNG+ A   QSDGD +NTT+FVGGLDPNVS++DL+Q FSQYGE+ SVKIPVGK CG
Sbjct  260  GGFGSNGASAQSFQSDGDPTNTTVFVGGLDPNVSEDDLKQAFSQYGEVASVKIPVGKQCG  319

Query  476  FVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDG  297
            FVQF +R +AEEALQ+L G VIGKQ VRLSWGRNP ++Q R+   + W G Y+GG  ++G
Sbjct  320  FVQFVHRNNAEEALQQLNGTVIGKQLVRLSWGRNPTNKQLRARPGSHWNGVYHGGQVHNG  379

Query  296  YTYAFPAPHNPN  261
            Y Y  PA H+P+
Sbjct  380  YGYVLPA-HDPS  390



>ref|XP_010525621.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Tarenaya 
hassleriana]
Length=434

 Score =   173 bits (438),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 111/154 (72%), Positives = 124/154 (81%), Gaps = 4/154 (3%)
 Frame = -1

Query  656  QGGYS-NGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGC  480
            QGGY+ NG+  H    DGDS NTTIFVGGLDPNV+DEDLRQPF+ YG+IVSVKIP GKGC
Sbjct  284  QGGYTLNGAQGH---PDGDSLNTTIFVGGLDPNVTDEDLRQPFADYGDIVSVKIPTGKGC  340

Query  479  GFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYD  300
            GFVQF NRT AEEAL KL G+VIGKQTVRLSWGR+PA++Q R +F NQW G YYGG +Y+
Sbjct  341  GFVQFVNRTSAEEALDKLNGVVIGKQTVRLSWGRSPANKQVRGEFGNQWVGPYYGGQYYN  400

Query  299  GYTYAFPAPHNPNmyapaaygaypmyGTHQQQVS  198
            GY Y  P PH+P MY  A YGAYPMYG  QQQVS
Sbjct  401  GYGYMIPPPHDPIMYTAAPYGAYPMYGGDQQQVS  434



>gb|KDP23018.1| hypothetical protein JCGZ_01681 [Jatropha curcas]
Length=429

 Score =   173 bits (438),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 88/127 (69%), Positives = 104/127 (82%), Gaps = 6/127 (5%)
 Frame = -1

Query  686  SSGNQQQLPAQ-----GGYS-NGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQ  525
            SS  QQQ  +Q     GG++ NG+ A GSQSDGDS+NTTIFVGG+D ++SDEDLRQPFSQ
Sbjct  271  SSAYQQQYSSQALVLAGGHAPNGAIAQGSQSDGDSNNTTIFVGGIDSDISDEDLRQPFSQ  330

Query  524  YGEIVSVKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDF  345
            +GE+VSVKIPVGKGCGFVQFANR +AE+ALQ L G  IGKQTVRLSWGR+PA++Q R D 
Sbjct  331  FGEVVSVKIPVGKGCGFVQFANRKNAEDALQSLNGTTIGKQTVRLSWGRSPANKQWRGDH  390

Query  344  TNQWAGA  324
             +QW GA
Sbjct  391  HSQWNGA  397



>ref|XP_009390905.1| PREDICTED: polyadenylate-binding protein RBP47-like [Musa acuminata 
subsp. malaccensis]
Length=403

 Score =   172 bits (435),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 102/126 (81%), Gaps = 3/126 (2%)
 Frame = -1

Query  641  NGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFA  462
            NG+ A GSQ+D DS+NTT+FVGGLDP+V+++DL++ FS+YGE+ SVKIPVGK CGFV F 
Sbjct  260  NGASAAGSQTDMDSANTTVFVGGLDPDVNEDDLKEAFSRYGEVASVKIPVGKQCGFVLFV  319

Query  461  NRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAF  282
            +R +AEEA+Q+L G +IGKQTVRLSWGRNPA +QSR++   +W GAYYGG  YDGY+   
Sbjct  320  HRNNAEEAMQQLNGTIIGKQTVRLSWGRNPAKKQSRAERGKRWNGAYYGGQVYDGYSL--  377

Query  281  PAPHNP  264
              PH P
Sbjct  378  -PPHYP  382



>ref|NP_001275480.1| DNA binding protein ACBF-like [Solanum tuberosum]
 gb|ABB86267.1| DNA binding protein ACBF-like [Solanum tuberosum]
Length=372

 Score =   170 bits (431),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 102/126 (81%), Gaps = 8/126 (6%)
 Frame = -1

Query  674  QQQLPAQ-----GGY-SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEI  513
            QQQ  +Q     GGY SNGS  HGSQSDGDSSNTTIFVGGLD +V+DE+LRQ F+Q+GE+
Sbjct  211  QQQFSSQAVILSGGYASNGSATHGSQSDGDSSNTTIFVGGLDSDVTDEELRQSFTQFGEV  270

Query  512  VSVKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQW  333
            VSVKIP GKGCGFVQF++R+ A+EA+QKL G +IGKQ VRLSWGR+PA++Q R+D  N  
Sbjct  271  VSVKIPAGKGCGFVQFSDRSSAQEAIQKLSGAIIGKQAVRLSWGRSPANKQMRTDSGN--  328

Query  332  AGAYYG  315
             G YYG
Sbjct  329  GGGYYG  334



>gb|ABR25764.1| nucleic acid binding protein [Oryza sativa Indica Group]
Length=151

 Score =   164 bits (414),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 79/125 (63%), Positives = 99/125 (79%), Gaps = 4/125 (3%)
 Frame = -1

Query  635  SPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANR  456
            +P H   SDGDS+N T++VGGLDPNVS+++LR+ F++YG++ SVKIP+GK CGFVQF +R
Sbjct  12   TPGH---SDGDSTNRTVYVGGLDPNVSEDELRKAFAKYGDVASVKIPLGKQCGFVQFVSR  68

Query  455  TDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPA  276
            TDAEEALQ L G VIGKQ VRLSWGR+P+H+QSR+D  ++    YYG  FY GY YA P 
Sbjct  69   TDAEEALQGLNGSVIGKQAVRLSWGRSPSHKQSRADSGSRRNNMYYGTPFYGGYGYASPV  128

Query  275  PHNPN  261
            PH PN
Sbjct  129  PH-PN  132



>ref|XP_010907889.1| PREDICTED: polyadenylate-binding protein RBP47 [Elaeis guineensis]
Length=402

 Score =   171 bits (432),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 91/113 (81%), Gaps = 0/113 (0%)
 Frame = -1

Query  611  DGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRTDAEEALQ  432
            DGDS+NTT+FVGGLDPNVS++DLRQ FS +G+I SVKIPVGK CGFVQF  R +AEEALQ
Sbjct  268  DGDSTNTTVFVGGLDPNVSEDDLRQAFSPFGDIASVKIPVGKQCGFVQFVQRNNAEEALQ  327

Query  431  KLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAP  273
             L G VIGKQ VRLSWGRNPA++Q R D  NQW G YYG  FY+GY YA P P
Sbjct  328  ALNGAVIGKQQVRLSWGRNPANKQLRGDHGNQWNGFYYGAPFYNGYGYAAPFP  380



>ref|XP_002313840.2| RNA-binding protein 47 [Populus trichocarpa]
 gb|EEE87795.2| RNA-binding protein 47 [Populus trichocarpa]
Length=435

 Score =   171 bits (433),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 96/117 (82%), Gaps = 1/117 (1%)
 Frame = -1

Query  671  QQLPAQGGY-SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIP  495
            Q L   GG+ SNG+ A GSQSDGDS+NTTIFVGG+D +V+DEDLRQPFSQ+GE+VSVK+P
Sbjct  287  QALVLAGGHASNGTMAQGSQSDGDSNNTTIFVGGIDSDVTDEDLRQPFSQFGEVVSVKMP  346

Query  494  VGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGA  324
             GKGC FVQFANR +AE+ALQ L G  IGKQTVRLSWGR PA++Q R D  NQW GA
Sbjct  347  TGKGCAFVQFANRKNAEDALQSLNGTTIGKQTVRLSWGRTPANKQWRGDHGNQWHGA  403



>ref|XP_010540323.1| PREDICTED: polyadenylate-binding protein RBP47B [Tarenaya hassleriana]
Length=410

 Score =   170 bits (431),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 90/149 (60%), Positives = 113/149 (76%), Gaps = 12/149 (8%)
 Frame = -1

Query  686  SSGNQQQLPAQ-----GGY-SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQ  525
            ++ +QQQ  +Q     GG+ +NGS  HGSQ DG++ N+TIFVGGLD  V+DEDLRQPFSQ
Sbjct  256  AASHQQQYSSQAVILAGGHGANGSIPHGSQFDGETINSTIFVGGLDAEVTDEDLRQPFSQ  315

Query  524  YGEIVSVKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDF  345
            +GE+VSVKIP+GKGCGF+Q +NR +AEEA+QKL G VIGK TVRLSWGRNP ++Q RSD 
Sbjct  316  FGEVVSVKIPLGKGCGFIQLSNRKNAEEAIQKLNGTVIGKNTVRLSWGRNPGNKQWRSDT  375

Query  344  TNQWAGAYYGGHFY---DGYT---YAFPA  276
            ++QW G Y  G  +   +GYT   YA PA
Sbjct  376  SHQWNGGYARGQGFNNGNGYTNQDYASPA  404



>ref|NP_001275430.1| DNA-binding protein-like [Solanum tuberosum]
 gb|ABB86246.1| DNA-binding protein-like [Solanum tuberosum]
Length=423

 Score =   171 bits (432),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 82/129 (64%), Positives = 101/129 (78%), Gaps = 1/129 (1%)
 Frame = -1

Query  671  QQLPAQGGY-SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIP  495
            QQ  +QGG+ SNG+    SQ+D D SNTT+FVGGLD +V+DE+LRQ FSQ+G +VSVKIP
Sbjct  264  QQYSSQGGHASNGAATQTSQTDSDLSNTTVFVGGLDSDVTDEELRQSFSQFGNVVSVKIP  323

Query  494  VGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYG  315
             GKGCGFVQF+ R+ AE+A++KL G VIG QTVRLSWGRNPA++Q R+D  +QW G YYG
Sbjct  324  AGKGCGFVQFSERSAAEDAIEKLNGTVIGTQTVRLSWGRNPANKQFRTDSGSQWNGGYYG  383

Query  314  GHFYDGYTY  288
               Y GY Y
Sbjct  384  RQNYGGYGY  392



>ref|XP_009404023.1| PREDICTED: polyadenylate-binding protein RBP47-like [Musa acuminata 
subsp. malaccensis]
Length=403

 Score =   170 bits (431),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 102/126 (81%), Gaps = 4/126 (3%)
 Frame = -1

Query  641  NGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFA  462
            +G+ A GSQSD DS+NTT+FVGGLDP VS++DL++ FSQYGEI SVKIPVGK CGFV FA
Sbjct  262  DGASATGSQSDIDSANTTVFVGGLDPEVSEDDLKEAFSQYGEITSVKIPVGKQCGFVLFA  321

Query  461  NRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAF  282
            +R +AEEALQ+L G +IGKQTVRLSWGRNPA RQSR++ + +W G Y+GG  YDG  Y  
Sbjct  322  HRNNAEEALQQLNGTIIGKQTVRLSWGRNPA-RQSRAERSKRWNGVYFGGQAYDG--YGL  378

Query  281  PAPHNP  264
            P PH P
Sbjct  379  P-PHYP  383



>ref|XP_011000065.1| PREDICTED: polyadenylate-binding protein RBP47 [Populus euphratica]
Length=436

 Score =   171 bits (432),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 96/117 (82%), Gaps = 1/117 (1%)
 Frame = -1

Query  671  QQLPAQGGY-SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIP  495
            Q L   GG+ SNG+ A GSQSDGDS+NTTIFVGG+D +V+DEDLRQPFSQ+GE+VSVK+P
Sbjct  288  QALVLAGGHASNGAMAQGSQSDGDSNNTTIFVGGIDSDVTDEDLRQPFSQFGEVVSVKMP  347

Query  494  VGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGA  324
             GKGC FVQFANR +AE+ALQ L G  IGKQTVRLSWGR PA++Q R D  NQW GA
Sbjct  348  TGKGCAFVQFANRKNAEDALQSLNGTTIGKQTVRLSWGRTPANKQWRGDHGNQWHGA  404



>gb|KFK36144.1| hypothetical protein AALP_AA4G083000 [Arabis alpina]
Length=426

 Score =   170 bits (430),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 110/154 (71%), Positives = 122/154 (79%), Gaps = 4/154 (3%)
 Frame = -1

Query  656  QGGYS-NGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGC  480
            QGGY  NG+ A   + +GDS NTTIFVGGLD  VSDEDLRQPF+ YGEIVSVKIPVGKGC
Sbjct  276  QGGYMPNGALA---RPEGDSLNTTIFVGGLDSTVSDEDLRQPFANYGEIVSVKIPVGKGC  332

Query  479  GFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYD  300
            GFVQF +R DAEEAL+KL G VIGKQTVRLSWGRNP ++Q R  + NQWAG YYGG +Y+
Sbjct  333  GFVQFVSRPDAEEALEKLNGTVIGKQTVRLSWGRNPGNKQPRDKYGNQWAGPYYGGQYYN  392

Query  299  GYTYAFPAPHNPNmyapaaygaypmyGTHQQQVS  198
            GY Y  P PH+P MYA A YG Y MYG HQQQVS
Sbjct  393  GYGYMVPQPHDPRMYAAAPYGGYQMYGGHQQQVS  426



>gb|AAC49850.1| DNA binding protein ACBF [Nicotiana tabacum]
Length=428

 Score =   170 bits (430),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 86/135 (64%), Positives = 105/135 (78%), Gaps = 7/135 (5%)
 Frame = -1

Query  674  QQQLPAQ-----GGY-SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEI  513
            QQQ  +Q     GGY SNG+  HGSQSDGD+SNTTIFVGGLD +V+DE+LRQ F+Q+GE+
Sbjct  262  QQQYSSQAVILSGGYASNGAATHGSQSDGDASNTTIFVGGLDSDVTDEELRQSFNQFGEV  321

Query  512  VSVKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQW  333
            VSVKIP GKGCGFVQF++R+ A+EA+QKL G +IGKQ VRLSWGR  A++Q R+D  +QW
Sbjct  322  VSVKIPAGKGCGFVQFSDRSSAQEAIQKLSGAIIGKQAVRLSWGR-TANKQMRADSGSQW  380

Query  332  AGAYYGGHFYDGYTY  288
             G Y G   Y GY Y
Sbjct  381  NGGYNGRQNYGGYGY  395



>ref|XP_006384437.1| hypothetical protein POPTR_0004s15080g [Populus trichocarpa]
 gb|ERP62234.1| hypothetical protein POPTR_0004s15080g [Populus trichocarpa]
Length=435

 Score =   170 bits (430),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 95/114 (83%), Gaps = 1/114 (1%)
 Frame = -1

Query  671  QQLPAQGGY-SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIP  495
            Q L   GG+ SNG+ A GSQSDGDS+NTTIFVGG+D +V+DEDLRQPFSQ+GE+VSVKIP
Sbjct  287  QALVLAGGHASNGAMAQGSQSDGDSNNTTIFVGGIDSDVTDEDLRQPFSQFGEVVSVKIP  346

Query  494  VGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQW  333
            VGKGC FVQFANR +AE+ALQ L G  IGKQTVRLSWGR PA++Q R D  NQW
Sbjct  347  VGKGCAFVQFANRKNAEDALQSLNGTTIGKQTVRLSWGRTPANKQWRGDHGNQW  400



>ref|XP_002518798.1| nuclear acid binding protein, putative [Ricinus communis]
 gb|EEF43723.1| nuclear acid binding protein, putative [Ricinus communis]
Length=438

 Score =   169 bits (429),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 95/114 (83%), Gaps = 1/114 (1%)
 Frame = -1

Query  671  QQLPAQGGYS-NGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIP  495
            Q L   GG++ NGS A GSQSDGDS+NTTIFVGG+D ++SDEDLRQPFSQ+GE+VSVKIP
Sbjct  290  QALVLAGGHAPNGSMAQGSQSDGDSNNTTIFVGGIDSDISDEDLRQPFSQFGEVVSVKIP  349

Query  494  VGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQW  333
             GKGCGFVQFA+R  AE+ALQ L G  IGKQTVRLSWGR+PA++Q R D  NQW
Sbjct  350  AGKGCGFVQFADRKSAEDALQSLNGTTIGKQTVRLSWGRSPANKQWRGDHNNQW  403



>ref|XP_011088289.1| PREDICTED: polyadenylate-binding protein RBP47 [Sesamum indicum]
Length=423

 Score =   169 bits (428),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 88/140 (63%), Positives = 106/140 (76%), Gaps = 6/140 (4%)
 Frame = -1

Query  674  QQQLPAQ-----GGYSNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIV  510
            QQQ  +Q     GGY NG    G QS+ DSSNTTIFVGGLD +V+DE+LRQ FS +G++V
Sbjct  270  QQQYSSQAVVLAGGYPNGIVPQG-QSENDSSNTTIFVGGLDSDVTDEELRQSFSPFGDVV  328

Query  509  SVKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWA  330
            SVKIP GKGCGFVQFANR++AE+A+Q+L G VIGKQTVRLSWGRN  ++QSR D  +QW 
Sbjct  329  SVKIPAGKGCGFVQFANRSNAEDAIQRLNGTVIGKQTVRLSWGRNMGNKQSRVDPNSQWN  388

Query  329  GAYYGGHFYDGYTYAFPAPH  270
            GAYYG   Y+GY Y   A +
Sbjct  389  GAYYGRQGYNGYGYGAVAAY  408


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 58/128 (45%), Gaps = 15/128 (12%)
 Frame = -1

Query  617  QSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGC------GFVQFANR  456
            QS G+  N TI++G L   + +  L+  FSQ GE+VSVKI   K        GF++F + 
Sbjct  85   QSSGED-NKTIWIGDLQQWMDEGYLQSCFSQTGEVVSVKIIRNKQTGQSERYGFIEFNSH  143

Query  455  TDAEEALQKLKGLVI--GKQTVRLSWG------RNPAHRQSRSDFTNQWAGAYYGGHFYD  300
              AE+ LQ   G V+   +Q  RL+W       R P      S F    A        +D
Sbjct  144  LAAEKVLQSYNGTVMPNTEQPFRLNWAAFSSGDRRPEAGSDLSIFVGDLATDVTDTLLHD  203

