BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF027E17

Length=702
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010552451.1|  PREDICTED: auxin-responsive protein IAA14-like     214   3e-65   Tarenaya hassleriana [spider flower]
emb|CDO99148.1|  unnamed protein product                                213   4e-65   Coffea canephora [robusta coffee]
emb|CBI26357.3|  unnamed protein product                                213   5e-65   Vitis vinifera
ref|XP_002284133.1|  PREDICTED: auxin-responsive protein IAA14          213   6e-65   Vitis vinifera
ref|XP_009611797.1|  PREDICTED: auxin-responsive protein IAA14          212   2e-64   Nicotiana tomentosiformis
ref|XP_009591035.1|  PREDICTED: auxin-responsive protein IAA7-like      211   2e-64   Nicotiana tomentosiformis
ref|XP_011091113.1|  PREDICTED: auxin-responsive protein IAA14          211   3e-64   Sesamum indicum [beniseed]
gb|KDP40274.1|  hypothetical protein JCGZ_02272                         211   6e-64   Jatropha curcas
ref|XP_002517023.1|  Auxin-responsive protein IAA7, putative            208   7e-64   
ref|XP_009776553.1|  PREDICTED: auxin-responsive protein IAA14-like     210   9e-64   Nicotiana sylvestris
gb|ABM53874.1|  IAA6                                                    207   1e-63   Cestrum elegans
ref|XP_011030586.1|  PREDICTED: auxin-responsive protein IAA14-li...    210   1e-63   Populus euphratica
ref|XP_007034956.1|  Indole-3-acetic acid 7 isoform 1                   209   3e-63   
ref|XP_002315736.1|  aux/IAA family protein                             210   3e-63   Populus trichocarpa [western balsam poplar]
ref|XP_007143877.1|  hypothetical protein PHAVU_007G109500g             208   5e-63   Phaseolus vulgaris [French bean]
ref|NP_001275031.1|  auxin-responsive protein IAA14-like                207   5e-63   Solanum tuberosum [potatoes]
ref|XP_002311658.1|  aux/IAA family protein                             208   6e-63   Populus trichocarpa [western balsam poplar]
gb|EYU32514.1|  hypothetical protein MIMGU_mgv1a012542mg                208   7e-63   Erythranthe guttata [common monkey flower]
ref|XP_004172452.1|  PREDICTED: auxin-responsive protein IAA14-like     208   8e-63   
gb|AFZ78617.1|  hypothetical protein                                    208   9e-63   Populus tomentosa [Chinese white poplar]
ref|XP_008465181.1|  PREDICTED: auxin-responsive protein IAA14-like     208   9e-63   Cucumis melo [Oriental melon]
ref|XP_009777122.1|  PREDICTED: auxin-responsive protein IAA14-like     207   1e-62   Nicotiana sylvestris
ref|XP_011027555.1|  PREDICTED: auxin-responsive protein IAA14 is...    207   2e-62   Populus euphratica
gb|AFK44393.1|  unknown                                                 207   2e-62   Lotus japonicus
ref|NP_001266070.1|  IAA14                                              207   2e-62   Solanum lycopersicum
gb|KHN05057.1|  Auxin-responsive protein IAA14                          207   2e-62   Glycine soja [wild soybean]
ref|XP_006362195.1|  PREDICTED: auxin-responsive protein IAA14-like     206   3e-62   Solanum tuberosum [potatoes]
ref|XP_007223810.1|  hypothetical protein PRUPE_ppa010698mg             206   3e-62   
ref|NP_001266039.1|  IAA7 protein                                       205   4e-62   Solanum lycopersicum
gb|ADJ68049.1|  auxin responsive protein                                206   4e-62   Catharanthus roseus [chatas]
gb|AEE25653.1|  auxin-responsive protein                                206   4e-62   Gossypium hirsutum [American cotton]
gb|EYU33008.1|  hypothetical protein MIMGU_mgv1a012321mg                206   5e-62   Erythranthe guttata [common monkey flower]
gb|KHF98789.1|  Auxin-responsive IAA14 -like protein                    206   5e-62   Gossypium arboreum [tree cotton]
gb|KJB38280.1|  hypothetical protein B456_006G246000                    206   5e-62   Gossypium raimondii
ref|NP_001240213.1|  auxin-induced protein ali50                        205   1e-61   Glycine max [soybeans]
ref|XP_011030585.1|  PREDICTED: auxin-responsive protein IAA14-li...    205   1e-61   Populus euphratica
ref|XP_006420094.1|  hypothetical protein CICLE_v10005789mg             204   1e-61   Citrus clementina [clementine]
ref|XP_011073485.1|  PREDICTED: auxin-responsive protein IAA14          205   1e-61   Sesamum indicum [beniseed]
gb|KJB38278.1|  hypothetical protein B456_006G246000                    206   1e-61   Gossypium raimondii
gb|AFK37379.1|  unknown                                                 204   1e-61   Medicago truncatula
ref|XP_010532600.1|  PREDICTED: auxin-responsive protein IAA14          204   1e-61   Tarenaya hassleriana [spider flower]
ref|XP_008224185.1|  PREDICTED: auxin-responsive protein IAA14          205   1e-61   Prunus mume [ume]
ref|XP_003591806.1|  Indoleacetic acid-induced-like protein             204   2e-61   Medicago truncatula
gb|AAM65301.1|  indoleacetic acid (IAA)-inducible gene (IAA7)           204   3e-61   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010466604.1|  PREDICTED: auxin-responsive protein IAA7-like      204   3e-61   Camelina sativa [gold-of-pleasure]
gb|KFK39592.1|  hypothetical protein AALP_AA3G264300                    203   3e-61   Arabis alpina [alpine rockcress]
ref|XP_010551700.1|  PREDICTED: auxin-responsive protein IAA14          203   3e-61   Tarenaya hassleriana [spider flower]
emb|CAC84710.1|  aux/IAA protein                                        204   3e-61   Populus tremula x Populus tremuloides
ref|XP_010512022.1|  PREDICTED: auxin-responsive protein IAA7           203   4e-61   Camelina sativa [gold-of-pleasure]
ref|XP_010488346.1|  PREDICTED: auxin-responsive protein IAA7-like      203   4e-61   Camelina sativa [gold-of-pleasure]
ref|XP_003556389.2|  PREDICTED: auxin-responsive protein IAA14-like     206   4e-61   
ref|XP_006406100.1|  hypothetical protein EUTSA_v10021428mg             203   5e-61   Eutrema salsugineum [saltwater cress]
ref|XP_006298251.1|  hypothetical protein CARUB_v10014321mg             204   5e-61   
ref|XP_002883395.1|  hypothetical protein ARALYDRAFT_319024             203   6e-61   Arabidopsis lyrata subsp. lyrata
ref|NP_188945.1|  auxin-responsive protein IAA7                         203   6e-61   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004288427.1|  PREDICTED: auxin-responsive protein IAA14-like     202   8e-61   Fragaria vesca subsp. vesca
ref|XP_010024036.1|  PREDICTED: auxin-responsive protein IAA14-like     202   8e-61   Eucalyptus grandis [rose gum]
ref|XP_008438588.1|  PREDICTED: auxin-responsive protein IAA14-like     202   1e-60   Cucumis melo [Oriental melon]
ref|XP_004134096.1|  PREDICTED: auxin-responsive protein IAA14-li...    202   1e-60   Cucumis sativus [cucumbers]
ref|XP_011027545.1|  PREDICTED: auxin-responsive protein IAA14 is...    202   1e-60   Populus euphratica
gb|KJB28413.1|  hypothetical protein B456_005G046500                    202   1e-60   Gossypium raimondii
gb|KFK24541.1|  hypothetical protein AALP_AAs58011U000100               202   1e-60   Arabis alpina [alpine rockcress]
ref|XP_004495392.1|  PREDICTED: auxin-responsive protein IAA14-li...    202   1e-60   Cicer arietinum [garbanzo]
ref|XP_010274203.1|  PREDICTED: auxin-responsive protein IAA16-like     202   2e-60   Nelumbo nucifera [Indian lotus]
ref|XP_010435110.1|  PREDICTED: auxin-responsive protein IAA14          201   2e-60   Camelina sativa [gold-of-pleasure]
ref|XP_010440448.1|  PREDICTED: auxin-responsive protein IAA14-like     201   2e-60   Camelina sativa [gold-of-pleasure]
ref|XP_006414696.1|  hypothetical protein EUTSA_v10026031mg             202   3e-60   
ref|XP_006284476.1|  hypothetical protein CARUB_v10005662mg             201   3e-60   Capsella rubella
emb|CDY10694.1|  BnaA05g16680D                                          199   3e-60   Brassica napus [oilseed rape]
emb|CDY10349.1|  BnaC05g29300D                                          201   4e-60   Brassica napus [oilseed rape]
gb|KHG01271.1|  Auxin-responsive IAA14 -like protein                    201   4e-60   Gossypium arboreum [tree cotton]
gb|KJB82525.1|  hypothetical protein B456_013G200700                    201   4e-60   Gossypium raimondii
gb|AEE25654.1|  auxin-responsive protein                                201   5e-60   Gossypium hirsutum [American cotton]
ref|XP_009135842.1|  PREDICTED: auxin-responsive protein IAA7-like      200   5e-60   Brassica rapa
ref|XP_011038568.1|  PREDICTED: auxin-responsive protein IAA16-like     200   6e-60   Populus euphratica
ref|NP_001288823.1|  auxin-responsive protein IAA7                      200   7e-60   Brassica rapa
ref|XP_010679165.1|  PREDICTED: auxin-responsive protein IAA14-like     201   9e-60   
ref|XP_007030567.1|  Indoleacetic acid-induced protein 16               200   1e-59   
gb|AFS44507.1|  auxin repressor                                         199   1e-59   Fragaria x ananassa
ref|XP_010102292.1|  Auxin-responsive protein IAA16                     200   1e-59   Morus notabilis
ref|NP_001275398.1|  auxin/indole-3-acetic acid 3                       200   1e-59   Solanum tuberosum [potatoes]
gb|KDP23667.1|  hypothetical protein JCGZ_23500                         199   1e-59   Jatropha curcas
ref|NP_001266049.1|  IAA9 protein                                       199   2e-59   Solanum lycopersicum
gb|AAC49055.1|  IAA14                                                   196   2e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010278165.1|  PREDICTED: auxin-responsive protein IAA16-like     199   2e-59   Nelumbo nucifera [Indian lotus]
gb|KHG19190.1|  Auxin-responsive IAA16 -like protein                    199   2e-59   Gossypium arboreum [tree cotton]
ref|XP_010450026.1|  PREDICTED: auxin-responsive protein IAA14-like     198   3e-59   Camelina sativa [gold-of-pleasure]
ref|XP_002319075.1|  hypothetical protein POPTR_0013s03870g             199   3e-59   Populus trichocarpa [western balsam poplar]
emb|CBI35213.3|  unnamed protein product                                196   3e-59   Vitis vinifera
ref|XP_002531288.1|  Auxin-responsive protein IAA16, putative           199   3e-59   Ricinus communis
ref|XP_009107777.1|  PREDICTED: auxin-responsive protein IAA14          198   4e-59   Brassica rapa
ref|XP_008362015.1|  PREDICTED: auxin-responsive protein IAA14-like     198   4e-59   
emb|CDY47148.1|  BnaA08g05350D                                          198   4e-59   Brassica napus [oilseed rape]
gb|AAM96891.1|  auxin-responsive protein IAA1                           197   4e-59   Mirabilis jalapa
gb|AAD32147.1|AF123509_1  Nt-iaa4.1 deduced protein                     197   5e-59   Nicotiana tabacum [American tobacco]
ref|NP_193191.2|  auxin-responsive protein IAA14                        197   6e-59   Arabidopsis thaliana [mouse-ear cress]
gb|AAD32146.1|AF123508_1  Nt-iaa28 deduced protein                      197   8e-59   Nicotiana tabacum [American tobacco]
gb|ACL81167.1|  auxin-responsive protein IAA1                           198   8e-59   Mirabilis jalapa
ref|NP_001268036.1|  uncharacterized protein LOC100250231               197   9e-59   Vitis vinifera
ref|XP_009761467.1|  PREDICTED: auxin-responsive protein IAA16          197   9e-59   Nicotiana sylvestris
ref|NP_001280973.1|  auxin-responsive protein IAA16                     197   1e-58   Malus domestica [apple tree]
gb|KFK37887.1|  hypothetical protein AALP_AA3G042100                    197   1e-58   Arabis alpina [alpine rockcress]
ref|XP_006432923.1|  hypothetical protein CICLE_v10002290mg             197   1e-58   Citrus clementina [clementine]
gb|KDO48905.1|  hypothetical protein CISIN_1g026005mg                   197   1e-58   Citrus sinensis [apfelsine]
ref|XP_009610435.1|  PREDICTED: auxin-responsive protein IAA16          197   2e-58   Nicotiana tomentosiformis
gb|ADL70680.1|  indole-3-acetic acid inducible 16                       194   2e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006408159.1|  hypothetical protein EUTSA_v10021441mg             196   2e-58   Eutrema salsugineum [saltwater cress]
gb|ADB93631.2|  indole-3-acetic acid inducible 16                       194   2e-58   Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ34138.1|  unnamed protein product                                196   2e-58   Eutrema halophilum
ref|XP_009337294.1|  PREDICTED: auxin-responsive protein IAA14-like     197   2e-58   
gb|ADL70670.1|  indole-3-acetic acid inducible 16                       194   2e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002868277.1|  hypothetical protein ARALYDRAFT_493451             196   2e-58   
gb|ADL70678.1|  indole-3-acetic acid inducible 16                       194   2e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004289900.1|  PREDICTED: auxin-induced protein AUX28-like        196   2e-58   Fragaria vesca subsp. vesca
emb|CDY62130.1|  BnaC08g47390D                                          196   3e-58   Brassica napus [oilseed rape]
ref|XP_011032399.1|  PREDICTED: auxin-responsive protein IAA16-like     196   3e-58   Populus euphratica
ref|XP_006382798.1|  hypothetical protein POPTR_0005s05560g             196   3e-58   Populus trichocarpa [western balsam poplar]
gb|EYU30526.1|  hypothetical protein MIMGU_mgv1a012831mg                196   4e-58   Erythranthe guttata [common monkey flower]
gb|AAM21317.1|AF373100_1  auxin-regulated protein                       196   4e-58   Populus tremula x Populus tremuloides
gb|ADL70673.1|  indole-3-acetic acid inducible 16                       193   4e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010556884.1|  PREDICTED: auxin-responsive protein IAA17          195   4e-58   Tarenaya hassleriana [spider flower]
gb|ADL70672.1|  indole-3-acetic acid inducible 16                       193   4e-58   Arabidopsis thaliana [mouse-ear cress]
gb|ADL70671.1|  indole-3-acetic acid inducible 16                       193   5e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010674855.1|  PREDICTED: auxin-induced protein AUX28             197   5e-58   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001280875.1|  auxin-responsive protein IAA14-like                195   6e-58   Malus domestica [apple tree]
ref|XP_010025014.1|  PREDICTED: auxin-responsive protein IAA16-like     196   6e-58   Eucalyptus grandis [rose gum]
ref|XP_010418365.1|  PREDICTED: auxin-responsive protein IAA16          195   6e-58   Camelina sativa [gold-of-pleasure]
ref|NP_187124.1|  auxin-responsive protein IAA16                        195   7e-58   Arabidopsis thaliana [mouse-ear cress]
gb|EPS64756.1|  hypothetical protein M569_10024                         194   8e-58   Genlisea aurea
ref|NP_001288939.1|  auxin-responsive protein IAA16                     194   9e-58   Brassica rapa
gb|ABM53872.1|  IAA4                                                    191   1e-57   Cestrum elegans
ref|XP_010485858.1|  PREDICTED: auxin-responsive protein IAA16-like     194   1e-57   Camelina sativa [gold-of-pleasure]
gb|ABI36487.1|  AUX/IAA7 A                                              191   3e-57   Malus domestica [apple tree]
gb|ABH01143.1|  auxin-regulated protein                                 194   3e-57   Populus tomentosa [Chinese white poplar]
ref|XP_004495802.1|  PREDICTED: auxin-responsive protein IAA16-like     194   3e-57   Cicer arietinum [garbanzo]
gb|KJB11141.1|  hypothetical protein B456_001G242900                    194   4e-57   Gossypium raimondii
emb|CDY50750.1|  BnaAnng10570D                                          194   4e-57   Brassica napus [oilseed rape]
ref|XP_008382962.1|  PREDICTED: auxin-induced protein AUX28-like        193   4e-57   Malus domestica [apple tree]
ref|XP_004302055.1|  PREDICTED: auxin-responsive protein IAA16          193   5e-57   Fragaria vesca subsp. vesca
dbj|BAH15071.1|  indole-3-acetic acid 14 transcription factor like      193   5e-57   Malus prunifolia
ref|XP_006298436.1|  hypothetical protein CARUB_v10014507mg             193   5e-57   Capsella rubella
gb|KJB42200.1|  hypothetical protein B456_007G141900                    192   5e-57   Gossypium raimondii
ref|XP_002281771.1|  PREDICTED: auxin-responsive protein IAA16-like     192   7e-57   Vitis vinifera
emb|CAN63268.1|  hypothetical protein VITISV_013635                     192   7e-57   Vitis vinifera
ref|XP_007205640.1|  hypothetical protein PRUPE_ppa009254mg             194   7e-57   
gb|KJB44871.1|  hypothetical protein B456_007G276900                    189   8e-57   Gossypium raimondii
dbj|BAI94494.1|  Aux/IAA protein                                        192   1e-56   Dianthus caryophyllus [carnation]
ref|XP_009364490.1|  PREDICTED: auxin-responsive protein IAA16          192   1e-56   Pyrus x bretschneideri [bai li]
ref|XP_009124981.1|  PREDICTED: auxin-responsive protein IAA16-like     192   1e-56   Brassica rapa
ref|XP_002884465.1|  indoleacetic acid-induced protein 16               191   1e-56   
dbj|BAG55005.1|  auxin-responsive Aux/IAA gene family member            191   2e-56   Ipomoea nil [qian niu]
ref|XP_010463960.1|  PREDICTED: auxin-responsive protein IAA16-like     191   2e-56   Camelina sativa [gold-of-pleasure]
ref|XP_008218270.1|  PREDICTED: auxin-responsive protein IAA16          191   2e-56   Prunus mume [ume]
ref|NP_001241599.1|  uncharacterized protein LOC100803065               191   3e-56   Glycine max [soybeans]
emb|CDY63910.1|  BnaC01g43640D                                          191   4e-56   Brassica napus [oilseed rape]
gb|ADL36587.1|  ARF domain class transcription factor                   188   4e-56   Malus domestica [apple tree]
gb|KHN18836.1|  Auxin-induced protein AUX28                             191   4e-56   Glycine soja [wild soybean]
gb|ABI36493.1|  AUX/IAA16 A                                             187   5e-56   Malus domestica [apple tree]
gb|KJB44873.1|  hypothetical protein B456_007G276900                    191   5e-56   Gossypium raimondii
emb|CDP06818.1|  unnamed protein product                                190   5e-56   Coffea canephora [robusta coffee]
ref|NP_001239753.1|  uncharacterized protein LOC100781847               190   5e-56   Glycine max [soybeans]
ref|XP_008235328.1|  PREDICTED: auxin-induced protein AUX28-like        191   5e-56   Prunus mume [ume]
gb|KHN22078.1|  Auxin-responsive protein IAA16                          190   5e-56   Glycine soja [wild soybean]
ref|XP_009367750.1|  PREDICTED: auxin-induced protein AUX28-like        191   6e-56   Pyrus x bretschneideri [bai li]
ref|XP_010087762.1|  Auxin-responsive protein IAA7                      192   6e-56   
gb|AFK36086.1|  unknown                                                 191   6e-56   Lotus japonicus
ref|XP_008372303.1|  PREDICTED: auxin-induced protein AUX28-like        191   6e-56   
gb|AEE25650.1|  auxin-responsive protein                                190   7e-56   Gossypium hirsutum [American cotton]
gb|AFK44192.1|  unknown                                                 190   9e-56   Medicago truncatula
ref|XP_008462706.1|  PREDICTED: auxin-responsive protein IAA16-li...    189   9e-56   Cucumis melo [Oriental melon]
gb|AFK42876.1|  unknown                                                 190   1e-55   Medicago truncatula
emb|CDY41894.1|  BnaC05g47100D                                          189   1e-55   Brassica napus [oilseed rape]
ref|XP_010550916.1|  PREDICTED: LOW QUALITY PROTEIN: auxin-respon...    188   1e-55   Tarenaya hassleriana [spider flower]
ref|XP_007050421.1|  Indole-3-acetic acid inducible 14 isoform 1        191   1e-55   
gb|KHG04941.1|  Auxin-induced AUX28                                     189   2e-55   Gossypium arboreum [tree cotton]
gb|KEH43017.1|  auxin-responsive AUX/IAA family protein                 189   2e-55   Medicago truncatula
ref|XP_009354870.1|  PREDICTED: auxin-induced protein AUX28-like        189   2e-55   Pyrus x bretschneideri [bai li]
gb|ACU18407.1|  unknown                                                 189   2e-55   Glycine max [soybeans]
ref|XP_007201400.1|  hypothetical protein PRUPE_ppa010342mg             189   3e-55   Prunus persica
ref|XP_003521753.1|  PREDICTED: auxin-responsive protein IAA16-like     188   3e-55   Glycine max [soybeans]
ref|XP_011082603.1|  PREDICTED: auxin-responsive protein IAA14-like     187   3e-55   Sesamum indicum [beniseed]
ref|XP_010936171.1|  PREDICTED: auxin-responsive protein IAA30-like     188   3e-55   Elaeis guineensis
gb|KHN31465.1|  Auxin-responsive protein IAA16                          188   3e-55   Glycine soja [wild soybean]
ref|XP_007034957.1|  Indole-3-acetic acid inducible 14 isoform 2        187   4e-55   
ref|XP_004493739.1|  PREDICTED: auxin-induced protein AUX28-like        187   6e-55   Cicer arietinum [garbanzo]
gb|ACJ83896.1|  unknown                                                 187   6e-55   Medicago truncatula
emb|CAH59413.1|  auxin resistance protein                               187   8e-55   Plantago major [cart-track plant]
emb|CDY30017.1|  BnaC01g39910D                                          186   1e-54   Brassica napus [oilseed rape]
gb|ACJ84642.1|  unknown                                                 187   1e-54   Medicago truncatula
ref|XP_011079949.1|  PREDICTED: auxin-induced protein AUX28-like        187   1e-54   Sesamum indicum [beniseed]
ref|XP_002302075.1|  auxin-induced protein aux28                        186   1e-54   Populus trichocarpa [western balsam poplar]
ref|XP_009418923.1|  PREDICTED: auxin-responsive protein IAA30-like     186   1e-54   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006366663.1|  PREDICTED: auxin-responsive protein IAA16-like     186   2e-54   Solanum tuberosum [potatoes]
ref|XP_002520980.1|  Auxin-induced protein AUX28, putative              186   2e-54   Ricinus communis
ref|XP_007144686.1|  hypothetical protein PHAVU_007G176600g             186   2e-54   Phaseolus vulgaris [French bean]
ref|XP_009420668.1|  PREDICTED: auxin-responsive protein IAA30-like     186   2e-54   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006383686.1|  auxin-induced protein aux28                        186   3e-54   Populus trichocarpa [western balsam poplar]
gb|KJB11145.1|  hypothetical protein B456_001G242900                    186   3e-54   Gossypium raimondii
ref|XP_004142529.1|  PREDICTED: auxin-responsive protein IAA16-like     185   3e-54   Cucumis sativus [cucumbers]
ref|XP_009413916.1|  PREDICTED: auxin-responsive protein IAA30-like     185   5e-54   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008788131.1|  PREDICTED: auxin-responsive protein IAA30-like     185   5e-54   Phoenix dactylifera
gb|ADL70548.1|  indole-3-acetic acid inducible 7                        180   6e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006838867.1|  hypothetical protein AMTR_s00002p00266760          185   6e-54   Amborella trichopoda
gb|AAN16886.1|  Aux/IAA1                                                180   6e-54   Mirabilis jalapa
ref|XP_009774251.1|  PREDICTED: auxin-responsive protein IAA16-like     183   8e-54   Nicotiana sylvestris
gb|ADL70558.1|  indole-3-acetic acid inducible 7                        179   8e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004963100.1|  PREDICTED: auxin-responsive protein IAA30-like     185   8e-54   Setaria italica
ref|XP_006443921.1|  hypothetical protein CICLE_v10022032mg             184   8e-54   Citrus clementina [clementine]
ref|XP_002443496.1|  hypothetical protein SORBIDRAFT_08g020580          186   9e-54   Sorghum bicolor [broomcorn]
gb|KHN30563.1|  Auxin-responsive protein IAA14                          184   1e-53   Glycine soja [wild soybean]
gb|KDO68557.1|  hypothetical protein CISIN_1g026823mg                   184   1e-53   Citrus sinensis [apfelsine]
gb|ADL70552.1|  indole-3-acetic acid inducible 7                        179   2e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010923478.1|  PREDICTED: auxin-responsive protein IAA30-li...    184   2e-53   Elaeis guineensis
ref|NP_001267662.1|  auxin-induced protein AUX28-like                   183   2e-53   Cucumis sativus [cucumbers]
dbj|BAJ84870.1|  predicted protein                                      184   2e-53   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK01326.1|  predicted protein                                      184   2e-53   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACF88333.1|  unknown                                                 184   2e-53   Zea mays [maize]
gb|AGV54230.1|  auxin-induced protein AUX28                             183   2e-53   Phaseolus vulgaris [French bean]
ref|XP_010917602.1|  PREDICTED: auxin-responsive protein IAA30 is...    183   3e-53   Elaeis guineensis
ref|XP_006418150.1|  hypothetical protein EUTSA_v10008679mg             183   3e-53   Eutrema salsugineum [saltwater cress]
ref|XP_006418149.1|  hypothetical protein EUTSA_v10008679mg             182   3e-53   Eutrema salsugineum [saltwater cress]
gb|ADL70676.1|  indole-3-acetic acid inducible 16                       180   3e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008451270.1|  PREDICTED: auxin-induced protein AUX28-like        183   3e-53   Cucumis melo [Oriental melon]
ref|XP_008810170.1|  PREDICTED: auxin-responsive protein IAA30-like     183   3e-53   Phoenix dactylifera
gb|ADL70554.1|  indole-3-acetic acid inducible 7                        178   3e-53   Arabidopsis thaliana [mouse-ear cress]
gb|ACF87179.1|  unknown                                                 184   3e-53   Zea mays [maize]
ref|XP_009398568.1|  PREDICTED: auxin-responsive protein IAA30-like     183   4e-53   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007147174.1|  hypothetical protein PHAVU_006G102100g             184   4e-53   Phaseolus vulgaris [French bean]
gb|ACU19136.1|  unknown                                                 182   4e-53   Glycine max [soybeans]
ref|NP_001150626.1|  IAA30 - auxin-responsive Aux/IAA family member     183   6e-53   Zea mays [maize]
ref|XP_003579189.1|  PREDICTED: auxin-responsive protein IAA30-like     182   7e-53   Brachypodium distachyon [annual false brome]
ref|XP_007162490.1|  hypothetical protein PHAVU_001G156600g             182   7e-53   Phaseolus vulgaris [French bean]
ref|XP_011026048.1|  PREDICTED: auxin-induced protein AUX28-like        181   1e-52   Populus euphratica
ref|XP_010475075.1|  PREDICTED: auxin-responsive protein IAA17-like     181   1e-52   Camelina sativa [gold-of-pleasure]
ref|XP_010457463.1|  PREDICTED: auxin-responsive protein IAA17          181   1e-52   Camelina sativa [gold-of-pleasure]
ref|NP_001236693.1|  auxin-induced protein AUX28                        181   2e-52   
ref|XP_006304183.1|  hypothetical protein CARUB_v10010236mg             180   2e-52   Capsella rubella
gb|ACU21378.1|  unknown                                                 181   2e-52   Glycine max [soybeans]
gb|KHN02537.1|  Auxin-induced protein AUX28                             181   2e-52   Glycine soja [wild soybean]
gb|KEH42778.1|  auxin-responsive AUX/IAA family protein                 181   3e-52   Medicago truncatula
ref|XP_010483317.1|  PREDICTED: auxin-responsive protein IAA17-like     180   4e-52   Camelina sativa [gold-of-pleasure]
gb|EYU46510.1|  hypothetical protein MIMGU_mgv1a013084mg                180   4e-52   Erythranthe guttata [common monkey flower]
ref|XP_002889499.1|  hypothetical protein ARALYDRAFT_470401             180   4e-52   
ref|XP_011042427.1|  PREDICTED: auxin-induced protein AUX28-like        180   5e-52   Populus euphratica
gb|EEE53551.1|  hypothetical protein OsJ_36765                          178   5e-52   Oryza sativa Japonica Group [Japonica rice]
gb|AAC39440.1|  IAA17/AXR3-1 protein                                    179   6e-52   Arabidopsis thaliana [mouse-ear cress]
gb|AAM64837.1|  putative auxin-induced protein, IAA17/AXR3-1            179   6e-52   Arabidopsis thaliana [mouse-ear cress]
ref|NP_171921.1|  auxin-responsive protein IAA17                        179   7e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004495391.1|  PREDICTED: auxin-responsive protein IAA14-li...    179   7e-52   
emb|CAB46059.1|  IAA7 like protein                                      179   1e-51   Arabidopsis thaliana [mouse-ear cress]
gb|ABI36490.1|  AUX/IAA7 C                                              175   2e-51   Malus domestica [apple tree]
gb|ADB93633.2|  indole-3-acetic acid inducible 16                       175   2e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009417112.1|  PREDICTED: auxin-responsive protein IAA30-like     178   3e-51   Musa acuminata subsp. malaccensis [pisang utan]
gb|ADL70681.1|  indole-3-acetic acid inducible 16                       175   4e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003521268.1|  PREDICTED: auxin-induced protein AUX28-like        178   4e-51   Glycine max [soybeans]
ref|XP_003554705.1|  PREDICTED: auxin-responsive protein IAA16-li...    177   4e-51   Glycine max [soybeans]
emb|CDY15493.1|  BnaA08g27770D                                          177   4e-51   Brassica napus [oilseed rape]
ref|XP_009111119.1|  PREDICTED: auxin-responsive protein IAA17          177   5e-51   Brassica rapa
ref|XP_006605305.1|  PREDICTED: uncharacterized protein LOC100499...    177   5e-51   
ref|NP_001067209.1|  Os12g0601300                                       178   5e-51   
ref|NP_001266055.1|  IAA10 protein                                      176   6e-51   Solanum lycopersicum
ref|XP_010038039.1|  PREDICTED: auxin-induced protein AUX28-like        178   8e-51   Eucalyptus grandis [rose gum]
gb|ABD98055.1|  auxin-regulated protein                                 176   1e-50   Striga asiatica [witchweed]
gb|ADB93630.2|  indole-3-acetic acid inducible 16                       173   2e-50   Arabidopsis thaliana [mouse-ear cress]
gb|ADL70677.1|  indole-3-acetic acid inducible 16                       173   2e-50   Arabidopsis thaliana [mouse-ear cress]
emb|CAN72026.1|  hypothetical protein VITISV_014421                     176   7e-50   Vitis vinifera
ref|XP_004982377.1|  PREDICTED: auxin-responsive protein IAA30-li...    175   7e-50   Setaria italica
ref|XP_010917600.1|  PREDICTED: auxin-responsive protein IAA30 is...    174   9e-50   
emb|CDY18214.1|  BnaC05g02370D                                          173   1e-49   Brassica napus [oilseed rape]
ref|XP_006408158.1|  hypothetical protein EUTSA_v10021441mg             173   1e-49   
emb|CDY63072.1|  BnaCnng41350D                                          178   1e-49   Brassica napus [oilseed rape]
gb|ADB93634.2|  indole-3-acetic acid inducible 16                       171   1e-49   Arabidopsis thaliana [mouse-ear cress]
gb|ADL70679.1|  indole-3-acetic acid inducible 16                       171   1e-49   Arabidopsis thaliana [mouse-ear cress]
gb|ADB93632.2|  indole-3-acetic acid inducible 16                       171   1e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004153443.1|  PREDICTED: auxin-responsive protein IAA16-like     170   1e-49   
ref|XP_007201399.1|  hypothetical protein PRUPE_ppa010342mg             173   2e-49   
emb|CDX89832.1|  BnaA10g02500D                                          172   3e-49   
gb|KGN60808.1|  hypothetical protein Csa_2G010920                       172   4e-49   Cucumis sativus [cucumbers]
gb|KJB11146.1|  hypothetical protein B456_001G242900                    174   5e-49   Gossypium raimondii
gb|ADL70559.1|  indole-3-acetic acid inducible 7                        166   8e-49   
ref|XP_009118658.1|  PREDICTED: auxin-responsive protein IAA17-like     171   9e-49   
ref|XP_004156465.1|  PREDICTED: LOW QUALITY PROTEIN: auxin-respon...    171   9e-49   
emb|CDY32537.1|  BnaA09g50590D                                          171   9e-49   
gb|ACU19616.1|  unknown                                                 171   1e-48   
ref|XP_008455985.1|  PREDICTED: auxin-responsive protein IAA16 is...    171   2e-48   
gb|KFK31703.1|  hypothetical protein AALP_AA6G148100                    169   2e-48   
ref|XP_004982376.1|  PREDICTED: auxin-responsive protein IAA30-li...    171   2e-48   
gb|AAV50046.1|  auxin-induced protein                                   169   3e-48   
ref|XP_010522504.1|  PREDICTED: auxin-responsive protein IAA17-like     170   4e-48   
ref|XP_009119323.1|  PREDICTED: auxin-responsive protein IAA17-like     169   5e-48   
ref|XP_006443920.1|  hypothetical protein CICLE_v10022032mg             169   5e-48   
emb|CDY10068.1|  BnaC08g43830D                                          169   7e-48   
gb|ABK24636.1|  unknown                                                 172   1e-47   
gb|ADL70550.1|  indole-3-acetic acid inducible 7                        163   1e-47   
ref|XP_004134097.1|  PREDICTED: auxin-responsive protein IAA14-li...    167   4e-47   
dbj|BAJ97201.1|  predicted protein                                      167   4e-47   
ref|NP_001237212.1|  uncharacterized protein LOC100499872               166   1e-46   
ref|XP_006664171.1|  PREDICTED: auxin-responsive protein IAA30-like     166   2e-46   
gb|KEH43016.1|  auxin-responsive AUX/IAA family protein                 165   2e-46   
gb|ADC29384.1|  indole-3-acetic acid inducible 7                        160   2e-46   
gb|AFK43673.1|  unknown                                                 166   3e-46   
ref|XP_008444965.1|  PREDICTED: auxin-responsive protein IAA9-like      168   3e-46   
gb|ADC29387.2|  indole-3-acetic acid inducible 7                        159   4e-46   
ref|NP_001267710.1|  auxin-responsive protein IAA9-like                 168   4e-46   
ref|XP_009421456.1|  PREDICTED: auxin-responsive protein IAA21-like     167   4e-46   
gb|ADC29385.2|  indole-3-acetic acid inducible 7                        159   5e-46   
ref|XP_002306817.1|  hypothetical protein POPTR_0005s23980g             163   8e-46   
gb|ADC29388.2|  indole-3-acetic acid inducible 7                        158   9e-46   
gb|ABR17764.1|  unknown                                                 166   1e-45   
ref|XP_008802939.1|  PREDICTED: auxin-responsive protein IAA17-like     166   1e-45   
ref|XP_004150556.1|  PREDICTED: auxin-responsive protein IAA27-like     165   2e-45   
ref|XP_010925905.1|  PREDICTED: auxin-responsive protein IAA17-like     165   2e-45   
gb|AEQ94167.1|  auxin induced family protein                            159   2e-45   
gb|KDP41528.1|  hypothetical protein JCGZ_15935                         166   4e-45   
ref|XP_010915883.1|  PREDICTED: auxin-responsive protein IAA17-like     164   4e-45   
gb|ABR16302.1|  unknown                                                 164   4e-45   
ref|XP_006850381.1|  hypothetical protein AMTR_s00184p00030540          166   4e-45   
ref|XP_010254042.1|  PREDICTED: auxin-responsive protein IAA27-like     164   5e-45   
gb|KDP21369.1|  hypothetical protein JCGZ_21840                         161   9e-45   
gb|ABM53871.1|  IAA3                                                    158   1e-44   
gb|ABR16139.1|  unknown                                                 166   1e-44   
gb|ABB55368.1|  Aux/IAA protein-like                                    164   1e-44   
ref|XP_009390697.1|  PREDICTED: auxin-responsive protein IAA17-like     162   1e-44   
emb|CAC84711.1|  aux/IAA protein                                        160   2e-44   
ref|NP_001275473.1|  Aux/IAA protein                                    163   2e-44   
gb|AAP44405.1|  auxin-induced protein 2                                 162   2e-44   
emb|CBI28036.3|  unnamed protein product                                158   2e-44   
ref|XP_009380572.1|  PREDICTED: auxin-responsive protein IAA21-li...    162   2e-44   
ref|XP_007013106.1|  Phytochrome-associated protein 2 isoform 1         162   2e-44   
ref|XP_009789143.1|  PREDICTED: auxin-responsive protein IAA8-like      163   2e-44   
ref|XP_007013107.1|  Phytochrome-associated protein 2 isoform 2         162   2e-44   
emb|CBI36106.3|  unnamed protein product                                161   2e-44   
ref|XP_009608764.1|  PREDICTED: auxin-responsive protein IAA8-like      163   3e-44   
gb|KHG03466.1|  Auxin-responsive IAA27 -like protein                    162   3e-44   
emb|CAI77628.1|  Aux/IAA protein                                        161   3e-44   
gb|KJB54240.1|  hypothetical protein B456_009G026700                    161   3e-44   
emb|CAC85936.1|  putative auxin induced transcription factor Aux/IAA    161   4e-44   
ref|XP_006472387.1|  PREDICTED: auxin-responsive protein IAA9-lik...    163   4e-44   
ref|XP_008462746.1|  PREDICTED: auxin-responsive protein IAA27          161   4e-44   
emb|CDP03299.1|  unnamed protein product                                162   4e-44   
gb|ABI36491.1|  AUX/IAA8A                                               156   5e-44   
gb|KJB18638.1|  hypothetical protein B456_003G064200                    159   5e-44   
ref|XP_010320058.1|  PREDICTED: auxin-responsive protein (Aux/IAA...    162   6e-44   
ref|XP_008783241.1|  PREDICTED: auxin-responsive protein IAA17-li...    161   6e-44   
ref|NP_001265888.1|  auxin-responsive protein (Aux/IAA)                 162   6e-44   
gb|KJB64033.1|  hypothetical protein B456_010G031600                    161   6e-44   
ref|XP_004150437.1|  PREDICTED: LOW QUALITY PROTEIN: auxin-respon...    159   6e-44   
ref|XP_011016963.1|  PREDICTED: auxin-responsive protein IAA9-like      162   8e-44   
ref|XP_002284282.1|  PREDICTED: auxin-responsive protein IAA27-like     161   8e-44   
ref|XP_002302351.1|  auxin-responsive family protein                    162   9e-44   
ref|XP_011073641.1|  PREDICTED: auxin-responsive protein IAA9-like      161   9e-44   
gb|AFZ78618.1|  hypothetical protein                                    162   9e-44   
ref|XP_009388718.1|  PREDICTED: auxin-responsive protein IAA17-like     160   9e-44   
emb|CAC84706.1|  aux/IAA protein                                        162   1e-43   
gb|KHG09793.1|  Auxin-responsive IAA27 -like protein                    160   1e-43   
gb|KJB56779.1|  hypothetical protein B456_009G135900                    160   1e-43   
gb|AEI70506.1|  auxin-responsive protein                                160   1e-43   
gb|KJB64027.1|  hypothetical protein B456_010G031600                    161   1e-43   
gb|KHG13564.1|  Auxin-responsive IAA9 -like protein                     161   1e-43   
gb|AEV89263.1|  IAA9                                                    160   1e-43   
gb|AEI70507.1|  auxin-responsive protein                                161   1e-43   
emb|CBI19314.3|  unnamed protein product                                160   1e-43   
ref|XP_006833393.1|  hypothetical protein AMTR_s00109p00120700          161   1e-43   
gb|KHG27397.1|  Auxin-responsive IAA27 -like protein                    158   1e-43   
pdb|2MUK|X  Chain X, 1h, 13c, And 15n Chemical Shift Assignments ...    154   2e-43   
ref|XP_007024229.1|  Phytochrome-associated protein 2 isoform 2         160   2e-43   
gb|KJB18635.1|  hypothetical protein B456_003G064200                    160   2e-43   
ref|NP_001268170.1|  Aux/IAA protein                                    160   2e-43   
ref|XP_006433732.1|  hypothetical protein CICLE_v10001479mg             160   2e-43   
ref|XP_010664066.1|  PREDICTED: aux/IAA protein isoform X1              160   2e-43   
ref|XP_008236708.1|  PREDICTED: auxin-responsive protein IAA9           161   2e-43   
gb|AAL92850.1|  Aux/IAA protein                                         160   3e-43   
ref|XP_007205358.1|  hypothetical protein PRUPE_ppa007194mg             161   3e-43   
gb|ABR25977.1|  osiaa30-auxin-responsive aux/iaa gene family member     152   3e-43   
ref|XP_008353316.1|  PREDICTED: auxin-responsive protein IAA14-like     152   3e-43   
ref|XP_008455992.1|  PREDICTED: auxin-responsive protein IAA16 is...    157   3e-43   
gb|KJB18637.1|  hypothetical protein B456_003G064200                    160   3e-43   
ref|XP_007018336.1|  Aux/IAA protein isoform 1                          160   3e-43   
gb|KDO81302.1|  hypothetical protein CISIN_1g017824mg                   160   3e-43   
ref|XP_002284118.1|  PREDICTED: auxin-responsive protein IAA27          159   3e-43   
gb|KJB58777.1|  hypothetical protein B456_009G226000                    160   3e-43   
gb|KJB58781.1|  hypothetical protein B456_009G226000                    160   4e-43   
gb|ABI36497.1|  AUX/IAA27 B                                             153   4e-43   
gb|AFK35603.1|  unknown                                                 152   5e-43   
ref|XP_002514266.1|  Auxin-responsive protein IAA27, putative           158   5e-43   
emb|CAD10639.1|  IAA9 protein                                           159   5e-43   
ref|XP_002464208.1|  hypothetical protein SORBIDRAFT_01g014130          157   5e-43   
gb|ABI36495.1|  AUX/IAA27 A                                             152   6e-43   
gb|KEH27147.1|  auxin response factor                                   157   6e-43   
ref|XP_010275506.1|  PREDICTED: auxin-responsive protein IAA9 iso...    160   7e-43   
ref|XP_010275505.1|  PREDICTED: auxin-responsive protein IAA9 iso...    160   8e-43   
gb|ABR25699.1|  osiaa30-auxin-responsive aux/iaa gene family memb...    151   8e-43   
ref|XP_010275504.1|  PREDICTED: auxin-responsive protein IAA9 iso...    160   9e-43   
ref|XP_010249636.1|  PREDICTED: auxin-responsive protein IAA27          159   9e-43   
ref|XP_009344514.1|  PREDICTED: auxin-responsive protein IAA9           159   1e-42   
ref|XP_010526458.1|  PREDICTED: auxin-responsive protein IAA27          157   1e-42   
ref|XP_009366395.1|  PREDICTED: auxin-responsive protein IAA8-like      159   1e-42   
gb|ADL36578.1|  ARF domain class transcription factor                   159   1e-42   
gb|EPS60474.1|  hypothetical protein M569_14329                         154   2e-42   
gb|ABI36496.1|  AUX/IAA26                                               150   3e-42   
ref|XP_007225724.1|  hypothetical protein PRUPE_ppa006744mg             158   3e-42   
ref|XP_008378626.1|  PREDICTED: auxin-responsive protein IAA8-like      158   3e-42   
emb|CDP02673.1|  unnamed protein product                                158   3e-42   
ref|XP_008339000.1|  PREDICTED: auxin-responsive protein IAA8-lik...    157   3e-42   
ref|XP_009793769.1|  PREDICTED: auxin-responsive protein IAA27-like     156   3e-42   
ref|XP_009381047.1|  PREDICTED: auxin-responsive protein IAA17-like     156   3e-42   
gb|KHN09036.1|  Auxin-responsive protein IAA8                           157   4e-42   
ref|XP_008219180.1|  PREDICTED: auxin-responsive protein IAA8-like      157   4e-42   
gb|ABY48132.1|  GH1 protein                                             157   4e-42   
ref|XP_003612933.1|  Auxin-responsive protein (Aux/IAA)                 157   4e-42   
gb|KDO56957.1|  hypothetical protein CISIN_1g019236mg                   157   4e-42   
ref|XP_006465643.1|  PREDICTED: auxin-responsive protein IAA8-lik...    157   5e-42   
ref|NP_001280795.1|  auxin-responsive protein IAA8-like                 157   5e-42   
ref|XP_007225727.1|  hypothetical protein PRUPE_ppa006744mg             158   5e-42   
ref|XP_009617338.1|  PREDICTED: auxin-responsive protein IAA27-like     155   6e-42   
ref|XP_002303297.1|  auxin-responsive protein IAA27                     156   8e-42   
ref|XP_008242568.1|  PREDICTED: auxin-responsive protein IAA27          155   9e-42   
ref|XP_003534212.1|  PREDICTED: auxin-responsive protein IAA27          155   1e-41   
gb|KCW69643.1|  hypothetical protein EUGRSUZ_F03050                     156   1e-41   
ref|XP_006426926.1|  hypothetical protein CICLE_v10025988mg             156   1e-41   
ref|XP_007152862.1|  hypothetical protein PHAVU_004G166400g             155   1e-41   
ref|XP_009786555.1|  PREDICTED: auxin-responsive protein IAA27-like     154   1e-41   
ref|XP_010254653.1|  PREDICTED: auxin-responsive protein IAA9-like      156   1e-41   
ref|XP_009352507.1|  PREDICTED: auxin-responsive protein IAA27-like     155   1e-41   
ref|XP_009409066.1|  PREDICTED: auxin-responsive protein IAA17-like     155   2e-41   
gb|ABW24025.1|  aux/IAA protein                                         150   2e-41   
ref|NP_001280937.1|  auxin-responsive protein IAA27                     155   2e-41   
ref|XP_009336858.1|  PREDICTED: auxin-responsive protein IAA27-like     155   2e-41   
ref|XP_011464769.1|  PREDICTED: auxin-responsive protein IAA8-lik...    155   2e-41   
ref|XP_008789309.1|  PREDICTED: auxin-responsive protein IAA27-like     154   2e-41   
gb|AFK41855.1|  unknown                                                 148   2e-41   
ref|XP_007158315.1|  hypothetical protein PHAVU_002G142500g             155   2e-41   
ref|XP_006451212.1|  hypothetical protein CICLE_v10009070mg             154   2e-41   
gb|AAM12952.1|  auxin-regulated protein                                 155   2e-41   
ref|XP_004299829.1|  PREDICTED: auxin-responsive protein IAA8-lik...    155   2e-41   
gb|AGV54485.1|  auxin-responsive protein                                155   2e-41   
gb|AFK45766.1|  unknown                                                 152   3e-41   
emb|CDP00957.1|  unnamed protein product                                155   3e-41   
ref|XP_004288310.1|  PREDICTED: auxin-responsive protein IAA9           155   3e-41   
ref|XP_009771095.1|  PREDICTED: auxin-responsive protein IAA8-like      153   3e-41   
gb|EYU41350.1|  hypothetical protein MIMGU_mgv1a009380mg                155   3e-41   
ref|XP_009612337.1|  PREDICTED: auxin-responsive protein IAA27-like     154   3e-41   
ref|XP_008793078.1|  PREDICTED: auxin-responsive protein IAA27-li...    154   4e-41   
ref|XP_011072390.1|  PREDICTED: auxin-responsive protein IAA27          154   4e-41   
gb|KFK29453.1|  hypothetical protein AALP_AA7G136400                    153   5e-41   
ref|XP_006381732.1|  hypothetical protein POPTR_0006s16640g             153   5e-41   
ref|XP_011010527.1|  PREDICTED: auxin-responsive protein IAA27-li...    154   5e-41   
ref|XP_010924571.1|  PREDICTED: auxin-responsive protein IAA27-like     153   5e-41   
ref|NP_194637.1|  phytochrome-associated protein 2                      153   5e-41   
ref|NP_001241389.1|  uncharacterized protein LOC100783314               154   5e-41   
ref|XP_002867425.1|  phytochrome-associated protein 2                   153   5e-41   
ref|XP_007203891.1|  hypothetical protein PRUPE_ppa009134mg             153   5e-41   
ref|XP_003519213.1|  PREDICTED: auxin-responsive protein IAA9-like      154   6e-41   
gb|KHN46011.1|  Auxin-responsive protein IAA9                           154   6e-41   
ref|XP_003544843.1|  PREDICTED: auxin-responsive protein IAA9           154   7e-41   
gb|ADL70549.1|  indole-3-acetic acid inducible 7                        145   8e-41   
ref|XP_004287443.1|  PREDICTED: auxin-responsive protein IAA27          152   8e-41   
ref|XP_010447892.1|  PREDICTED: auxin-responsive protein IAA27          152   9e-41   
gb|EYU44549.1|  hypothetical protein MIMGU_mgv1a010252mg                152   1e-40   
ref|XP_007156440.1|  hypothetical protein PHAVU_003G286200g             153   1e-40   
ref|XP_004509716.1|  PREDICTED: auxin-responsive protein IAA9-lik...    153   1e-40   
ref|XP_007160318.1|  hypothetical protein PHAVU_002G311500g             152   1e-40   
ref|XP_003531969.1|  PREDICTED: auxin-responsive protein IAA9-lik...    153   2e-40   
gb|KHN22187.1|  Auxin-responsive protein IAA9                           153   2e-40   
ref|XP_009774736.1|  PREDICTED: auxin-responsive protein IAA27-like     151   2e-40   
gb|KDP37265.1|  hypothetical protein JCGZ_06321                         152   2e-40   
ref|XP_010433139.1|  PREDICTED: auxin-responsive protein IAA27-like     152   2e-40   
emb|CDX97478.1|  BnaC08g13430D                                          146   2e-40   
ref|XP_004512542.1|  PREDICTED: auxin-responsive protein IAA8-like      152   2e-40   
ref|XP_004509715.1|  PREDICTED: auxin-responsive protein IAA9-lik...    152   2e-40   
ref|XP_010683059.1|  PREDICTED: auxin-responsive protein IAA9           152   2e-40   
ref|XP_006343091.1|  PREDICTED: auxin-responsive protein IAA27-like     150   2e-40   
ref|XP_010098105.1|  Auxin-responsive protein IAA27                     152   3e-40   
ref|XP_009129008.1|  PREDICTED: auxin-responsive protein IAA27          150   4e-40   
ref|NP_001266034.1|  IAA6 protein                                       150   4e-40   
gb|KHN04889.1|  Auxin-responsive protein IAA8                           150   4e-40   
gb|AFK38538.1|  unknown                                                 151   4e-40   
ref|XP_010917562.1|  PREDICTED: auxin-responsive protein IAA27-like     151   5e-40   
ref|XP_009398379.1|  PREDICTED: auxin-responsive protein IAA30-like     149   5e-40   
gb|KHN08222.1|  Auxin-responsive protein IAA8                           152   5e-40   
ref|XP_006432922.1|  hypothetical protein CICLE_v10002290mg             148   6e-40   
ref|XP_008342663.1|  PREDICTED: LOW QUALITY PROTEIN: auxin-respon...    151   6e-40   
gb|KDO48904.1|  hypothetical protein CISIN_1g026005mg                   148   6e-40   
ref|XP_004143431.1|  PREDICTED: auxin-responsive protein IAA9-like      152   7e-40   
ref|XP_009377833.1|  PREDICTED: auxin-responsive protein IAA21-like     150   7e-40   
ref|XP_003630761.1|  Auxin-responsive protein (Aux/IAA)                 150   7e-40   
ref|XP_004141756.1|  PREDICTED: auxin-responsive protein IAA8-like      151   8e-40   
gb|AFK49596.1|  unknown                                                 150   8e-40   
ref|XP_011099452.1|  PREDICTED: auxin-responsive protein IAA9-like      151   8e-40   
ref|XP_010023411.1|  PREDICTED: auxin-responsive protein IAA9 iso...    151   8e-40   
ref|XP_010062501.1|  PREDICTED: auxin-responsive protein IAA27          150   9e-40   
ref|XP_004490496.1|  PREDICTED: auxin-responsive protein IAA9-like      151   9e-40   
gb|AAB70005.1|  GH1 protein                                             150   9e-40   
dbj|BAJ33683.1|  unnamed protein product                                150   1e-39   
ref|XP_003517136.1|  PREDICTED: auxin-responsive protein IAA9 iso...    151   1e-39   
ref|XP_006284170.1|  hypothetical protein CARUB_v10005309mg             150   1e-39   
ref|XP_002516003.1|  Auxin-responsive protein IAA27, putative           151   1e-39   
ref|XP_008338995.1|  PREDICTED: auxin-responsive protein IAA9-lik...    151   1e-39   
ref|XP_009416499.1|  PREDICTED: auxin-responsive protein IAA21-like     149   1e-39   
ref|XP_010438351.1|  PREDICTED: auxin-responsive protein IAA27-like     149   1e-39   