Query  299  GYTYAFPA  276
             +   FP+
Sbjct  204  TFASRFPS  211



>ref|XP_006406535.1| hypothetical protein EUTSA_v10020763mg [Eutrema salsugineum]
 gb|ESQ47988.1| hypothetical protein EUTSA_v10020763mg [Eutrema salsugineum]
Length=436

 Score =   169 bits (429),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 89/137 (65%), Positives = 107/137 (78%), Gaps = 7/137 (5%)
 Frame = -1

Query  677  NQQQLPAQ-----GGY-SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGE  516
            NQQQ  +Q     GG+ +NGS AHGSQ+DG+S+N+TIFVGGLDP+V+DEDLRQPFSQ+GE
Sbjct  289  NQQQHSSQALILAGGHGANGSMAHGSQTDGESNNSTIFVGGLDPDVTDEDLRQPFSQFGE  348

Query  515  IVSVKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQ  336
            +VSVKIPVGKGCGFVQFANR  A++A+Q L G VIGK TVRLSWGR+P ++Q R D   Q
Sbjct  349  VVSVKIPVGKGCGFVQFANRKSADDAIQSLNGTVIGKNTVRLSWGRSP-NKQWRGDSGQQ  407

Query  335  WAGAYYGGHFYDGYTYA  285
            W G Y  G  Y+   YA
Sbjct  408  WNGGYSRGQGYNNGGYA  424



>ref|XP_010327390.1| PREDICTED: DNA-binding protein isoform X2 [Solanum lycopersicum]
Length=423

 Score =   169 bits (427),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 82/129 (64%), Positives = 100/129 (78%), Gaps = 1/129 (1%)
 Frame = -1

Query  671  QQLPAQGGY-SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIP  495
            QQ  +QGG+ SNG+    SQ+D D SNTT+FVGGLD  V+DE+LRQ FSQ+G +VSVKIP
Sbjct  264  QQYFSQGGHASNGAATQTSQTDSDLSNTTVFVGGLDSEVTDEELRQSFSQFGNVVSVKIP  323

Query  494  VGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYG  315
             GKGCGFVQF+ R+ AE+A++KL G VIG QTVRLSWGRNPA++Q R+D  +QW G YYG
Sbjct  324  AGKGCGFVQFSERSAAEDAIEKLNGTVIGAQTVRLSWGRNPANKQFRTDSGSQWNGGYYG  383

Query  314  GHFYDGYTY  288
               Y GY Y
Sbjct  384  RQNYGGYGY  392



>ref|XP_006423626.1| hypothetical protein CICLE_v10030115mg, partial [Citrus clementina]
 gb|ESR36866.1| hypothetical protein CICLE_v10030115mg, partial [Citrus clementina]
Length=191

 Score =   162 bits (410),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 88/146 (60%), Positives = 104/146 (71%), Gaps = 8/146 (5%)
 Frame = -1

Query  686  SSGNQQQLPAQGGYSNGSPA-HGSQ---SDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYG  519
            +SG QQQ  +Q     G PA +G++   SDG+S+N TIFVG LD NVSD+DLR+ FS +G
Sbjct  39   ASGYQQQYSSQALVLAGGPASNGARVQGSDGESNNATIFVGALDSNVSDKDLRELFSHFG  98

Query  518  EIVSVKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTN  339
            EI+SVKIPVGKGCGFVQFANR DAE    KL+G  IGKQTVRLSWG NP ++Q R D  N
Sbjct  99   EILSVKIPVGKGCGFVQFANRKDAE----KLQGTAIGKQTVRLSWGHNPRNKQWRGDHIN  154

Query  338  QWAGAYYGGHFYDGYTYAFPAPHNPN  261
             W  A+YGG  Y G  YAFP   +PN
Sbjct  155  HWNRAHYGGQGYSGNGYAFPPNQDPN  180



>ref|XP_011004995.1| PREDICTED: polyadenylate-binding protein RBP47-like [Populus 
euphratica]
Length=434

 Score =   169 bits (427),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 95/114 (83%), Gaps = 1/114 (1%)
 Frame = -1

Query  671  QQLPAQGGY-SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIP  495
            Q L   GG+ SNG+ A GSQS+GDS+NTTIFVGG+D +V+DEDLRQPFSQ+GE+VSVKIP
Sbjct  286  QALVLAGGHASNGAMAQGSQSNGDSNNTTIFVGGIDSDVTDEDLRQPFSQFGEVVSVKIP  345

Query  494  VGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQW  333
            VGKGC FVQFANR +AE+ALQ L G  IGKQTVRLSWGR PA++Q R D  NQW
Sbjct  346  VGKGCAFVQFANRKNAEDALQSLNGTTIGKQTVRLSWGRTPANKQGRGDHGNQW  399



>ref|XP_006349627.1| PREDICTED: polyadenylate-binding protein RBP47 isoform X1 [Solanum 
tuberosum]
Length=428

 Score =   167 bits (424),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 80/130 (62%), Positives = 99/130 (76%), Gaps = 0/130 (0%)
 Frame = -1

Query  677  NQQQLPAQGGYSNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKI  498
            +Q  + A G  SNG+    SQ+D D SNTT+FVGGLD +V+DE+LRQ FSQ+G +VSVKI
Sbjct  268  SQAVILAGGHASNGAATQTSQTDSDLSNTTVFVGGLDSDVTDEELRQSFSQFGNVVSVKI  327

Query  497  PVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYY  318
            P GKGCGFVQF+ R+ AE+A++KL G VIG QTVRLSWGRNPA++Q R+D  +QW G YY
Sbjct  328  PAGKGCGFVQFSERSAAEDAIEKLNGTVIGTQTVRLSWGRNPANKQFRTDSGSQWNGGYY  387

Query  317  GGHFYDGYTY  288
            G   Y GY Y
Sbjct  388  GRQNYGGYGY  397



>ref|XP_006349628.1| PREDICTED: polyadenylate-binding protein RBP47 isoform X2 [Solanum 
tuberosum]
Length=424

 Score =   167 bits (424),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 81/130 (62%), Positives = 99/130 (76%), Gaps = 2/130 (2%)
 Frame = -1

Query  671  QQLPAQGG--YSNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKI  498
            QQ  +Q G   SNG+    SQ+D D SNTT+FVGGLD +V+DE+LRQ FSQ+G +VSVKI
Sbjct  264  QQYSSQAGGHASNGAATQTSQTDSDLSNTTVFVGGLDSDVTDEELRQSFSQFGNVVSVKI  323

Query  497  PVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYY  318
            P GKGCGFVQF+ R+ AE+A++KL G VIG QTVRLSWGRNPA++Q R+D  +QW G YY
Sbjct  324  PAGKGCGFVQFSERSAAEDAIEKLNGTVIGTQTVRLSWGRNPANKQFRTDSGSQWNGGYY  383

Query  317  GGHFYDGYTY  288
            G   Y GY Y
Sbjct  384  GRQNYGGYGY  393



>ref|XP_011461514.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X2 
[Fragaria vesca subsp. vesca]
Length=448

 Score =   167 bits (424),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 82/119 (69%), Positives = 97/119 (82%), Gaps = 1/119 (1%)
 Frame = -1

Query  686  SSGNQQQLPAQGG-YSNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIV  510
            SSG QQQ  +QGG ++NG  A GSQSDG+ +NTTIFVGGLD +V++EDLRQPFSQ+GE++
Sbjct  294  SSGYQQQYSSQGGGHANGGVAQGSQSDGEPNNTTIFVGGLDSDVNEEDLRQPFSQFGEVI  353

Query  509  SVKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQW  333
            SVKIPVGK CGFVQFANR DAE A+  L   VIGKQTVRLSWGR+  ++Q RSD  NQW
Sbjct  354  SVKIPVGKACGFVQFANRKDAENAMNMLNATVIGKQTVRLSWGRSQGNKQWRSDSNNQW  412



>gb|EEE69858.1| hypothetical protein OsJ_29658 [Oryza sativa Japonica Group]
Length=310

 Score =   164 bits (415),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 84/135 (62%), Positives = 99/135 (73%), Gaps = 2/135 (1%)
 Frame = -1

Query  662  PAQGGYSNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKG  483
            P +   ++G     ++SDGD +NTT+FVGGLDPNVS++DLRQ FSQYGEI SVKIPVGK 
Sbjct  156  PRKTSGTSGPTGSAARSDGDLTNTTVFVGGLDPNVSEDDLRQTFSQYGEISSVKIPVGKQ  215

Query  482  CGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQW-AGAYYGGH-  309
            CGFVQF  R +AE+ALQ L G  IGKQTVRLSWGRNPA++Q RSD  +QW  G YY    
Sbjct  216  CGFVQFVQRKNAEDALQGLNGSTIGKQTVRLSWGRNPANKQLRSDNGSQWNNGMYYAASP  275

Query  308  FYDGYTYAFPAPHNP  264
            FY GY Y  P P +P
Sbjct  276  FYSGYGYPAPFPADP  290



>ref|XP_009628458.1| PREDICTED: polyadenylate-binding protein RBP47-like [Nicotiana 
tomentosiformis]
Length=418

 Score =   167 bits (422),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 99/129 (77%), Gaps = 0/129 (0%)
 Frame = -1

Query  674  QQQLPAQGGYSNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIP  495
            Q  + A G  SNG+    S SD D SNTT+FVGGLD +V+D++LRQ F+Q+G +VSVKIP
Sbjct  257  QAVILAGGHASNGAATQTSHSDSDLSNTTVFVGGLDSDVTDDELRQSFNQFGNVVSVKIP  316

Query  494  VGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYG  315
             GKGCGFVQF++R+ AE+A+QKL G VIGKQTVRLSWGRNPA++Q R+D  +QW G YYG
Sbjct  317  AGKGCGFVQFSDRSAAEDAIQKLNGAVIGKQTVRLSWGRNPANKQLRTDSGSQWNGGYYG  376

Query  314  GHFYDGYTY  288
               Y GY Y
Sbjct  377  RQNYGGYGY  385



>ref|XP_010327389.1| PREDICTED: DNA-binding protein isoform X1 [Solanum lycopersicum]
Length=424

 Score =   167 bits (422),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 81/130 (62%), Positives = 98/130 (75%), Gaps = 1/130 (1%)
 Frame = -1

Query  674  QQQLPAQGGY-SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKI  498
            QQ     GG+ SNG+    SQ+D D SNTT+FVGGLD  V+DE+LRQ FSQ+G +VSVKI
Sbjct  264  QQYFSQAGGHASNGAATQTSQTDSDLSNTTVFVGGLDSEVTDEELRQSFSQFGNVVSVKI  323

Query  497  PVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYY  318
            P GKGCGFVQF+ R+ AE+A++KL G VIG QTVRLSWGRNPA++Q R+D  +QW G YY
Sbjct  324  PAGKGCGFVQFSERSAAEDAIEKLNGTVIGAQTVRLSWGRNPANKQFRTDSGSQWNGGYY  383

Query  317  GGHFYDGYTY  288
            G   Y GY Y
Sbjct  384  GRQNYGGYGY  393



>ref|XP_010539063.1| PREDICTED: polyadenylate-binding protein RBP47C-like isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010539064.1| PREDICTED: polyadenylate-binding protein RBP47C-like isoform 
X2 [Tarenaya hassleriana]
Length=426

 Score =   167 bits (422),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 91/132 (69%), Positives = 108/132 (82%), Gaps = 4/132 (3%)
 Frame = -1

Query  656  QGGY-SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGC  480
             GGY SNG+     + +GDS NTTIFVGGLDP+V+DEDLRQPF++YG+I+SVKIP GKGC
Sbjct  275  HGGYMSNGAQC---RPEGDSLNTTIFVGGLDPSVTDEDLRQPFAEYGDIISVKIPSGKGC  331

Query  479  GFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYD  300
            GFVQF NRT AEEAL+KL G VIG+QTVRLSWGRNPA++Q R +F NQW G YYGG +Y+
Sbjct  332  GFVQFVNRTSAEEALEKLNGSVIGQQTVRLSWGRNPANKQHRGEFRNQWVGPYYGGEYYN  391

Query  299  GYTYAFPAPHNP  264
            GY Y  P PH+P
Sbjct  392  GYGYMIPPPHDP  403



>gb|KFK39248.1| hypothetical protein AALP_AA3G219800 [Arabis alpina]
Length=436

 Score =   167 bits (422),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 100/130 (77%), Gaps = 1/130 (1%)
 Frame = -1

Query  671  QQLPAQGGY-SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIP  495
            Q L   GG+ +NGS A+ SQSDG+S+N TIFVGGLDP+V+DEDLRQPFSQ+G++VSVKIP
Sbjct  294  QALILAGGHGANGSMAYSSQSDGESNNATIFVGGLDPDVTDEDLRQPFSQFGDVVSVKIP  353

Query  494  VGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYG  315
            VGKGCGFVQFANR  AE+A+Q L G VIGK TVRLSWGR+P  +Q R D   QW G Y  
Sbjct  354  VGKGCGFVQFANRNGAEDAIQNLNGTVIGKNTVRLSWGRSPNKQQWRGDSGQQWNGGYSR  413

Query  314  GHFYDGYTYA  285
            G  Y+   YA
Sbjct  414  GQGYNNGGYA  423



>gb|KHN31058.1| Polyadenylate-binding protein RBP47 [Glycine soja]
Length=266

 Score =   162 bits (411),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 82/131 (63%), Positives = 99/131 (76%), Gaps = 4/131 (3%)
 Frame = -1

Query  677  NQQQLPAQGGYSNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKI  498
            +Q  L A G  +NG+ A GS S+GD +NTTIFVGGLD + SDEDLRQPF Q+GE+VSVKI
Sbjct  121  SQAVLLAGGHAANGAVAQGSHSEGDLNNTTIFVGGLDSDTSDEDLRQPFLQFGEVVSVKI  180

Query  497  PVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYY  318
            PVGKGCGFVQFA+R +AEEA+  L G VIGKQTVRLSWGR+P ++  RSD      G Y+
Sbjct  181  PVGKGCGFVQFADRKNAEEAIHALNGTVIGKQTVRLSWGRSPGNKHWRSDSN----GGYF  236

Query  317  GGHFYDGYTYA  285
            GG  Y G+ +A
Sbjct  237  GGQSYGGHGFA  247



>dbj|BAD33940.1| putative nucleic acid binding protein [Oryza sativa Japonica 
Group]
 dbj|BAD38554.1| putative nucleic acid binding protein [Oryza sativa Japonica 
Group]
Length=316

 Score =   164 bits (414),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 84/135 (62%), Positives = 99/135 (73%), Gaps = 2/135 (1%)
 Frame = -1

Query  662  PAQGGYSNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKG  483
            P +   ++G     ++SDGD +NTT+FVGGLDPNVS++DLRQ FSQYGEI SVKIPVGK 
Sbjct  162  PRKTSGTSGPTGSAARSDGDLTNTTVFVGGLDPNVSEDDLRQTFSQYGEISSVKIPVGKQ  221

Query  482  CGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQW-AGAYYGGH-  309
            CGFVQF  R +AE+ALQ L G  IGKQTVRLSWGRNPA++Q RSD  +QW  G YY    
Sbjct  222  CGFVQFVQRKNAEDALQGLNGSTIGKQTVRLSWGRNPANKQLRSDNGSQWNNGMYYAASP  281

Query  308  FYDGYTYAFPAPHNP  264
            FY GY Y  P P +P
Sbjct  282  FYSGYGYPAPFPADP  296



>ref|NP_001234487.1| DNA-binding protein [Solanum lycopersicum]
 gb|AAR91698.1| DNA-binding protein [Solanum lycopersicum]
Length=428

 Score =   166 bits (421),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 97/129 (75%), Gaps = 0/129 (0%)
 Frame = -1

Query  674  QQQLPAQGGYSNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIP  495
            Q  + A G  SNG+    SQ+D D SNTT+FVGGLD  V+DE+LRQ FSQ+G +VSVKIP
Sbjct  269  QAVILAGGHASNGAATQTSQTDSDLSNTTVFVGGLDSEVTDEELRQSFSQFGNVVSVKIP  328

Query  494  VGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYG  315
             GKGCGFVQF+ R+ AE+A++KL G VIG QTVRLSWGRNPA++Q R+D  +QW G YYG
Sbjct  329  AGKGCGFVQFSERSAAEDAIEKLNGTVIGAQTVRLSWGRNPANKQFRTDSGSQWNGGYYG  388

Query  314  GHFYDGYTY  288
               Y GY Y
Sbjct  389  RQNYGGYGY  397



>ref|XP_009783555.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X1 
[Nicotiana sylvestris]
Length=437

 Score =   166 bits (420),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 99/129 (77%), Gaps = 0/129 (0%)
 Frame = -1

Query  674  QQQLPAQGGYSNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIP  495
            Q  + A G  SNG+    S SD D SNTT+FVGGLD +V+D++LRQ F+Q G +VSVKIP
Sbjct  277  QAVILAGGHASNGAATQTSHSDSDLSNTTVFVGGLDSDVTDDELRQSFNQCGNVVSVKIP  336

Query  494  VGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYG  315
             GKGCGFVQF++R++AE+A+QKL G VIGKQTVRLSWGRNPA++Q R+D  +QW G YYG
Sbjct  337  AGKGCGFVQFSDRSEAEDAIQKLNGAVIGKQTVRLSWGRNPANKQLRTDSGSQWNGGYYG  396

Query  314  GHFYDGYTY  288
               Y GY Y
Sbjct  397  RQNYGGYGY  405



>ref|XP_002446570.1| hypothetical protein SORBIDRAFT_06g018280 [Sorghum bicolor]
 gb|EES10898.1| hypothetical protein SORBIDRAFT_06g018280 [Sorghum bicolor]
Length=423

 Score =   166 bits (419),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 81/125 (65%), Positives = 99/125 (79%), Gaps = 4/125 (3%)
 Frame = -1

Query  635  SPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANR  456
            +P H   SDGDSSN T++VGGLDPNVS+++LR+ F++YG++ SVKIP+GK CGFVQFA+R
Sbjct  284  TPGH---SDGDSSNRTVYVGGLDPNVSEDELRKAFAKYGDLASVKIPLGKQCGFVQFASR  340

Query  455  TDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPA  276
            TDAEEALQ L G +IGKQ VRLSWGR+P+H+QSR D  N+    YYG  FY GY YA P 
Sbjct  341  TDAEEALQGLNGSLIGKQAVRLSWGRSPSHKQSRGDSGNRRNNMYYGTPFYGGYGYASPV  400