>ref|XP_010552451.1| PREDICTED: auxin-responsive protein IAA14-like [Tarenaya hassleriana]
Length=235

 Score =   214 bits (544),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY+SYQ+LSDALAKMFSSFTMGNYGAQGMIDFMNE KLMDLLNSSEYVPTYEDK
Sbjct  131  RKVDLKMYKSYQELSDALAKMFSSFTMGNYGAQGMIDFMNESKLMDLLNSSEYVPTYEDK  190

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPW+MFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR
Sbjct  191  DGDWMLVGDVPWQMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  234



>emb|CDO99148.1| unnamed protein product [Coffea canephora]
Length=239

 Score =   213 bits (543),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 99/105 (94%), Positives = 103/105 (98%), Gaps = 0/105 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY+SYQ+LSDALAKMFSSFTMGNYG QGMIDFMNE KLMDLLNSSEYVPTYEDK
Sbjct  135  RKVDLKMYKSYQELSDALAKMFSSFTMGNYGPQGMIDFMNESKLMDLLNSSEYVPTYEDK  194

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  388
            DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRA+EKCK+RC
Sbjct  195  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSRC  239



>emb|CBI26357.3| unnamed protein product [Vitis vinifera]
Length=237

 Score =   213 bits (543),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 100/105 (95%), Positives = 103/105 (98%), Gaps = 0/105 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY+SYQ+LSDAL KMFSSFTMGNYGAQGMIDFMNE KLMDLLNSSEYVPTYEDK
Sbjct  133  RKVDLKMYKSYQELSDALGKMFSSFTMGNYGAQGMIDFMNESKLMDLLNSSEYVPTYEDK  192

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  388
            DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRA+EKCKNRC
Sbjct  193  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKNRC  237



>ref|XP_002284133.1| PREDICTED: auxin-responsive protein IAA14 [Vitis vinifera]
Length=243

 Score =   213 bits (543),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 100/105 (95%), Positives = 103/105 (98%), Gaps = 0/105 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY+SYQ+LSDAL KMFSSFTMGNYGAQGMIDFMNE KLMDLLNSSEYVPTYEDK
Sbjct  139  RKVDLKMYKSYQELSDALGKMFSSFTMGNYGAQGMIDFMNESKLMDLLNSSEYVPTYEDK  198

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  388
            DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRA+EKCKNRC
Sbjct  199  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKNRC  243



>ref|XP_009611797.1| PREDICTED: auxin-responsive protein IAA14 [Nicotiana tomentosiformis]
Length=243

 Score =   212 bits (540),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 99/104 (95%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY+SYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSS+YVPTYEDK
Sbjct  139  RKVDLKMYKSYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSDYVPTYEDK  198

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPW+MFVDSCKRLRIMKGSEAIGLAPRA+EKCK+R
Sbjct  199  DGDWMLVGDVPWQMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSR  242



>ref|XP_009591035.1| PREDICTED: auxin-responsive protein IAA7-like [Nicotiana tomentosiformis]
Length=225

 Score =   211 bits (538),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY+SYQQLSDALAKMFSSFTMGNYGAQGMIDFMNE KLMDLLNSSEYVPTYEDK
Sbjct  121  RKVDLKMYKSYQQLSDALAKMFSSFTMGNYGAQGMIDFMNESKLMDLLNSSEYVPTYEDK  180

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRA+EKCK R
Sbjct  181  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKRR  224



>ref|XP_011091113.1| PREDICTED: auxin-responsive protein IAA14 [Sesamum indicum]
Length=241

 Score =   211 bits (538),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 98/105 (93%), Positives = 103/105 (98%), Gaps = 0/105 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY+SYQ+LSDALAKMFSSFTMGNYG QGMIDFMNE KLMDLLNSSEYVPTYEDK
Sbjct  137  RKVDLKMYKSYQELSDALAKMFSSFTMGNYGTQGMIDFMNESKLMDLLNSSEYVPTYEDK  196

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  388
            DGDWMLVGDVPW+MFVDSCKRLRIMKGSEAIGLAPRA+EKCK+RC
Sbjct  197  DGDWMLVGDVPWQMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSRC  241



>gb|KDP40274.1| hypothetical protein JCGZ_02272 [Jatropha curcas]
Length=241

 Score =   211 bits (536),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 99/104 (95%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY+SYQ+LSDALAKMFSSFTMGNYGAQGMIDFMNE KLMDLLNSSEYVPTYEDK
Sbjct  137  RKVDLKMYKSYQELSDALAKMFSSFTMGNYGAQGMIDFMNESKLMDLLNSSEYVPTYEDK  196

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRA+EKCK+R
Sbjct  197  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSR  240



>ref|XP_002517023.1| Auxin-responsive protein IAA7, putative [Ricinus communis]
 gb|EEF45186.1| Auxin-responsive protein IAA7, putative [Ricinus communis]
Length=181

 Score =   208 bits (530),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY+SYQ+LSDALAKMFSSFTMGNYG QGMIDFMNE KLMDLLNSSEYVPTYEDK
Sbjct  77   RKVDLKMYKSYQELSDALAKMFSSFTMGNYGTQGMIDFMNESKLMDLLNSSEYVPTYEDK  136

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRA+EKCK+R
Sbjct  137  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSR  180



>ref|XP_009776553.1| PREDICTED: auxin-responsive protein IAA14-like [Nicotiana sylvestris]
Length=244

 Score =   210 bits (535),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY+SYQQLSDALA MFSSFTMGNYGAQGMIDFMNERKLMDLLNSS+YVPTYEDK
Sbjct  140  RKVDLKMYKSYQQLSDALANMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSDYVPTYEDK  199

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPW+MFVDSCKRLRIMKGSEAIGLAPRA+EKCK+R
Sbjct  200  DGDWMLVGDVPWQMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSR  243



>gb|ABM53874.1| IAA6 [Cestrum elegans]
Length=153

 Score =   207 bits (526),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 97/104 (93%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY+SY+QLSDALAKMFSSFTMGNYGAQGMIDFMNE KLMDLLN+SEYVP+YEDK
Sbjct  49   RKVDLKMYKSYKQLSDALAKMFSSFTMGNYGAQGMIDFMNESKLMDLLNTSEYVPSYEDK  108

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRA+EKCK+R
Sbjct  109  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSR  152



>ref|XP_011030586.1| PREDICTED: auxin-responsive protein IAA14-like isoform X2 [Populus 
euphratica]
Length=248

 Score =   210 bits (534),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY SYQ+LSDALAKMFSSFTMGNYGAQGMIDFMNE KLMDLLNSSEYVP+YEDK
Sbjct  144  RKVDLKMYRSYQELSDALAKMFSSFTMGNYGAQGMIDFMNESKLMDLLNSSEYVPSYEDK  203

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRA+EKCK+R
Sbjct  204  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSR  247



>ref|XP_007034956.1| Indole-3-acetic acid 7 isoform 1 [Theobroma cacao]
 gb|EOY05882.1| Indole-3-acetic acid 7 isoform 1 [Theobroma cacao]
Length=254

 Score =   209 bits (532),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY+SYQ+LSDALAKMFSSFTMGNYGAQGMIDFMNE KLMDLLNSS+YVPTYEDK
Sbjct  150  RKVDLKMYKSYQELSDALAKMFSSFTMGNYGAQGMIDFMNESKLMDLLNSSDYVPTYEDK  209

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRA+EKCK+R
Sbjct  210  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSR  253



>ref|XP_002315736.1| aux/IAA family protein [Populus trichocarpa]
 gb|EEF01907.1| aux/IAA family protein [Populus trichocarpa]
Length=277

 Score =   210 bits (534),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 98/105 (93%), Positives = 103/105 (98%), Gaps = 0/105 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY+SYQ+LSDALAKMFSSFTMGNYGAQGMIDFMNE KLMDLLNSSEYVP+YEDK
Sbjct  173  RKVDLKMYKSYQELSDALAKMFSSFTMGNYGAQGMIDFMNESKLMDLLNSSEYVPSYEDK  232

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  388
            DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRA+EKCK+R 
Sbjct  233  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSRT  277



>ref|XP_007143877.1| hypothetical protein PHAVU_007G109500g [Phaseolus vulgaris]
 gb|ESW15871.1| hypothetical protein PHAVU_007G109500g [Phaseolus vulgaris]
Length=244

 Score =   208 bits (530),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 97/104 (93%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDL MY+SY+ LSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK
Sbjct  140  RKVDLTMYKSYKDLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  199

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRA+EKCK+R
Sbjct  200  DGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKSR  243



>ref|NP_001275031.1| auxin-responsive protein IAA14-like [Solanum tuberosum]
 gb|ABK41009.1| auxin/indole-3-acetic acid [Solanum tuberosum]
Length=213

 Score =   207 bits (527),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 96/104 (92%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY+SYQQLSD+L KMFSSFTMGNYG+QGMIDFMNERKLMD+LNSS+YVPTYEDK
Sbjct  109  RKVDLKMYKSYQQLSDSLTKMFSSFTMGNYGSQGMIDFMNERKLMDVLNSSDYVPTYEDK  168

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPW+MFVDSCKRLRIMKGSEAIGLAPRA+EKCKNR
Sbjct  169  DGDWMLVGDVPWQMFVDSCKRLRIMKGSEAIGLAPRAMEKCKNR  212



>ref|XP_002311658.1| aux/IAA family protein [Populus trichocarpa]
 gb|ABK95711.1| unknown [Populus trichocarpa]
 gb|EEE89025.1| aux/IAA family protein [Populus trichocarpa]
Length=248

 Score =   208 bits (530),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 97/104 (93%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY SYQ+LSDALAKMFSSFTMGNYGAQGMIDFMNE KLMDLLNSSEYVP+YEDK
Sbjct  144  RKVDLKMYRSYQELSDALAKMFSSFTMGNYGAQGMIDFMNESKLMDLLNSSEYVPSYEDK  203

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRA+EKCK+R
Sbjct  204  DGDWMLVGDVPWEMFVNSCKRLRIMKGSEAIGLAPRAMEKCKSR  247



>gb|EYU32514.1| hypothetical protein MIMGU_mgv1a012542mg [Erythranthe guttata]
Length=247

 Score =   208 bits (529),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 96/105 (91%), Positives = 103/105 (98%), Gaps = 0/105 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY +YQ+LSDALAKMFSSFTMGNYG++GMIDFMNE KLMDLLNSSEYVPTYEDK
Sbjct  143  RKVDLKMYGAYQELSDALAKMFSSFTMGNYGSEGMIDFMNEGKLMDLLNSSEYVPTYEDK  202

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  388
            DGDWMLVGDVPWEMFVDSCKR+RIMKGSEAIGLAPRA+EKCK+RC
Sbjct  203  DGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRAMEKCKSRC  247



>ref|XP_004172452.1| PREDICTED: auxin-responsive protein IAA14-like [Cucumis sativus]
 gb|KGN61643.1| hypothetical protein Csa_2G200420 [Cucumis sativus]
Length=256

 Score =   208 bits (530),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 97/104 (93%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY+SYQ+LSDALAKMFSSFTMG YG QGMIDFMNERKLMDLLNSSE+VPTYEDK
Sbjct  152  RKVDLKMYQSYQELSDALAKMFSSFTMGEYGTQGMIDFMNERKLMDLLNSSEFVPTYEDK  211

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRA+EKCK+R
Sbjct  212  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSR  255



>gb|AFZ78617.1| hypothetical protein [Populus tomentosa]
Length=248

 Score =   208 bits (529),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 97/104 (93%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY SYQ+LSDALAKMFSSFTMGNYGAQGMIDFMNE KLMDLLNSSEYVP+YEDK
Sbjct  144  RKVDLKMYRSYQELSDALAKMFSSFTMGNYGAQGMIDFMNESKLMDLLNSSEYVPSYEDK  203

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRA+EKCK+R
Sbjct  204  DGDWMLVGDVPWEMFVNSCKRLRIMKGSEAIGLAPRAMEKCKSR  247



>ref|XP_008465181.1| PREDICTED: auxin-responsive protein IAA14-like [Cucumis melo]
Length=256

 Score =   208 bits (529),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 97/104 (93%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY+SYQ+LSDALAKMFSSFTMG YG QGMIDFMNERKLMDLLNSSE+VPTYEDK
Sbjct  152  RKVDLKMYQSYQELSDALAKMFSSFTMGEYGTQGMIDFMNERKLMDLLNSSEFVPTYEDK  211

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRA+EKCK+R
Sbjct  212  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSR  255



>ref|XP_009777122.1| PREDICTED: auxin-responsive protein IAA14-like [Nicotiana sylvestris]
Length=223

 Score =   207 bits (526),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY+SYQQLSDALAKMFSSFTMGNYG QGMIDFMNE KLMDLLNSSEYVPTYEDK
Sbjct  119  RKVDLKMYKSYQQLSDALAKMFSSFTMGNYGPQGMIDFMNESKLMDLLNSSEYVPTYEDK  178

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPW MFVDSCKRLRIMKGSEAIGLAPRA+EKCK R
Sbjct  179  DGDWMLVGDVPWVMFVDSCKRLRIMKGSEAIGLAPRAMEKCKRR  222



>ref|XP_011027555.1| PREDICTED: auxin-responsive protein IAA14 isoform X2 [Populus 
euphratica]
 ref|XP_011029891.1| PREDICTED: auxin-responsive protein IAA14-like isoform X2 [Populus 
euphratica]
Length=248

 Score =   207 bits (527),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 96/104 (92%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY SYQ+LSDALAKMFSSFTMGNYGAQGMIDFMNE KLMDLLNSSEYVP+YEDK
Sbjct  144  RKVDLKMYRSYQELSDALAKMFSSFTMGNYGAQGMIDFMNESKLMDLLNSSEYVPSYEDK  203

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFV+SCKRLR+MKGSEAIGLAPRA+EKCK+R
Sbjct  204  DGDWMLVGDVPWEMFVNSCKRLRLMKGSEAIGLAPRAMEKCKSR  247



>gb|AFK44393.1| unknown [Lotus japonicus]
Length=242

 Score =   207 bits (526),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 97/104 (93%), Positives = 101/104 (97%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDL MY+SY++LSDALAKMFSSFTMGNYGAQGMIDFMNE KLMDLLNSSEYVPTYEDK
Sbjct  138  RKVDLTMYKSYKELSDALAKMFSSFTMGNYGAQGMIDFMNESKLMDLLNSSEYVPTYEDK  197

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFV SCKRLRIMKGSEAIGLAPRA+EKCKNR
Sbjct  198  DGDWMLVGDVPWEMFVGSCKRLRIMKGSEAIGLAPRAMEKCKNR  241



>ref|NP_001266070.1| IAA14 [Solanum lycopersicum]
 gb|AEX00357.1| IAA14 [Solanum lycopersicum]
Length=236

 Score =   207 bits (526),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 97/104 (93%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY+SYQ+LSDALAKMFSSFT GNYG+QGMIDFMNE KLMDLLNSSEYVPTYEDK
Sbjct  132  RKVDLKMYKSYQELSDALAKMFSSFTNGNYGSQGMIDFMNESKLMDLLNSSEYVPTYEDK  191

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRA+EKCK+R
Sbjct  192  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSR  235



>gb|KHN05057.1| Auxin-responsive protein IAA14 [Glycine soja]
Length=245

 Score =   207 bits (526),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 96/104 (92%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDL MY+SY++LSDALAKMFSSFTMGNYGAQGMIDFMNE KLMDLLNSSEYVPTYEDK
Sbjct  141  RKVDLTMYKSYKELSDALAKMFSSFTMGNYGAQGMIDFMNESKLMDLLNSSEYVPTYEDK  200

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRA+EKCK+R
Sbjct  201  DGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKSR  244



>ref|XP_006362195.1| PREDICTED: auxin-responsive protein IAA14-like [Solanum tuberosum]
Length=238

 Score =   206 bits (525),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 97/104 (93%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY+SYQ+LSDALAKMFSSFT GNYG+QGMIDFMNE KLMDLLNSSEYVPTYEDK
Sbjct  134  RKVDLKMYKSYQELSDALAKMFSSFTNGNYGSQGMIDFMNESKLMDLLNSSEYVPTYEDK  193

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRA+EKCK+R
Sbjct  194  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSR  237



>ref|XP_007223810.1| hypothetical protein PRUPE_ppa010698mg [Prunus persica]
 gb|EMJ25009.1| hypothetical protein PRUPE_ppa010698mg [Prunus persica]
Length=239

 Score =   206 bits (524),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 97/104 (93%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY+SYQ+LS++LAKMFSSFTMG YGAQGMIDFMNE KLMDLLNSSEYVPTYEDK
Sbjct  135  RKVDLKMYKSYQELSNSLAKMFSSFTMGYYGAQGMIDFMNESKLMDLLNSSEYVPTYEDK  194

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRA+EKCKNR
Sbjct  195  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKNR  238



>ref|NP_001266039.1| IAA7 protein [Solanum lycopersicum]
 gb|AEX00351.1| IAA7 [Solanum lycopersicum]
Length=218

 Score =   205 bits (522),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 94/105 (90%), Positives = 101/105 (96%), Gaps = 0/105 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY+SYQQLS +L  MFSSFTMGNYG+QGMIDFMNERKLMD+LNSS+YVPTYEDK
Sbjct  114  RKVDLKMYKSYQQLSHSLTNMFSSFTMGNYGSQGMIDFMNERKLMDVLNSSDYVPTYEDK  173

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  388
            DGDWMLVGDVPW+MFVDSCKRLRIMKGSEAIGLAPRA+EKCKNR 
Sbjct  174  DGDWMLVGDVPWQMFVDSCKRLRIMKGSEAIGLAPRAMEKCKNRS  218



>gb|ADJ68049.1| auxin responsive protein [Catharanthus roseus]
Length=242

 Score =   206 bits (523),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 97/106 (92%), Positives = 103/106 (97%), Gaps = 1/106 (1%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQ-GMIDFMNERKLMDLLNSSEYVPTYED  526
            RKVDLK+Y+SYQ+L+DALAKMFSSFTMGNYG Q GMIDFMNE KLMDLLNSSEYVPTYED
Sbjct  137  RKVDLKIYKSYQELADALAKMFSSFTMGNYGTQQGMIDFMNESKLMDLLNSSEYVPTYED  196

Query  525  KDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  388
            KDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRA+EKCK+RC
Sbjct  197  KDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSRC  242



>gb|AEE25653.1| auxin-responsive protein [Gossypium hirsutum]
Length=249

 Score =   206 bits (524),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 95/105 (90%), Positives = 102/105 (97%), Gaps = 0/105 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY+SYQ+LSDALAKMFSSFTMGNYG QGMIDFMNE KLMDLLNSS+YVP+YEDK
Sbjct  145  RKVDLKMYKSYQELSDALAKMFSSFTMGNYGPQGMIDFMNESKLMDLLNSSDYVPSYEDK  204

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  388
            DGDWMLVGDVPW+MFVDSCKRLRIMKGSEAIGLAPRA+EKCK+R 
Sbjct  205  DGDWMLVGDVPWQMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSRA  249



>gb|EYU33008.1| hypothetical protein MIMGU_mgv1a012321mg [Erythranthe guttata]
Length=254

 Score =   206 bits (524),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 94/105 (90%), Positives = 103/105 (98%), Gaps = 0/105 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY+SYQ+ SDALAKMFSSFTMG YG++GMIDFMNERKLMD+LNS+EYVPTYEDK
Sbjct  150  RKVDLKMYKSYQEFSDALAKMFSSFTMGKYGSEGMIDFMNERKLMDVLNSTEYVPTYEDK  209

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  388
            DGDWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRA+EKCK+RC
Sbjct  210  DGDWMLVGDVPWEMFVNSCKRLRIMKGSEAIGLAPRAMEKCKSRC  254



>gb|KHF98789.1| Auxin-responsive IAA14 -like protein [Gossypium arboreum]
Length=249

 Score =   206 bits (524),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 95/105 (90%), Positives = 102/105 (97%), Gaps = 0/105 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY+SYQ+LSDALAKMFSSFTMGNYG QGMIDFMNE KLMDLLNSS+YVP+YEDK
Sbjct  145  RKVDLKMYKSYQELSDALAKMFSSFTMGNYGPQGMIDFMNESKLMDLLNSSDYVPSYEDK  204

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  388
            DGDWMLVGDVPW+MFVDSCKRLRIMKGSEAIGLAPRA+EKCK+R 
Sbjct  205  DGDWMLVGDVPWQMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSRA  249



>gb|KJB38280.1| hypothetical protein B456_006G246000 [Gossypium raimondii]
Length=249

 Score =   206 bits (523),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 95/105 (90%), Positives = 102/105 (97%), Gaps = 0/105 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY+SYQ+LSDALAKMFSSFTMGNYG QGMIDFMNE KLMDLLNSS+YVP+YEDK
Sbjct  145  RKVDLKMYKSYQELSDALAKMFSSFTMGNYGPQGMIDFMNESKLMDLLNSSDYVPSYEDK  204

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  388
            DGDWMLVGDVPW+MFVDSCKRLRIMKGSEAIGLAPRA+EKCK+R 
Sbjct  205  DGDWMLVGDVPWQMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSRA  249



>ref|NP_001240213.1| auxin-induced protein ali50 [Glycine max]
 gb|ACR39367.1| Aux/IAA protein [Glycine max]
Length=239

 Score =   205 bits (521),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 96/104 (92%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDL MY+SY+ LSDALAKMFSSFTMGNYGAQGMIDFMNE KLMDLLNSSEYVPTYEDK
Sbjct  135  RKVDLTMYKSYKDLSDALAKMFSSFTMGNYGAQGMIDFMNESKLMDLLNSSEYVPTYEDK  194

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFV SCKRLRIMKGSEAIGLAPRA+EKCK+R
Sbjct  195  DGDWMLVGDVPWEMFVGSCKRLRIMKGSEAIGLAPRAMEKCKSR  238



>ref|XP_011030585.1| PREDICTED: auxin-responsive protein IAA14-like isoform X1 [Populus 
euphratica]
Length=250

 Score =   205 bits (522),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 98/106 (92%), Positives = 102/106 (96%), Gaps = 2/106 (2%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY SYQ+LSDALAKMFSSFTMGNYGAQGMIDFMNE KLMDLLNSSEYVP+YEDK
Sbjct  144  RKVDLKMYRSYQELSDALAKMFSSFTMGNYGAQGMIDFMNESKLMDLLNSSEYVPSYEDK  203

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGL--APRAVEKCKNR  391
            DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGL  APRA+EKCK+R
Sbjct  204  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLVSAPRAMEKCKSR  249



>ref|XP_006420094.1| hypothetical protein CICLE_v10005789mg [Citrus clementina]
 ref|XP_006489503.1| PREDICTED: auxin-responsive protein IAA14-like [Citrus sinensis]
 gb|ESR33334.1| hypothetical protein CICLE_v10005789mg [Citrus clementina]
 gb|KDO53918.1| hypothetical protein CISIN_1g026811mg [Citrus sinensis]
Length=232

 Score =   204 bits (520),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 95/104 (91%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLK Y+SYQ+LSDALAKMFSSFTMGNYG+QGMIDFMNE KLMDLLNSS+YVPTYEDK
Sbjct  128  RKVDLKTYKSYQELSDALAKMFSSFTMGNYGSQGMIDFMNESKLMDLLNSSDYVPTYEDK  187