Query  275  PHNPN  261
            PH PN
Sbjct  401  PH-PN  404



>ref|XP_006307520.1| hypothetical protein CARUB_v10009143mg [Capsella rubella]
 gb|EOA40418.1| hypothetical protein CARUB_v10009143mg [Capsella rubella]
Length=443

 Score =   165 bits (418),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 103/153 (67%), Positives = 120/153 (78%), Gaps = 2/153 (1%)
 Frame = -1

Query  656  QGGYSNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCG  477
            QGGY    P   ++ +GD+ NTTIFVGGLD +V+DEDLRQPF++YGEIVSVKIPVGKGCG
Sbjct  293  QGGYMPNGPM--ARPEGDTLNTTIFVGGLDSSVTDEDLRQPFAEYGEIVSVKIPVGKGCG  350

Query  476  FVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDG  297
            FVQF +R  AE+AL+KL G VIGKQTVRLSWGRNPA++Q R  + NQW   YYGG +Y+G
Sbjct  351  FVQFVSRPSAEDALEKLNGTVIGKQTVRLSWGRNPANKQPRDKYGNQWVVPYYGGQYYNG  410

Query  296  YTYAFPAPHNPNmyapaaygaypmyGTHQQQVS  198
            Y Y  P PH+P MY  A YG YPMYG HQQQVS
Sbjct  411  YGYMAPQPHDPRMYPAAPYGGYPMYGGHQQQVS  443



>dbj|BAG87507.1| unnamed protein product [Oryza sativa Japonica Group]
Length=345

 Score =   163 bits (412),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 84/135 (62%), Positives = 99/135 (73%), Gaps = 2/135 (1%)
 Frame = -1

Query  662  PAQGGYSNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKG  483
            P +   ++G     ++SDGD +NTT+FVGGLDPNVS++DLRQ FSQYGEI SVKIPVGK 
Sbjct  191  PRKTSGTSGPTGSAARSDGDLTNTTVFVGGLDPNVSEDDLRQTFSQYGEISSVKIPVGKQ  250

Query  482  CGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQW-AGAYYGGH-  309
            CGFVQF  R +AE+ALQ L G  IGKQTVRLSWGRNPA++Q RSD  +QW  G YY    
Sbjct  251  CGFVQFVQRKNAEDALQGLNGSTIGKQTVRLSWGRNPANKQLRSDNGSQWNNGMYYAASP  310

Query  308  FYDGYTYAFPAPHNP  264
            FY GY Y  P P +P
Sbjct  311  FYSGYGYPAPFPADP  325



>ref|XP_008236618.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X2 
[Prunus mume]
Length=446

 Score =   165 bits (418),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 95/117 (81%), Gaps = 3/117 (3%)
 Frame = -1

Query  674  QQQLPAQGG---YSNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSV  504
            QQQ  +Q G    SNG+ A GSQ D +++NTTIFVGGLD +V+DEDLRQPFSQ+GE+VSV
Sbjct  295  QQQYSSQAGGGHASNGAVAQGSQFDSETNNTTIFVGGLDSDVNDEDLRQPFSQFGEVVSV  354

Query  503  KIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQW  333
            KIPVGK CGFVQFANR DAE A+Q L G VIGKQTVRLSWGR+  ++Q RSD +NQW
Sbjct  355  KIPVGKACGFVQFANRKDAENAMQMLNGTVIGKQTVRLSWGRSQGNKQWRSDSSNQW  411



>gb|EMT27298.1| Putative RNA-binding protein [Aegilops tauschii]
Length=302

 Score =   162 bits (409),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/120 (64%), Positives = 93/120 (78%), Gaps = 1/120 (1%)
 Frame = -1

Query  620  SQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRTDAEE  441
            +QSDGDS+N T++VGGLDPN+S+++LR+ F +YG++ SVKIPVGK CGFVQF NR DAEE
Sbjct  165  TQSDGDSTNRTVYVGGLDPNISEDELRKAFVKYGDVASVKIPVGKQCGFVQFVNRADAEE  224

Query  440  ALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPN  261
            ALQ L G  IGKQ VRLSWGR+PA +QSR D  ++  G YYG  FY GY Y  P PH PN
Sbjct  225  ALQGLSGSTIGKQAVRLSWGRSPASKQSRGDSGHRRNGMYYGTPFYGGYGYGSPVPH-PN  283



>gb|EEE61093.1| hypothetical protein OsJ_14988 [Oryza sativa Japonica Group]
Length=373

 Score =   163 bits (413),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 79/125 (63%), Positives = 99/125 (79%), Gaps = 4/125 (3%)
 Frame = -1

Query  635  SPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANR  456
            +P H   SDGDS+N T++VGGLDPNVS+++LR+ F++YG++ SVKIP+GK CGFVQF +R
Sbjct  234  TPGH---SDGDSTNRTVYVGGLDPNVSEDELRKAFAKYGDVASVKIPLGKQCGFVQFVSR  290

Query  455  TDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPA  276
            TDAEEALQ L G VIGKQ VRLSWGR+P+H+QSR+D  ++    YYG  FY GY YA P 
Sbjct  291  TDAEEALQGLNGSVIGKQAVRLSWGRSPSHKQSRADSGSRRNNMYYGTPFYGGYGYASPV  350

Query  275  PHNPN  261
            PH PN
Sbjct  351  PH-PN  354



>ref|XP_006660711.1| PREDICTED: polyadenylate-binding protein RBP47-like [Oryza brachyantha]
Length=344

 Score =   162 bits (411),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 84/135 (62%), Positives = 99/135 (73%), Gaps = 2/135 (1%)
 Frame = -1

Query  662  PAQGGYSNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKG  483
            P +   ++G     ++SDGD +NTT+FVGGLDPNVS++DLRQ FSQYGEI SVKIPVGK 
Sbjct  189  PRKTSGTSGPTGSSARSDGDLTNTTVFVGGLDPNVSEDDLRQTFSQYGEISSVKIPVGKQ  248

Query  482  CGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQW-AGAYYGGH-  309
            CGFVQF  R +AE+ALQ L G  IGKQTVRLSWGRNPA++Q RSD  +QW  G YY    
Sbjct  249  CGFVQFIQRKNAEDALQGLNGSTIGKQTVRLSWGRNPANKQLRSDNGSQWNNGMYYAASP  308

Query  308  FYDGYTYAFPAPHNP  264
            FY GY Y  P P +P
Sbjct  309  FYSGYGYPAPFPADP  323



>ref|NP_001052934.2| Os04g0449900 [Oryza sativa Japonica Group]
 dbj|BAF14848.2| Os04g0449900 [Oryza sativa Japonica Group]
Length=387

 Score =   163 bits (412),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 79/125 (63%), Positives = 99/125 (79%), Gaps = 4/125 (3%)
 Frame = -1

Query  635  SPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANR  456
            +P H   SDGDS+N T++VGGLDPNVS+++LR+ F++YG++ SVKIP+GK CGFVQF +R
Sbjct  248  TPGH---SDGDSTNRTVYVGGLDPNVSEDELRKAFAKYGDVASVKIPLGKQCGFVQFVSR  304

Query  455  TDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPA  276
            TDAEEALQ L G VIGKQ VRLSWGR+P+H+QSR+D  ++    YYG  FY GY YA P 
Sbjct  305  TDAEEALQGLNGSVIGKQAVRLSWGRSPSHKQSRADSGSRRNNMYYGTPFYGGYGYASPV  364

Query  275  PHNPN  261
            PH PN
Sbjct  365  PH-PN  368



>gb|KFK39249.1| hypothetical protein AALP_AA3G219800 [Arabis alpina]
Length=435

 Score =   164 bits (415),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 101/130 (78%), Gaps = 2/130 (2%)
 Frame = -1

Query  671  QQLPAQGGY-SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIP  495
            Q L   GG+ +NGS A+ SQSDG+S+N TIFVGGLDP+V+DEDLRQPFSQ+G++VSVKIP
Sbjct  294  QALILAGGHGANGSMAYSSQSDGESNNATIFVGGLDPDVTDEDLRQPFSQFGDVVSVKIP  353

Query  494  VGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYG  315
            VGKGCGFVQFANR  AE+A+Q L G VIGK TVRLSWGR+P ++Q R D   QW G Y  
Sbjct  354  VGKGCGFVQFANRNGAEDAIQNLNGTVIGKNTVRLSWGRSP-NKQWRGDSGQQWNGGYSR  412

Query  314  GHFYDGYTYA  285
            G  Y+   YA
Sbjct  413  GQGYNNGGYA  422



>ref|XP_006297697.1| hypothetical protein CARUB_v10013726mg [Capsella rubella]
 gb|EOA30595.1| hypothetical protein CARUB_v10013726mg [Capsella rubella]
Length=439

 Score =   164 bits (415),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 87/138 (63%), Positives = 105/138 (76%), Gaps = 7/138 (5%)
 Frame = -1

Query  677  NQQQLPAQ-----GGY-SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGE  516
            NQQQ  +Q     GG+ +NG  AHGSQSDG+S+N+TIFVGG+DP+V+DEDLRQPFSQ+GE
Sbjct  290  NQQQHSSQALILAGGHGANGYMAHGSQSDGESTNSTIFVGGIDPDVTDEDLRQPFSQFGE  349

Query  515  IVSVKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSR-SDFTN  339
            +VSVKIPVGKGCGFVQFA+R  AE+A++ L G VIGK TVRLSWGR+P  +Q R  D   
Sbjct  350  VVSVKIPVGKGCGFVQFADRKSAEDAIESLNGTVIGKNTVRLSWGRSPNKQQWRGGDSGQ  409

Query  338  QWAGAYYGGHFYDGYTYA  285
            QW G Y  G  Y+   YA
Sbjct  410  QWNGGYSRGQGYNNGGYA  427



>ref|XP_010442131.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Camelina 
sativa]
Length=432

 Score =   164 bits (414),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 99/132 (75%), Gaps = 8/132 (6%)
 Frame = -1

Query  656  QGGYSN--GSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKG  483
            QGGY +  G P H    DG+S NTTIFVGGLD +V+DEDLRQPF+ +G+IVSVKIP+G+G
Sbjct  280  QGGYMSNGGLPRH----DGESLNTTIFVGGLDSSVTDEDLRQPFTAFGDIVSVKIPIGRG  335

Query  482  CGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAG-AYYGGHF  306
            CGF+QF NR +AEEAL+KL G +IGKQTVRLSWG N  ++Q R ++   W    YYGG F
Sbjct  336  CGFIQFVNRENAEEALEKLNGSLIGKQTVRLSWGHNTGNKQPRGEYAEHWVDHPYYGGQF  395

Query  305  YDGYTYAFPAPH  270
            Y+GY Y  P PH
Sbjct  396  YNGYGYMVP-PH  406



>ref|XP_006487135.1| PREDICTED: uncharacterized protein LOC102626638 [Citrus sinensis]
Length=508

 Score =   165 bits (417),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 86/146 (59%), Positives = 101/146 (69%), Gaps = 8/146 (5%)
 Frame = -1

Query  680  GNQQQLPAQ------GGYSNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYG  519
            G QQQ  +Q      G  SNG+   GS  DG+S+N TIF+G LD NVSD++LR+PFS  G
Sbjct  354  GYQQQCSSQALVLAGGLASNGARVQGS--DGESNNATIFIGALDSNVSDKNLREPFSHLG  411

Query  518  EIVSVKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTN  339
            EI+SVKI +GK CGFVQFANR DAE ALQKL+G  IGKQTVRLSWG NP ++Q R D  N
Sbjct  412  EILSVKIHIGKRCGFVQFANRKDAEVALQKLQGTAIGKQTVRLSWGHNPGNKQWRGDHIN  471

Query  338  QWAGAYYGGHFYDGYTYAFPAPHNPN  261
             W G +Y G  Y G  YAFP   +PN
Sbjct  472  HWNGEHYRGQGYSGNGYAFPPNQDPN  497



>gb|EAY94326.1| hypothetical protein OsI_16094 [Oryza sativa Indica Group]
Length=426

 Score =   163 bits (413),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 79/125 (63%), Positives = 99/125 (79%), Gaps = 4/125 (3%)
 Frame = -1

Query  635  SPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANR  456
            +P H   SDGDS+N T++VGGLDPNVS+++LR+ F++YG++ SVKIP+GK CGFVQF +R
Sbjct  287  TPGH---SDGDSTNRTVYVGGLDPNVSEDELRKAFAKYGDVASVKIPLGKQCGFVQFVSR  343

Query  455  TDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPA  276
            TDAEEALQ L G VIGKQ VRLSWGR+P+H+QSR+D  ++    YYG  FY GY YA P 
Sbjct  344  TDAEEALQGLNGSVIGKQAVRLSWGRSPSHKQSRADSGSRRNNMYYGTPFYGGYGYASPV  403

Query  275  PHNPN  261
            PH PN
Sbjct  404  PH-PN  407



>emb|CAH67097.1| H0818E04.14 [Oryza sativa Indica Group]
Length=426

 Score =   163 bits (413),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 79/125 (63%), Positives = 99/125 (79%), Gaps = 4/125 (3%)
 Frame = -1

Query  635  SPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANR  456
            +P H   SDGDS+N T++VGGLDPNVS+++LR+ F++YG++ SVKIP+GK CGFVQF +R
Sbjct  287  TPGH---SDGDSTNRTVYVGGLDPNVSEDELRKAFAKYGDVASVKIPLGKQCGFVQFVSR  343

Query  455  TDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPA  276
            TDAEEALQ L G VIGKQ VRLSWGR+P+H+QSR+D  ++    YYG  FY GY YA P 
Sbjct  344  TDAEEALQGLNGSVIGKQAVRLSWGRSPSHKQSRADSGSRRNNMYYGTPFYGGYGYASPV  403

Query  275  PHNPN  261
            PH PN
Sbjct  404  PH-PN  407



>ref|XP_006653468.1| PREDICTED: polyadenylate-binding protein RBP47-like [Oryza brachyantha]
Length=409

 Score =   163 bits (412),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 79/125 (63%), Positives = 98/125 (78%), Gaps = 4/125 (3%)
 Frame = -1

Query  635  SPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANR  456
            +P H   SDGD +N T++VGGLDPNVS+++LR+ F++YG++ SVKIP+GK CGFVQF +R
Sbjct  270  TPGH---SDGDFTNRTVYVGGLDPNVSEDELRKAFAKYGDVASVKIPLGKQCGFVQFVSR  326

Query  455  TDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPA  276
            TDAEEALQ L G VIGKQ VRLSWGR+P+H+QSR+D  N+    YYG  FY GY YA P 
Sbjct  327  TDAEEALQGLNGSVIGKQAVRLSWGRSPSHKQSRADSGNRRNNMYYGTPFYGGYGYASPV  386

Query  275  PHNPN  261
            PH PN
Sbjct  387  PH-PN  390



>gb|EEC84714.1| hypothetical protein OsI_31675 [Oryza sativa Indica Group]
Length=377

 Score =   162 bits (410),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 99/135 (73%), Gaps = 2/135 (1%)
 Frame = -1

Query  662  PAQGGYSNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKG  483
            P +   ++G     ++SDGD +NTT+FVGGLDPNVS++DLRQ FSQYGEI SVKIPVGK 
Sbjct  223  PRKTSGTSGPTGSAARSDGDLTNTTVFVGGLDPNVSEDDLRQTFSQYGEISSVKIPVGKQ  282

Query  482  CGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQW-AGAYYGGH-  309
            CGFVQF  R +AE+ALQ L G  IGKQTVRLSWGRNPA++Q RSD  +QW  G +Y    
Sbjct  283  CGFVQFVQRKNAEDALQGLNGSTIGKQTVRLSWGRNPANKQLRSDNGSQWNNGMFYAASP  342

Query  308  FYDGYTYAFPAPHNP  264
            FY GY Y  P P +P
Sbjct  343  FYSGYGYPAPFPADP  357



>ref|XP_007156541.1| hypothetical protein PHAVU_003G294800g [Phaseolus vulgaris]
 gb|ESW28535.1| hypothetical protein PHAVU_003G294800g [Phaseolus vulgaris]
Length=363

 Score =   162 bits (409),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 97/114 (85%), Gaps = 3/114 (3%)
 Frame = -1

Query  680  GNQQQLPAQ--GGYS-NGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIV  510
            G QQQ  +Q  GG+S NG+ A GSQS+GDS+NTTIFVGGLD ++SDEDLRQPF Q+GE+V
Sbjct  212  GYQQQYSSQAGGGHSANGAVAQGSQSEGDSNNTTIFVGGLDSDISDEDLRQPFLQFGEVV  271

Query  509  SVKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSD  348
            SVKIPVGKGCGFVQFA+R +AE+A+Q L G VIGKQTVRLSWGR+P ++  RSD
Sbjct  272  SVKIPVGKGCGFVQFADRKNAEDAIQALNGTVIGKQTVRLSWGRSPGNKHWRSD  325



>ref|XP_006297696.1| hypothetical protein CARUB_v10013726mg [Capsella rubella]
 gb|EOA30594.1| hypothetical protein CARUB_v10013726mg [Capsella rubella]
Length=438

 Score =   163 bits (413),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 85/137 (62%), Positives = 103/137 (75%), Gaps = 6/137 (4%)
 Frame = -1

Query  677  NQQQLPAQ-----GGY-SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGE  516
            NQQQ  +Q     GG+ +NG  AHGSQSDG+S+N+TIFVGG+DP+V+DEDLRQPFSQ+GE
Sbjct  290  NQQQHSSQALILAGGHGANGYMAHGSQSDGESTNSTIFVGGIDPDVTDEDLRQPFSQFGE  349

Query  515  IVSVKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQ  336
            +VSVKIPVGKGCGFVQFA+R  AE+A++ L G VIGK TVRLSWGR+P  +    D   Q
Sbjct  350  VVSVKIPVGKGCGFVQFADRKSAEDAIESLNGTVIGKNTVRLSWGRSPNKQWRGGDSGQQ  409

Query  335  WAGAYYGGHFYDGYTYA  285
            W G Y  G  Y+   YA
Sbjct  410  WNGGYSRGQGYNNGGYA  426



>gb|KCW68769.1| hypothetical protein EUGRSUZ_F02369 [Eucalyptus grandis]
Length=428

 Score =   163 bits (413),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 78/96 (81%), Positives = 87/96 (91%), Gaps = 0/96 (0%)
 Frame = -1

Query  641  NGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFA  462
            NG+ +   QSDGDS+NTTIFVGGLDP+V+DEDLRQ FSQYGEIVSVKIP GKGCGFVQFA
Sbjct  304  NGASSQSFQSDGDSANTTIFVGGLDPSVNDEDLRQQFSQYGEIVSVKIPSGKGCGFVQFA  363

Query  461  NRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSR  354
            NR++AEEALQKL G VIGKQTVRLSWGRNPA++Q R
Sbjct  364  NRSNAEEALQKLNGTVIGKQTVRLSWGRNPANKQVR  399



>ref|XP_010481964.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Camelina 
sativa]
Length=434

 Score =   163 bits (413),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 98/132 (74%), Gaps = 8/132 (6%)
 Frame = -1

Query  656  QGGYSN--GSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKG  483
            QGGY +  G P H    DG+S NTTIFVGGLD +V+DEDLRQPF+ +G+IVSVKIP+G+G
Sbjct  282  QGGYMSNGGLPRH----DGESLNTTIFVGGLDSSVTDEDLRQPFAAFGDIVSVKIPIGRG  337

Query  482  CGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAG-AYYGGHF  306
            CGF+QF NR +AEEAL+KL G +IGKQTVRLSWG N   +Q R ++   W    YYGG F
Sbjct  338  CGFIQFVNRENAEEALEKLNGSLIGKQTVRLSWGHNTGKKQPRGEYAEHWVDHPYYGGQF  397

Query  305  YDGYTYAFPAPH  270
            Y+GY Y  P PH
Sbjct  398  YNGYGYMVP-PH  408



>gb|KCW63816.1| hypothetical protein EUGRSUZ_G01492 [Eucalyptus grandis]
Length=432

 Score =   163 bits (412),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 83/140 (59%), Positives = 109/140 (78%), Gaps = 10/140 (7%)
 Frame = -1

Query  686  SSGNQQQLPAQ-----GGYSNGSPAHGSQSDG----DSSNTTIFVGGLDPNVSDEDLRQP  534
            SSG QQQ  +Q     GG++ G  ++G+ S G    +S+N+TIFVGGLD +VSDEDLRQ 
Sbjct  274  SSGYQQQYSSQALVLAGGHAGGHASNGATSQGSQAHESNNSTIFVGGLDSDVSDEDLRQT  333

Query  533  FSQYGEIVSVKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSR  354
            FSQ+GE+VSVKIP GKGCGFV FA+R +AEEA+Q L G  IGKQ+VRLSWGR+PA++Q R
Sbjct  334  FSQFGEVVSVKIPAGKGCGFVHFADRKNAEEAMQDLNGTTIGKQSVRLSWGRSPANKQWR  393

Query  353  SDFTNQWAGAYYGGHFYDGY  294
            ++ +NQW G+Y+GG + +GY
Sbjct  394  TERSNQWNGSYHGG-YANGY  412



>dbj|BAJ85933.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=152

 Score =   155 bits (393),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 95/127 (75%), Gaps = 6/127 (5%)
 Frame = -1

Query  635  SPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANR  456
            +P H   SDGDS+N T++VGGLD NVS+++LR+ F++YG++ SVKIP+GK CGFVQ+ NR
Sbjct  11   TPGH---SDGDSNNRTVYVGGLDQNVSEDELRKSFAKYGDVASVKIPLGKQCGFVQYVNR  67

Query  455  TDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSD--FTNQWAGAYYGGHFYDGYTYAF  282
            TDAEEALQ L G VIGKQ VRLSWGR+P+H+QSR D          YYG  FY GY YA 
Sbjct  68   TDAEEALQGLNGAVIGKQAVRLSWGRSPSHKQSRGDSGNRRNNNNMYYGTPFYGGYGYAS  127

Query  281  PAPHNPN  261
            P PH PN
Sbjct  128  PVPH-PN  133



>ref|XP_007199852.1| hypothetical protein PRUPE_ppa005661mg [Prunus persica]
 gb|EMJ01051.1| hypothetical protein PRUPE_ppa005661mg [Prunus persica]
Length=449

 Score =   163 bits (413),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 80/116 (69%), Positives = 96/116 (83%), Gaps = 1/116 (1%)
 Frame = -1

Query  677  NQQQLPAQGGY-SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVK  501
            +Q  + A GG+ SNG+ A GSQ D +++NTTIFVGGLD +V+DEDLRQPFSQ+GE+VSVK
Sbjct  299  SQALVLAGGGHASNGAVAQGSQFDSETNNTTIFVGGLDSDVNDEDLRQPFSQFGEVVSVK  358

Query  500  IPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQW  333
            IPVGK CGFVQFANR DAE A+Q L G VIGKQTVRLSWGR+  ++Q RSD +NQW
Sbjct  359  IPVGKACGFVQFANRKDAENAMQMLNGTVIGKQTVRLSWGRSQGNKQWRSDSSNQW  414



>ref|XP_010494212.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Camelina 
sativa]
Length=428

 Score =   163 bits (412),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 82/132 (62%), Positives = 98/132 (74%), Gaps = 8/132 (6%)
 Frame = -1

Query  656  QGGYSN--GSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKG  483
            QGGY +  G P H    DG+S NTTIFVGGLD +V+DEDLRQPF+ +GEIVSVKIP+G+G
Sbjct  276  QGGYMSNGGLPRH----DGESLNTTIFVGGLDSSVTDEDLRQPFAAFGEIVSVKIPIGRG  331

Query  482  CGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAG-AYYGGHF  306
            CGF+QF NR +AEEAL KL G +IGKQTVRLSWG N  ++Q R ++   W    YYGG F
Sbjct  332  CGFIQFVNRENAEEALGKLNGSLIGKQTVRLSWGHNTGNKQPRGEYAEHWVDHPYYGGQF  391

Query  305  YDGYTYAFPAPH  270
            Y+GY Y  P PH
Sbjct  392  YNGYGYMVP-PH  402



>ref|XP_010066047.1| PREDICTED: polyadenylate-binding protein RBP47 [Eucalyptus grandis]
Length=445

 Score =   163 bits (412),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 83/140 (59%), Positives = 109/140 (78%), Gaps = 10/140 (7%)
 Frame = -1

Query  686  SSGNQQQLPAQ-----GGYSNGSPAHGSQSDG----DSSNTTIFVGGLDPNVSDEDLRQP  534
            SSG QQQ  +Q     GG++ G  ++G+ S G    +S+N+TIFVGGLD +VSDEDLRQ 
Sbjct  287  SSGYQQQYSSQALVLAGGHAGGHASNGATSQGSQAHESNNSTIFVGGLDSDVSDEDLRQT  346

Query  533  FSQYGEIVSVKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSR  354
            FSQ+GE+VSVKIP GKGCGFV FA+R +AEEA+Q L G  IGKQ+VRLSWGR+PA++Q R
Sbjct  347  FSQFGEVVSVKIPAGKGCGFVHFADRKNAEEAMQDLNGTTIGKQSVRLSWGRSPANKQWR  406

Query  353  SDFTNQWAGAYYGGHFYDGY  294
            ++ +NQW G+Y+GG + +GY
Sbjct  407  TERSNQWNGSYHGG-YANGY  425



>ref|XP_008236617.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X1 
[Prunus mume]
Length=450

 Score =   163 bits (413),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 80/116 (69%), Positives = 96/116 (83%), Gaps = 1/116 (1%)
 Frame = -1

Query  677  NQQQLPAQGGY-SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVK  501
            +Q  + A GG+ SNG+ A GSQ D +++NTTIFVGGLD +V+DEDLRQPFSQ+GE+VSVK
Sbjct  300  SQALVLAGGGHASNGAVAQGSQFDSETNNTTIFVGGLDSDVNDEDLRQPFSQFGEVVSVK  359

Query  500  IPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQW  333
            IPVGK CGFVQFANR DAE A+Q L G VIGKQTVRLSWGR+  ++Q RSD +NQW
Sbjct  360  IPVGKACGFVQFANRKDAENAMQMLNGTVIGKQTVRLSWGRSQGNKQWRSDSSNQW  415



>gb|KDO38218.1| hypothetical protein CISIN_1g038175mg, partial [Citrus sinensis]
Length=155

 Score =   155 bits (392),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 73/100 (73%), Positives = 82/100 (82%), Gaps = 0/100 (0%)
 Frame = -1

Query  614  SDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRTDAEEAL  435
            SDG S+N TIFVG LD NVSD+DLR+ FS +GEI+SVKIPVGKGCGFVQFANR DAE AL
Sbjct  56   SDGKSNNATIFVGALDSNVSDKDLRELFSHFGEILSVKIPVGKGCGFVQFANRKDAEVAL  115

Query  434  QKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYG  315
            QKL+G  IGKQTVRLSWG NP ++Q R D  N W GA+YG
Sbjct  116  QKLQGTAIGKQTVRLSWGHNPGNKQWRGDHINHWNGAHYG  155



>ref|NP_001047180.1| Os02g0567900 [Oryza sativa Japonica Group]
 dbj|BAF09094.1| Os02g0567900, partial [Oryza sativa Japonica Group]
Length=259

 Score =   159 bits (401),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 92/119 (77%), Gaps = 1/119 (1%)
 Frame = -1

Query  617  QSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRTDAEEA  438
            QSD DS+N TI+VGGLDPN ++++LR+ F++YG++ SVKIPVGK CGFVQF NR DAEEA
Sbjct  123  QSDSDSTNRTIYVGGLDPNATEDELRKAFAKYGDLASVKIPVGKQCGFVQFVNRPDAEEA  182

Query  437  LQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPN  261
            LQ L G  IGKQ VRLSWGR+PA +QSR D  ++  G YYG  FY GY YA P PH PN
Sbjct  183  LQGLNGSTIGKQAVRLSWGRSPASKQSRGDSGHRRNGMYYGTPFYGGYGYASPLPH-PN  240



>ref|NP_001063403.1| Os09g0462700 [Oryza sativa Japonica Group]
 dbj|BAF25317.1| Os09g0462700, partial [Oryza sativa Japonica Group]
Length=441

 Score =   163 bits (412),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 84/135 (62%), Positives = 99/135 (73%), Gaps = 2/135 (1%)
 Frame = -1

Query  662  PAQGGYSNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKG  483
            P +   ++G     ++SDGD +NTT+FVGGLDPNVS++DLRQ FSQYGEI SVKIPVGK 
Sbjct  287  PRKTSGTSGPTGSAARSDGDLTNTTVFVGGLDPNVSEDDLRQTFSQYGEISSVKIPVGKQ  346

Query  482  CGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQW-AGAYYGGH-  309
            CGFVQF  R +AE+ALQ L G  IGKQTVRLSWGRNPA++Q RSD  +QW  G YY    
Sbjct  347  CGFVQFVQRKNAEDALQGLNGSTIGKQTVRLSWGRNPANKQLRSDNGSQWNNGMYYAASP  406

Query  308  FYDGYTYAFPAPHNP  264
            FY GY Y  P P +P
Sbjct  407  FYSGYGYPAPFPADP  421



>ref|XP_003579863.1| PREDICTED: polyadenylate-binding protein RBP47-like [Brachypodium 
distachyon]
Length=428

 Score =   162 bits (410),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 79/125 (63%), Positives = 96/125 (77%), Gaps = 4/125 (3%)
 Frame = -1

Query  635  SPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANR  456
            +P H   SDGDS+N T++VGGLDPNVS+++LR+ F++YG++ SVKIP GK CGFVQ+ NR
Sbjct  287  TPGH---SDGDSTNRTVYVGGLDPNVSEDELRKSFAKYGDVASVKIPQGKQCGFVQYVNR  343

Query  455  TDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPA  276
            TDAEEALQ L G VIGKQ VRLSWGR+P+H+Q R D  N+    YYG  FY GY YA P 
Sbjct  344  TDAEEALQGLNGSVIGKQAVRLSWGRSPSHKQPRGDSGNRRNNMYYGTPFYGGYGYASPV  403

Query  275  PHNPN  261
            PH PN
Sbjct  404  PH-PN  407



>ref|XP_003529385.1| PREDICTED: polyadenylate-binding protein RBP47-like [Glycine 
max]
Length=431

 Score =   162 bits (410),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 82/131 (63%), Positives = 99/131 (76%), Gaps = 4/131 (3%)
 Frame = -1

Query  677  NQQQLPAQGGYSNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKI  498
            +Q  L A G  +NG+ A GS S+GD +NTTIFVGGLD + SDEDLRQPF Q+GE+VSVKI
Sbjct  286  SQAVLLAGGHAANGAVAQGSHSEGDLNNTTIFVGGLDSDTSDEDLRQPFLQFGEVVSVKI  345

Query  497  PVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYY  318
            PVGKGCGFVQFA+R +AEEA+  L G VIGKQTVRLSWGR+P ++  RSD      G Y+
Sbjct  346  PVGKGCGFVQFADRKNAEEAIHALNGTVIGKQTVRLSWGRSPGNKHWRSDSN----GGYF  401

Query  317  GGHFYDGYTYA  285
            GG  Y G+ +A
Sbjct  402  GGQSYGGHGFA  412



>ref|XP_004975779.1| PREDICTED: polyadenylate-binding protein RBP47-like [Setaria 
italica]
Length=420

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 81/125 (65%), Positives = 98/125 (78%), Gaps = 5/125 (4%)
 Frame = -1

Query  635  SPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANR  456
            +P H   SDGDSSN T++VGGLDPNVS+++LR+ F++YG++ SVKIP+GK CGFVQF +R
Sbjct  281  TPGH---SDGDSSNRTVYVGGLDPNVSEDELRKAFAKYGDLASVKIPLGKQCGFVQFVSR  337

Query  455  TDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPA  276
            TDAEEALQ L G VIGKQ VRLSWGR+P+H+QSR D  N+    YYG  FY GY YA P 
Sbjct  338  TDAEEALQGLNGSVIGKQAVRLSWGRSPSHKQSRGDSGNR-RNMYYGTPFYGGYGYASPV  396

Query  275  PHNPN  261
            PH PN
Sbjct  397  PH-PN  400



>ref|XP_009114049.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Brassica 
rapa]
Length=419

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 77/117 (66%), Positives = 92/117 (79%), Gaps = 1/117 (1%)
 Frame = -1

Query  611  DGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRTDAEEALQ  432
            DGDS NTTIFVGGLD +V+DE LRQPF+ +GEIVSVKIPVGKGCGF+QF NR +AEEAL+
Sbjct  278  DGDSLNTTIFVGGLDADVTDEVLRQPFAGFGEIVSVKIPVGKGCGFIQFVNRENAEEALE  337

Query  431  KLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYA-FPAPHNP  264
            KL G VIGKQTVRLSWGRN  ++Q R  + +QW   +Y G +Y+GY Y   P P +P
Sbjct  338  KLNGSVIGKQTVRLSWGRNQGNKQPRGGYGDQWVEPFYRGQYYNGYGYMPLPPPIDP  394



>gb|EMS68577.1| Uncharacterized RNA-binding protein C23E6.01c [Triticum urartu]
Length=314

 Score =   159 bits (402),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 79/127 (62%), Positives = 96/127 (76%), Gaps = 6/127 (5%)
 Frame = -1

Query  635  SPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANR  456
            +P H   SDGDS+N T++VGGLDPNVS+++LR+ F++YG++ SVKIP+GK CGFVQ+ NR
Sbjct  173  TPGH---SDGDSNNRTVYVGGLDPNVSEDELRKSFAKYGDVASVKIPLGKQCGFVQYVNR  229

Query  455  TDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSD--FTNQWAGAYYGGHFYDGYTYAF  282
            TDAEEALQ L G VIGKQ VRLSWGR+P+H+QSR D          YYG  FY GY YA 
Sbjct  230  TDAEEALQGLNGAVIGKQAVRLSWGRSPSHKQSRGDSGNRRNNNNMYYGTPFYGGYGYAS  289

Query  281  PAPHNPN  261
            P PH PN
Sbjct  290  PVPH-PN  295



>emb|CDY52067.1| BnaA09g53390D [Brassica napus]
Length=419

 Score =   162 bits (409),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 77/117 (66%), Positives = 92/117 (79%), Gaps = 1/117 (1%)
 Frame = -1

Query  611  DGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRTDAEEALQ  432
            DGDS NTTIFVGGLD +V+DE LRQPF+ +GEIVSVKIPVGKGCGF+QF NR +AEEAL+
Sbjct  278  DGDSLNTTIFVGGLDADVTDEVLRQPFAGFGEIVSVKIPVGKGCGFIQFVNRENAEEALE  337

Query  431  KLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYA-FPAPHNP  264
            KL G VIGKQTVRLSWGRN  ++Q R  + +QW   +Y G +Y+GY Y   P P +P
Sbjct  338  KLNGSVIGKQTVRLSWGRNQGNKQPRGGYGDQWVEPFYRGQYYNGYGYMPLPPPIDP  394



>ref|XP_007156542.1| hypothetical protein PHAVU_003G294800g [Phaseolus vulgaris]
 gb|ESW28536.1| hypothetical protein PHAVU_003G294800g [Phaseolus vulgaris]
Length=367

 Score =   160 bits (405),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 81/118 (69%), Positives = 97/118 (82%), Gaps = 7/118 (6%)
 Frame = -1

Query  680  GNQQQLPAQ------GGYS-NGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQY  522
            G QQQ  +Q      GG+S NG+ A GSQS+GDS+NTTIFVGGLD ++SDEDLRQPF Q+
Sbjct  212  GYQQQYSSQAVVLAGGGHSANGAVAQGSQSEGDSNNTTIFVGGLDSDISDEDLRQPFLQF  271

Query  521  GEIVSVKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSD  348
            GE+VSVKIPVGKGCGFVQFA+R +AE+A+Q L G VIGKQTVRLSWGR+P ++  RSD
Sbjct  272  GEVVSVKIPVGKGCGFVQFADRKNAEDAIQALNGTVIGKQTVRLSWGRSPGNKHWRSD  329



>emb|CDX95176.1| BnaC09g16940D [Brassica napus]
Length=419

 Score =   161 bits (408),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 92/117 (79%), Gaps = 1/117 (1%)
 Frame = -1

Query  611  DGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRTDAEEALQ  432
            DGDS NTTIFVGGLD +V+DE LRQPF+ +GEIVSVKIP+GKGCGF+QF NR +AEEAL+
Sbjct  278  DGDSLNTTIFVGGLDADVTDEVLRQPFAGFGEIVSVKIPIGKGCGFIQFVNRENAEEALE  337