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFVDSCKR+RIMKGSEAIGLAPRA+EKCK+R
Sbjct  188  DGDWMLVGDVPWEMFVDSCKRMRIMKGSEAIGLAPRAMEKCKSR  231



>ref|XP_011073485.1| PREDICTED: auxin-responsive protein IAA14 [Sesamum indicum]
Length=251

 Score =   205 bits (522),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 97/106 (92%), Positives = 103/106 (97%), Gaps = 1/106 (1%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTM-GNYGAQGMIDFMNERKLMDLLNSSEYVPTYED  526
            RKVDLKMY+SYQ+LSDAL KMFS+FTM GNYG+QGMIDFMNE KLMDLLNSSEYVPTYED
Sbjct  146  RKVDLKMYKSYQELSDALVKMFSAFTMAGNYGSQGMIDFMNEGKLMDLLNSSEYVPTYED  205

Query  525  KDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  388
            KDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRA+EKCK+RC
Sbjct  206  KDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSRC  251



>gb|KJB38278.1| hypothetical protein B456_006G246000 [Gossypium raimondii]
Length=294

 Score =   206 bits (525),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 95/105 (90%), Positives = 102/105 (97%), Gaps = 0/105 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY+SYQ+LSDALAKMFSSFTMGNYG QGMIDFMNE KLMDLLNSS+YVP+YEDK
Sbjct  190  RKVDLKMYKSYQELSDALAKMFSSFTMGNYGPQGMIDFMNESKLMDLLNSSDYVPSYEDK  249

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  388
            DGDWMLVGDVPW+MFVDSCKRLRIMKGSEAIGLAPRA+EKCK+R 
Sbjct  250  DGDWMLVGDVPWQMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSRA  294



>gb|AFK37379.1| unknown [Medicago truncatula]
Length=236

 Score =   204 bits (520),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 95/104 (91%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDL MY++Y+ LSDALAKMFSSFT+GNYGAQGMIDFMNE KLMDLLNSSEYVPTYEDK
Sbjct  132  RKVDLTMYKTYKDLSDALAKMFSSFTIGNYGAQGMIDFMNESKLMDLLNSSEYVPTYEDK  191

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFV SCKRLRIMKGSEAIGLAPRA+EKCKNR
Sbjct  192  DGDWMLVGDVPWEMFVGSCKRLRIMKGSEAIGLAPRAMEKCKNR  235



>ref|XP_010532600.1| PREDICTED: auxin-responsive protein IAA14 [Tarenaya hassleriana]
Length=229

 Score =   204 bits (519),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 96/105 (91%), Positives = 101/105 (96%), Gaps = 0/105 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKM++SYQ LSDALAKMFSSFTMG+YGAQGMIDFMNE KLMDLLNSSEYVPTYEDK
Sbjct  125  RKVDLKMHKSYQDLSDALAKMFSSFTMGSYGAQGMIDFMNESKLMDLLNSSEYVPTYEDK  184

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  388
            DGDWMLVGDVPW MFV+SCKRLRIMKGSEAIGLAPRA+EKCKNR 
Sbjct  185  DGDWMLVGDVPWLMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS  229



>ref|XP_008224185.1| PREDICTED: auxin-responsive protein IAA14 [Prunus mume]
Length=248

 Score =   205 bits (521),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 96/104 (92%), Positives = 101/104 (97%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY+SYQ+LS++LAKMFSSFTMG YG QGMIDFMNE KLMDLLNSSEYVPTYEDK
Sbjct  144  RKVDLKMYKSYQELSNSLAKMFSSFTMGYYGPQGMIDFMNESKLMDLLNSSEYVPTYEDK  203

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRA+EKCKNR
Sbjct  204  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKNR  247



>ref|XP_003591806.1| Indoleacetic acid-induced-like protein [Medicago truncatula]
 gb|AES62057.1| auxin-responsive AUX/IAA family protein [Medicago truncatula]
Length=236

 Score =   204 bits (519),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 95/104 (91%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDL MY++Y+ LSDALAKMFSSFT GNYGAQGMIDFMNE KLMDLLNSSEYVPTYEDK
Sbjct  132  RKVDLTMYKTYKDLSDALAKMFSSFTTGNYGAQGMIDFMNESKLMDLLNSSEYVPTYEDK  191

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFV SCKRLRIMKGSEAIGLAPRA+EKCKNR
Sbjct  192  DGDWMLVGDVPWEMFVGSCKRLRIMKGSEAIGLAPRAMEKCKNR  235



>gb|AAM65301.1| indoleacetic acid (IAA)-inducible gene (IAA7) [Arabidopsis thaliana]
Length=238

 Score =   204 bits (518),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 97/105 (92%), Positives = 102/105 (97%), Gaps = 1/105 (1%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY+SYQ LSDALAKMFSSFTMGNYGAQGMIDFMNE KLM+LLNSSEYVP+YEDK
Sbjct  133  RKVDLKMYKSYQDLSDALAKMFSSFTMGNYGAQGMIDFMNESKLMNLLNSSEYVPSYEDK  192

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEK-CKNR  391
            DGDWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRA+EK CKNR
Sbjct  193  DGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKYCKNR  237



>ref|XP_010466604.1| PREDICTED: auxin-responsive protein IAA7-like [Camelina sativa]
Length=242

 Score =   204 bits (518),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 97/105 (92%), Positives = 102/105 (97%), Gaps = 1/105 (1%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY+SYQ LSDALAKMFSSFTMGNYGAQGMIDFMNE KLM+LLNSSEYVP+YEDK
Sbjct  137  RKVDLKMYKSYQDLSDALAKMFSSFTMGNYGAQGMIDFMNESKLMNLLNSSEYVPSYEDK  196

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEK-CKNR  391
            DGDWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRA+EK CKNR
Sbjct  197  DGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKYCKNR  241



>gb|KFK39592.1| hypothetical protein AALP_AA3G264300 [Arabis alpina]
Length=235

 Score =   203 bits (517),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 97/105 (92%), Positives = 101/105 (96%), Gaps = 1/105 (1%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDL MY+SYQ LSDALAKMFSSFTMGNYGAQGMIDFMNE KLMDLLNSSEYVP+YEDK
Sbjct  130  RKVDLNMYKSYQDLSDALAKMFSSFTMGNYGAQGMIDFMNESKLMDLLNSSEYVPSYEDK  189

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEK-CKNR  391
            DGDWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRA+EK CKNR
Sbjct  190  DGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKYCKNR  234



>ref|XP_010551700.1| PREDICTED: auxin-responsive protein IAA14 [Tarenaya hassleriana]
Length=234

 Score =   203 bits (517),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 94/104 (90%), Positives = 101/104 (97%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLK+Y+ YQ LSDALAKMFSSFTMGNYG+QGMIDFMNE KLMDLLNSSEYVP+YEDK
Sbjct  130  RKVDLKIYQCYQDLSDALAKMFSSFTMGNYGSQGMIDFMNESKLMDLLNSSEYVPSYEDK  189

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPW+MFV+SCKRLRIMKGSEAIGLAPRA+EKCKNR
Sbjct  190  DGDWMLVGDVPWQMFVESCKRLRIMKGSEAIGLAPRAMEKCKNR  233



>emb|CAC84710.1| aux/IAA protein [Populus tremula x Populus tremuloides]
Length=277

 Score =   204 bits (520),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 95/104 (91%), Positives = 101/104 (97%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY+SYQ+LSDALAKMFSS TMGNYGAQGMIDFMNE KLMDLLNSSEYVP+YEDK
Sbjct  173  RKVDLKMYKSYQELSDALAKMFSSLTMGNYGAQGMIDFMNESKLMDLLNSSEYVPSYEDK  232

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFVDSCKR RIMKGSEA+GLAPRA+EKCK+R
Sbjct  233  DGDWMLVGDVPWEMFVDSCKRPRIMKGSEAVGLAPRAMEKCKSR  276



>ref|XP_010512022.1| PREDICTED: auxin-responsive protein IAA7 [Camelina sativa]
Length=242

 Score =   203 bits (517),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 97/105 (92%), Positives = 102/105 (97%), Gaps = 1/105 (1%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY+SYQ LSDALAKMFSSFTMGNYGAQGMIDFMNE KLM+LLNSSEYVP+YEDK
Sbjct  137  RKVDLKMYKSYQDLSDALAKMFSSFTMGNYGAQGMIDFMNESKLMNLLNSSEYVPSYEDK  196

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEK-CKNR  391
            DGDWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRA+EK CKNR
Sbjct  197  DGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKYCKNR  241



>ref|XP_010488346.1| PREDICTED: auxin-responsive protein IAA7-like [Camelina sativa]
Length=242

 Score =   203 bits (517),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 97/105 (92%), Positives = 102/105 (97%), Gaps = 1/105 (1%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY+SYQ LSDALAKMFSSFTMGNYGAQGMIDFMNE KLM+LLNSSEYVP+YEDK
Sbjct  137  RKVDLKMYKSYQDLSDALAKMFSSFTMGNYGAQGMIDFMNESKLMNLLNSSEYVPSYEDK  196

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEK-CKNR  391
            DGDWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRA+EK CKNR
Sbjct  197  DGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKYCKNR  241



>ref|XP_003556389.2| PREDICTED: auxin-responsive protein IAA14-like [Glycine max]
Length=331

 Score =   206 bits (525),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 95/104 (91%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDL MY+SY++LSDALAKMFSSFTMGNYGAQGMIDFMNE KLMDLLNSSEYVP+YEDK
Sbjct  227  RKVDLTMYKSYKELSDALAKMFSSFTMGNYGAQGMIDFMNESKLMDLLNSSEYVPSYEDK  286

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRA+EKCK+R
Sbjct  287  DGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKSR  330



>ref|XP_006406100.1| hypothetical protein EUTSA_v10021428mg [Eutrema salsugineum]
 dbj|BAJ33997.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ47553.1| hypothetical protein EUTSA_v10021428mg [Eutrema salsugineum]
Length=239

 Score =   203 bits (516),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 97/105 (92%), Positives = 102/105 (97%), Gaps = 1/105 (1%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY+SYQ LSDALAKMFSSFTMGNYGAQGMIDFMNE KLM+LLNSSEYVP+YEDK
Sbjct  134  RKVDLKMYKSYQDLSDALAKMFSSFTMGNYGAQGMIDFMNESKLMNLLNSSEYVPSYEDK  193

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEK-CKNR  391
            DGDWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRA+EK CKNR
Sbjct  194  DGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKYCKNR  238



>ref|XP_006298251.1| hypothetical protein CARUB_v10014321mg [Capsella rubella]
 gb|EOA31149.1| hypothetical protein CARUB_v10014321mg [Capsella rubella]
Length=285

 Score =   204 bits (520),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 97/105 (92%), Positives = 102/105 (97%), Gaps = 1/105 (1%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY+SYQ LSDALAKMFSSFTMGNYGAQGMIDFMNE KLM+LLNSSEYVP+YEDK
Sbjct  180  RKVDLKMYKSYQDLSDALAKMFSSFTMGNYGAQGMIDFMNESKLMNLLNSSEYVPSYEDK  239

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEK-CKNR  391
            DGDWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRA+EK CKNR
Sbjct  240  DGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKYCKNR  284



>ref|XP_002883395.1| hypothetical protein ARALYDRAFT_319024 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59654.1| hypothetical protein ARALYDRAFT_319024 [Arabidopsis lyrata subsp. 
lyrata]
Length=242

 Score =   203 bits (516),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 97/105 (92%), Positives = 102/105 (97%), Gaps = 1/105 (1%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY+SYQ LSDALAKMFSSFTMGNYGAQGMIDFMNE KLM+LLNSSEYVP+YEDK
Sbjct  137  RKVDLKMYKSYQDLSDALAKMFSSFTMGNYGAQGMIDFMNESKLMNLLNSSEYVPSYEDK  196

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEK-CKNR  391
            DGDWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRA+EK CKNR
Sbjct  197  DGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKYCKNR  241



>ref|NP_188945.1| auxin-responsive protein IAA7 [Arabidopsis thaliana]
 sp|Q38825.1|IAA7_ARATH RecName: Full=Auxin-responsive protein IAA7; AltName: Full=Auxin 
resistant 2; AltName: Full=Indoleacetic acid-induced protein 
7 [Arabidopsis thaliana]
 gb|AAG48759.1|AF332395_1 indoleacetic acid-inducible protein IAA7 [Arabidopsis thaliana]
 gb|AAC49048.1| IAA7 [Arabidopsis thaliana]
 dbj|BAB02096.1| auxin-responsive protein IAA7 [Arabidopsis thaliana]
 gb|AAK96842.1| auxin-responsive protein IAA7 [Arabidopsis thaliana]
 gb|AAL66876.1| auxin-responsive protein IAA7 [Arabidopsis thaliana]
 gb|AEE76710.1| auxin-responsive protein IAA7 [Arabidopsis thaliana]
Length=243

 Score =   203 bits (516),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 96/105 (91%), Positives = 102/105 (97%), Gaps = 1/105 (1%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY+SYQ LSDALAKMFSSFTMGNYGAQGMIDFMNE KLM+LLNSSEYVP+YEDK
Sbjct  138  RKVDLKMYKSYQDLSDALAKMFSSFTMGNYGAQGMIDFMNESKLMNLLNSSEYVPSYEDK  197

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEK-CKNR  391
            DGDWMLVGDVPWEMFV+SCKRLRIMKGSEA+GLAPRA+EK CKNR
Sbjct  198  DGDWMLVGDVPWEMFVESCKRLRIMKGSEAVGLAPRAMEKYCKNR  242



>ref|XP_004288427.1| PREDICTED: auxin-responsive protein IAA14-like [Fragaria vesca 
subsp. vesca]
Length=238

 Score =   202 bits (515),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 94/104 (90%), Positives = 101/104 (97%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY+SY++LSDAL+KMFSSFT G YGAQGMIDFMNE KLMDLLNS+EYVPTYEDK
Sbjct  134  RKVDLKMYKSYKELSDALSKMFSSFTTGYYGAQGMIDFMNESKLMDLLNSTEYVPTYEDK  193

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAP+A+EKCKNR
Sbjct  194  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPKAMEKCKNR  237



>ref|XP_010024036.1| PREDICTED: auxin-responsive protein IAA14-like [Eucalyptus grandis]
 gb|KCW60450.1| hypothetical protein EUGRSUZ_H03170 [Eucalyptus grandis]
Length=243

 Score =   202 bits (515),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 95/105 (90%), Positives = 100/105 (95%), Gaps = 0/105 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLK Y SY+QLSDAL KMFSSFTMG+YGAQGMIDFMNE KLMDLLNSS+YVPTYEDK
Sbjct  139  RKVDLKNYSSYKQLSDALGKMFSSFTMGSYGAQGMIDFMNESKLMDLLNSSDYVPTYEDK  198

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  388
            DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRA+EKCK+R 
Sbjct  199  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSRS  243



>ref|XP_008438588.1| PREDICTED: auxin-responsive protein IAA14-like [Cucumis melo]
Length=237

 Score =   202 bits (514),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 97/105 (92%), Positives = 103/105 (98%), Gaps = 1/105 (1%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTM-GNYGAQGMIDFMNERKLMDLLNSSEYVPTYED  526
            RKVDLKMY+SYQ+LS+ALAKMFSSFTM G+YGAQGMIDFMNE KLMDLLNSSEYVPTYED
Sbjct  132  RKVDLKMYKSYQELSNALAKMFSSFTMAGDYGAQGMIDFMNESKLMDLLNSSEYVPTYED  191

Query  525  KDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            KDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRA+EKCK+R
Sbjct  192  KDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSR  236



>ref|XP_004134096.1| PREDICTED: auxin-responsive protein IAA14-like isoform 1 [Cucumis 
sativus]
 ref|XP_004162257.1| PREDICTED: LOW QUALITY PROTEIN: auxin-responsive protein IAA14-like 
[Cucumis sativus]
 gb|KGN56916.1| hypothetical protein Csa_3G143570 [Cucumis sativus]
Length=237

 Score =   202 bits (514),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 97/105 (92%), Positives = 103/105 (98%), Gaps = 1/105 (1%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTM-GNYGAQGMIDFMNERKLMDLLNSSEYVPTYED  526
            RKVDLKMY+SYQ+LS+ALAKMFSSFTM G+YGAQGMIDFMNE KLMDLLNSSEYVPTYED
Sbjct  132  RKVDLKMYKSYQELSNALAKMFSSFTMAGDYGAQGMIDFMNESKLMDLLNSSEYVPTYED  191

Query  525  KDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            KDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRA+EKCK+R
Sbjct  192  KDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSR  236



>ref|XP_011027545.1| PREDICTED: auxin-responsive protein IAA14 isoform X1 [Populus 
euphratica]
 ref|XP_011029890.1| PREDICTED: auxin-responsive protein IAA14-like isoform X1 [Populus 
euphratica]
Length=250

 Score =   202 bits (514),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 96/106 (91%), Positives = 102/106 (96%), Gaps = 2/106 (2%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY SYQ+LSDALAKMFSSFTMGNYGAQGMIDFMNE KLMDLLNSSEYVP+YEDK
Sbjct  144  RKVDLKMYRSYQELSDALAKMFSSFTMGNYGAQGMIDFMNESKLMDLLNSSEYVPSYEDK  203

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGL--APRAVEKCKNR  391
            DGDWMLVGDVPWEMFV+SCKRLR+MKGSEAIGL  APRA+EKCK+R
Sbjct  204  DGDWMLVGDVPWEMFVNSCKRLRLMKGSEAIGLVSAPRAMEKCKSR  249



>gb|KJB28413.1| hypothetical protein B456_005G046500 [Gossypium raimondii]
Length=248

 Score =   202 bits (514),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 95/104 (91%), Positives = 101/104 (97%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY SYQ+LSDALAKMFSSFTMG+YG +GMIDFMNE KLMDLLNSS+YVPTYEDK
Sbjct  144  RKVDLKMYNSYQKLSDALAKMFSSFTMGSYGCEGMIDFMNESKLMDLLNSSDYVPTYEDK  203

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRA+EKCK+R
Sbjct  204  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSR  247



>gb|KFK24541.1| hypothetical protein AALP_AAs58011U000100 [Arabis alpina]
Length=230

 Score =   202 bits (513),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 94/104 (90%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY SY+ LSDALAKMFSSFTMG+YGAQGMIDFMNE K+MDLLNSSEYVP+YEDK
Sbjct  126  RKVDLKMYNSYKDLSDALAKMFSSFTMGSYGAQGMIDFMNETKVMDLLNSSEYVPSYEDK  185

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPW MFV+SCKRLRIMKGSEAIGLAPRA+EKCKNR
Sbjct  186  DGDWMLVGDVPWPMFVESCKRLRIMKGSEAIGLAPRAMEKCKNR  229



>ref|XP_004495392.1| PREDICTED: auxin-responsive protein IAA14-like isoform X2 [Cicer 
arietinum]
Length=240

 Score =   202 bits (513),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 94/104 (90%), Positives = 98/104 (94%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDL MY +Y+ LSDALAKMFSSFT G YGAQGMIDFMNE KLMDLLNSSEYVPTYEDK
Sbjct  136  RKVDLTMYNTYKDLSDALAKMFSSFTTGKYGAQGMIDFMNESKLMDLLNSSEYVPTYEDK  195

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRA+EKCKNR
Sbjct  196  DGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNR  239



>ref|XP_010274203.1| PREDICTED: auxin-responsive protein IAA16-like [Nelumbo nucifera]
Length=252

 Score =   202 bits (513),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 95/104 (91%), Positives = 98/104 (94%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY+SYQ+LSDAL KMFSSFT+GN G QGM DFMNE KLMDLLN SEYVPTYEDK
Sbjct  148  RKVDLKMYKSYQELSDALGKMFSSFTIGNCGPQGMKDFMNESKLMDLLNGSEYVPTYEDK  207

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR
Sbjct  208  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  251



>ref|XP_010435110.1| PREDICTED: auxin-responsive protein IAA14 [Camelina sativa]
Length=228

 Score =   201 bits (511),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 93/104 (89%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY SY+ LSDALAKMFSSFTMG+YGAQGMIDFMNE K+MDLLNSSEYVP+YEDK
Sbjct  124  RKVDLKMYNSYKDLSDALAKMFSSFTMGSYGAQGMIDFMNESKVMDLLNSSEYVPSYEDK  183

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPW MFV+SCKRLRIMKGSEA+GLAPRA+EKCKNR
Sbjct  184  DGDWMLVGDVPWPMFVESCKRLRIMKGSEAVGLAPRAMEKCKNR  227



>ref|XP_010440448.1| PREDICTED: auxin-responsive protein IAA14-like [Camelina sativa]
Length=225

 Score =   201 bits (511),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 93/104 (89%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY SY+ LSDALAKMFSSFTMG+YGAQGMIDFMNE K+MDLLNSSEYVP+YEDK
Sbjct  121  RKVDLKMYNSYKNLSDALAKMFSSFTMGSYGAQGMIDFMNESKVMDLLNSSEYVPSYEDK  180

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPW MFV+SCKRLRIMKGSE+IGLAPRA+EKCKNR
Sbjct  181  DGDWMLVGDVPWPMFVESCKRLRIMKGSESIGLAPRAMEKCKNR  224



>ref|XP_006414696.1| hypothetical protein EUTSA_v10026031mg [Eutrema salsugineum]
 gb|ESQ56149.1| hypothetical protein EUTSA_v10026031mg [Eutrema salsugineum]
Length=257

 Score =   202 bits (513),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 94/104 (90%), Positives = 101/104 (97%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY+SY+ LSDALAKMFSSFTMG+YGAQGMIDFMNE K+MDLLNSSEYVP+YEDK
Sbjct  153  RKVDLKMYKSYKDLSDALAKMFSSFTMGSYGAQGMIDFMNESKVMDLLNSSEYVPSYEDK  212

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPW MFV+SCKRLRIMKGSEAIGLAPRA+EKCKNR
Sbjct  213  DGDWMLVGDVPWPMFVESCKRLRIMKGSEAIGLAPRAMEKCKNR  256



>ref|XP_006284476.1| hypothetical protein CARUB_v10005662mg [Capsella rubella]
 gb|EOA17374.1| hypothetical protein CARUB_v10005662mg [Capsella rubella]
Length=228

 Score =   201 bits (510),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 93/104 (89%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDL+MY SY+ LSDALAKMFSSFTMG+YGAQGMIDFMNE K+MDLLNSSEYVP+YEDK
Sbjct  124  RKVDLRMYNSYKDLSDALAKMFSSFTMGSYGAQGMIDFMNESKVMDLLNSSEYVPSYEDK  183

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPW MFV+SCKRLRIMKGSEAIGLAPRA+EKCKNR
Sbjct  184  DGDWMLVGDVPWPMFVESCKRLRIMKGSEAIGLAPRAMEKCKNR  227



>emb|CDY10694.1| BnaA05g16680D [Brassica napus]
Length=174

 Score =   199 bits (505),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 96/105 (91%), Positives = 100/105 (95%), Gaps = 1/105 (1%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY+SY+  SDALAKMFSSFTMG YGAQGMIDFMNE KLMDLLNSSEYVP+YEDK
Sbjct  69   RKVDLKMYKSYKDFSDALAKMFSSFTMGKYGAQGMIDFMNESKLMDLLNSSEYVPSYEDK  128

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEK-CKNR  391
            DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRA+EK CKNR
Sbjct  129  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKYCKNR  173



>emb|CDY10349.1| BnaC05g29300D [Brassica napus]
Length=246

 Score =   201 bits (511),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 96/105 (91%), Positives = 101/105 (96%), Gaps = 1/105 (1%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY+SYQ LSDALAKMFSSFTMGNYGAQGMIDFMNE KLMDLLNSS+YVP+YEDK
Sbjct  141  RKVDLKMYKSYQDLSDALAKMFSSFTMGNYGAQGMIDFMNESKLMDLLNSSDYVPSYEDK  200

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEK-CKNR  391
            D DWMLVGDVPWEMFVDSCKRLRIMKG+EAIGLAPRA+EK CKNR
Sbjct  201  DSDWMLVGDVPWEMFVDSCKRLRIMKGAEAIGLAPRAMEKYCKNR  245



>gb|KHG01271.1| Auxin-responsive IAA14 -like protein [Gossypium arboreum]
Length=248

 Score =   201 bits (511),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 94/104 (90%), Positives = 101/104 (97%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY SYQ+LSDALAKMFSSFTMG+YG +GMIDFMNE KLMDLLNSS+YVPTYEDK
Sbjct  144  RKVDLKMYNSYQKLSDALAKMFSSFTMGSYGCEGMIDFMNESKLMDLLNSSDYVPTYEDK  203

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRA+EKCK+R
Sbjct  204  DGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKSR  247



>gb|KJB82525.1| hypothetical protein B456_013G200700 [Gossypium raimondii]
Length=246

 Score =   201 bits (511),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 93/104 (89%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLK+Y+SYQQLSDAL+KMFSSFT+GN G+ GM DFMNE KL+DLLN SEYVPTYEDK
Sbjct  142  RKVDLKLYKSYQQLSDALSKMFSSFTIGNCGSHGMKDFMNESKLIDLLNGSEYVPTYEDK  201

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR
Sbjct  202  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  245



>gb|AEE25654.1| auxin-responsive protein [Gossypium hirsutum]
Length=246

 Score =   201 bits (510),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 93/104 (89%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLK+Y+SYQQLSDAL+KMFSSFT+GN G+ GM DFMNE KL+DLLN SEYVPTYEDK
Sbjct  142  RKVDLKLYKSYQQLSDALSKMFSSFTIGNCGSHGMKDFMNESKLIDLLNGSEYVPTYEDK  201

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR
Sbjct  202  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  245