Query  431  KLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYA-FPAPHNP  264
            KL G VIGKQTVRLSWGRN  ++Q R  + +QW   +Y G +Y+GY Y   P P +P
Sbjct  338  KLNGSVIGKQTVRLSWGRNQGNKQPRGGYGDQWVEPFYRGQYYNGYGYMPLPPPIDP  394



>gb|EEC73442.1| hypothetical protein OsI_07730 [Oryza sativa Indica Group]
Length=312

 Score =   159 bits (401),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 92/119 (77%), Gaps = 1/119 (1%)
 Frame = -1

Query  617  QSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRTDAEEA  438
            QSD DS+N TI+VGGLDPN ++++LR+ F++YG++ SVKIPVGK CGFVQF NR DAEEA
Sbjct  176  QSDSDSTNRTIYVGGLDPNATEDELRKAFAKYGDLASVKIPVGKQCGFVQFVNRPDAEEA  235

Query  437  LQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPN  261
            LQ L G  IGKQ VRLSWGR+PA +QSR D  ++  G YYG  FY GY YA P PH PN
Sbjct  236  LQGLNGSTIGKQAVRLSWGRSPASKQSRGDSGHRRNGMYYGTPFYGGYGYASPLPH-PN  293



>ref|XP_002885294.1| RNA-binding protein 47B [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61553.1| RNA-binding protein 47B [Arabidopsis lyrata subsp. lyrata]
Length=435

 Score =   161 bits (408),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 83/125 (66%), Positives = 99/125 (79%), Gaps = 7/125 (6%)
 Frame = -1

Query  677  NQQQLPAQ-----GGY-SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGE  516
            NQQQ  +Q     GG+ +NGS AHGSQSDG+S+N TIFVGG+D +V+DEDLRQPFSQ+GE
Sbjct  287  NQQQHSSQALILAGGHGANGSMAHGSQSDGESTNATIFVGGIDADVTDEDLRQPFSQFGE  346

Query  515  IVSVKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQ  336
            +VSVKIPVGKGCGFVQFA R  AE+A++ L G VIGK TVRLSWGR+P ++Q R D   Q
Sbjct  347  VVSVKIPVGKGCGFVQFAERKSAEDAIETLNGTVIGKNTVRLSWGRSP-NKQWRGDSGQQ  405

Query  335  WAGAY  321
            W G Y
Sbjct  406  WNGGY  410



>ref|XP_010487839.1| PREDICTED: polyadenylate-binding protein RBP47B isoform X1 [Camelina 
sativa]
Length=444

 Score =   161 bits (408),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 99/126 (79%), Gaps = 7/126 (6%)
 Frame = -1

Query  677  NQQQLPAQ-----GGY-SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGE  516
            NQQQ  +Q     GG+ +NG  AHGSQSDG+S+N+TIFVGG+DP+V+DEDLRQPFSQ+GE
Sbjct  294  NQQQHSSQALILAGGHGANGYMAHGSQSDGESTNSTIFVGGIDPDVTDEDLRQPFSQFGE  353

Query  515  IVSVKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSR-SDFTN  339
            +VSVKIPVGKGCGFVQFA+R  AE+A++ L G VIGK TVRLSWGR P  +Q R  D   
Sbjct  354  VVSVKIPVGKGCGFVQFADRKSAEDAIESLNGTVIGKNTVRLSWGRTPNKQQWRGGDSGQ  413

Query  338  QWAGAY  321
            QW G Y
Sbjct  414  QWNGGY  419



>ref|XP_003608019.1| RNA Binding Protein [Medicago truncatula]
 gb|AES90216.1| polyadenylate-binding protein RBP47B [Medicago truncatula]
Length=454

 Score =   161 bits (408),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 96/118 (81%), Gaps = 7/118 (6%)
 Frame = -1

Query  680  GNQQQLPAQ-------GGYSNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQY  522
            GN QQ  +Q       GG+SNG+ A GSQS+GDS+NTTIFVGGLD ++SDEDLRQPF Q+
Sbjct  298  GNPQQYSSQAVVLAGGGGHSNGAMAQGSQSEGDSNNTTIFVGGLDSDISDEDLRQPFLQF  357

Query  521  GEIVSVKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSD  348
            G+++SVKIPVGKGCGFVQ A+R +AEEA+Q L G VIGKQTVRLSWGR+P ++  R+D
Sbjct  358  GDVISVKIPVGKGCGFVQLADRKNAEEAIQGLNGTVIGKQTVRLSWGRSPGNKHGRND  415



>gb|AAM67293.1| nuclear acid binding protein, putative [Arabidopsis thaliana]
Length=392

 Score =   160 bits (404),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 83/125 (66%), Positives = 99/125 (79%), Gaps = 7/125 (6%)
 Frame = -1

Query  677  NQQQLPAQ-----GGY-SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGE  516
            NQQQ  +Q     GG+ SNGS  +GSQSDG+S+N TIFVGG+DP+V DEDLRQPFSQ+GE
Sbjct  244  NQQQHSSQAVILAGGHGSNGSMGYGSQSDGESTNATIFVGGIDPDVIDEDLRQPFSQFGE  303

Query  515  IVSVKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQ  336
            +VSVKIPVGKGCGFVQFA+R  AE+A++ L G VIGK TVRLSWGR+P ++Q R D   Q
Sbjct  304  VVSVKIPVGKGCGFVQFADRKSAEDAIESLNGTVIGKNTVRLSWGRSP-NKQWRGDSGQQ  362

Query  335  WAGAY  321
            W G Y
Sbjct  363  WNGGY  367



>ref|XP_010487840.1| PREDICTED: polyadenylate-binding protein RBP47B isoform X2 [Camelina 
sativa]
Length=443

 Score =   160 bits (406),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 81/125 (65%), Positives = 97/125 (78%), Gaps = 6/125 (5%)
 Frame = -1

Query  677  NQQQLPAQ-----GGY-SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGE  516
            NQQQ  +Q     GG+ +NG  AHGSQSDG+S+N+TIFVGG+DP+V+DEDLRQPFSQ+GE
Sbjct  294  NQQQHSSQALILAGGHGANGYMAHGSQSDGESTNSTIFVGGIDPDVTDEDLRQPFSQFGE  353

Query  515  IVSVKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQ  336
            +VSVKIPVGKGCGFVQFA+R  AE+A++ L G VIGK TVRLSWGR P  +    D   Q
Sbjct  354  VVSVKIPVGKGCGFVQFADRKSAEDAIESLNGTVIGKNTVRLSWGRTPNKQWRGGDSGQQ  413

Query  335  WAGAY  321
            W G Y
Sbjct  414  WNGGY  418



>ref|NP_188544.1| RNA-binding protein 47B [Arabidopsis thaliana]
 sp|Q0WW84.1|RB47B_ARATH RecName: Full=Polyadenylate-binding protein RBP47B; Short=Poly(A)-binding 
protein RBP47B; AltName: Full=RNA-binding protein 
47B; Short=AtRBP47B [Arabidopsis thaliana]
 dbj|BAE98614.1| putative nuclear acid binding protein [Arabidopsis thaliana]
 gb|ABH04596.1| At3g19130 [Arabidopsis thaliana]
 gb|AEE76196.1| RNA-binding protein 47B [Arabidopsis thaliana]
Length=435

 Score =   160 bits (405),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 83/125 (66%), Positives = 99/125 (79%), Gaps = 7/125 (6%)
 Frame = -1

Query  677  NQQQLPAQ-----GGY-SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGE  516
            NQQQ  +Q     GG+ SNGS  +GSQSDG+S+N TIFVGG+DP+V DEDLRQPFSQ+GE
Sbjct  287  NQQQHSSQAVILAGGHGSNGSMGYGSQSDGESTNATIFVGGIDPDVIDEDLRQPFSQFGE  346

Query  515  IVSVKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQ  336
            +VSVKIPVGKGCGFVQFA+R  AE+A++ L G VIGK TVRLSWGR+P ++Q R D   Q
Sbjct  347  VVSVKIPVGKGCGFVQFADRKSAEDAIESLNGTVIGKNTVRLSWGRSP-NKQWRGDSGQQ  405

Query  335  WAGAY  321
            W G Y
Sbjct  406  WNGGY  410



>emb|CDX95462.1| BnaC01g33540D [Brassica napus]
Length=434

 Score =   160 bits (405),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 81/131 (62%), Positives = 100/131 (76%), Gaps = 2/131 (2%)
 Frame = -1

Query  677  NQQQLPAQGGYSNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKI  498
            +Q  + A G  +NGS A+GSQ+DG+S+N+TIFVGGLDP+V+DEDLRQPF+++GE+VSVKI
Sbjct  294  SQAVIVAGGHGANGSMANGSQADGESNNSTIFVGGLDPDVTDEDLRQPFTEFGEVVSVKI  353

Query  497  PVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYY  318
            PVGKGCGFVQFANR  A++A+Q L G VIGK TVRLSWGR P   + R D   QW G Y 
Sbjct  354  PVGKGCGFVQFANRKSADDAIQSLNGTVIGKNTVRLSWGRTP--NKWRGDSGQQWNGGYS  411

Query  317  GGHFYDGYTYA  285
             G  Y+   YA
Sbjct  412  RGQGYNNGGYA  422



>gb|AFK40720.1| unknown [Medicago truncatula]
Length=454

 Score =   160 bits (406),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 96/118 (81%), Gaps = 7/118 (6%)
 Frame = -1

Query  680  GNQQQLPAQ-------GGYSNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQY  522
            GN QQ  +Q       GG+SNG+ A GSQS+GDS+NTTIFVGGLD ++SDEDLRQPF Q+
Sbjct  298  GNPQQYSSQAVVLAGGGGHSNGAMAQGSQSEGDSNNTTIFVGGLDSDISDEDLRQPFLQF  357

Query  521  GEIVSVKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSD  348
            G+++SVKIPVGKGCGFVQ A+R +AEEA+Q L G VIGKQTVRLSWGR+P ++  R+D
Sbjct  358  GDVISVKIPVGKGCGFVQLADRKNAEEAIQGLNGTVIGKQTVRLSWGRSPGNKHWRND  415



>gb|EMS62393.1| Uncharacterized RNA-binding protein C23E6.01c [Triticum urartu]
Length=384

 Score =   159 bits (402),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 89/143 (62%), Positives = 103/143 (72%), Gaps = 4/143 (3%)
 Frame = -1

Query  620  SQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRTDAEE  441
            ++SDGD +NTT+FVGGLDPNVS++DL+Q FSQYGEI SVKIPVGK CGFVQF  R +AE+
Sbjct  244  ARSDGDLTNTTVFVGGLDPNVSEDDLKQTFSQYGEISSVKIPVGKQCGFVQFLQRKNAED  303

Query  440  ALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQW-AGAYYG-GHFYDGYTYAFPAPHN  267
            ALQ L G  IGKQTVRLSWGRNPA++Q RSD  NQW  G YY    FY+GY Y  PA   
Sbjct  304  ALQGLNGSTIGKQTVRLSWGRNPANKQLRSDNGNQWNNGMYYAPSPFYNGYGY--PAAPF  361

Query  266  PNmyapaaygaypmyGTHQQQVS  198
            P+    AA         +QQQVS
Sbjct  362  PDPGMYAAAYGAYPVYGNQQQVS  384



>ref|XP_009112131.1| PREDICTED: polyadenylate-binding protein RBP47B-like isoform 
X2 [Brassica rapa]
Length=434

 Score =   160 bits (404),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 81/131 (62%), Positives = 100/131 (76%), Gaps = 2/131 (2%)
 Frame = -1

Query  677  NQQQLPAQGGYSNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKI  498
            +Q  + A G  +NGS A+GSQ+DG+S+N+TIFVGGLDP+V+DEDLRQPF+++GE+VSVKI
Sbjct  294  SQAVIVAGGHGANGSMANGSQADGESNNSTIFVGGLDPDVTDEDLRQPFTEFGEVVSVKI  353

Query  497  PVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYY  318
            PVGKGCGFVQFANR  A++A+Q L G VIGK TVRLSWGR P   + R D   QW G Y 
Sbjct  354  PVGKGCGFVQFANRKSADDAIQSLNGTVIGKNTVRLSWGRTP--NKWRGDSGQQWNGGYS  411

Query  317  GGHFYDGYTYA  285
             G  Y+   YA
Sbjct  412  RGQGYNNGGYA  422



>ref|XP_009358068.1| PREDICTED: polyadenylate-binding protein RBP47-like [Pyrus x 
bretschneideri]
Length=390

 Score =   159 bits (402),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 79/117 (68%), Positives = 93/117 (79%), Gaps = 1/117 (1%)
 Frame = -1

Query  680  GNQQQLPAQGGY-SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSV  504
             +Q  + A GG+ SNG+ A GSQ D + +NTTIFVGGLD  V+DEDLRQPFS +GE+VSV
Sbjct  239  ASQALVLAGGGHASNGAVAQGSQFDSEPNNTTIFVGGLDSEVNDEDLRQPFSHFGEVVSV  298

Query  503  KIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQW  333
            KIPVGK CGFVQFANR DAE A+Q L G VIGKQTVRLSWGR+  ++Q RSD +NQW
Sbjct  299  KIPVGKACGFVQFANRKDAENAIQMLNGTVIGKQTVRLSWGRSQGNKQWRSDSSNQW  355



>ref|XP_003578248.1| PREDICTED: polyadenylate-binding protein RBP47-like [Brachypodium 
distachyon]
Length=431

 Score =   160 bits (404),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 83/121 (69%), Positives = 94/121 (78%), Gaps = 5/121 (4%)
 Frame = -1

Query  620  SQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRTDAEE  441
            ++SDGD +NTT+FVGGLDPNVS++DLRQ FSQYGEI SVKIPVGK CGFVQF  R +AE+
Sbjct  290  ARSDGDLTNTTVFVGGLDPNVSEDDLRQSFSQYGEISSVKIPVGKQCGFVQFLQRKNAED  349

Query  440  ALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQW-AGAYYGGH-FYDGYTY---AFPA  276
            ALQ L G  IGKQTVRLSWGRNPA++Q RSD  NQW  G YY    FY+GY Y    FP 
Sbjct  350  ALQGLNGSTIGKQTVRLSWGRNPANKQLRSDNGNQWNNGMYYAASPFYNGYGYPAAPFPD  409

Query  275  P  273
            P
Sbjct  410  P  410



>emb|CDY18570.1| BnaA01g26250D [Brassica napus]
Length=434

 Score =   160 bits (404),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 81/131 (62%), Positives = 100/131 (76%), Gaps = 2/131 (2%)
 Frame = -1

Query  677  NQQQLPAQGGYSNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKI  498
            +Q  + A G  +NGS A+GSQ+DG+S+N+TIFVGGLDP+V+DEDLRQPF+++GE+VSVKI
Sbjct  294  SQAVIVAGGHGANGSMANGSQADGESNNSTIFVGGLDPDVTDEDLRQPFTEFGEVVSVKI  353

Query  497  PVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYY  318
            PVGKGCGFVQFANR  A++A+Q L G VIGK TVRLSWGR P   + R D   QW G Y 
Sbjct  354  PVGKGCGFVQFANRKSADDAIQSLNGTVIGKNTVRLSWGRTP--NKWRGDSGQQWNGGYS  411

Query  317  GGHFYDGYTYA  285
             G  Y+   YA
Sbjct  412  RGQGYNNGGYA  422



>gb|ABR25993.1| nucleic acid binding protein [Oryza sativa Indica Group]
Length=128

 Score =   151 bits (382),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 89/110 (81%), Gaps = 1/110 (1%)
 Frame = -1

Query  590  TIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRTDAEEALQKLKGLVI  411
            T++VGGLDPNVS+++LR+ F++YG++ SVKIP+GK CGFVQF +RTDAEEALQ L G VI
Sbjct  1    TVYVGGLDPNVSEDELRKAFAKYGDVASVKIPLGKQCGFVQFVSRTDAEEALQGLNGSVI  60

Query  410  GKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPN  261
            GKQ VRLSWGR+P+H+QSR+D  ++    YYG  FY GY YA P PH PN
Sbjct  61   GKQAVRLSWGRSPSHKQSRADSGSRRNNMYYGTPFYGGYGYASPVPH-PN  109



>ref|XP_003575198.1| PREDICTED: polyadenylate-binding protein RBP47C'-like [Brachypodium 
distachyon]
Length=421

 Score =   159 bits (403),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 92/119 (77%), Gaps = 1/119 (1%)
 Frame = -1

Query  617  QSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRTDAEEA  438
            QSDGD +N T++VGGLDPNVS+++LR+ F++YG++ SVKIPVGK CGFVQF NR DAEEA
Sbjct  285  QSDGDLTNRTVYVGGLDPNVSEDELRKTFAKYGDVASVKIPVGKQCGFVQFVNRADAEEA  344

Query  437  LQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPN  261
            LQ L G  IGKQ VRLSWGR+PA +Q R D  ++  G YYG  FY GY YA P PH PN
Sbjct  345  LQALSGSTIGKQAVRLSWGRSPASKQPRGDSGHRRNGMYYGTPFYGGYGYASPVPH-PN  402



>ref|XP_010466046.1| PREDICTED: polyadenylate-binding protein RBP47B-like [Camelina 
sativa]
Length=441

 Score =   159 bits (403),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 80/125 (64%), Positives = 97/125 (78%), Gaps = 6/125 (5%)
 Frame = -1

Query  677  NQQQLPAQ-----GGY-SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGE  516
            NQQQ  +Q     GG+ +NG  AHGSQSDG+S+N+TIFVGG+DP+V+DEDLRQPFSQ+G+
Sbjct  292  NQQQHSSQALILAGGHGANGYMAHGSQSDGESTNSTIFVGGIDPDVTDEDLRQPFSQFGD  351

Query  515  IVSVKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQ  336
            +VSVKIPVGKGCGFVQFA+R  AE+A++ L G VIGK TVRLSWGR P  +    D   Q
Sbjct  352  VVSVKIPVGKGCGFVQFADRKSAEDAIESLNGTVIGKNTVRLSWGRTPNKQWRGGDSGQQ  411

Query  335  WAGAY  321
            W G Y
Sbjct  412  WNGGY  416



>gb|KHN37491.1| Polyadenylate-binding protein RBP47 [Glycine soja]
Length=321

 Score =   156 bits (395),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 94/117 (80%), Gaps = 6/117 (5%)
 Frame = -1

Query  680  GNQQQLPAQ-----GGYS-NGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYG  519
            G QQQ  +Q     GG+S NG+ A GS S+GD +NTTIFVGGLD + SDEDLRQPF Q+G
Sbjct  168  GFQQQYSSQAVVLAGGHSANGAVAQGSHSEGDINNTTIFVGGLDSDTSDEDLRQPFLQFG  227

Query  518  EIVSVKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSD  348
            E+VSVKIPVGKGCGFVQFA+R +AEEA+Q L G VIGKQTVRLSWGR+P ++  RSD
Sbjct  228  EVVSVKIPVGKGCGFVQFADRKNAEEAIQGLNGTVIGKQTVRLSWGRSPGNKHWRSD  284



>ref|XP_006393234.1| hypothetical protein EUTSA_v10011485mg [Eutrema salsugineum]
 gb|ESQ30520.1| hypothetical protein EUTSA_v10011485mg [Eutrema salsugineum]
Length=441

 Score =   159 bits (402),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 80/125 (64%), Positives = 97/125 (78%), Gaps = 2/125 (2%)
 Frame = -1

Query  671  QQLPAQGGYS-NGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIP  495
            Q L   GG+  NGS AHGS SDG+S+N+TIFVGGLD +V++EDL QPF+Q+GE+VSVKIP
Sbjct  296  QALTLAGGHGGNGSMAHGSMSDGESNNSTIFVGGLDADVTEEDLMQPFAQFGEVVSVKIP  355

Query  494  VGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYG  315
            VGKGCGFVQF NR  AE+A+Q L G VIGK TVRLSWGR+P ++Q R D  +QW G Y  
Sbjct  356  VGKGCGFVQFGNRQSAEDAIQNLNGTVIGKNTVRLSWGRSP-NKQWRGDSGHQWNGGYSR  414

Query  314  GHFYD  300
            G  Y+
Sbjct  415  GQGYN  419



>gb|ACF83065.1| unknown [Zea mays]
 tpg|DAA61809.1| TPA: hypothetical protein ZEAMMB73_995180 [Zea mays]
Length=320

 Score =   156 bits (394),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 79/115 (69%), Positives = 88/115 (77%), Gaps = 3/115 (3%)
 Frame = -1

Query  608  GDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRTDAEEALQK  429
            GD +NTT+FVGGLDPNVS+EDLRQ FSQYGEI SVKIP+GK CGFVQFA R +AE+ALQ 
Sbjct  181  GDLTNTTVFVGGLDPNVSEEDLRQTFSQYGEISSVKIPIGKQCGFVQFAQRKNAEDALQG  240

Query  428  LKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQW--AGAYYGG-HFYDGYTYAFPAP  273
            L G  IGKQ VRLSWGRNPA++Q R D  NQW   G YY    FY+GY Y   AP
Sbjct  241  LNGSTIGKQNVRLSWGRNPANKQFRGDNGNQWNNGGMYYAAPPFYNGYGYPAAAP  295



>ref|XP_009356988.1| PREDICTED: polyadenylate-binding protein RBP47-like [Pyrus x 
bretschneideri]
Length=445

 Score =   159 bits (401),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 80/120 (67%), Positives = 95/120 (79%), Gaps = 1/120 (1%)
 Frame = -1

Query  677  NQQQLPAQGGY-SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVK  501
            +Q  + A GG+ SN + A GSQ D + +NTTIFVGGLD  V+DEDLRQPFS +GE+VSVK
Sbjct  296  SQALVLAGGGHASNVAVAQGSQFDSEPNNTTIFVGGLDSEVNDEDLRQPFSHFGEVVSVK  355

Query  500  IPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAY  321
            IPVGK CGFVQFANR DAE A+Q L G VIGKQTVRLSWGR+  ++Q RSD +NQW GA+
Sbjct  356  IPVGKACGFVQFANRKDAENAIQMLNGTVIGKQTVRLSWGRSQGNKQWRSDSSNQWNGAH  415



>gb|EMT16295.1| Putative RNA-binding protein [Aegilops tauschii]
Length=481

 Score =   159 bits (402),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 88/143 (62%), Positives = 103/143 (72%), Gaps = 4/143 (3%)
 Frame = -1

Query  620  SQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRTDAEE  441
            ++SDGD +NTT+FVGGLDPNVS++DL+Q F+QYGEI SVKIPVGK CGFVQF  R +AE+
Sbjct  341  ARSDGDLTNTTVFVGGLDPNVSEDDLKQTFTQYGEISSVKIPVGKQCGFVQFLQRKNAED  400

Query  440  ALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWA-GAYYG-GHFYDGYTYAFPAPHN  267
            ALQ L G  IGKQTVRLSWGRNPA++Q RSD  NQW  G YY    FY+GY Y  PA   
Sbjct  401  ALQGLNGSTIGKQTVRLSWGRNPANKQLRSDNGNQWTNGMYYAPSPFYNGYGY--PAAPF  458

Query  266  PNmyapaaygaypmyGTHQQQVS  198
            P+    AA         +QQQVS
Sbjct  459  PDPGMYAAAYGAYPVYGNQQQVS  481



>ref|XP_010507446.1| PREDICTED: polyadenylate-binding protein RBP47B-like isoform 
X1 [Camelina sativa]
Length=444

 Score =   158 bits (400),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 95/119 (80%), Gaps = 2/119 (2%)
 Frame = -1

Query  671  QQLPAQGGY-SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIP  495
            Q L   GG+ +NG  AHGSQSDG+S+N+TIFVGG+DP+V+DEDLR+PFSQ+GE+VSVKIP
Sbjct  301  QALILAGGHGANGYMAHGSQSDGESTNSTIFVGGIDPDVTDEDLRKPFSQFGEVVSVKIP  360

Query  494  VGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSR-SDFTNQWAGAY  321
            VG+GCGFVQFA+R  AE+A++ L G VIGK TVRLSWGR P  +Q R  D   QW G Y
Sbjct  361  VGRGCGFVQFADRKSAEDAIESLNGTVIGKNTVRLSWGRTPNKQQWRGGDSGQQWNGGY  419



>ref|XP_004168889.1| PREDICTED: polyadenylate-binding protein RBP47-like [Cucumis 
sativus]
Length=437

 Score =   158 bits (400),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 91/113 (81%), Gaps = 0/113 (0%)
 Frame = -1

Query  671  QQLPAQGGYSNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPV  492
            Q L   GG+ NG    GSQSD +S+NTTIFVGGLD +VSDEDL+Q FS++G++VSVKIP+
Sbjct  285  QALVLAGGHPNGMAVQGSQSDSESNNTTIFVGGLDSDVSDEDLKQAFSKFGDVVSVKIPI  344

Query  491  GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQW  333
            GKGCGFVQFANR +AE+A+Q L G VIGKQTVRLSWGR+  ++Q R D  NQW
Sbjct  345  GKGCGFVQFANRKNAEDAIQGLNGTVIGKQTVRLSWGRSTGNKQWRGDSNNQW  397



>ref|XP_004145357.1| PREDICTED: polyadenylate-binding protein RBP47-like [Cucumis 
sativus]
Length=436

 Score =   158 bits (399),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 91/113 (81%), Gaps = 0/113 (0%)
 Frame = -1

Query  671  QQLPAQGGYSNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPV  492
            Q L   GG+ NG    GSQSD +S+NTTIFVGGLD +VSDEDL+Q FS++G++VSVKIP+
Sbjct  284  QALVLAGGHPNGMAVQGSQSDSESNNTTIFVGGLDSDVSDEDLKQAFSKFGDVVSVKIPI  343

Query  491  GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQW  333
            GKGCGFVQFANR +AE+A+Q L G VIGKQTVRLSWGR+  ++Q R D  NQW
Sbjct  344  GKGCGFVQFANRKNAEDAIQGLNGTVIGKQTVRLSWGRSTGNKQWRGDSNNQW  396



>dbj|BAJ85879.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=479

 Score =   159 bits (401),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 89/143 (62%), Positives = 103/143 (72%), Gaps = 4/143 (3%)
 Frame = -1

Query  620  SQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRTDAEE  441
            ++SDGD +NTT+FVGGLDPNVS++DL+Q FSQYGEI SVKIPVGK CGFVQF  R +AE+
Sbjct  339  ARSDGDLTNTTVFVGGLDPNVSEDDLKQTFSQYGEISSVKIPVGKQCGFVQFLQRKNAED  398

Query  440  ALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQW-AGAYYG-GHFYDGYTYAFPAPHN  267
            ALQ L G  IGKQTVRLSWGRNPA++Q RSD  NQW  G YY    FY+GY Y  PA   
Sbjct  399  ALQGLNGSTIGKQTVRLSWGRNPANKQLRSDNGNQWNNGMYYAPSPFYNGYGY--PAAPF  456

Query  266  PNmyapaaygaypmyGTHQQQVS  198
            P+    AA         +QQQVS
Sbjct  457  PDPGMYAAAYGAYPLYGNQQQVS  479



>dbj|BAD17764.1| putative nucleic acid binding protein [Oryza sativa Japonica 
Group]
Length=396

 Score =   157 bits (397),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 92/119 (77%), Gaps = 1/119 (1%)
 Frame = -1

Query  617  QSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRTDAEEA  438
            QSD DS+N TI+VGGLDPN ++++LR+ F++YG++ SVKIPVGK CGFVQF NR DAEEA
Sbjct  260  QSDSDSTNRTIYVGGLDPNATEDELRKAFAKYGDLASVKIPVGKQCGFVQFVNRPDAEEA  319

Query  437  LQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPN  261
            LQ L G  IGKQ VRLSWGR+PA +QSR D  ++  G YYG  FY GY YA P PH PN
Sbjct  320  LQGLNGSTIGKQAVRLSWGRSPASKQSRGDSGHRRNGMYYGTPFYGGYGYASPLPH-PN  377



>ref|XP_004957051.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Setaria 
italica]
Length=437

 Score =   157 bits (398),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 87/136 (64%), Positives = 99/136 (73%), Gaps = 6/136 (4%)
 Frame = -1

Query  662  PAQGGYSNGSPAHGSQSDG-DSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGK  486
            P +   + GS    ++SDG D +NTT+FVGGLDPNVS+EDLRQ FSQYGEI SVKIPVGK
Sbjct  281  PRKSSGTTGSNGSSARSDGGDLTNTTVFVGGLDPNVSEEDLRQTFSQYGEISSVKIPVGK  340

Query  485  GCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQW-AGAYYGGH  309
             CGFVQFA R +AE+ALQ L G  IGKQTVRLSWGRNPA++Q R D  NQW  G YY   
Sbjct  341  QCGFVQFAQRKNAEDALQGLNGSTIGKQTVRLSWGRNPANKQFRGDNGNQWNNGMYYAAS  400

Query  308  -FYDGYTY---AFPAP  273
             FY+GY Y    FP P
Sbjct  401  PFYNGYGYPAAPFPDP  416



>gb|ACN40970.1| unknown [Picea sitchensis]
Length=430

 Score =   157 bits (398),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 102/148 (69%), Gaps = 10/148 (7%)
 Frame = -1

Query  686  SSGNQQQLPAQGGYSNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVS  507
            S+G Q Q   + G + GS A G  SD D +NTTIFVG LDPN +DEDLRQ F QYGE+VS
Sbjct  267  SAGVQHQYSGRAG-NGGSHAQGFPSDNDLNNTTIFVGRLDPNATDEDLRQVFGQYGELVS  325

Query  506  VKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFT-----  342
            VKIPVGKGCGFVQF NR  AEEALQ+L G VI +QTVRLSWGR+PA++Q           
Sbjct  326  VKIPVGKGCGFVQFGNRASAEEALQRLHGTVIRQQTVRLSWGRSPANKQQPQPQGQQPQS  385

Query  341  --NQWAGAYYGGHFYDGYTYAFPAPHNP  264
              NQW GAYY G  Y+ Y YA P P +P
Sbjct  386  DPNQWNGAYY-GQGYESYGYA-PPPQDP  411



>ref|XP_010507452.1| PREDICTED: polyadenylate-binding protein RBP47B-like isoform 
X2 [Camelina sativa]
Length=443

 Score =   158 bits (399),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 93/118 (79%), Gaps = 1/118 (1%)
 Frame = -1

Query  671  QQLPAQGGY-SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIP  495
            Q L   GG+ +NG  AHGSQSDG+S+N+TIFVGG+DP+V+DEDLR+PFSQ+GE+VSVKIP
Sbjct  301  QALILAGGHGANGYMAHGSQSDGESTNSTIFVGGIDPDVTDEDLRKPFSQFGEVVSVKIP  360

Query  494  VGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAY  321
            VG+GCGFVQFA+R  AE+A++ L G VIGK TVRLSWGR P  +    D   QW G Y
Sbjct  361  VGRGCGFVQFADRKSAEDAIESLNGTVIGKNTVRLSWGRTPNKQWRGGDSGQQWNGGY  418



>gb|EEE57226.1| hypothetical protein OsJ_07197 [Oryza sativa Japonica Group]
Length=459

 Score =   158 bits (399),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 92/119 (77%), Gaps = 1/119 (1%)
 Frame = -1

Query  617  QSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRTDAEEA  438
            QSD DS+N TI+VGGLDPN ++++LR+ F++YG++ SVKIPVGK CGFVQF NR DAEEA
Sbjct  323  QSDSDSTNRTIYVGGLDPNATEDELRKAFAKYGDLASVKIPVGKQCGFVQFVNRPDAEEA  382

Query  437  LQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPN  261
            LQ L G  IGKQ VRLSWGR+PA +QSR D  ++  G YYG  FY GY YA P PH PN
Sbjct  383  LQGLNGSTIGKQAVRLSWGRSPASKQSRGDSGHRRNGMYYGTPFYGGYGYASPLPH-PN  440



>ref|XP_006279885.1| hypothetical protein CARUB_v100264670mg, partial [Capsella rubella]
 gb|EOA12783.1| hypothetical protein CARUB_v100264670mg, partial [Capsella rubella]
Length=307

 Score =   154 bits (390),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/111 (67%), Positives = 90/111 (81%), Gaps = 6/111 (5%)
 Frame = -1

Query  656  QGGYSN--GSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKG  483
            QGGY +  G P H    DGDS NTTIFVGGLD +V+DEDLRQPF+ +GEIVSVKIP+G+G
Sbjct  156  QGGYMSNGGFPRH----DGDSLNTTIFVGGLDSSVTDEDLRQPFAGFGEIVSVKIPIGRG  211

Query  482  CGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWA  330
            CGF+QF NR +AEEAL+KL G +IGKQTVRLSWGRNP ++Q R ++T+ W 
Sbjct  212  CGFIQFVNRENAEEALEKLNGSMIGKQTVRLSWGRNPGNKQPRGEYTDPWV  262



>ref|XP_009406503.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=430

 Score =   157 bits (397),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 84/143 (59%), Positives = 99/143 (69%), Gaps = 7/143 (5%)
 Frame = -1

Query  686  SSGNQQQLPAQGGYSNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVS  507
            S G QQQ P+   Y       G++S+ D +NTTIFVGGLDPNV+DE LRQ FS YGEIV 
Sbjct  270  SLGTQQQYPSNASYQT---TQGAESENDPNNTTIFVGGLDPNVTDEHLRQVFSPYGEIVY  326

Query  506  VKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAG  327
            +KIPVGK CGFVQF NR +AEEALQ L G ++G Q VRLSWGR+P ++Q + D  NQW G
Sbjct  327  IKIPVGKRCGFVQFGNRANAEEALQMLNGTLLGGQNVRLSWGRSPTNKQPQQD-PNQWNG  385

Query  326  AYYG-GHFYDGYTYAFPAPHNPN  261
             YYG    YD Y YA   P +PN
Sbjct  386  NYYGYTQSYDAYGYA--PPQDPN  406



>ref|XP_009406502.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=437

 Score =   157 bits (398),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 84/143 (59%), Positives = 99/143 (69%), Gaps = 7/143 (5%)
 Frame = -1

Query  686  SSGNQQQLPAQGGYSNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVS  507
            S G QQQ P+   Y       G++S+ D +NTTIFVGGLDPNV+DE LRQ FS YGEIV 
Sbjct  277  SLGTQQQYPSNASYQT---TQGAESENDPNNTTIFVGGLDPNVTDEHLRQVFSPYGEIVY  333

Query  506  VKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAG  327
            +KIPVGK CGFVQF NR +AEEALQ L G ++G Q VRLSWGR+P ++Q + D  NQW G
Sbjct  334  IKIPVGKRCGFVQFGNRANAEEALQMLNGTLLGGQNVRLSWGRSPTNKQPQQD-PNQWNG  392

Query  326  AYYG-GHFYDGYTYAFPAPHNPN  261
             YYG    YD Y YA   P +PN
Sbjct  393  NYYGYTQSYDAYGYA--PPQDPN  413



>ref|XP_004952707.1| PREDICTED: polyadenylate-binding protein RBP47C'-like [Setaria 
italica]
Length=428

 Score =   157 bits (397),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 79/121 (65%), Positives = 93/121 (77%), Gaps = 3/121 (2%)
 Frame = -1

Query  617  QSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRTDAEEA  438
            QSD DS+N T++VGGLDPNVS+E+LR+ F++YG++ SVKIPVGK CGFVQF NR DAEEA
Sbjct  290  QSDADSTNRTVYVGGLDPNVSEEELRKAFAKYGDLASVKIPVGKQCGFVQFVNRADAEEA  349

Query  437  LQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQW--AGAYYGGHFYDGYTYAFPAPHNP  264
            LQ L G  IGKQ VRLSWGR+PA +QSR D  ++    G YYG  FY GY YA P PH P
Sbjct  350  LQGLNGSTIGKQAVRLSWGRSPASKQSRGDSGHRRNGNGMYYGTPFYGGYGYASPVPH-P  408

Query  263  N  261
            N
Sbjct  409  N  409



>gb|ACN39849.1| unknown [Picea sitchensis]
Length=429

 Score =   157 bits (397),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 102/148 (69%), Gaps = 11/148 (7%)
 Frame = -1

Query  686  SSGNQQQLPAQGGYSNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVS  507
            S+G Q Q   +G  + GS A G  SD D +NTTIFVG LDPN +DEDLRQ F QYGE+VS
Sbjct  267  SAGVQHQYSGRG--NGGSHAQGFPSDNDLNNTTIFVGRLDPNATDEDLRQVFGQYGELVS  324