>ref|XP_009135842.1| PREDICTED: auxin-responsive protein IAA7-like [Brassica rapa]
 emb|CDX92973.1| BnaA03g36950D [Brassica napus]
Length=237

 Score =   200 bits (509),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 96/105 (91%), Positives = 100/105 (95%), Gaps = 1/105 (1%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDL MY+SYQ LSDALAKMFSSFTMGNYGAQGMIDFMNE KLM+LLNSSEYVP+YEDK
Sbjct  132  RKVDLTMYKSYQDLSDALAKMFSSFTMGNYGAQGMIDFMNESKLMNLLNSSEYVPSYEDK  191

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEK-CKNR  391
            DGDWMLVGDVPWEMFV SCKRLRIMKGSEAIGLAPRA+EK CKNR
Sbjct  192  DGDWMLVGDVPWEMFVQSCKRLRIMKGSEAIGLAPRAMEKYCKNR  236



>ref|XP_011038568.1| PREDICTED: auxin-responsive protein IAA16-like [Populus euphratica]
Length=246

 Score =   200 bits (509),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 93/104 (89%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLK+Y+SYQ+LSDAL KMFSSFT+GN G+QGM DFMNE KL+DLLN SEYVPTYEDK
Sbjct  142  RKVDLKLYKSYQELSDALGKMFSSFTIGNCGSQGMKDFMNESKLIDLLNGSEYVPTYEDK  201

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR
Sbjct  202  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  245



>ref|NP_001288823.1| auxin-responsive protein IAA7 [Brassica rapa]
 dbj|BAF81520.1| auxin-responsive protein IAA [Brassica rapa]
Length=242

 Score =   200 bits (509),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 96/105 (91%), Positives = 100/105 (95%), Gaps = 1/105 (1%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY+SY+  SDALAKMFSSFTMG YGAQGMIDFMNE KLMDLLNSSEYVP+YEDK
Sbjct  137  RKVDLKMYKSYKDFSDALAKMFSSFTMGKYGAQGMIDFMNESKLMDLLNSSEYVPSYEDK  196

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEK-CKNR  391
            DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRA+EK CKNR
Sbjct  197  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKYCKNR  241



>ref|XP_010679165.1| PREDICTED: auxin-responsive protein IAA14-like [Beta vulgaris 
subsp. vulgaris]
Length=278

 Score =   201 bits (511),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 93/105 (89%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY+SYQ LSDAL KMFSSFT+GNYGAQGMIDFMNE KLMDLLN S+YVPTYEDK
Sbjct  174  RKVDLKMYKSYQDLSDALGKMFSSFTLGNYGAQGMIDFMNESKLMDLLNDSDYVPTYEDK  233

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  388
            DGDWMLVGDVPWEMFV+SCKRLRIMKG EA GLAPRA+EKCKNR 
Sbjct  234  DGDWMLVGDVPWEMFVESCKRLRIMKGKEAAGLAPRAMEKCKNRS  278



>ref|XP_007030567.1| Indoleacetic acid-induced protein 16 [Theobroma cacao]
 gb|EOY11069.1| Indoleacetic acid-induced protein 16 [Theobroma cacao]
Length=249

 Score =   200 bits (508),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 93/104 (89%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLK+Y+SYQ+LSDAL KMFSSFT+GN G+QGM DFMNE KL+DLLN SEYVPTYEDK
Sbjct  145  RKVDLKLYKSYQELSDALGKMFSSFTIGNCGSQGMKDFMNESKLIDLLNGSEYVPTYEDK  204

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR
Sbjct  205  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  248



>gb|AFS44507.1| auxin repressor, partial [Fragaria x ananassa]
Length=231

 Score =   199 bits (507),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 92/104 (88%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY+SY++LSDAL+KMFSSFT G YG QGMIDFMNE KLMDLLNS++YVPTYEDK
Sbjct  127  RKVDLKMYKSYKELSDALSKMFSSFTTGYYGTQGMIDFMNESKLMDLLNSTDYVPTYEDK  186

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAP+A+EKCKNR
Sbjct  187  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPKAMEKCKNR  230



>ref|XP_010102292.1| Auxin-responsive protein IAA16 [Morus notabilis]
 gb|EXB93235.1| Auxin-responsive protein IAA16 [Morus notabilis]
Length=257

 Score =   200 bits (509),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 93/105 (89%), Positives = 99/105 (94%), Gaps = 0/105 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLK+Y+SYQ+LSDAL KMFSSFT+GN G+QGM DFMNE KL+DLLN SEYVPTYEDK
Sbjct  153  RKVDLKLYKSYQELSDALGKMFSSFTIGNCGSQGMKDFMNESKLIDLLNGSEYVPTYEDK  212

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  388
            DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR 
Sbjct  213  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRT  257



>ref|NP_001275398.1| auxin/indole-3-acetic acid 3 [Solanum tuberosum]
 gb|ACV31209.1| auxin/indole-3-acetic acid 3 [Solanum tuberosum]
Length=249

 Score =   200 bits (508),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 93/104 (89%), Positives = 97/104 (93%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY+SYQQLSDAL KMFSSFT+GN G QG  DFMNE KL+DLLN S+YVPTYEDK
Sbjct  145  RKVDLKMYKSYQQLSDALGKMFSSFTIGNCGTQGFKDFMNESKLIDLLNGSDYVPTYEDK  204

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR
Sbjct  205  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  248



>gb|KDP23667.1| hypothetical protein JCGZ_23500 [Jatropha curcas]
Length=248

 Score =   199 bits (507),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 92/104 (88%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLK+Y+SYQ+LSDAL KMFSSFT+GN G+QGM DFMNE KL+DLLN SEYVPTYEDK
Sbjct  144  RKVDLKLYKSYQELSDALGKMFSSFTIGNCGSQGMKDFMNESKLIDLLNGSEYVPTYEDK  203

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMF+DSCKRLRIMKGSEAIGLAPRAVEKCKNR
Sbjct  204  DGDWMLVGDVPWEMFIDSCKRLRIMKGSEAIGLAPRAVEKCKNR  247



>ref|NP_001266049.1| IAA9 protein [Solanum lycopersicum]
 gb|AEX00359.1| IAA16 [Solanum lycopersicum]
Length=251

 Score =   199 bits (507),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 93/104 (89%), Positives = 97/104 (93%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY+SYQQLSDAL KMFSSFT+GN G QG  DFMNE KL+DLLN S+YVPTYEDK
Sbjct  147  RKVDLKMYKSYQQLSDALGKMFSSFTIGNCGTQGFKDFMNESKLIDLLNGSDYVPTYEDK  206

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR
Sbjct  207  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  250



>gb|AAC49055.1| IAA14, partial [Arabidopsis thaliana]
Length=164

 Score =   196 bits (499),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 93/105 (89%), Positives = 99/105 (94%), Gaps = 0/105 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY SY+ LSDALAKMFSSFTMG+YGAQGMIDFMNE K+MDLLNSSEYVP+YEDK
Sbjct  60   RKVDLKMYTSYKDLSDALAKMFSSFTMGSYGAQGMIDFMNESKVMDLLNSSEYVPSYEDK  119

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  388
            DGDWMLVGDVPW MFV+SCKRLRIMKGSEAIGLAPRA+EK KNR 
Sbjct  120  DGDWMLVGDVPWPMFVESCKRLRIMKGSEAIGLAPRAMEKFKNRS  164



>ref|XP_010278165.1| PREDICTED: auxin-responsive protein IAA16-like [Nelumbo nucifera]
Length=251

 Score =   199 bits (506),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 94/104 (90%), Positives = 97/104 (93%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY+SYQ+LSDAL KMFSSFT+GN G QGM DFMNE KLMDLLN SEYVPTYEDK
Sbjct  147  RKVDLKMYKSYQELSDALGKMFSSFTIGNCGPQGMKDFMNESKLMDLLNGSEYVPTYEDK  206

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCK R
Sbjct  207  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKKR  250



>gb|KHG19190.1| Auxin-responsive IAA16 -like protein [Gossypium arboreum]
Length=246

 Score =   199 bits (505),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 91/104 (88%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLK+Y+SYQQLSDAL+KMFSSFT+GN G+ GM DFMNE KL+DLLN SEYVPTYED+
Sbjct  142  RKVDLKLYKSYQQLSDALSKMFSSFTIGNCGSHGMKDFMNESKLIDLLNGSEYVPTYEDR  201

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFVD+CKRLRIMKGSEAIGLAPRAVEKCKNR
Sbjct  202  DGDWMLVGDVPWEMFVDTCKRLRIMKGSEAIGLAPRAVEKCKNR  245



>ref|XP_010450026.1| PREDICTED: auxin-responsive protein IAA14-like [Camelina sativa]
Length=225

 Score =   198 bits (503),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 93/104 (89%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY SY+ LSDALAKMFSSFTM +YGAQGMIDFMNE K+MDLLNSSEYVP+YEDK
Sbjct  121  RKVDLKMYNSYKDLSDALAKMFSSFTMESYGAQGMIDFMNESKVMDLLNSSEYVPSYEDK  180

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPW MFV+SCKRLRIMKGSEAIGLAPRA+EKCKNR
Sbjct  181  DGDWMLVGDVPWPMFVESCKRLRIMKGSEAIGLAPRAMEKCKNR  224



>ref|XP_002319075.1| hypothetical protein POPTR_0013s03870g [Populus trichocarpa]
 gb|EEE94998.1| hypothetical protein POPTR_0013s03870g [Populus trichocarpa]
Length=246

 Score =   199 bits (505),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 92/104 (88%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLK+Y+SYQ+LSDAL KMFSSFT+GN G+QGM DFMNE KL+DLLN S+YVPTYEDK
Sbjct  142  RKVDLKLYKSYQELSDALGKMFSSFTIGNCGSQGMKDFMNESKLIDLLNGSDYVPTYEDK  201

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR
Sbjct  202  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  245



>emb|CBI35213.3| unnamed protein product [Vitis vinifera]
Length=170

 Score =   196 bits (498),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 92/104 (88%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY+SYQ+LSDAL KMFSSFT+GN G+QGM DFMNE KL+DLLN S+YVPTYEDK
Sbjct  66   RKVDLKMYKSYQELSDALGKMFSSFTIGNCGSQGMKDFMNESKLIDLLNGSDYVPTYEDK  125

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRAVEKCKNR
Sbjct  126  DGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAVEKCKNR  169



>ref|XP_002531288.1| Auxin-responsive protein IAA16, putative [Ricinus communis]
 gb|EEF31101.1| Auxin-responsive protein IAA16, putative [Ricinus communis]
Length=257

 Score =   199 bits (506),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 92/104 (88%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLK+Y+SYQ+LSDAL KMFSSFT+GN G+QGM DFMNE KL+DLLN SEYVPTYEDK
Sbjct  153  RKVDLKLYKSYQELSDALGKMFSSFTIGNCGSQGMKDFMNESKLIDLLNGSEYVPTYEDK  212

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRAVEKCKNR
Sbjct  213  DGDWMLVGDVPWEMFVNSCKRLRIMKGSEAIGLAPRAVEKCKNR  256



>ref|XP_009107777.1| PREDICTED: auxin-responsive protein IAA14 [Brassica rapa]
Length=233

 Score =   198 bits (503),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 90/104 (87%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY+SY++LSDALAKMFSSFTMG+YGAQGMIDFMNE K+MDL+NSS+YVP+YEDK
Sbjct  129  RKVDLKMYKSYKELSDALAKMFSSFTMGSYGAQGMIDFMNESKVMDLVNSSDYVPSYEDK  188

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPW MF++SCKRLRIMKGSEAIGLAPRA++KCKNR
Sbjct  189  DGDWMLVGDVPWPMFIESCKRLRIMKGSEAIGLAPRAMQKCKNR  232



>ref|XP_008362015.1| PREDICTED: auxin-responsive protein IAA14-like [Malus domestica]
Length=244

 Score =   198 bits (504),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 94/104 (90%), Positives = 98/104 (94%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY+SYQ+LS+ALAKMFSSFT G YGAQGMIDFMNE KLMDLLNSSEYVPTYEDK
Sbjct  140  RKVDLKMYKSYQELSNALAKMFSSFTTGYYGAQGMIDFMNESKLMDLLNSSEYVPTYEDK  199

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPW MFVDSCKRLRIMKGSEAIGLAP+A EKCK R
Sbjct  200  DGDWMLVGDVPWGMFVDSCKRLRIMKGSEAIGLAPKAXEKCKGR  243



>emb|CDY47148.1| BnaA08g05350D [Brassica napus]
Length=233

 Score =   198 bits (503),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 90/104 (87%), Positives = 101/104 (97%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY SY++LSDALAKMFSSFTMG+YGAQGMIDFMNE K+MDL+NSS+YVP+YEDK
Sbjct  129  RKVDLKMYTSYKELSDALAKMFSSFTMGSYGAQGMIDFMNESKVMDLVNSSDYVPSYEDK  188

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPW MF++SCKRLRIMKGSEAIGLAPRA++KCKNR
Sbjct  189  DGDWMLVGDVPWPMFIESCKRLRIMKGSEAIGLAPRAMQKCKNR  232



>gb|AAM96891.1| auxin-responsive protein IAA1 [Mirabilis jalapa]
Length=194

 Score =   197 bits (500),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 90/104 (87%), Positives = 98/104 (94%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLK+Y+SYQ LSDAL KMFSSFT+GNYG+QGMIDFMNE KLMDL+N S+YVPTYEDK
Sbjct  90   RKVDLKLYKSYQDLSDALGKMFSSFTLGNYGSQGMIDFMNESKLMDLINGSDYVPTYEDK  149

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFV+SCKRLRIMKG EA GLAPRA+EKCKNR
Sbjct  150  DGDWMLVGDVPWEMFVESCKRLRIMKGKEAAGLAPRAMEKCKNR  193



>gb|AAD32147.1|AF123509_1 Nt-iaa4.1 deduced protein [Nicotiana tabacum]
Length=220

 Score =   197 bits (501),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 92/104 (88%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY+SYQQLSDAL KMFSSFT+GN G  G  DFMNE KL+DLLN S+YVPTYEDK
Sbjct  116  RKVDLKMYKSYQQLSDALGKMFSSFTIGNCGNHGFKDFMNESKLIDLLNGSDYVPTYEDK  175

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR
Sbjct  176  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  219



>ref|NP_193191.2| auxin-responsive protein IAA14 [Arabidopsis thaliana]
 sp|Q38832.2|IAA14_ARATH RecName: Full=Auxin-responsive protein IAA14; AltName: Full=Indoleacetic 
acid-induced protein 14; AltName: Full=Protein SOLITARY 
ROOT [Arabidopsis thaliana]
 gb|AAG50096.1|AF334718_1 IAA14 [Arabidopsis thaliana]
 dbj|BAF00338.1| IAA14 [Arabidopsis thaliana]
 dbj|BAH30518.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE83459.1| auxin-responsive protein IAA14 [Arabidopsis thaliana]
Length=228

 Score =   197 bits (502),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 93/105 (89%), Positives = 99/105 (94%), Gaps = 0/105 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY SY+ LSDALAKMFSSFTMG+YGAQGMIDFMNE K+MDLLNSSEYVP+YEDK
Sbjct  124  RKVDLKMYTSYKDLSDALAKMFSSFTMGSYGAQGMIDFMNESKVMDLLNSSEYVPSYEDK  183

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  388
            DGDWMLVGDVPW MFV+SCKRLRIMKGSEAIGLAPRA+EK KNR 
Sbjct  184  DGDWMLVGDVPWPMFVESCKRLRIMKGSEAIGLAPRAMEKFKNRS  228



>gb|AAD32146.1|AF123508_1 Nt-iaa28 deduced protein [Nicotiana tabacum]
Length=240

 Score =   197 bits (502),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 92/104 (88%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY+SYQQLSDAL KMFSSFT+GN G  G  DFMNE KL+DLLN S+YVPTYEDK
Sbjct  136  RKVDLKMYKSYQQLSDALGKMFSSFTIGNCGTHGFKDFMNESKLIDLLNGSDYVPTYEDK  195

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR
Sbjct  196  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  239



>gb|ACL81167.1| auxin-responsive protein IAA1, partial [Mirabilis jalapa]
Length=263

 Score =   198 bits (504),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 90/104 (87%), Positives = 98/104 (94%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLK+Y+SYQ LSDAL KMFSSFT+GNYG+QGMIDFMNE KLMDL+N S+YVPTYEDK
Sbjct  159  RKVDLKLYKSYQDLSDALGKMFSSFTLGNYGSQGMIDFMNESKLMDLINGSDYVPTYEDK  218

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFV+SCKRLRIMKG EA GLAPRA+EKCKNR
Sbjct  219  DGDWMLVGDVPWEMFVESCKRLRIMKGKEAAGLAPRAMEKCKNR  262



>ref|NP_001268036.1| uncharacterized protein LOC100250231 [Vitis vinifera]
 gb|ADR80321.1| indole-3-acetic acid-induced protein 16 [Vitis vinifera]
Length=238

 Score =   197 bits (501),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 92/104 (88%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY+SYQ+LSDAL KMFSSFT+GN G+QGM DFMNE KL+DLLN S+YVPTYEDK
Sbjct  134  RKVDLKMYKSYQELSDALGKMFSSFTIGNCGSQGMKDFMNESKLIDLLNGSDYVPTYEDK  193

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRAVEKCKNR
Sbjct  194  DGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAVEKCKNR  237



>ref|XP_009761467.1| PREDICTED: auxin-responsive protein IAA16 [Nicotiana sylvestris]
Length=240

 Score =   197 bits (501),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 92/104 (88%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY+SYQQLSDAL KMFSSFT+GN G  G  DFMNE KL+DLLN S+YVPTYEDK
Sbjct  136  RKVDLKMYKSYQQLSDALGKMFSSFTIGNCGTHGFKDFMNESKLIDLLNGSDYVPTYEDK  195

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR
Sbjct  196  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  239



>ref|NP_001280973.1| auxin-responsive protein IAA16 [Malus domestica]
 gb|ABI36494.1| AUX/IAA16 B [Malus domestica]
Length=251

 Score =   197 bits (502),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 90/105 (86%), Positives = 99/105 (94%), Gaps = 0/105 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLK+Y+SYQ+LS AL KMFSSFT+G+YG+QGM DFMNE KL+DLLN SEYVPTYEDK
Sbjct  147  RKVDLKLYKSYQELSTALGKMFSSFTIGSYGSQGMKDFMNESKLIDLLNGSEYVPTYEDK  206

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  388
            DGDWMLVGDVPWEMFV+SCKRLRIM+GSEAIGLAPRAVEKCKNR 
Sbjct  207  DGDWMLVGDVPWEMFVNSCKRLRIMRGSEAIGLAPRAVEKCKNRS  251



>gb|KFK37887.1| hypothetical protein AALP_AA3G042100 [Arabis alpina]
Length=232

 Score =   197 bits (500),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 89/105 (85%), Positives = 99/105 (94%), Gaps = 0/105 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RK+DLK+Y++YQ LSDAL+KMFSSFT+GNYG QGM DFMNE KL+DLLN S+YVPTYEDK
Sbjct  128  RKIDLKLYKTYQDLSDALSKMFSSFTIGNYGPQGMKDFMNESKLIDLLNGSDYVPTYEDK  187

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  388
            DGDWMLVGDVPWEMFVDSCKR+RIMKGSEAIGLAPRA+EKCKNR 
Sbjct  188  DGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKNRS  232



>ref|XP_006432923.1| hypothetical protein CICLE_v10002290mg [Citrus clementina]
 ref|XP_006471684.1| PREDICTED: auxin-responsive protein IAA16-like isoform X1 [Citrus 
sinensis]
 gb|ESR46163.1| hypothetical protein CICLE_v10002290mg [Citrus clementina]
Length=245

 Score =   197 bits (500),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 91/104 (88%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLK+Y+SYQ+LSDAL KMFSSFT+GN G+QGM DFMNE KL+DLLN S+YVPTYEDK
Sbjct  141  RKVDLKLYKSYQELSDALGKMFSSFTIGNCGSQGMKDFMNESKLIDLLNGSDYVPTYEDK  200

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPW+MFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR
Sbjct  201  DGDWMLVGDVPWDMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  244



>gb|KDO48905.1| hypothetical protein CISIN_1g026005mg [Citrus sinensis]
Length=245

 Score =   197 bits (500),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 91/104 (88%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLK+Y+SYQ+LSDAL KMFSSFT+GN G+QGM DFMNE KL+DLLN S+YVPTYEDK
Sbjct  141  RKVDLKLYKSYQELSDALGKMFSSFTIGNCGSQGMKDFMNESKLIDLLNGSDYVPTYEDK  200

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPW+MFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR
Sbjct  201  DGDWMLVGDVPWDMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  244



>ref|XP_009610435.1| PREDICTED: auxin-responsive protein IAA16 [Nicotiana tomentosiformis]
Length=240

 Score =   197 bits (500),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 92/104 (88%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY+SYQQLSDAL KMFSSFT+GN G  G  DFMNE KL+DLLN S+YVPTYEDK
Sbjct  136  RKVDLKMYKSYQQLSDALGKMFSSFTIGNCGNHGFKDFMNESKLIDLLNGSDYVPTYEDK  195

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR
Sbjct  196  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  239



>gb|ADL70680.1| indole-3-acetic acid inducible 16 [Arabidopsis thaliana]
Length=152

 Score =   194 bits (492),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RK+DLK+Y++YQ LS+AL+KMFSSFT+GNYG QGM DFMNE KL+DLLN S+YVPTYEDK
Sbjct  48   RKIDLKLYKTYQDLSNALSKMFSSFTIGNYGPQGMKDFMNESKLIDLLNGSDYVPTYEDK  107

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFVDSCKR+RIMKGSEAIGLAPRA+EKCKNR
Sbjct  108  DGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKNR  151



>ref|XP_006408159.1| hypothetical protein EUTSA_v10021441mg [Eutrema salsugineum]
 gb|ESQ49612.1| hypothetical protein EUTSA_v10021441mg [Eutrema salsugineum]
Length=234

 Score =   196 bits (499),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RK+DLK+Y++YQ LSDAL+KMFSSFT+GNYG QGM DFMNE KL+DLLN S+YVPTYEDK
Sbjct  130  RKIDLKLYKTYQDLSDALSKMFSSFTIGNYGPQGMKDFMNESKLIDLLNGSDYVPTYEDK  189

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPW+MFVDSCKR+RIMKGSEAIGLAPRA+EKCKNR
Sbjct  190  DGDWMLVGDVPWKMFVDSCKRIRIMKGSEAIGLAPRALEKCKNR  233



>gb|ADB93631.2| indole-3-acetic acid inducible 16 [Arabidopsis thaliana]
Length=152

 Score =   194 bits (492),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RK+DLK+Y++YQ LS+AL+KMFSSFT+GNYG QGM DFMNE KL+DLLN S+YVPTYEDK
Sbjct  49   RKIDLKLYKTYQDLSNALSKMFSSFTIGNYGPQGMKDFMNESKLIDLLNGSDYVPTYEDK  108

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFVDSCKR+RIMKGSEAIGLAPRA+EKCKNR
Sbjct  109  DGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKNR  152



>dbj|BAJ34138.1| unnamed protein product [Thellungiella halophila]
Length=234

 Score =   196 bits (499),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RK+DLK+Y++YQ LSDAL+KMFSSFT+GNYG QGM DFMNE KL+DLLN S+YVPTYEDK
Sbjct  130  RKIDLKLYKTYQDLSDALSKMFSSFTIGNYGPQGMKDFMNESKLIDLLNGSDYVPTYEDK  189

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPW+MFVDSCKR+RIMKGSEAIGLAPRA+EKCKNR
Sbjct  190  DGDWMLVGDVPWKMFVDSCKRIRIMKGSEAIGLAPRALEKCKNR  233



>ref|XP_009337294.1| PREDICTED: auxin-responsive protein IAA14-like [Pyrus x bretschneideri]
Length=244

 Score =   197 bits (500),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 92/104 (88%), Positives = 98/104 (94%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY+SYQ+LS+AL+KMFSSFT G YG QGMIDFMNE KLMDLLNSSEYVPTYEDK
Sbjct  140  RKVDLKMYKSYQELSNALSKMFSSFTTGYYGTQGMIDFMNESKLMDLLNSSEYVPTYEDK  199

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPW MFVDSCKRLRIMKGSEAIGLAP+A+EKCK R
Sbjct  200  DGDWMLVGDVPWGMFVDSCKRLRIMKGSEAIGLAPKAMEKCKGR  243



>gb|ADL70670.1| indole-3-acetic acid inducible 16 [Arabidopsis thaliana]
Length=156

 Score =   194 bits (492),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RK+DLK+Y++YQ LS+AL+KMFSSFT+GNYG QGM DFMNE KL+DLLN S+YVPTYEDK
Sbjct  52   RKIDLKLYKTYQDLSNALSKMFSSFTIGNYGPQGMKDFMNESKLIDLLNGSDYVPTYEDK  111

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFVDSCKR+RIMKGSEAIGLAPRA+EKCKNR
Sbjct  112  DGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKNR  155



>ref|XP_002868277.1| hypothetical protein ARALYDRAFT_493451 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44536.1| hypothetical protein ARALYDRAFT_493451 [Arabidopsis lyrata subsp. 
lyrata]
Length=228

 Score =   196 bits (498),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 92/104 (88%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY+SY+ LSDALAKMFSSFTMG+YGAQGMIDFMNE K+MDLLNSSEYVP+YEDK
Sbjct  124  RKVDLKMYKSYKDLSDALAKMFSSFTMGSYGAQGMIDFMNESKVMDLLNSSEYVPSYEDK  183

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPW MFV+SCKR+RIMKGSEAIGLAPRA+EK KNR
Sbjct  184  DGDWMLVGDVPWPMFVESCKRMRIMKGSEAIGLAPRAMEKFKNR  227



>gb|ADL70678.1| indole-3-acetic acid inducible 16 [Arabidopsis thaliana]
Length=161

 Score =   194 bits (492),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RK+DLK+Y++YQ LS+AL+KMFSSFT+GNYG QGM DFMNE KL+DLLN S+YVPTYEDK
Sbjct  58   RKIDLKLYKTYQDLSNALSKMFSSFTIGNYGPQGMKDFMNESKLIDLLNGSDYVPTYEDK  117

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFVDSCKR+RIMKGSEAIGLAPRA+EKCKNR
Sbjct  118  DGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKNR  161



>ref|XP_004289900.1| PREDICTED: auxin-induced protein AUX28-like [Fragaria vesca subsp. 
vesca]
Length=250

 Score =   196 bits (499),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 89/104 (86%), Positives = 98/104 (94%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDL MY++Y QLSDALAKMFSSFT+GN G+QG IDFMNERKLMDLLN S+Y+PTYEDK
Sbjct  146  RKVDLNMYKTYPQLSDALAKMFSSFTIGNCGSQGTIDFMNERKLMDLLNDSDYIPTYEDK  205

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFV+SCKRLRIMKG EA+GLAPRA+EKCKNR
Sbjct  206  DGDWMLVGDVPWEMFVESCKRLRIMKGKEAVGLAPRAMEKCKNR  249



>emb|CDY62130.1| BnaC08g47390D [Brassica napus]
Length=233

 Score =   196 bits (498),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 91/104 (88%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY SY++LSDALAKMFSSFTMG+YGAQGMIDFMNE K+MDL+NSSEYVP+YEDK
Sbjct  129  RKVDLKMYTSYKELSDALAKMFSSFTMGSYGAQGMIDFMNESKVMDLVNSSEYVPSYEDK  188

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPW MF++SCKRLRIMKGSEAIGLAPRA+EK KNR
Sbjct  189  DGDWMLVGDVPWPMFIESCKRLRIMKGSEAIGLAPRAMEKYKNR  232



>ref|XP_011032399.1| PREDICTED: auxin-responsive protein IAA16-like [Populus euphratica]
Length=249

 Score =   196 bits (499),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 91/104 (88%), Positives = 98/104 (94%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLK+Y+SY++LSDAL KMFSSFT+GN G+QG  DFMNE KL+DLLNSSEYVPTYEDK
Sbjct  145  RKVDLKLYKSYRELSDALGKMFSSFTIGNCGSQGTKDFMNESKLIDLLNSSEYVPTYEDK  204

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPW MFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR
Sbjct  205  DGDWMLVGDVPWGMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  248



>ref|XP_006382798.1| hypothetical protein POPTR_0005s05560g [Populus trichocarpa]
 gb|ABK94241.1| unknown [Populus trichocarpa]
 gb|ERP60595.1| hypothetical protein POPTR_0005s05560g [Populus trichocarpa]
Length=250

 Score =   196 bits (498),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 91/104 (88%), Positives = 98/104 (94%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLK+Y+SY++LSDAL KMFSSFT+GN G+QG  DFMNE KL+DLLNSSEYVPTYEDK
Sbjct  146  RKVDLKLYKSYRELSDALGKMFSSFTIGNCGSQGTKDFMNESKLIDLLNSSEYVPTYEDK  205

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPW MFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR
Sbjct  206  DGDWMLVGDVPWGMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  249



>gb|EYU30526.1| hypothetical protein MIMGU_mgv1a012831mg [Erythranthe guttata]
Length=239

 Score =   196 bits (497),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 90/104 (87%), Positives = 97/104 (93%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY SYQQLSDAL KMFSSFT+GN G++G+ D MNE KL+DLLN S+YVPTYEDK
Sbjct  135  RKVDLKMYTSYQQLSDALGKMFSSFTIGNCGSEGIKDLMNESKLIDLLNGSDYVPTYEDK  194

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFVDSCKR+RIMKGSEAIGLAPRAVEKCKNR
Sbjct  195  DGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRAVEKCKNR  238



>gb|AAM21317.1|AF373100_1 auxin-regulated protein [Populus tremula x Populus tremuloides]
Length=249

 Score =   196 bits (498),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 91/104 (88%), Positives = 98/104 (94%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLK+Y+SY++LSDAL KMFSSFT+GN G+QG  DFMNE KL+DLLNSSEYVPTYEDK
Sbjct  145  RKVDLKLYKSYRELSDALGKMFSSFTIGNCGSQGTKDFMNESKLIDLLNSSEYVPTYEDK  204

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPW MFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR
Sbjct  205  DGDWMLVGDVPWGMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  248



>gb|ADL70673.1| indole-3-acetic acid inducible 16 [Arabidopsis thaliana]
 gb|ADL70674.1| indole-3-acetic acid inducible 16 [Arabidopsis thaliana]
Length=165

 Score =   193 bits (490),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RK+DLK+Y++YQ LS+AL+KMFSSFT+GNYG QGM DFMNE KL+DLLN S+YVPTYEDK
Sbjct  61   RKIDLKLYKTYQDLSNALSKMFSSFTIGNYGPQGMKDFMNESKLIDLLNGSDYVPTYEDK  120

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFVDSCKR+RIMKGSEAIGLAPRA+EKCKNR
Sbjct  121  DGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKNR  164



>ref|XP_010556884.1| PREDICTED: auxin-responsive protein IAA17 [Tarenaya hassleriana]
Length=238

 Score =   195 bits (496),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 94/107 (88%), Positives = 99/107 (93%), Gaps = 2/107 (2%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTM--GNYGAQGMIDFMNERKLMDLLNSSEYVPTYE  529
            RKVDLKMY SY+ LS+ALAKMFSSFT   GNYGAQGMIDFMNE KLMDLLNSS+YVPTYE
Sbjct  132  RKVDLKMYNSYEDLSNALAKMFSSFTTEKGNYGAQGMIDFMNESKLMDLLNSSDYVPTYE  191

Query  528  DKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  388
            DKDGDWMLVGDVPW MFV+SCKRLRIMKGSEAIGLAPRA+EKCKNR 
Sbjct  192  DKDGDWMLVGDVPWLMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRA  238



>gb|ADL70672.1| indole-3-acetic acid inducible 16 [Arabidopsis thaliana]
 gb|ADL70675.1| indole-3-acetic acid inducible 16 [Arabidopsis thaliana]
Length=166

 Score =   193 bits (490),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RK+DLK+Y++YQ LS+AL+KMFSSFT+GNYG QGM DFMNE KL+DLLN S+YVPTYEDK
Sbjct  63   RKIDLKLYKTYQDLSNALSKMFSSFTIGNYGPQGMKDFMNESKLIDLLNGSDYVPTYEDK  122

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFVDSCKR+RIMKGSEAIGLAPRA+EKCKNR
Sbjct  123  DGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKNR  166



>gb|ADL70671.1| indole-3-acetic acid inducible 16 [Arabidopsis thaliana]
Length=167

 Score =   193 bits (490),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RK+DLK+Y++YQ LS+AL+KMFSSFT+GNYG QGM DFMNE KL+DLLN S+YVPTYEDK
Sbjct  63   RKIDLKLYKTYQDLSNALSKMFSSFTIGNYGPQGMKDFMNESKLIDLLNGSDYVPTYEDK  122

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFVDSCKR+RIMKGSEAIGLAPRA+EKCKNR
Sbjct  123  DGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKNR  166



>ref|XP_010674855.1| PREDICTED: auxin-induced protein AUX28 [Beta vulgaris subsp. 
vulgaris]
Length=297

 Score =   197 bits (501),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 90/104 (87%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLK+Y+SYQ+LSDAL KMFSSFT+GN G+QGM DFMNE KL+DLLN S+YVPTYEDK
Sbjct  193  RKVDLKLYKSYQELSDALGKMFSSFTIGNCGSQGMKDFMNESKLIDLLNGSDYVPTYEDK  252

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRAVEKCK+R
Sbjct  253  DGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAVEKCKSR  296



>ref|NP_001280875.1| auxin-responsive protein IAA14-like [Malus domestica]
 gb|ADL36585.1| ARF domain class transcription factor [Malus domestica]
Length=244

 Score =   195 bits (496),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 92/104 (88%), Positives = 97/104 (93%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY+SYQ+LS+ALAKMFSSFT G YG QGMIDFMNE KLMDLLNSSEYVPTYEDK
Sbjct  140  RKVDLKMYKSYQELSNALAKMFSSFTTGYYGTQGMIDFMNESKLMDLLNSSEYVPTYEDK  199

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPW M VDSCKRLRIMKGSEAIGLAP+A+EKCK R
Sbjct  200  DGDWMLVGDVPWGMLVDSCKRLRIMKGSEAIGLAPKAMEKCKGR  243



>ref|XP_010025014.1| PREDICTED: auxin-responsive protein IAA16-like [Eucalyptus grandis]
 gb|KCW61599.1| hypothetical protein EUGRSUZ_H04335 [Eucalyptus grandis]
Length=270

 Score =   196 bits (498),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 91/104 (88%), Positives = 98/104 (94%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLK+Y+SYQ LSDALAKMFSSFT+GN G+ GM DFMNE KL+DLLN S+YVPTYEDK
Sbjct  166  RKVDLKLYKSYQDLSDALAKMFSSFTIGNCGSGGMKDFMNESKLIDLLNGSDYVPTYEDK  225

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPW+MFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR
Sbjct  226  DGDWMLVGDVPWDMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  269



>ref|XP_010418365.1| PREDICTED: auxin-responsive protein IAA16 [Camelina sativa]
Length=232

 Score =   195 bits (495),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 88/105 (84%), Positives = 99/105 (94%), Gaps = 0/105 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RK+DLK+Y++YQ LS+AL+KMFSSFT+GNYG QGM DFMNE KL+DLLN S+YVPTYEDK
Sbjct  128  RKIDLKLYKTYQDLSNALSKMFSSFTIGNYGPQGMKDFMNESKLIDLLNGSDYVPTYEDK  187

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  388
            DGDWMLVGDVPWEMFVDSCKR+RIMKGSEAIGLAPRA+EKCKNR 
Sbjct  188  DGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKNRS  232



>ref|NP_187124.1| auxin-responsive protein IAA16 [Arabidopsis thaliana]
 sp|O24407.1|IAA16_ARATH RecName: Full=Auxin-responsive protein IAA16; AltName: Full=Indoleacetic 
acid-induced protein 16 [Arabidopsis thaliana]
 gb|AAF04899.1|AC011437_14 auxin-induced protein [Arabidopsis thaliana]
 gb|AAG48764.1|AF332400_1 auxin-induced protein IAA16 [Arabidopsis thaliana]
 gb|AAK53004.1|AF375420_1 AT3g04730/F7O18_22 [Arabidopsis thaliana]
 gb|AAB84353.1| IAA16 [Arabidopsis thaliana]
 gb|AAM64751.1| auxin-induced protein [Arabidopsis thaliana]
 gb|AAN38694.1| At3g04730/F7O18_22 [Arabidopsis thaliana]
 dbj|BAF01307.1| auxin-induced protein [Arabidopsis thaliana]
 gb|AEE74127.1| auxin-responsive protein IAA16 [Arabidopsis thaliana]
Length=236

 Score =   195 bits (495),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RK+DLK+Y++YQ LS+AL+KMFSSFT+GNYG QGM DFMNE KL+DLLN S+YVPTYEDK
Sbjct  132  RKIDLKLYKTYQDLSNALSKMFSSFTIGNYGPQGMKDFMNESKLIDLLNGSDYVPTYEDK  191

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFVDSCKR+RIMKGSEAIGLAPRA+EKCKNR
Sbjct  192  DGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKNR  235



>gb|EPS64756.1| hypothetical protein M569_10024, partial [Genlisea aurea]
Length=214

 Score =   194 bits (493),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 94/106 (89%), Positives = 98/106 (92%), Gaps = 2/106 (2%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTM--GNYGAQGMIDFMNERKLMDLLNSSEYVPTYE  529
            RKVDLK Y SYQQLSDALAKMFSSFTM  GNYG +GMIDFMNE K+M LLNSSEYVPTYE
Sbjct  108  RKVDLKTYGSYQQLSDALAKMFSSFTMNEGNYGVEGMIDFMNESKVMHLLNSSEYVPTYE  167

Query  528  DKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DKDGDWMLVGDVPWEMFV SCKRLRIMKGSEAIGLAPRA+EKCK+R
Sbjct  168  DKDGDWMLVGDVPWEMFVCSCKRLRIMKGSEAIGLAPRAMEKCKSR  213



>ref|NP_001288939.1| auxin-responsive protein IAA16 [Brassica rapa]
 gb|ABV89663.1| indoleacetic acid-induced protein 16 [Brassica rapa]
Length=231

 Score =   194 bits (494),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 87/105 (83%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RK+DLK+Y++YQ LSDAL+KMFSSFT+GNYG QGM DFMNE +L+DLLN S+YVPTYEDK
Sbjct  127  RKIDLKLYKTYQDLSDALSKMFSSFTLGNYGPQGMKDFMNESRLIDLLNGSDYVPTYEDK  186

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  388
            DGDWMLVGDVPW MFVDSCKR+RIMKGSEAIGLAPRA+EKCKNR 
Sbjct  187  DGDWMLVGDVPWGMFVDSCKRIRIMKGSEAIGLAPRALEKCKNRS  231



>gb|ABM53872.1| IAA4 [Cestrum elegans]
Length=149

 Score =   191 bits (486),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 91/104 (88%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY+SYQQLSDAL KMFSSFT+ N G QG  DFMNE KL+DLLN S+YVPTYEDK
Sbjct  45   RKVDLKMYKSYQQLSDALGKMFSSFTIENCGTQGFKDFMNESKLIDLLNGSDYVPTYEDK  104

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPW MFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR
Sbjct  105  DGDWMLVGDVPWGMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  148



>ref|XP_010485858.1| PREDICTED: auxin-responsive protein IAA16-like [Camelina sativa]
Length=232

 Score =   194 bits (493),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 87/105 (83%), Positives = 99/105 (94%), Gaps = 0/105 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RK+DLK+Y++YQ LS+AL+KMFSSFT+GNYG QGM DF+NE KL+DLLN S+YVPTYEDK
Sbjct  128  RKIDLKLYKTYQDLSNALSKMFSSFTIGNYGPQGMKDFLNESKLIDLLNGSDYVPTYEDK  187

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  388
            DGDWMLVGDVPWEMFVDSCKR+RIMKGSEAIGLAPRA+EKCKNR 
Sbjct  188  DGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKNRS  232



>gb|ABI36487.1| AUX/IAA7 A [Malus domestica]
 gb|ABI36488.1| AUX/IAA7 B [Malus domestica]
Length=154

 Score =   191 bits (484),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 98/104 (94%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY+SY +LSDALAKMFSSFT+GN G+QGM DFMNERKLMD+LN S+Y+PTYEDK
Sbjct  50   RKVDLKMYKSYPELSDALAKMFSSFTIGNCGSQGMKDFMNERKLMDVLNGSDYIPTYEDK  109

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFV+SCKRLRIMK  EA+GLAPRA+EKCKNR
Sbjct  110  DGDWMLVGDVPWEMFVESCKRLRIMKSKEAVGLAPRAMEKCKNR  153



>gb|ABH01143.1| auxin-regulated protein [Populus tomentosa]
Length=258

 Score =   194 bits (492),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 90/105 (86%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLK+Y+SY++LSDAL KMFSSFT+GN G+QG  +FMNE KL+DLLNSSEYVPTYEDK
Sbjct  147  RKVDLKLYKSYRELSDALGKMFSSFTIGNCGSQGTKEFMNESKLIDLLNSSEYVPTYEDK  206

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  388
            DGDWMLVGDVPW MFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR 
Sbjct  207  DGDWMLVGDVPWGMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS  251



>ref|XP_004495802.1| PREDICTED: auxin-responsive protein IAA16-like [Cicer arietinum]
Length=252

 Score =   194 bits (492),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 90/104 (87%), Positives = 97/104 (93%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLK+Y+SYQ+LSDALAKMFSSFT+GN G+Q   DFMNE KL+DLLN S+YVPTYEDK
Sbjct  148  RKVDLKLYKSYQELSDALAKMFSSFTIGNCGSQVTKDFMNESKLIDLLNGSDYVPTYEDK  207

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFV SCKRLRIMKGSEAIGLAPRAVEKCKNR
Sbjct  208  DGDWMLVGDVPWEMFVGSCKRLRIMKGSEAIGLAPRAVEKCKNR  251



>gb|KJB11141.1| hypothetical protein B456_001G242900 [Gossypium raimondii]
 gb|KJB11144.1| hypothetical protein B456_001G242900 [Gossypium raimondii]
Length=253

 Score =   194 bits (492),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 89/104 (86%), Positives = 97/104 (93%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDL+MY SY QLSDALAKMFSSFT+GN G+QG+ DFMNE KLMDLLN S+YVPTYEDK
Sbjct  149  RKVDLRMYTSYHQLSDALAKMFSSFTIGNCGSQGIKDFMNESKLMDLLNGSDYVPTYEDK  208

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFV+SCKRLRIMKG+EAIGLAP+AVEKCK R
Sbjct  209  DGDWMLVGDVPWEMFVESCKRLRIMKGTEAIGLAPKAVEKCKKR  252



>emb|CDY50750.1| BnaAnng10570D [Brassica napus]
Length=291

 Score =   194 bits (494),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 87/105 (83%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RK+DLK+Y++YQ LSDAL+KMFSSFT+GNYG QGM DFMNE +L+DLLN S+YVPTYEDK
Sbjct  187  RKIDLKLYKTYQDLSDALSKMFSSFTIGNYGPQGMKDFMNESRLIDLLNGSDYVPTYEDK  246

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  388
            DGDWMLVGDVPW MFVDSCKR+RIMKGSEAIGLAPRA+EKCKNR 
Sbjct  247  DGDWMLVGDVPWGMFVDSCKRIRIMKGSEAIGLAPRALEKCKNRS  291



>ref|XP_008382962.1| PREDICTED: auxin-induced protein AUX28-like [Malus domestica]
Length=257

 Score =   193 bits (491),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 98/104 (94%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY+SY +LSDALAKMFSSFT+GN G+QGM DFMNERKLMD+LN S+Y+PTYEDK
Sbjct  153  RKVDLKMYKSYPELSDALAKMFSSFTIGNCGSQGMKDFMNERKLMDVLNGSDYIPTYEDK  212

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFV+SCKRLRIMK  EA+GLAPRA+EKCKNR
Sbjct  213  DGDWMLVGDVPWEMFVESCKRLRIMKSKEAVGLAPRAMEKCKNR  256



>ref|XP_004302055.1| PREDICTED: auxin-responsive protein IAA16 [Fragaria vesca subsp. 
vesca]
Length=254

 Score =   193 bits (491),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 90/104 (87%), Positives = 97/104 (93%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLK+Y+SYQ+LS AL KMFSSFT+GN G+QGM DFMNE KL+DLLN SEYVP+YEDK
Sbjct  150  RKVDLKLYQSYQELSTALGKMFSSFTIGNCGSQGMKDFMNESKLIDLLNGSEYVPSYEDK  209

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEK KNR
Sbjct  210  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKFKNR  253



>dbj|BAH15071.1| indole-3-acetic acid 14 transcription factor like [Malus prunifolia]
Length=243

 Score =   193 bits (490),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 91/104 (88%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY SYQ+LS+ALAKMFSSFT G YG QGMIDFMNE KLMDLLNSSEYVPTYEDK
Sbjct  139  RKVDLKMYRSYQELSNALAKMFSSFTTGYYGDQGMIDFMNESKLMDLLNSSEYVPTYEDK  198

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPW M VDSCKRLRIMKGSEAIG+AP+A+EKCK R
Sbjct  199  DGDWMLVGDVPWGMLVDSCKRLRIMKGSEAIGIAPKAMEKCKGR  242



>ref|XP_006298436.1| hypothetical protein CARUB_v10014507mg [Capsella rubella]
 gb|EOA31334.1| hypothetical protein CARUB_v10014507mg [Capsella rubella]
Length=241

 Score =   193 bits (490),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 98/104 (94%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RK+DLK+Y++YQ LSDAL+KMFSSFT+GN G QGM DFMNE KL+DLLN S+YVPTYEDK
Sbjct  137  RKIDLKLYKTYQDLSDALSKMFSSFTIGNCGPQGMKDFMNESKLIDLLNGSDYVPTYEDK  196

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFVDSCKR+RIMKGSEAIGLAPRA+EKCKNR
Sbjct  197  DGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKNR  240



>gb|KJB42200.1| hypothetical protein B456_007G141900 [Gossypium raimondii]
Length=235

 Score =   192 bits (489),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 89/105 (85%), Positives = 101/105 (96%), Gaps = 1/105 (1%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMI-DFMNERKLMDLLNSSEYVPTYED  526
            RKVDL+MY++YQQLSDALAKMFSSFT+GN G+QG++ DFMNE KLMDLLN S+YVPTYED
Sbjct  130  RKVDLRMYKTYQQLSDALAKMFSSFTIGNCGSQGLLKDFMNESKLMDLLNGSDYVPTYED  189

Query  525  KDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            KDGDWMLVGDVPWEMF++SCKRLRIMKG+EAIGLAPRA+EKCKNR
Sbjct  190  KDGDWMLVGDVPWEMFIESCKRLRIMKGTEAIGLAPRAMEKCKNR  234



>ref|XP_002281771.1| PREDICTED: auxin-responsive protein IAA16-like [Vitis vinifera]
Length=244

 Score =   192 bits (489),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 89/104 (86%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY SYQ+LS+AL  MFSSFT+GNYG+QGM DFMNE KLMDLLN  ++VPTYEDK
Sbjct  140  RKVDLKMYTSYQELSNALGNMFSSFTIGNYGSQGMKDFMNESKLMDLLNGFDHVPTYEDK  199

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFVDSCKRLRIMKG EAIGLAPRA+EKCKNR
Sbjct  200  DGDWMLVGDVPWEMFVDSCKRLRIMKGKEAIGLAPRAMEKCKNR  243



>emb|CAN63268.1| hypothetical protein VITISV_013635 [Vitis vinifera]
 emb|CBI17932.3| unnamed protein product [Vitis vinifera]
Length=235

 Score =   192 bits (488),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 89/104 (86%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY SYQ+LS+AL  MFSSFT+GNYG+QGM DFMNE KLMDLLN  ++VPTYEDK
Sbjct  131  RKVDLKMYTSYQELSNALGNMFSSFTIGNYGSQGMKDFMNESKLMDLLNGFDHVPTYEDK  190

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFVDSCKRLRIMKG EAIGLAPRA+EKCKNR
Sbjct  191  DGDWMLVGDVPWEMFVDSCKRLRIMKGKEAIGLAPRAMEKCKNR  234



>ref|XP_007205640.1| hypothetical protein PRUPE_ppa009254mg [Prunus persica]
 gb|EMJ06839.1| hypothetical protein PRUPE_ppa009254mg [Prunus persica]
Length=299

 Score =   194 bits (493),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 90/105 (86%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLK+Y+SYQ+LS AL KMFSSFT+GN G+ GM DFMNE KL+DLLN S+YVPTYEDK
Sbjct  195  RKVDLKLYKSYQELSTALGKMFSSFTIGNCGSDGMKDFMNESKLIDLLNGSDYVPTYEDK  254

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  388
            DGDWMLVGDVPW MFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC
Sbjct  255  DGDWMLVGDVPWGMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  299



>gb|KJB44871.1| hypothetical protein B456_007G276900 [Gossypium raimondii]
Length=158

 Score =   189 bits (481),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 90/105 (86%), Positives = 98/105 (93%), Gaps = 1/105 (1%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYG-AQGMIDFMNERKLMDLLNSSEYVPTYED  526
            RKVDLK+Y+SYQ+LSDAL KMFSSFT+GN G +QGM DFMNE KL+DLLN SEYVPTYED
Sbjct  41   RKVDLKLYKSYQELSDALGKMFSSFTVGNCGGSQGMKDFMNEGKLIDLLNGSEYVPTYED  100

Query  525  KDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            KDGDWML+GDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCK +
Sbjct  101  KDGDWMLIGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKEQ  145



>dbj|BAI94494.1| Aux/IAA protein [Dianthus caryophyllus]
Length=238

 Score =   192 bits (487),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 89/104 (86%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKV LKMY+SYQ+LSDAL KMFS FT+GNYG QGMIDFMNERKLMDLLN S+YVPTYEDK
Sbjct  134  RKVHLKMYKSYQELSDALGKMFSFFTLGNYGEQGMIDFMNERKLMDLLNDSDYVPTYEDK  193

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPW MFV+SCKR+RIMKG EA GLAPRA+EKCKNR
Sbjct  194  DGDWMLVGDVPWGMFVESCKRIRIMKGKEAAGLAPRAMEKCKNR  237



>ref|XP_009364490.1| PREDICTED: auxin-responsive protein IAA16 [Pyrus x bretschneideri]
Length=252

 Score =   192 bits (488),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLK+Y+SYQ+LS AL+KMFSSFT+GN G+QGM DF+NE KL+DLL+ SEYVP+YEDK
Sbjct  147  RKVDLKLYKSYQELSTALSKMFSSFTIGNCGSQGMKDFVNESKLIDLLSGSEYVPSYEDK  206

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRAVEKCKNR
Sbjct  207  DGDWMLVGDVPWEMFVNSCKRLRIMKGSEAIGLAPRAVEKCKNR  250



>ref|XP_009124981.1| PREDICTED: auxin-responsive protein IAA16-like [Brassica rapa]
 emb|CDY21111.1| BnaA01g33420D [Brassica napus]
Length=236