Query  506  VKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFT-----  342
            VKIPVGKGCGFVQF NR  AEEALQ+L G VI +QTVRLSWGR+PA++Q           
Sbjct  325  VKIPVGKGCGFVQFGNRASAEEALQRLHGTVIRQQTVRLSWGRSPANKQQPQPQGQQPQS  384

Query  341  --NQWAGAYYGGHFYDGYTYAFPAPHNP  264
              NQW GAYY G  Y+ Y YA P P +P
Sbjct  385  DPNQWNGAYY-GQGYESYGYA-PPPQDP  410



>ref|XP_009112124.1| PREDICTED: polyadenylate-binding protein RBP47B-like isoform 
X1 [Brassica rapa]
Length=464

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 78/123 (63%), Positives = 97/123 (79%), Gaps = 2/123 (2%)
 Frame = -1

Query  677  NQQQLPAQGGYSNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKI  498
            +Q  + A G  +NGS A+GSQ+DG+S+N+TIFVGGLDP+V+DEDLRQPF+++GE+VSVKI
Sbjct  294  SQAVIVAGGHGANGSMANGSQADGESNNSTIFVGGLDPDVTDEDLRQPFTEFGEVVSVKI  353

Query  497  PVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYY  318
            PVGKGCGFVQFANR  A++A+Q L G VIGK TVRLSWGR P   + R D   QW G Y 
Sbjct  354  PVGKGCGFVQFANRKSADDAIQSLNGTVIGKNTVRLSWGRTP--NKWRGDSGQQWNGGYS  411

Query  317  GGH  309
             G+
Sbjct  412  RGY  414



>gb|ACG32072.1| nucleic acid binding protein [Zea mays]
 gb|ACG34530.1| nucleic acid binding protein [Zea mays]
 gb|AFW58432.2| hypothetical protein ZEAMMB73_000058 [Zea mays]
Length=369

 Score =   155 bits (392),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 96/125 (77%), Gaps = 5/125 (4%)
 Frame = -1

Query  635  SPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANR  456
            +P H   SDGDSSN T++VGGLDPNVS+++LR+ F++Y ++ SVKIP+GK CGFVQF +R
Sbjct  231  TPGH---SDGDSSNRTVYVGGLDPNVSEDELRKAFAKY-DLASVKIPLGKQCGFVQFVSR  286

Query  455  TDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPA  276
            TDAEEALQ L G +IGKQ VRLSW R+P+H+QSR D  N+    YYG  FY GY YA P 
Sbjct  287  TDAEEALQGLNGSLIGKQAVRLSWVRSPSHKQSRGDSVNRRNNMYYGTPFYGGYGYASPV  346

Query  275  PHNPN  261
            PH PN
Sbjct  347  PH-PN  350



>ref|XP_006648763.1| PREDICTED: polyadenylate-binding protein RBP47-like [Oryza brachyantha]
Length=378

 Score =   155 bits (392),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 93/120 (78%), Gaps = 2/120 (2%)
 Frame = -1

Query  617  QSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRTDAEEA  438
            QSD DS+N TI+VGGLDPNV++++LR+ F++YG++ SVKIPVGK CGFVQF NR DAEEA
Sbjct  241  QSDNDSTNRTIYVGGLDPNVTEDELRKAFAKYGDLASVKIPVGKQCGFVQFVNRPDAEEA  300

Query  437  LQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGG-HFYDGYTYAFPAPHNPN  261
            LQ L G  IGKQ VRLSWGR+PA +QSR D  ++  G YYG   FY GY YA P PH PN
Sbjct  301  LQGLNGSTIGKQAVRLSWGRSPASKQSRGDSGHRRNGMYYGTPPFYGGYGYASPLPH-PN  359



>ref|XP_009420609.1| PREDICTED: polyadenylate-binding protein RBP45 [Musa acuminata 
subsp. malaccensis]
Length=430

 Score =   156 bits (394),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 82/143 (57%), Positives = 101/143 (71%), Gaps = 7/143 (5%)
 Frame = -1

Query  686  SSGNQQQLPAQGGYSNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVS  507
            S G QQQ  A   +  G    G +S+ D +NTTIFVGGLDPN++D+ LRQ FS YGEIV 
Sbjct  269  SLGTQQQYSANASFQTG---QGDESESDPNNTTIFVGGLDPNITDDHLRQVFSAYGEIVY  325

Query  506  VKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAG  327
            VKIPVGK CGFVQFANR  AEEAL+ L G ++G Q++RLSWGR+PA++Q + D  NQW G
Sbjct  326  VKIPVGKRCGFVQFANRASAEEALRMLNGTLLGGQSIRLSWGRSPANKQPQQD-PNQWNG  384

Query  326  AYYG-GHFYDGYTYAFPAPHNPN  261
            +YYG    YD  TY +  P +PN
Sbjct  385  SYYGYTQSYD--TYGYAPPQDPN  405



>ref|XP_003518846.1| PREDICTED: polyadenylate-binding protein RBP47-like [Glycine 
max]
Length=431

 Score =   156 bits (394),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 94/117 (80%), Gaps = 6/117 (5%)
 Frame = -1

Query  680  GNQQQLPAQ-----GGYS-NGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYG  519
            G QQQ  +Q     GG+S NG+ A GS S+GD +NTTIFVGGLD + SDEDLRQPF Q+G
Sbjct  278  GFQQQYSSQAVVLAGGHSANGAVAQGSHSEGDINNTTIFVGGLDSDTSDEDLRQPFLQFG  337

Query  518  EIVSVKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSD  348
            E+VSVKIPVGKGCGFVQFA+R +AEEA+Q L G VIGKQTVRLSWGR+P ++  RSD
Sbjct  338  EVVSVKIPVGKGCGFVQFADRKNAEEAIQGLNGTVIGKQTVRLSWGRSPGNKHWRSD  394



>ref|XP_008392304.1| PREDICTED: polyadenylate-binding protein RBP47 [Malus domestica]
Length=443

 Score =   156 bits (394),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 78/116 (67%), Positives = 92/116 (79%), Gaps = 1/116 (1%)
 Frame = -1

Query  677  NQQQLPAQGGY-SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVK  501
            +Q  + A GG+ SNG+ A GSQ D + +NTTIFVGGLD  V+DEDLR PFS +GE+VSVK
Sbjct  293  SQALVLAGGGHASNGAVAQGSQFDSEPNNTTIFVGGLDSEVNDEDLRLPFSHFGEVVSVK  352

Query  500  IPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQW  333
            IPVGK CGFVQFANR DAE A+Q L G VIGKQTVRLSWGR+  ++Q RSD +NQW
Sbjct  353  IPVGKACGFVQFANRKDAENAIQMLNGTVIGKQTVRLSWGRSQGNKQWRSDSSNQW  408



>gb|ACF85767.1| unknown [Zea mays]
 gb|AFW58431.2| hypothetical protein ZEAMMB73_000058 [Zea mays]
Length=420

 Score =   155 bits (393),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 96/125 (77%), Gaps = 5/125 (4%)
 Frame = -1

Query  635  SPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANR  456
            +P H   SDGDSSN T++VGGLDPNVS+++LR+ F++Y ++ SVKIP+GK CGFVQF +R
Sbjct  282  TPGH---SDGDSSNRTVYVGGLDPNVSEDELRKAFAKY-DLASVKIPLGKQCGFVQFVSR  337

Query  455  TDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPA  276
            TDAEEALQ L G +IGKQ VRLSW R+P+H+QSR D  N+    YYG  FY GY YA P 
Sbjct  338  TDAEEALQGLNGSLIGKQAVRLSWVRSPSHKQSRGDSVNRRNNMYYGTPFYGGYGYASPV  397

Query  275  PHNPN  261
            PH PN
Sbjct  398  PH-PN  401



>emb|CDY22988.1| BnaC03g40810D [Brassica napus]
Length=420

 Score =   155 bits (393),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 93/118 (79%), Gaps = 1/118 (1%)
 Frame = -1

Query  674  QQQLPAQGGYSNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIP  495
            Q  + A G  +NG  AHGSQSDG+S+N+TIFVGG+DP+V++EDLRQPF+Q+GE+VSVKIP
Sbjct  279  QAVIVAGGHGANGFMAHGSQSDGESNNSTIFVGGIDPDVTEEDLRQPFTQFGEVVSVKIP  338

Query  494  VGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAY  321
            VGKGCGFVQ  NR  A++A+Q L G VIGK TVRLSWGR P ++Q R D   QW G Y
Sbjct  339  VGKGCGFVQLDNRKSADDAIQSLNGTVIGKNTVRLSWGRTP-NKQWRGDSGQQWNGGY  395



>ref|XP_008459212.1| PREDICTED: polyadenylate-binding protein RBP47 [Cucumis melo]
Length=439

 Score =   156 bits (394),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 90/113 (80%), Gaps = 0/113 (0%)
 Frame = -1

Query  671  QQLPAQGGYSNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPV  492
            Q L   GG+ NG    GSQSD +S+NTTIFVGGLD +VSDEDL+  FS++G+++SVKIP+
Sbjct  285  QALVLAGGHPNGMAVQGSQSDSESNNTTIFVGGLDSDVSDEDLKLAFSKFGDVISVKIPI  344

Query  491  GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQW  333
            GKGCGFVQFANR +AE+ALQ L G VIGKQTVRLSWGR+  ++Q R D  NQW
Sbjct  345  GKGCGFVQFANRKNAEDALQGLNGTVIGKQTVRLSWGRSTGNKQWRGDSNNQW  397



>ref|NP_001150649.1| nucleic acid binding protein [Zea mays]
 gb|ACG39896.1| nucleic acid binding protein [Zea mays]
Length=420

 Score =   155 bits (393),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 96/125 (77%), Gaps = 5/125 (4%)
 Frame = -1

Query  635  SPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANR  456
            +P H   SDGDSSN T++VGGLDPNVS+++LR+ F++Y ++ SVKIP+GK CGFVQF +R
Sbjct  282  TPGH---SDGDSSNRTVYVGGLDPNVSEDELRKAFAKY-DLASVKIPLGKQCGFVQFVSR  337

Query  455  TDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPA  276
            TDAEEALQ L G +IGKQ VRLSW R+P+H+QSR D  N+    YYG  FY GY YA P 
Sbjct  338  TDAEEALQGLNGSLIGKQAVRLSWVRSPSHKQSRGDSVNRRNNMYYGTPFYGGYGYASPV  397

Query  275  PHNPN  261
            PH PN
Sbjct  398  PH-PN  401



>ref|XP_010523211.1| PREDICTED: polyadenylate-binding protein RBP47B-like [Tarenaya 
hassleriana]
Length=449

 Score =   156 bits (394),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 94/119 (79%), Gaps = 1/119 (1%)
 Frame = -1

Query  635  SPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANR  456
            S   G  SDG+S N+TIFVGGLD +V+DEDLRQPFSQ+G++VSVKIP+GKGCGFVQFA+R
Sbjct  315  SVTQGPPSDGESINSTIFVGGLDADVTDEDLRQPFSQFGDVVSVKIPIGKGCGFVQFADR  374

Query  455  TDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYY-GGHFYDGYTYAF  282
              AEEA+Q L G VIGK TVRLSWGR+P ++Q RSD ++QW G Y  GG  Y+  + A+
Sbjct  375  KSAEEAIQTLNGTVIGKNTVRLSWGRSPGNKQWRSDSSHQWNGGYTRGGQGYNNNSNAY  433



>ref|XP_002891364.1| ATRBP47C [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67623.1| ATRBP47C [Arabidopsis lyrata subsp. lyrata]
Length=443

 Score =   155 bits (393),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 98/154 (64%), Positives = 114/154 (74%), Gaps = 4/154 (3%)
 Frame = -1

Query  656  QGGYS-NGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGC  480
            QGGY  NG+    ++ +GD+ NTTIFVGGLD +V+D+DLRQPFS++GEIVSVKIPVGKGC
Sbjct  293  QGGYMPNGA---LTRPEGDTLNTTIFVGGLDSSVTDDDLRQPFSEFGEIVSVKIPVGKGC  349

Query  479  GFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYD  300
            GFVQF NR  AEEAL+KL G VIGKQTVRLSWGRN A++Q R  + NQW   YYGG +Y+
Sbjct  350  GFVQFVNRPSAEEALEKLNGTVIGKQTVRLSWGRNQANKQPRDKYGNQWVAPYYGGQYYN  409

Query  299  GYTYAFPAPHNPNmyapaaygaypmyGTHQQQVS  198
            GY Y  P P      A    G Y MYG HQQQVS
Sbjct  410  GYGYMVPQPDPRMYPATPYGGGYRMYGGHQQQVS  443



>ref|XP_004505196.1| PREDICTED: polyadenylate-binding protein RBP47-like [Cicer arietinum]
Length=442

 Score =   155 bits (392),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 77/117 (66%), Positives = 96/117 (82%), Gaps = 6/117 (5%)
 Frame = -1

Query  680  GNQQQLPAQ-----GGYS-NGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYG  519
            GN QQ  +Q     GG+S NG+ A GSQS+GDS+NTTIFVGGLD ++SDEDLRQPF Q+G
Sbjct  284  GNPQQYASQAVVLAGGHSSNGAVAQGSQSEGDSNNTTIFVGGLDSDISDEDLRQPFLQFG  343

Query  518  EIVSVKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSD  348
            ++VSVKIPVGKGCGFVQ A+R +AE+A+Q L G +IGKQTVRLSWGR+P ++  R+D
Sbjct  344  DVVSVKIPVGKGCGFVQLADRKNAEDAIQALNGTMIGKQTVRLSWGRSPGNKHWRND  400



>ref|NP_001144988.1| uncharacterized protein LOC100278143 [Zea mays]
 gb|ACG44236.1| hypothetical protein [Zea mays]
Length=436

 Score =   155 bits (392),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 79/115 (69%), Positives = 88/115 (77%), Gaps = 3/115 (3%)
 Frame = -1

Query  608  GDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRTDAEEALQK  429
            GD +NTT+FVGGLDPNVS+EDLRQ FSQYGEI SVKIP+GK CGFVQFA R +AE+ALQ 
Sbjct  297  GDLTNTTVFVGGLDPNVSEEDLRQTFSQYGEISSVKIPIGKQCGFVQFAQRKNAEDALQG  356

Query  428  LKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQW--AGAYYGG-HFYDGYTYAFPAP  273
            L G  IGKQ VRLSWGRNPA++Q R D  NQW   G YY    FY+GY Y   AP
Sbjct  357  LNGSTIGKQNVRLSWGRNPANKQFRGDNGNQWNNGGMYYAAPPFYNGYGYPAAAP  411



>gb|ACF87959.1| unknown [Zea mays]
 tpg|DAA61808.1| TPA: hypothetical protein ZEAMMB73_995180 [Zea mays]
Length=433

 Score =   155 bits (391),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 79/115 (69%), Positives = 88/115 (77%), Gaps = 3/115 (3%)
 Frame = -1

Query  608  GDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRTDAEEALQK  429
            GD +NTT+FVGGLDPNVS+EDLRQ FSQYGEI SVKIP+GK CGFVQFA R +AE+ALQ 
Sbjct  294  GDLTNTTVFVGGLDPNVSEEDLRQTFSQYGEISSVKIPIGKQCGFVQFAQRKNAEDALQG  353

Query  428  LKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQW--AGAYYGG-HFYDGYTYAFPAP  273
            L G  IGKQ VRLSWGRNPA++Q R D  NQW   G YY    FY+GY Y   AP
Sbjct  354  LNGSTIGKQNVRLSWGRNPANKQFRGDNGNQWNNGGMYYAAPPFYNGYGYPAAAP  408



>ref|XP_010519119.1| PREDICTED: LOW QUALITY PROTEIN: polyadenylate-binding protein 
RBP47C-like [Tarenaya hassleriana]
Length=424

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 107/155 (69%), Positives = 121/155 (78%), Gaps = 8/155 (5%)
 Frame = -1

Query  656  QGGYSNGSPAHGSQS--DGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKG  483
            QGGY      +G QS  DGDS NTTIFVGGLDP+V+DEDLRQPF +YG+IVS   P GKG
Sbjct  276  QGGYM----LNGVQSYPDGDSLNTTIFVGGLDPSVTDEDLRQPFIEYGDIVSX--PAGKG  329

Query  482  CGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFY  303
            CGFVQF NRT AEEAL+KL G VIGKQTVRLSWGRNPA++Q R  F NQW G YYGG +Y
Sbjct  330  CGFVQFVNRTSAEEALEKLNGTVIGKQTVRLSWGRNPANKQLRGGFGNQWVGPYYGGQYY  389

Query  302  DGYTYAFPAPHNPNmyapaaygaypmyGTHQQQVS  198
            +GY Y  P P +P MY+PAAYGAYP+Y  +QQQVS
Sbjct  390  NGYGYMIPPPLDPIMYSPAAYGAYPVYVGNQQQVS  424



>ref|XP_008782206.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X2 
[Phoenix dactylifera]
Length=385

 Score =   152 bits (385),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 75/117 (64%), Positives = 92/117 (79%), Gaps = 1/117 (1%)
 Frame = -1

Query  659  AQGGY-SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKG  483
            + GG+ SNG+ A   QSDGD +NTT+FVGGLDPNVS++DL+Q FSQYGE+ SVKIPVGK 
Sbjct  258  SSGGFGSNGASAQSFQSDGDPTNTTVFVGGLDPNVSEDDLKQAFSQYGEVASVKIPVGKQ  317

Query  482  CGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGG  312
            CGFVQF +R +AEEALQ+L G VIGKQ VRLSWGRNP ++QS S  + +W   +  G
Sbjct  318  CGFVQFVHRNNAEEALQQLNGTVIGKQLVRLSWGRNPTNKQSSSWQSLEWCIPWRTG  374



>ref|XP_009412453.1| PREDICTED: polyadenylate-binding protein RBP45 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009412454.1| PREDICTED: polyadenylate-binding protein RBP45 [Musa acuminata 
subsp. malaccensis]
Length=453

 Score =   154 bits (388),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 81/141 (57%), Positives = 100/141 (71%), Gaps = 7/141 (5%)
 Frame = -1

Query  680  GNQQQLPAQGGYSNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVK  501
            G QQQ P    Y N   A G++S+ D +NTTIFVGGLD NV+D+ LRQ FS YGEIV VK
Sbjct  281  GTQQQYPTNASYQN---AQGAESENDPNNTTIFVGGLDTNVTDDHLRQVFSTYGEIVYVK  337