 Score =   192 bits (487),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 86/104 (83%), Positives = 98/104 (94%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RK+DLK+Y++YQ LSDAL+KMFSSFT+G+YG QGM D +NE KL+DLLN S+YVPTYEDK
Sbjct  132  RKIDLKLYKTYQDLSDALSKMFSSFTIGSYGPQGMKDIVNEGKLIDLLNGSDYVPTYEDK  191

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFVDSCKR+RIMKGSEAIGLAPRA+EKCKNR
Sbjct  192  DGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKNR  235



>ref|XP_002884465.1| indoleacetic acid-induced protein 16 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60724.1| indoleacetic acid-induced protein 16 [Arabidopsis lyrata subsp. 
lyrata]
Length=236

 Score =   191 bits (486),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 87/104 (84%), Positives = 97/104 (93%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RK+DLK+Y++YQ LSDAL+KMFSSFT+G YG QGM DFMNE  L+DLLN S+YVPTYEDK
Sbjct  132  RKIDLKLYKTYQDLSDALSKMFSSFTIGTYGPQGMKDFMNESILIDLLNGSDYVPTYEDK  191

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFVDSCKR+RIMKGSEAIGLAPRA+EKCKNR
Sbjct  192  DGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKNR  235



>dbj|BAG55005.1| auxin-responsive Aux/IAA gene family member [Ipomoea nil]
Length=225

 Score =   191 bits (485),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY+SY +LS+AL KMFSSFT+GN G  G  DFMNE KL+DLLN S+YVPTYEDK
Sbjct  121  RKVDLKMYKSYHELSEALGKMFSSFTIGNCGTHGFKDFMNESKLIDLLNGSDYVPTYEDK  180

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPW MFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR
Sbjct  181  DGDWMLVGDVPWNMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  224



>ref|XP_010463960.1| PREDICTED: auxin-responsive protein IAA16-like [Camelina sativa]
Length=232

 Score =   191 bits (485),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 87/104 (84%), Positives = 98/104 (94%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RK+DLK+Y++YQ LS+AL+KMFSSFT+GNYG QGM DFMNE KL+DLLN S+ VPTYEDK
Sbjct  128  RKIDLKLYKTYQDLSNALSKMFSSFTIGNYGPQGMKDFMNESKLIDLLNGSDCVPTYEDK  187

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFVDSCKR+RIMKGSEAIGLAPRA+EKCKNR
Sbjct  188  DGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKNR  231



>ref|XP_008218270.1| PREDICTED: auxin-responsive protein IAA16 [Prunus mume]
Length=256

 Score =   191 bits (486),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/104 (86%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLK+Y+SYQ+LS AL KMFSSFT+GN G+ GM DFMNE KL+DLLN S+YVPTYEDK
Sbjct  152  RKVDLKLYKSYQELSTALGKMFSSFTIGNCGSDGMKDFMNESKLIDLLNGSDYVPTYEDK  211

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPW MFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR
Sbjct  212  DGDWMLVGDVPWGMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  255



>ref|NP_001241599.1| uncharacterized protein LOC100803065 [Glycine max]
 gb|ACU20028.1| unknown [Glycine max]
 gb|KHN03840.1| Auxin-induced protein AUX28 [Glycine soja]
Length=248

 Score =   191 bits (485),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 89/104 (86%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY+SY +LSDAL KMFSSFT+GN  +QG  DFMNE KLMDLLNSS+YVPTYED+
Sbjct  144  RKVDLKMYKSYPELSDALGKMFSSFTIGNCESQGFKDFMNESKLMDLLNSSDYVPTYEDR  203

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFV+SCKRLRIMKG EAIGLAPRAVEKCKNR
Sbjct  204  DGDWMLVGDVPWEMFVESCKRLRIMKGKEAIGLAPRAVEKCKNR  247



>emb|CDY63910.1| BnaC01g43640D [Brassica napus]
 emb|CDY30781.1| BnaC07g16810D [Brassica napus]
Length=240

 Score =   191 bits (484),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 94/106 (89%), Positives = 98/106 (92%), Gaps = 2/106 (2%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKV LKMY+SYQ LSDALAKMFSSFTMGNYGAQGMIDFMNE KLMDL NSSEYVP+YEDK
Sbjct  136  RKVHLKMYKSYQDLSDALAKMFSSFTMGNYGAQGMIDFMNETKLMDL-NSSEYVPSYEDK  194

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEK-CKNRC  388
            DGDWM VGDVPWEMFV+SCKRLRIMKGSEAIGLAPRA+EK  KNR 
Sbjct  195  DGDWMPVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKYSKNRS  240



>gb|ADL36587.1| ARF domain class transcription factor [Malus domestica]
Length=175

 Score =   188 bits (478),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 98/104 (94%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLK+Y+SYQ+LS AL+KMFSSFT+GN G+QGM DFMNE KL+DLL+ SEYVP+YEDK
Sbjct  71   RKVDLKLYKSYQELSTALSKMFSSFTIGNCGSQGMKDFMNESKLIDLLSGSEYVPSYEDK  130

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRAVEK KNR
Sbjct  131  DGDWMLVGDVPWEMFVNSCKRLRIMKGSEAIGLAPRAVEKYKNR  174



>gb|KHN18836.1| Auxin-induced protein AUX28 [Glycine soja]
Length=246

 Score =   191 bits (484),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 89/104 (86%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY+SY +LSDAL KMFSSFT+GN  +QG  DFMNE KLMDLLNSS+YVPTYED+
Sbjct  142  RKVDLKMYKSYPELSDALGKMFSSFTIGNCESQGFKDFMNESKLMDLLNSSDYVPTYEDR  201

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFV+SCKRLRIMKG EAIGLAPRAVEKCKNR
Sbjct  202  DGDWMLVGDVPWEMFVESCKRLRIMKGKEAIGLAPRAVEKCKNR  245



>gb|ABI36493.1| AUX/IAA16 A [Malus domestica]
Length=149

 Score =   187 bits (475),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 98/104 (94%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLK+Y+SYQ+LS AL+KMFSSFT+GN G+QGM DFMNE KL+DLL+ SEYVP+YEDK
Sbjct  45   RKVDLKLYKSYQELSTALSKMFSSFTIGNCGSQGMKDFMNESKLIDLLSGSEYVPSYEDK  104

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRAVEK KNR
Sbjct  105  DGDWMLVGDVPWEMFVNSCKRLRIMKGSEAIGLAPRAVEKYKNR  148



>gb|KJB44873.1| hypothetical protein B456_007G276900 [Gossypium raimondii]
Length=254

 Score =   191 bits (484),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 90/105 (86%), Positives = 98/105 (93%), Gaps = 1/105 (1%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYG-AQGMIDFMNERKLMDLLNSSEYVPTYED  526
            RKVDLK+Y+SYQ+LSDAL KMFSSFT+GN G +QGM DFMNE KL+DLLN SEYVPTYED
Sbjct  137  RKVDLKLYKSYQELSDALGKMFSSFTVGNCGGSQGMKDFMNEGKLIDLLNGSEYVPTYED  196

Query  525  KDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            KDGDWML+GDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCK +
Sbjct  197  KDGDWMLIGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKEQ  241



>emb|CDP06818.1| unnamed protein product [Coffea canephora]
Length=245

 Score =   190 bits (483),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 97/104 (93%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLK ++SYQ+LS AL+KMFSS T+G+YG+Q   DFMNERKL+DLLN SEYVPTYEDK
Sbjct  141  RKVDLKNFKSYQELSQALSKMFSSSTIGSYGSQEFKDFMNERKLIDLLNGSEYVPTYEDK  200

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFVDSCKRLRIMKGSEA+GLAPRAVEKCKNR
Sbjct  201  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAVGLAPRAVEKCKNR  244



>ref|NP_001239753.1| uncharacterized protein LOC100781847 [Glycine max]
 gb|ACU21611.1| unknown [Glycine max]
Length=231

 Score =   190 bits (482),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 87/104 (84%), Positives = 98/104 (94%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVD+K+Y+SYQ+LSDALAKMFSSFT+   G+QGM DFMNE KL+DLLN S+YVPTY+DK
Sbjct  127  RKVDIKLYKSYQELSDALAKMFSSFTIEKCGSQGMKDFMNETKLIDLLNGSDYVPTYQDK  186

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFV+SC+RLRIMKGSEAIGLAPRAVEKCKNR
Sbjct  187  DGDWMLVGDVPWEMFVESCQRLRIMKGSEAIGLAPRAVEKCKNR  230



>ref|XP_008235328.1| PREDICTED: auxin-induced protein AUX28-like [Prunus mume]
Length=253

 Score =   191 bits (484),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 87/104 (84%), Positives = 97/104 (93%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY+SY +LSDALAKMFSSFT+GN G+QGM DFMNE KLMD+L  S+Y+PTYEDK
Sbjct  149  RKVDLKMYKSYPELSDALAKMFSSFTIGNCGSQGMKDFMNESKLMDVLKGSDYIPTYEDK  208

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFV+SCKRLRIMKG EA+GLAPRA+EKCKNR
Sbjct  209  DGDWMLVGDVPWEMFVESCKRLRIMKGKEAVGLAPRAMEKCKNR  252



>gb|KHN22078.1| Auxin-responsive protein IAA16 [Glycine soja]
Length=231

 Score =   190 bits (482),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 87/104 (84%), Positives = 98/104 (94%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVD+K+Y+SYQ+LSDALAKMFSSFT+   G+QGM DFMNE KL+DLLN S+YVPTY+DK
Sbjct  127  RKVDIKLYKSYQELSDALAKMFSSFTIEKCGSQGMKDFMNETKLIDLLNGSDYVPTYQDK  186

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFV+SC+RLRIMKGSEAIGLAPRAVEKCKNR
Sbjct  187  DGDWMLVGDVPWEMFVESCQRLRIMKGSEAIGLAPRAVEKCKNR  230



>ref|XP_009367750.1| PREDICTED: auxin-induced protein AUX28-like [Pyrus x bretschneideri]
Length=259

 Score =   191 bits (484),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 87/104 (84%), Positives = 97/104 (93%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY+SY +LSDALAKMFSSFT+GN G+QGM DFMNE KLMD+LN S+Y+PTYEDK
Sbjct  155  RKVDLKMYKSYPELSDALAKMFSSFTIGNCGSQGMKDFMNESKLMDVLNGSDYIPTYEDK  214

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFV+SCKRLRIMK  EA+GLAPRA+EKCKNR
Sbjct  215  DGDWMLVGDVPWEMFVESCKRLRIMKSKEAVGLAPRAMEKCKNR  258



>ref|XP_010087762.1| Auxin-responsive protein IAA7 [Morus notabilis]
 gb|EXB29843.1| Auxin-responsive protein IAA7 [Morus notabilis]
Length=304

 Score =   192 bits (488),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 91/96 (95%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY+SYQ+LSDALAKMFSSFTMGNYGAQGMIDFMNE KLMDLLNSSEYVPTYEDK
Sbjct  151  RKVDLKMYKSYQELSDALAKMFSSFTMGNYGAQGMIDFMNESKLMDLLNSSEYVPTYEDK  210

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPR  415
            DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGL  R
Sbjct  211  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLGLR  246



>gb|AFK36086.1| unknown [Lotus japonicus]
Length=257

 Score =   191 bits (484),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 89/104 (86%), Positives = 97/104 (93%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY+SY+ LSD+LAKMFSSFT+G   +QGM DFMNE KLMDLLNSS+YVPTYEDK
Sbjct  153  RKVDLKMYKSYRDLSDSLAKMFSSFTIGTCESQGMKDFMNESKLMDLLNSSDYVPTYEDK  212

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFV+SCKRLRIMKG EAIGLAPRA+EKCKNR
Sbjct  213  DGDWMLVGDVPWEMFVESCKRLRIMKGKEAIGLAPRAMEKCKNR  256



>ref|XP_008372303.1| PREDICTED: auxin-induced protein AUX28-like [Malus domestica]
Length=257

 Score =   191 bits (484),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 87/104 (84%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY+SY +LSDALAKMFSSFT+GN G+QGM DFMNE KLMD+LN S+Y PTYEDK
Sbjct  153  RKVDLKMYKSYPELSDALAKMFSSFTIGNCGSQGMKDFMNESKLMDVLNGSDYTPTYEDK  212

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFV+SCKRLRIMK  EA+GLAPRA+EKCKNR
Sbjct  213  DGDWMLVGDVPWEMFVESCKRLRIMKSKEAVGLAPRAMEKCKNR  256



>gb|AEE25650.1| auxin-responsive protein [Gossypium hirsutum]
Length=253

 Score =   190 bits (483),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 89/104 (86%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDL+MY SY QLSDALAKMFSSFT+GN G+QGM DFMNE KLMDLLN S+YVPTYEDK
Sbjct  149  RKVDLRMYTSYHQLSDALAKMFSSFTIGNCGSQGMKDFMNESKLMDLLNGSDYVPTYEDK  208

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGD MLVGDVPWEMFV+SCKRLRIMKG+EAIGLAP+AVEKCK R
Sbjct  209  DGDRMLVGDVPWEMFVESCKRLRIMKGTEAIGLAPKAVEKCKKR  252



>gb|AFK44192.1| unknown [Medicago truncatula]
Length=253

 Score =   190 bits (482),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 89/104 (86%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLK+Y+SYQ+LSDALAKMFSSFT+ N G+Q   DFMNE KL+DLLN S+YVPTYEDK
Sbjct  149  RKVDLKLYKSYQELSDALAKMFSSFTIDNCGSQVTKDFMNESKLIDLLNGSDYVPTYEDK  208

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFV SCKRLRIMKGSEAIGLAPRAVEKCKNR
Sbjct  209  DGDWMLVGDVPWEMFVQSCKRLRIMKGSEAIGLAPRAVEKCKNR  252



>ref|XP_008462706.1| PREDICTED: auxin-responsive protein IAA16-like isoform X1 [Cucumis 
melo]
Length=232

 Score =   189 bits (481),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 89/104 (86%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMYESYQQL DAL+KMF SFT GN GAQ M D+MNERKL D+LN S+YVPTYEDK
Sbjct  128  RKVDLKMYESYQQLFDALSKMFGSFTTGNCGAQKMKDYMNERKLKDVLNGSDYVPTYEDK  187

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPW+MFV+SCKRLRIMKGSEAIGLAPRA+EKCKNR
Sbjct  188  DGDWMLVGDVPWDMFVNSCKRLRIMKGSEAIGLAPRALEKCKNR  231



>gb|AFK42876.1| unknown [Medicago truncatula]
 gb|KEH23853.1| auxin-responsive AUX/IAA family protein [Medicago truncatula]
Length=250

 Score =   190 bits (482),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY SY QLSD+L KMFSSFT+GN  +QGM DFMNE KLMDLLN+S+YVPTYEDK
Sbjct  146  RKVDLKMYTSYSQLSDSLGKMFSSFTIGNCESQGMKDFMNESKLMDLLNNSDYVPTYEDK  205

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFV+SCKRLRIMKG EAIG+APRA+EKCKNR
Sbjct  206  DGDWMLVGDVPWEMFVESCKRLRIMKGKEAIGIAPRAMEKCKNR  249



>emb|CDY41894.1| BnaC05g47100D [Brassica napus]
Length=231

 Score =   189 bits (480),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 86/104 (83%), Positives = 97/104 (93%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RK+DLK+Y++YQ LSDAL+KMFSSFT+GN G QGM DFMNE +L+DLLN S+YVPTYEDK
Sbjct  127  RKIDLKLYKTYQDLSDALSKMFSSFTIGNCGPQGMKDFMNESRLIDLLNGSDYVPTYEDK  186

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPW MFVDSCKR+RIMKGSEAIGLAPRA+EKCKNR
Sbjct  187  DGDWMLVGDVPWGMFVDSCKRIRIMKGSEAIGLAPRALEKCKNR  230



>ref|XP_010550916.1| PREDICTED: LOW QUALITY PROTEIN: auxin-responsive protein IAA16 
[Tarenaya hassleriana]
Length=212

 Score =   188 bits (478),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/106 (84%), Positives = 94/106 (89%), Gaps = 1/106 (1%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNER-KLMDLLNSSEYVPTYED  526
            RKVDLK+Y SY +LSDAL KMFSSFT GN+  QGM DFMNE  KL+DLLN SEY PTYED
Sbjct  107  RKVDLKLYNSYHELSDALGKMFSSFTSGNHEQQGMNDFMNENNKLIDLLNGSEYAPTYED  166

Query  525  KDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  388
            KDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRA+ KCKNRC
Sbjct  167  KDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRALVKCKNRC  212



>ref|XP_007050421.1| Indole-3-acetic acid inducible 14 isoform 1 [Theobroma cacao]
 gb|EOX94578.1| Indole-3-acetic acid inducible 14 isoform 1 [Theobroma cacao]
Length=305

 Score =   191 bits (485),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 87/104 (84%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDL+MY++Y +LSDALAKMFSSFT+GN G+QG+ DFMNE KLMDLLN S+YVPTYEDK
Sbjct  201  RKVDLRMYKTYLELSDALAKMFSSFTIGNCGSQGVKDFMNESKLMDLLNGSDYVPTYEDK  260

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPW+MFV+SCKRLRIMKG+EAIGLAPRA+EKCKNR
Sbjct  261  DGDWMLVGDVPWDMFVESCKRLRIMKGTEAIGLAPRAMEKCKNR  304



>gb|KHG04941.1| Auxin-induced AUX28 [Gossypium arboreum]
Length=235

 Score =   189 bits (479),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/105 (84%), Positives = 100/105 (95%), Gaps = 1/105 (1%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMI-DFMNERKLMDLLNSSEYVPTYED  526
            RKVDL+MY++YQQLSDALAKMFSSFT+GN G+QG++ DFMNE KLMDLLN S+YVPTYED
Sbjct  130  RKVDLRMYKTYQQLSDALAKMFSSFTIGNCGSQGLLKDFMNESKLMDLLNGSDYVPTYED  189

Query  525  KDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            KDGD MLVGDVPWEMF++SCKRLRIMKG+EAIGLAPRA+EKCKNR
Sbjct  190  KDGDLMLVGDVPWEMFIESCKRLRIMKGTEAIGLAPRAMEKCKNR  234



>gb|KEH43017.1| auxin-responsive AUX/IAA family protein [Medicago truncatula]
Length=253

 Score =   189 bits (480),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/104 (86%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLK+Y+SYQ+LSDALAKMFSSFT+ N G+Q   DFMNE KL+DLLN S+YVPTYEDK
Sbjct  149  RKVDLKLYKSYQELSDALAKMFSSFTIDNCGSQVTKDFMNESKLIDLLNGSDYVPTYEDK  208

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFV SCKRLRIMKGSEAIGLAPRAVEKCKNR
Sbjct  209  DGDWMLVGDVPWEMFVQSCKRLRIMKGSEAIGLAPRAVEKCKNR  252



>ref|XP_009354870.1| PREDICTED: auxin-induced protein AUX28-like [Pyrus x bretschneideri]
Length=257

 Score =   189 bits (480),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 86/103 (83%), Positives = 96/103 (93%), Gaps = 0/103 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY+SY +LSDALAKMFSSFT+GN G+QGM DFMNE KLMD+LN S+Y+PTYEDK
Sbjct  153  RKVDLKMYKSYPELSDALAKMFSSFTIGNCGSQGMKDFMNESKLMDVLNGSDYIPTYEDK  212

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKN  394
            DGDWMLVGDVPWEMFV+SCKRLRIMK  EA+GLAPRA+EKCKN
Sbjct  213  DGDWMLVGDVPWEMFVESCKRLRIMKSKEAVGLAPRAMEKCKN  255



>gb|ACU18407.1| unknown [Glycine max]
Length=246

 Score =   189 bits (479),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY+SY +LSDAL KMFSSFT+GN  +QG  DFMNE KLMDLLNSS+YVPTYED+
Sbjct  142  RKVDLKMYKSYPELSDALGKMFSSFTIGNCESQGFKDFMNESKLMDLLNSSDYVPTYEDR  201

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFV+SCKRL IMKG EAIGLAPRAVEKCKNR
Sbjct  202  DGDWMLVGDVPWEMFVESCKRLHIMKGKEAIGLAPRAVEKCKNR  245



>ref|XP_007201400.1| hypothetical protein PRUPE_ppa010342mg [Prunus persica]
 gb|EMJ02599.1| hypothetical protein PRUPE_ppa010342mg [Prunus persica]
Length=253

 Score =   189 bits (479),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 86/104 (83%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY+SY +LSDALAKMFSSF +GN G+QGM DFMNE KLMD+L  S+Y+PTYEDK
Sbjct  149  RKVDLKMYKSYPELSDALAKMFSSFAIGNCGSQGMKDFMNESKLMDVLKGSDYIPTYEDK  208

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFV+SCKRLRIMKG EA+GLAPRA+EKCKNR
Sbjct  209  DGDWMLVGDVPWEMFVESCKRLRIMKGKEAVGLAPRAMEKCKNR  252



>ref|XP_003521753.1| PREDICTED: auxin-responsive protein IAA16-like [Glycine max]
Length=243

 Score =   188 bits (478),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLK+Y+SYQ+L DALAKMFSSFT+   G+QGM DFMNE KL+DLLN S+YVPTYEDK
Sbjct  139  RKVDLKLYKSYQELLDALAKMFSSFTIDKCGSQGMKDFMNESKLIDLLNGSDYVPTYEDK  198

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            D DWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRAVEKCKNR
Sbjct  199  DADWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAVEKCKNR  242



>ref|XP_011082603.1| PREDICTED: auxin-responsive protein IAA14-like [Sesamum indicum]
Length=215

 Score =   187 bits (475),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 86/104 (83%), Positives = 97/104 (93%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RK+DLKMY++YQ+LSDAL KMFSSFTMG    QGM+DFMNE KLMDLLNSSEYVPTYEDK
Sbjct  111  RKIDLKMYKTYQELSDALGKMFSSFTMGKCDTQGMMDFMNESKLMDLLNSSEYVPTYEDK  170

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPW+MFV+SCKRLR+MKG+EA GLAPRA+EKCK+R
Sbjct  171  DGDWMLVGDVPWQMFVESCKRLRVMKGTEAKGLAPRAMEKCKSR  214



>ref|XP_010936171.1| PREDICTED: auxin-responsive protein IAA30-like [Elaeis guineensis]
Length=251

 Score =   188 bits (478),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 92/106 (87%), Positives = 96/106 (91%), Gaps = 2/106 (2%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMI--DFMNERKLMDLLNSSEYVPTYE  529
            RKVDLKMY SY++LS AL KMFSSFT GN G+QGM   DFMNE KLMDLLN SEYVPTYE
Sbjct  145  RKVDLKMYSSYKELSMALEKMFSSFTSGNCGSQGMNGRDFMNESKLMDLLNGSEYVPTYE  204

Query  528  DKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRA+EKCKNR
Sbjct  205  DKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKNR  250



>gb|KHN31465.1| Auxin-responsive protein IAA16 [Glycine soja]
Length=243

 Score =   188 bits (478),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLK+Y+SYQ+L DALAKMFSSFT+   G+QGM DFMNE KL+DLLN S+YVPTYEDK
Sbjct  139  RKVDLKLYKSYQELLDALAKMFSSFTIDKCGSQGMKDFMNESKLIDLLNGSDYVPTYEDK  198

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            D DWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRAVEKCKNR
Sbjct  199  DADWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAVEKCKNR  242



>ref|XP_007034957.1| Indole-3-acetic acid inducible 14 isoform 2, partial [Theobroma 
cacao]
 gb|EOY05883.1| Indole-3-acetic acid inducible 14 isoform 2, partial [Theobroma 
cacao]
Length=204

 Score =   187 bits (474),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 88/92 (96%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY+SYQ+LSDALAKMFSSFTMGNYGAQGMIDFMNE KLMDLLNSS+YVPTYEDK
Sbjct  113  RKVDLKMYKSYQELSDALAKMFSSFTMGNYGAQGMIDFMNESKLMDLLNSSDYVPTYEDK  172

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIG  427
            DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIG
Sbjct  173  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIG  204



>ref|XP_004493739.1| PREDICTED: auxin-induced protein AUX28-like [Cicer arietinum]
Length=246

 Score =   187 bits (476),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 86/104 (83%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLK+Y SY QLSD+L KMFSSFT+GN  +QGM DFMNE KLMDLLN+S+YVPTYEDK
Sbjct  141  RKVDLKIYNSYSQLSDSLGKMFSSFTIGNCESQGMKDFMNESKLMDLLNNSDYVPTYEDK  200

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWM+VGDVPWEMFV+SCKRLRIMKG EAIG+APRA+EKCKNR
Sbjct  201  DGDWMVVGDVPWEMFVESCKRLRIMKGKEAIGIAPRAMEKCKNR  244



>gb|ACJ83896.1| unknown [Medicago truncatula]
 gb|AFK48514.1| unknown [Medicago truncatula]
 gb|KEH42620.1| auxin-responsive AUX/IAA family protein [Medicago truncatula]
Length=245

 Score =   187 bits (476),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 89/105 (85%), Positives = 97/105 (92%), Gaps = 1/105 (1%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNE-RKLMDLLNSSEYVPTYED  526
            RKVDLKMY+SY +LSDALAKMF+SFT GN  +QG+ DFMNE  KLMDLLNSS+YVPTYED
Sbjct  140  RKVDLKMYKSYPELSDALAKMFNSFTTGNCESQGIKDFMNESNKLMDLLNSSDYVPTYED  199

Query  525  KDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            KDGDWMLVGDVPWEMF+DSCKRLRIMKG EAIGLAPRA+EKCKNR
Sbjct  200  KDGDWMLVGDVPWEMFIDSCKRLRIMKGKEAIGLAPRAMEKCKNR  244