Query  500  IPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAY  321
            IPVGK CGFVQFA+R +AEEAL+ L G  +G Q +RLSWGR+PA++Q + D  NQW G+Y
Sbjct  338  IPVGKRCGFVQFASRANAEEALRMLNGTPLGGQNIRLSWGRSPANKQPQQD-PNQWNGSY  396

Query  320  YGGHFYDGY-TYAFPAPHNPN  261
            YG  +   Y TY +  P +PN
Sbjct  397  YG--YAQNYNTYGYTPPQDPN  415



>ref|XP_004294842.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X1 
[Fragaria vesca subsp. vesca]
Length=454

 Score =   153 bits (387),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 81/125 (65%), Positives = 96/125 (77%), Gaps = 7/125 (6%)
 Frame = -1

Query  686  SSGNQQQLPAQG-------GYSNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFS  528
            SSG QQQ  +Q        G++NG  A GSQSDG+ +NTTIFVGGLD +V++EDLRQPFS
Sbjct  294  SSGYQQQYSSQALVLAGGGGHANGGVAQGSQSDGEPNNTTIFVGGLDSDVNEEDLRQPFS  353

Query  527  QYGEIVSVKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSD  348
            Q+GE++SVKIPVGK CGFVQFANR DAE A+  L   VIGKQTVRLSWGR+  ++Q RSD
Sbjct  354  QFGEVISVKIPVGKACGFVQFANRKDAENAMNMLNATVIGKQTVRLSWGRSQGNKQWRSD  413

Query  347  FTNQW  333
              NQW
Sbjct  414  SNNQW  418



>emb|CDY50959.1| BnaA06g37550D [Brassica napus]
Length=430

 Score =   153 bits (386),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 94/129 (73%), Gaps = 5/129 (4%)
 Frame = -1

Query  671  QQLPAQGGYSNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPV  492
            Q L   GG+      +GS SDGDS+N+TIFVGGLD +V++EDL QPFSQ+GE+VSVKIPV
Sbjct  289  QALTLAGGHG----GNGSMSDGDSNNSTIFVGGLDADVTEEDLMQPFSQFGEVVSVKIPV  344

Query  491  GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGG  312
            GKGCGFVQF NR  AEEA+  L G VIGK TVRLSWGR+P +RQ R D  +QW G Y  G
Sbjct  345  GKGCGFVQFGNRQSAEEAIGNLNGTVIGKNTVRLSWGRSP-NRQWRGDSGHQWNGGYSRG  403

Query  311  HFYDGYTYA  285
              Y+   YA
Sbjct  404  QGYNNNGYA  412



>ref|XP_009147873.1| PREDICTED: polyadenylate-binding protein RBP47A [Brassica rapa]
Length=431

 Score =   153 bits (386),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 94/129 (73%), Gaps = 5/129 (4%)
 Frame = -1

Query  671  QQLPAQGGYSNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPV  492
            Q L   GG+      +GS SDGDS+N+TIFVGGLD +V++EDL QPFSQ+GE+VSVKIPV
Sbjct  290  QALTLAGGHG----GNGSMSDGDSNNSTIFVGGLDADVTEEDLMQPFSQFGEVVSVKIPV  345

Query  491  GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGG  312
            GKGCGFVQF NR  AEEA+  L G VIGK TVRLSWGR+P +RQ R D  +QW G Y  G
Sbjct  346  GKGCGFVQFGNRQSAEEAIGSLNGTVIGKNTVRLSWGRSP-NRQWRGDSGHQWNGGYSRG  404

Query  311  HFYDGYTYA  285
              Y+   YA
Sbjct  405  QGYNNNGYA  413



>ref|XP_009418782.1| PREDICTED: polyadenylate-binding protein RBP45-like [Musa acuminata 
subsp. malaccensis]
Length=443

 Score =   153 bits (386),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 82/141 (58%), Positives = 97/141 (69%), Gaps = 7/141 (5%)
 Frame = -1

Query  680  GNQQQLPAQGGYSNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVK  501
            G QQQ PA   Y       G++S+ D +NTTIFVGGLDPNV+D+ LRQ F  YGEIV VK
Sbjct  286  GAQQQYPANASYQT---TQGAESENDPNNTTIFVGGLDPNVTDDHLRQVFGPYGEIVYVK  342

Query  500  IPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAY  321
            IPVGK CGFVQFANR +AEEAL+ L G  +G Q +RLSWGR+P ++Q + D  NQW G Y
Sbjct  343  IPVGKRCGFVQFANRANAEEALRALNGTSLGGQNIRLSWGRSPTNKQPQQD-PNQWNGGY  401

Query  320  YG-GHFYDGYTYAFPAPHNPN  261
            YG    YD Y YA   P +PN
Sbjct  402  YGYTQSYDAYGYA--PPQDPN  420



>gb|KDO36653.1| hypothetical protein CISIN_1g037126mg, partial [Citrus sinensis]
Length=192

 Score =   147 bits (370),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 79/125 (63%), Positives = 94/125 (75%), Gaps = 4/125 (3%)
 Frame = -1

Query  686  SSGNQQQLPAQGGYSNGSPA-HGSQ---SDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYG  519
            +SG QQQ  +Q     G PA +G++   SDG+S+N TIFVG LD +VSD+DLR+PFS +G
Sbjct  52   ASGYQQQCSSQALVLAGGPASNGTRVQGSDGESNNATIFVGALDSDVSDKDLREPFSHFG  111

Query  518  EIVSVKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTN  339
            EI+SVKIPVGKGCGFVQFANR DAE ALQKL+G  IGKQTVRLS G NP ++Q R D  N
Sbjct  112  EILSVKIPVGKGCGFVQFANRKDAEVALQKLQGTAIGKQTVRLSSGHNPGNKQWRGDHIN  171

Query  338  QWAGA  324
              A A
Sbjct  172  LIALA  176



>ref|XP_002452313.1| hypothetical protein SORBIDRAFT_04g023540 [Sorghum bicolor]
 gb|EES05289.1| hypothetical protein SORBIDRAFT_04g023540 [Sorghum bicolor]
Length=435

 Score =   153 bits (386),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 77/123 (63%), Positives = 92/123 (75%), Gaps = 5/123 (4%)
 Frame = -1

Query  617  QSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRTDAEEA  438
            QSD DS+N T++VGGLDPNVS+++LR+ F++YG++ SVKIP GK CGFVQF NR DAEEA
Sbjct  295  QSDVDSTNRTVYVGGLDPNVSEDELRKAFAKYGDLASVKIPFGKQCGFVQFVNRADAEEA  354

Query  437  LQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQW----AGAYYGGHFYDGYTYAFPAPH  270
            LQ L G  IGKQ VRLSWGR+PA +QSR D  ++      G YYG  FY GY YA P PH
Sbjct  355  LQGLNGATIGKQAVRLSWGRSPASKQSRGDSGHRRNGNGNGMYYGTPFYSGYGYASPVPH  414

Query  269  NPN  261
             PN
Sbjct  415  -PN  416



>gb|ABK24911.1| unknown [Picea sitchensis]
Length=397

 Score =   152 bits (383),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 94/133 (71%), Gaps = 9/133 (7%)
 Frame = -1

Query  647  YSNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQ  468
            Y       G QSD D +NTTIFVGGLDPN +DEDLRQ F  +GEIV VKIPVGKGCGFVQ
Sbjct  245  YGGAVAGQGFQSDNDPNNTTIFVGGLDPNATDEDLRQVFGPFGEIVYVKIPVGKGCGFVQ  304

Query  467  FANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRS------DFTNQW--AGAYYG-  315
            F NR+ AEEALQKL G +IG+Q++RLSWGR+PA++Q+ S         NQW   GAYY  
Sbjct  305  FTNRSSAEEALQKLHGTIIGQQSIRLSWGRSPANKQTASWGVQPQPDPNQWNGGGAYYSY  364

Query  314  GHFYDGYTYAFPA  276
            G  Y+ Y YA PA
Sbjct  365  GQGYEAYGYAPPA  377



>ref|XP_009145825.1| PREDICTED: polyadenylate-binding protein RBP47B-like [Brassica 
rapa]
Length=426

 Score =   152 bits (384),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 82/137 (60%), Positives = 102/137 (74%), Gaps = 12/137 (9%)
 Frame = -1

Query  677  NQQQLPAQ-----GGY-SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGE  516
            NQQQ  +Q     GG+ +NG  AHGSQSDGDS+N+TIFVGGLDP++++EDLRQPF+Q+GE
Sbjct  284  NQQQHSSQAVIVAGGHGANGFTAHGSQSDGDSNNSTIFVGGLDPDLTEEDLRQPFTQFGE  343

Query  515  IVSVKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQ  336
            +VSVKIP+GKGCGFVQ +NR  A++A+Q L G VIGK TVRLSWGR P ++Q R D    
Sbjct  344  VVSVKIPLGKGCGFVQLSNRKSADDAIQSLNGTVIGKNTVRLSWGRTP-NKQWRGD----  398

Query  335  WAGAYYGGHFYDGYTYA  285
              G Y  G  Y+   YA
Sbjct  399  -NGGYSRGQGYNNGGYA  414



>ref|XP_011092726.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X1 
[Sesamum indicum]
Length=403

 Score =   152 bits (383),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 95/132 (72%), Gaps = 9/132 (7%)
 Frame = -1

Query  671  QQLPAQGGYSNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPV  492
            Q +   GGY++        SD DSSNTT+FVGGLD +V+DE LR+ F+ YGE+VSVKIP 
Sbjct  265  QAMVLSGGYASNGAGPVGHSDSDSSNTTVFVGGLDSDVTDEQLRESFTPYGEVVSVKIPA  324

Query  491  GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGG  312
            GKGCGFVQFANR++AE+A+Q+L G VIGKQTVRLSWGRN  ++Q+         GAYYG 
Sbjct  325  GKGCGFVQFANRSNAEDAIQRLNGTVIGKQTVRLSWGRNLGNKQN---------GAYYGR  375

Query  311  HFYDGYTYAFPA  276
              Y+GY YA  A
Sbjct  376  QGYNGYGYAGAA  387



>ref|XP_002894197.1| hypothetical protein ARALYDRAFT_474095 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70456.1| hypothetical protein ARALYDRAFT_474095 [Arabidopsis lyrata subsp. 
lyrata]
Length=450

 Score =   152 bits (384),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 79/124 (64%), Positives = 94/124 (76%), Gaps = 5/124 (4%)
 Frame = -1

Query  671  QQLPAQGGYSNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPV  492
            Q L   GG+      +GS SDG+S+N+TIFVGGLD +V++EDL QPFSQ+GE+VSVKIPV
Sbjct  310  QALTLAGGHG----GNGSLSDGESNNSTIFVGGLDADVTEEDLMQPFSQFGEVVSVKIPV  365

Query  491  GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGG  312
            GKGCGFVQFANR  AEEA+  L G VIGK TVRLSWGR+P ++Q RSD  NQW G Y  G
Sbjct  366  GKGCGFVQFANRQSAEEAIGNLNGTVIGKNTVRLSWGRSP-NKQWRSDTGNQWNGGYSRG  424

Query  311  HFYD  300
              Y+
Sbjct  425  QGYN  428



>dbj|BAB02953.1| DNA/RNA binding protein-like [Arabidopsis thaliana]
Length=489

 Score =   153 bits (386),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/109 (70%), Positives = 90/109 (83%), Gaps = 6/109 (6%)
 Frame = -1

Query  680  GNQQQLPAQ-----GGY-SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYG  519
             NQQQ  +Q     GG+ SNGS  +GSQSDG+S+N TIFVGG+DP+V DEDLRQPFSQ+G
Sbjct  286  ANQQQHSSQAVILAGGHGSNGSMGYGSQSDGESTNATIFVGGIDPDVIDEDLRQPFSQFG  345

Query  518  EIVSVKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNP  372
            E+VSVKIPVGKGCGFVQFA+R  AE+A++ L G VIGK TVRLSWGR+P
Sbjct  346  EVVSVKIPVGKGCGFVQFADRKSAEDAIESLNGTVIGKNTVRLSWGRSP  394



>ref|XP_010500505.1| PREDICTED: polyadenylate-binding protein RBP47A-like [Camelina 
sativa]
Length=447

 Score =   152 bits (384),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 77/124 (62%), Positives = 94/124 (76%), Gaps = 5/124 (4%)
 Frame = -1

Query  671  QQLPAQGGYSNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPV  492
            Q L   GG+      +GS SDG+S+N+TIFVGG+DP+V++EDL QPFSQ+GE++SVKIPV
Sbjct  307  QALTLAGGHG----GNGSLSDGESNNSTIFVGGIDPDVTEEDLMQPFSQFGEVISVKIPV  362

Query  491  GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGG  312
            GKGCGFVQFANR  AEEA+  L G VIGK TVRLSWGR+P ++Q R D  NQW G Y  G
Sbjct  363  GKGCGFVQFANRQSAEEAIGNLNGTVIGKNTVRLSWGRSP-NKQWRGDSGNQWNGGYSRG  421

Query  311  HFYD  300
              Y+
Sbjct  422  QGYN  425



>ref|XP_010479396.1| PREDICTED: polyadenylate-binding protein RBP47A isoform X1 [Camelina 
sativa]
 ref|XP_010479397.1| PREDICTED: polyadenylate-binding protein RBP47A isoform X2 [Camelina 
sativa]
Length=454

 Score =   152 bits (384),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 77/124 (62%), Positives = 94/124 (76%), Gaps = 5/124 (4%)
 Frame = -1

Query  671  QQLPAQGGYSNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPV  492
            Q L   GG+      +GS SDG+S+N+TIFVGG+DP+V++EDL QPFSQ+GE++SVKIPV
Sbjct  314  QALTLAGGHG----GNGSLSDGESNNSTIFVGGIDPDVTEEDLMQPFSQFGEVISVKIPV  369

Query  491  GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGG  312
            GKGCGFVQFANR  AEEA+  L G VIGK TVRLSWGR+P ++Q R D  NQW G Y  G
Sbjct  370  GKGCGFVQFANRQSAEEAIGNLNGTVIGKNTVRLSWGRSP-NKQWRGDSGNQWNGGYSRG  428

Query  311  HFYD  300
              Y+
Sbjct  429  QGYN  432



>emb|CDX92304.1| BnaA05g21030D [Brassica napus]
Length=424

 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 82/137 (60%), Positives = 102/137 (74%), Gaps = 12/137 (9%)
 Frame = -1

Query  677  NQQQLPAQ-----GGY-SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGE  516
            NQQQ  +Q     GG+ +NG  AHGSQSDGDS+N+TIFVGGLDP++++EDLRQPF+Q+GE
Sbjct  282  NQQQHSSQAVIVAGGHGANGFTAHGSQSDGDSNNSTIFVGGLDPDLTEEDLRQPFTQFGE  341

Query  515  IVSVKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQ  336
            +VSVKIP+GKGCGFVQ +NR  A++A+Q L G VIGK TVRLSWGR P ++Q R D    
Sbjct  342  VVSVKIPLGKGCGFVQLSNRKSADDAIQSLNGTVIGKNTVRLSWGRTP-NKQWRGD----  396

Query  335  WAGAYYGGHFYDGYTYA  285
              G Y  G  Y+   YA
Sbjct  397  -NGGYSRGQGYNNGGYA  412



>emb|CDY28101.1| BnaC06g02820D [Brassica napus]
Length=429

 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 79/129 (61%), Positives = 94/129 (73%), Gaps = 5/129 (4%)
 Frame = -1

Query  671  QQLPAQGGYSNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPV  492
            Q L   GG+      +GS SDGDS+N+TIFVGGLD +V+++DL QPFSQ+GE+VSVKIPV
Sbjct  288  QALTLAGGHG----GNGSMSDGDSNNSTIFVGGLDADVTEDDLMQPFSQFGEVVSVKIPV  343

Query  491  GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGG  312
            GKGCGFVQF NR  AEEA+  L G VIGK TVRLSWGR+P +RQ R D  +QW G Y  G
Sbjct  344  GKGCGFVQFGNRQSAEEAIGSLNGTVIGKNTVRLSWGRSP-NRQWRGDSGHQWNGGYSRG  402

Query  311  HFYDGYTYA  285
              Y+   YA
Sbjct  403  QGYNNNGYA  411



>ref|XP_010461802.1| PREDICTED: polyadenylate-binding protein RBP47A-like isoform 
X1 [Camelina sativa]
 ref|XP_010461803.1| PREDICTED: polyadenylate-binding protein RBP47A-like isoform 
X2 [Camelina sativa]
Length=455

 Score =   152 bits (383),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 77/124 (62%), Positives = 94/124 (76%), Gaps = 5/124 (4%)
 Frame = -1

Query  671  QQLPAQGGYSNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPV  492
            Q L   GG+      +GS SDG+S+N+TIFVGG+DP+V++EDL QPFSQ+GE++SVKIPV
Sbjct  315  QALTLAGGHG----GNGSLSDGESNNSTIFVGGIDPDVTEEDLMQPFSQFGEVISVKIPV  370

Query  491  GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGG  312
            GKGCGFVQFANR  AEEA+  L G VIGK TVRLSWGR+P ++Q R D  NQW G Y  G
Sbjct  371  GKGCGFVQFANRQSAEEAIGNLNGTVIGKNTVRLSWGRSP-NKQWRGDSGNQWNGGYSRG  429

Query  311  HFYD  300
              Y+
Sbjct  430  QGYN  433



>emb|CDY16528.1| BnaA08g02390D [Brassica napus]
Length=424

 Score =   150 bits (380),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 79/127 (62%), Positives = 96/127 (76%), Gaps = 6/127 (5%)
 Frame = -1

Query  671  QQLPAQGGYSNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPV  492
            Q L   GG+     A+GS SDGDS+N+TIFVGG+D +V++EDL QPFSQ+GE+VSVKIPV
Sbjct  284  QALTLAGGHG----ANGSASDGDSNNSTIFVGGIDADVTEEDLMQPFSQFGEVVSVKIPV  339

Query  491  GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGG  312
            GKGCGFVQF NR  AEEA++ L G VIGK TVRLSWGR+P +RQ R +  +QW G Y  G
Sbjct  340  GKGCGFVQFGNRKSAEEAIENLNGTVIGKNTVRLSWGRSP-NRQWRGEAGHQWNGGYSRG  398

Query  311  HFY-DGY  294
              Y +GY
Sbjct  399  QGYSNGY  405



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1131443780880