>emb|CAH59413.1| auxin resistance protein [Plantago major]
Length=227

 Score =   187 bits (474),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 87/104 (84%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY++Y++LSDAL KMFSSFTM    AQGM+DFMNE KLMDLLN S+YVPTYEDK
Sbjct  123  RKVDLKMYKTYEELSDALGKMFSSFTMSKCDAQGMMDFMNESKLMDLLNGSDYVPTYEDK  182

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFV SCKRLRIMKG+EAIGLAPRA+EKCK+R
Sbjct  183  DGDWMLVGDVPWEMFVGSCKRLRIMKGTEAIGLAPRAMEKCKSR  226



>emb|CDY30017.1| BnaC01g39910D [Brassica napus]
Length=237

 Score =   186 bits (473),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 86/105 (82%), Positives = 97/105 (92%), Gaps = 1/105 (1%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLM-DLLNSSEYVPTYED  526
            RK+DLK+Y++YQ LSD L+KMFSSFT+G+YG QGM D +NE KLM DLLN S+YVPTYED
Sbjct  132  RKIDLKLYKAYQDLSDTLSKMFSSFTIGSYGPQGMKDIVNEGKLMIDLLNGSDYVPTYED  191

Query  525  KDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            KDGDWMLVGDVPWEMFVDSCKR+RIMKGSEAIGLAPRA+EKCKNR
Sbjct  192  KDGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKNR  236



>gb|ACJ84642.1| unknown [Medicago truncatula]
Length=250

 Score =   187 bits (474),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 87/104 (84%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY SY QLSD+L KMFSSFT+GN  +QGM DFMNE KLMDLLN+S+YVPTYEDK
Sbjct  146  RKVDLKMYTSYSQLSDSLGKMFSSFTIGNCESQGMKDFMNESKLMDLLNNSDYVPTYEDK  205

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPW MFV+SCKRLRIMKG EAIG+APRA+EKCKNR
Sbjct  206  DGDWMLVGDVPWGMFVESCKRLRIMKGKEAIGIAPRAMEKCKNR  249



>ref|XP_011079949.1| PREDICTED: auxin-induced protein AUX28-like [Sesamum indicum]
Length=244

 Score =   187 bits (474),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 87/104 (84%), Positives = 97/104 (93%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY+SYQ+LSDAL KMFSSFT+G   +QGM+DFMNE KLMDLLN S+YVPTYEDK
Sbjct  140  RKVDLKMYKSYQELSDALGKMFSSFTIGKCDSQGMMDFMNESKLMDLLNGSDYVPTYEDK  199

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFV+SCKRLRIMKG+EA GLAPRA+EKCK+R
Sbjct  200  DGDWMLVGDVPWEMFVESCKRLRIMKGTEAKGLAPRAMEKCKSR  243



>ref|XP_002302075.1| auxin-induced protein aux28 [Populus trichocarpa]
 gb|EEE81348.1| auxin-induced protein aux28 [Populus trichocarpa]
 gb|AFZ78622.1| hypothetical protein [Populus tomentosa]
Length=237

 Score =   186 bits (473),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 97/104 (93%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY++YQ+LSDAL KMFSSFT+GN G+ G+ DF+NE KL+DLLN ++YVPTYEDK
Sbjct  131  RKVDLKMYKTYQELSDALGKMFSSFTIGNCGSHGLKDFLNESKLIDLLNGTDYVPTYEDK  190

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPW+MFV+SCKRLRIMKG+EA GLAPRA+EKCKNR
Sbjct  191  DGDWMLVGDVPWDMFVESCKRLRIMKGTEATGLAPRAMEKCKNR  234



>ref|XP_009418923.1| PREDICTED: auxin-responsive protein IAA30-like [Musa acuminata 
subsp. malaccensis]
Length=243

 Score =   186 bits (473),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/106 (85%), Positives = 95/106 (90%), Gaps = 2/106 (2%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMI--DFMNERKLMDLLNSSEYVPTYE  529
            RKVDLKMY SYQ+LS  L KMF SFT GN G+QGM   DFMNER++MDLLN SEYVPTYE
Sbjct  137  RKVDLKMYRSYQELSMGLQKMFGSFTSGNCGSQGMSGRDFMNEREVMDLLNGSEYVPTYE  196

Query  528  DKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRA+EKCKNR
Sbjct  197  DKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKNR  242



>ref|XP_006366663.1| PREDICTED: auxin-responsive protein IAA16-like [Solanum tuberosum]
Length=214

 Score =   186 bits (471),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/104 (86%), Positives = 96/104 (92%), Gaps = 4/104 (4%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDL MY+SYQ+LSDALAKMF+SFT+     QGM DFMNERKLMDLLNSS+YVPTYEDK
Sbjct  113  RKVDLNMYKSYQELSDALAKMFNSFTI----VQGMKDFMNERKLMDLLNSSDYVPTYEDK  168

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPW MFVDSCKRLRIMKG+EAIGLAPRA+EKCKNR
Sbjct  169  DGDWMLVGDVPWGMFVDSCKRLRIMKGTEAIGLAPRAMEKCKNR  212



>ref|XP_002520980.1| Auxin-induced protein AUX28, putative [Ricinus communis]
 gb|EEF41397.1| Auxin-induced protein AUX28, putative [Ricinus communis]
Length=244

 Score =   186 bits (473),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 85/105 (81%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY+SYQ+LSDAL KMFSSFT+GN G+QGM DF+NE KL+DLLN ++YVPTYEDK
Sbjct  140  RKVDLKMYKSYQELSDALGKMFSSFTIGNCGSQGMKDFLNESKLIDLLNGTDYVPTYEDK  199

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  388
            DGDWMLVGDVPW+MFV+SCKRLRIMKG+EA GLAPRA+EK KNR 
Sbjct  200  DGDWMLVGDVPWKMFVESCKRLRIMKGTEATGLAPRAMEKRKNRS  244



>ref|XP_007144686.1| hypothetical protein PHAVU_007G176600g [Phaseolus vulgaris]
 gb|ESW16680.1| hypothetical protein PHAVU_007G176600g [Phaseolus vulgaris]
Length=245

 Score =   186 bits (473),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/104 (84%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY+SY +LSDAL KMFSSFT+GN  +QG  DFMNE KLMDLLNSS+ VPTYED+
Sbjct  141  RKVDLKMYKSYPELSDALGKMFSSFTIGNCESQGFKDFMNESKLMDLLNSSDCVPTYEDR  200

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFV+SCKRLRIMKG EAIGLAPRA+EKCKNR
Sbjct  201  DGDWMLVGDVPWEMFVESCKRLRIMKGKEAIGLAPRAMEKCKNR  244



>ref|XP_009420668.1| PREDICTED: auxin-responsive protein IAA30-like [Musa acuminata 
subsp. malaccensis]
Length=241

 Score =   186 bits (472),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/106 (85%), Positives = 95/106 (90%), Gaps = 2/106 (2%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMI--DFMNERKLMDLLNSSEYVPTYE  529
            RKVDLKMY SY +LS AL KMFS+FT GN G+QGM   DFMNE K+MDLLN SEYVPTYE
Sbjct  135  RKVDLKMYRSYHELSMALQKMFSTFTGGNCGSQGMSGRDFMNESKVMDLLNGSEYVPTYE  194

Query  528  DKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRA+EKCKNR
Sbjct  195  DKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKNR  240



>ref|XP_006383686.1| auxin-induced protein aux28 [Populus trichocarpa]
 gb|ERP61483.1| auxin-induced protein aux28 [Populus trichocarpa]
Length=237

 Score =   186 bits (471),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY++Y +LSDAL KMFSSFT+GN G+ GM DF+NE KL+DLLN ++YVPTYEDK
Sbjct  131  RKVDLKMYKTYHELSDALGKMFSSFTIGNCGSHGMKDFLNESKLIDLLNGTDYVPTYEDK  190

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPW+MFV+SCKRLRIMKG+EA GLAPRA+EKCKNR
Sbjct  191  DGDWMLVGDVPWDMFVESCKRLRIMKGTEATGLAPRAMEKCKNR  234



>gb|KJB11145.1| hypothetical protein B456_001G242900 [Gossypium raimondii]
Length=261

 Score =   186 bits (473),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 89/112 (79%), Positives = 97/112 (87%), Gaps = 8/112 (7%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDL+MY SY QLSDALAKMFSSFT+GN G+QG+ DFMNE KLMDLLN S+YVPTYEDK
Sbjct  149  RKVDLRMYTSYHQLSDALAKMFSSFTIGNCGSQGIKDFMNESKLMDLLNGSDYVPTYEDK  208

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGL--------APRAVEKCKNR  391
            DGDWMLVGDVPWEMFV+SCKRLRIMKG+EAIGL        AP+AVEKCK R
Sbjct  209  DGDWMLVGDVPWEMFVESCKRLRIMKGTEAIGLENYMLIIAAPKAVEKCKKR  260



>ref|XP_004142529.1| PREDICTED: auxin-responsive protein IAA16-like [Cucumis sativus]
 ref|XP_004170021.1| PREDICTED: auxin-responsive protein IAA16-like [Cucumis sativus]
 gb|KGN66786.1| hypothetical protein Csa_1G690240 [Cucumis sativus]
Length=236

 Score =   185 bits (470),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 87/104 (84%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY SYQ+LSDAL KMF+SFT G  GAQ M D+MNERKL+D+ N S+YVPTYEDK
Sbjct  132  RKVDLKMYGSYQELSDALRKMFASFTAGQCGAQKMRDYMNERKLIDVSNGSDYVPTYEDK  191

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPW+MFVDSCKRLRIMKGSEAIGLAPRA+EKCKNR
Sbjct  192  DGDWMLVGDVPWDMFVDSCKRLRIMKGSEAIGLAPRALEKCKNR  235



>ref|XP_009413916.1| PREDICTED: auxin-responsive protein IAA30-like [Musa acuminata 
subsp. malaccensis]
Length=244

 Score =   185 bits (470),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 89/106 (84%), Positives = 95/106 (90%), Gaps = 2/106 (2%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMI--DFMNERKLMDLLNSSEYVPTYE  529
            RKVDLKMY SYQ+L  AL KMF SFT GNYG+QG+   DFMNE K+MDLLN SEYVPTYE
Sbjct  138  RKVDLKMYRSYQELFMALQKMFISFTGGNYGSQGLSGRDFMNESKVMDLLNGSEYVPTYE  197

Query  528  DKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAP+A+EKCKNR
Sbjct  198  DKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPKAMEKCKNR  243



>ref|XP_008788131.1| PREDICTED: auxin-responsive protein IAA30-like [Phoenix dactylifera]
Length=241

 Score =   185 bits (470),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 90/106 (85%), Positives = 96/106 (91%), Gaps = 2/106 (2%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMI--DFMNERKLMDLLNSSEYVPTYE  529
            RKVDLK+Y SY++LS AL KMFSSFT GN G+QGM   DFMNE KLMDLLN SEYVPTYE
Sbjct  135  RKVDLKIYSSYKELSMALEKMFSSFTSGNCGSQGMNGRDFMNESKLMDLLNGSEYVPTYE  194

Query  528  DKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DKDGDWMLVGDVPWEMFVDSCKRLR+MKGSEAIGLAPRA+EKCKNR
Sbjct  195  DKDGDWMLVGDVPWEMFVDSCKRLRMMKGSEAIGLAPRAMEKCKNR  240



>gb|ADL70548.1| indole-3-acetic acid inducible 7 [Arabidopsis thaliana]
 gb|ADL70557.1| indole-3-acetic acid inducible 7 [Arabidopsis thaliana]
Length=95

 Score =   180 bits (456),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 87/94 (93%), Positives = 91/94 (97%), Gaps = 1/94 (1%)
 Frame = -1

Query  669  QQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVP  490
            Q LSDALAKMFSSFTMGNYGAQGMIDFMNE KLM+LLNSSEYVP+YEDKDGDWMLVGDVP
Sbjct  1    QDLSDALAKMFSSFTMGNYGAQGMIDFMNESKLMNLLNSSEYVPSYEDKDGDWMLVGDVP  60

Query  489  WEMFVDSCKRLRIMKGSEAIGLAPRAVEK-CKNR  391
            WEMFV+SCKRLRIMKGSEAIGLAPRA+EK CKNR
Sbjct  61   WEMFVESCKRLRIMKGSEAIGLAPRAMEKYCKNR  94



>ref|XP_006838867.1| hypothetical protein AMTR_s00002p00266760 [Amborella trichopoda]
 gb|ERN01436.1| hypothetical protein AMTR_s00002p00266760 [Amborella trichopoda]
Length=238

 Score =   185 bits (469),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 87/104 (84%), Positives = 95/104 (91%), Gaps = 1/104 (1%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDL MY+SYQ LS++L KMFS FTMG  G+QG I+F+NE KLMDLLN SEYVPTYED+
Sbjct  135  RKVDLNMYKSYQDLSNSLEKMFSCFTMGQCGSQG-INFLNESKLMDLLNGSEYVPTYEDR  193

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFVDSC+RLRIMKGSEAIGLAPRAVEKCKNR
Sbjct  194  DGDWMLVGDVPWEMFVDSCRRLRIMKGSEAIGLAPRAVEKCKNR  237



>gb|AAN16886.1| Aux/IAA1 [Mirabilis jalapa]
Length=97

 Score =   180 bits (456),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 83/96 (86%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = -1

Query  678  ESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVG  499
            +SYQ LSDAL KMFSSFT+GNYG+QGMIDFMNE KLMDL+N S+YVPTYEDKDGDWMLVG
Sbjct  1    KSYQDLSDALGKMFSSFTLGNYGSQGMIDFMNESKLMDLINGSDYVPTYEDKDGDWMLVG  60

Query  498  DVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DVPWEMFV+SCKRLRIMKG EA GLAPRA+EKCKNR
Sbjct  61   DVPWEMFVESCKRLRIMKGKEAAGLAPRAMEKCKNR  96



>ref|XP_009774251.1| PREDICTED: auxin-responsive protein IAA16-like [Nicotiana sylvestris]
Length=195

 Score =   183 bits (464),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 84/104 (81%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDL MY++YQQLSDAL+ MFSSFT+GN   QGM DFMNERKLMDLLNS ++VPT+EDK
Sbjct  91   RKVDLNMYKNYQQLSDALSNMFSSFTIGNCEVQGMKDFMNERKLMDLLNSCDFVPTFEDK  150

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPW MFV+SCKRLRIMKG+EAIGLAP+ +EKCKNR
Sbjct  151  DGDWMLVGDVPWGMFVESCKRLRIMKGTEAIGLAPKTMEKCKNR  194



>gb|ADL70558.1| indole-3-acetic acid inducible 7 [Arabidopsis thaliana]
Length=95

 Score =   179 bits (455),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 86/94 (91%), Positives = 91/94 (97%), Gaps = 1/94 (1%)
 Frame = -1

Query  669  QQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVP  490
            Q LSDALAKMFSSFTMGNYGAQGMIDFMNE KLM+LLNSSEYVP+YEDKDGDWMLVGDVP
Sbjct  1    QDLSDALAKMFSSFTMGNYGAQGMIDFMNESKLMNLLNSSEYVPSYEDKDGDWMLVGDVP  60

Query  489  WEMFVDSCKRLRIMKGSEAIGLAPRAVEK-CKNR  391
            WEMFV+SCKRLRIMKGSEA+GLAPRA+EK CKNR
Sbjct  61   WEMFVESCKRLRIMKGSEAVGLAPRAMEKYCKNR  94



>ref|XP_004963100.1| PREDICTED: auxin-responsive protein IAA30-like [Setaria italica]
Length=264

 Score =   185 bits (470),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 97/104 (93%), Gaps = 1/104 (1%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY+SYQ+LS AL KMFSSFT+G+ G+QGM + MNE KL+DLLN SEYVPTYEDK
Sbjct  161  RKVDLKMYKSYQELSKALEKMFSSFTIGSCGSQGM-NGMNESKLVDLLNGSEYVPTYEDK  219

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRA+EKCKNR
Sbjct  220  DGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNR  263



>ref|XP_006443921.1| hypothetical protein CICLE_v10022032mg [Citrus clementina]
 ref|XP_006479598.1| PREDICTED: auxin-induced protein AUX28-like [Citrus sinensis]
 gb|ESR57161.1| hypothetical protein CICLE_v10022032mg [Citrus clementina]
Length=232

 Score =   184 bits (467),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 85/104 (82%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDL+MY +Y+ L DAL KMFSSFT+GN G+QGM DFMNE KLMDLLN S+YVPTYEDK
Sbjct  128  RKVDLRMYNTYKDLYDALGKMFSSFTIGNCGSQGMKDFMNESKLMDLLNGSDYVPTYEDK  187

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPW MFV+SCKRLRI+KG+EAIGLAPRA+EKCKNR
Sbjct  188  DGDWMLVGDVPWGMFVESCKRLRIVKGTEAIGLAPRAMEKCKNR  231



>ref|XP_002443496.1| hypothetical protein SORBIDRAFT_08g020580 [Sorghum bicolor]
 gb|EES17334.1| hypothetical protein SORBIDRAFT_08g020580 [Sorghum bicolor]
Length=281

 Score =   186 bits (471),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 97/104 (93%), Gaps = 1/104 (1%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY+SYQ+LS AL KMFSSFT+G+ G+QGM + MNE KL+DLLN SEYVPTYEDK
Sbjct  178  RKVDLKMYKSYQELSKALEKMFSSFTIGSCGSQGM-NGMNESKLVDLLNGSEYVPTYEDK  236

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRA+EKCKNR
Sbjct  237  DGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNR  280



>gb|KHN30563.1| Auxin-responsive protein IAA14 [Glycine soja]
Length=233

 Score =   184 bits (467),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/94 (93%), Positives = 89/94 (95%), Gaps = 0/94 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDL MY+SY+ LSDALAKMFSSFTMGNYGAQGMIDFMNE KLMDLLNSSEYVPTYEDK
Sbjct  132  RKVDLTMYKSYKDLSDALAKMFSSFTMGNYGAQGMIDFMNESKLMDLLNSSEYVPTYEDK  191

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLA  421
            DGDWMLVGDVPWEMFV SCKRLRIMKGSEAIGL 
Sbjct  192  DGDWMLVGDVPWEMFVGSCKRLRIMKGSEAIGLG  225



>gb|KDO68557.1| hypothetical protein CISIN_1g026823mg [Citrus sinensis]
Length=232

 Score =   184 bits (466),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 85/104 (82%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDL+MY +YQ L  AL KMFSSFT+GN G+QGM DFMNE KLMDLLN S+YVPTYEDK
Sbjct  128  RKVDLRMYNTYQDLYHALGKMFSSFTIGNCGSQGMKDFMNESKLMDLLNGSDYVPTYEDK  187

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPW MFV+SCKRLRI+KG+EAIGLAPRA+EKCKNR
Sbjct  188  DGDWMLVGDVPWGMFVESCKRLRIVKGTEAIGLAPRAMEKCKNR  231



>gb|ADL70552.1| indole-3-acetic acid inducible 7 [Arabidopsis thaliana]
 gb|ADL70553.1| indole-3-acetic acid inducible 7 [Arabidopsis thaliana]
Length=95

 Score =   179 bits (454),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 86/94 (91%), Positives = 91/94 (97%), Gaps = 1/94 (1%)
 Frame = -1

Query  669  QQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVP  490
            Q LSDALAKMFSSFT+GNYGAQGMIDFMNE KLM+LLNSSEYVP+YEDKDGDWMLVGDVP
Sbjct  1    QDLSDALAKMFSSFTLGNYGAQGMIDFMNESKLMNLLNSSEYVPSYEDKDGDWMLVGDVP  60

Query  489  WEMFVDSCKRLRIMKGSEAIGLAPRAVEK-CKNR  391
            WEMFV+SCKRLRIMKGSEAIGLAPRA+EK CKNR
Sbjct  61   WEMFVESCKRLRIMKGSEAIGLAPRAMEKYCKNR  94



>ref|XP_010923478.1| PREDICTED: auxin-responsive protein IAA30-like isoform X1 [Elaeis 
guineensis]
Length=250

 Score =   184 bits (467),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 91/106 (86%), Positives = 95/106 (90%), Gaps = 2/106 (2%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMI--DFMNERKLMDLLNSSEYVPTYE  529
            RKVDLKMY SYQ+LS AL KMFSSFT GN G+QGM   DFMNE KLMDLLN SEYVPTYE
Sbjct  144  RKVDLKMYRSYQELSMALEKMFSSFTSGNCGSQGMSGRDFMNESKLMDLLNGSEYVPTYE  203

Query  528  DKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DKDGD MLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRA+EKCKNR
Sbjct  204  DKDGDLMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNR  249



>ref|NP_001267662.1| auxin-induced protein AUX28-like [Cucumis sativus]
 dbj|BAA81687.1| unnamed protein product [Cucumis sativus]
 gb|KGN44763.1| hypothetical protein Csa_7G378520 [Cucumis sativus]
Length=230

 Score =   183 bits (465),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/105 (84%), Positives = 96/105 (91%), Gaps = 1/105 (1%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFT-MGNYGAQGMIDFMNERKLMDLLNSSEYVPTYED  526
            RKVDLKMY+SY+QLSDALA MF SFT +GN G+Q M DFMNE KLMDLL+ S+YVPTYED
Sbjct  125  RKVDLKMYKSYKQLSDALAAMFGSFTTIGNCGSQEMKDFMNESKLMDLLSGSDYVPTYED  184

Query  525  KDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            KDGDWMLVGDVPWEMFV+SCKRLRIMKG EAIGLAPRA+EKCKNR
Sbjct  185  KDGDWMLVGDVPWEMFVESCKRLRIMKGKEAIGLAPRAMEKCKNR  229



>dbj|BAJ84870.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92398.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=252

 Score =   184 bits (466),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 94/104 (90%), Gaps = 1/104 (1%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDL MY++YQ LS AL KMFSSFT+GN G QGM + MNE KLMDLLN SEYVPTYEDK
Sbjct  149  RKVDLSMYKTYQDLSKALEKMFSSFTIGNCGTQGM-NGMNESKLMDLLNGSEYVPTYEDK  207

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRA+EKCKNR
Sbjct  208  DGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNR  251



>dbj|BAK01326.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=252

 Score =   184 bits (466),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 94/104 (90%), Gaps = 1/104 (1%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDL MY++YQ LS AL KMFSSFT+GN G QGM + MNE KLMDLLN SEYVPTYEDK
Sbjct  149  RKVDLSMYKTYQDLSKALEKMFSSFTIGNCGTQGM-NGMNESKLMDLLNGSEYVPTYEDK  207

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRA+EKCKNR
Sbjct  208  DGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNR  251



>gb|ACF88333.1| unknown [Zea mays]
 tpg|DAA55066.1| TPA: IAA30-auxin-responsive Aux/IAA family member [Zea mays]
Length=271

 Score =   184 bits (468),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 95/104 (91%), Gaps = 1/104 (1%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY SYQQLS AL  MFSSFT+G+ G+QGM + MNE KL+DLLN SEYVPTYEDK
Sbjct  168  RKVDLKMYRSYQQLSKALENMFSSFTIGSCGSQGM-NGMNESKLVDLLNGSEYVPTYEDK  226

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRA+EKCKNR
Sbjct  227  DGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNR  270



>gb|AGV54230.1| auxin-induced protein AUX28 [Phaseolus vulgaris]
Length=245

 Score =   183 bits (465),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/104 (82%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY++Y +LSDAL KMFSSFT+GN  +QG  DFMNE KLMD LNSS+ VPTYED+
Sbjct  141  RKVDLKMYKNYPELSDALGKMFSSFTIGNCESQGFKDFMNESKLMDFLNSSDCVPTYEDR  200

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFV+SCKRLRIMKG EAIGLAPRA+EKCKNR
Sbjct  201  DGDWMLVGDVPWEMFVESCKRLRIMKGKEAIGLAPRAMEKCKNR  244



>ref|XP_010917602.1| PREDICTED: auxin-responsive protein IAA30 isoform X2 [Elaeis 
guineensis]
Length=238

 Score =   183 bits (465),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 86/106 (81%), Positives = 96/106 (91%), Gaps = 2/106 (2%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMI--DFMNERKLMDLLNSSEYVPTYE  529
            RK+DLKMY SYQ+LS AL KMFSSFT+GN  +QG+   DFMNE KLMDL+N SEYVPTYE
Sbjct  132  RKIDLKMYRSYQELSVALEKMFSSFTIGNCSSQGIKGRDFMNESKLMDLINGSEYVPTYE  191

Query  528  DKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DKDGDWMLVGDVPWEMF+DSCKRLRIMKGSEAIGLAP+A+EKCKN+
Sbjct  192  DKDGDWMLVGDVPWEMFIDSCKRLRIMKGSEAIGLAPKAMEKCKNK  237



>ref|XP_006418150.1| hypothetical protein EUTSA_v10008679mg [Eutrema salsugineum]
 gb|ESQ36503.1| hypothetical protein EUTSA_v10008679mg [Eutrema salsugineum]
Length=229

 Score =   183 bits (464),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 85/106 (80%), Positives = 98/106 (92%), Gaps = 1/106 (1%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQ-GMIDFMNERKLMDLLNSSEYVPTYED  526
            RKVDLKMY+SY +LS+AL+ MFSSFTMG YG + GMIDFMNERKLMDL+NS +YVP+YED
Sbjct  124  RKVDLKMYKSYDELSNALSNMFSSFTMGKYGGEEGMIDFMNERKLMDLVNSWDYVPSYED  183

Query  525  KDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  388
            KDGDWMLVGDVPW MFVD+CKRLR+MKGS+AIGLAPRA+EKCK+R 
Sbjct  184  KDGDWMLVGDVPWPMFVDTCKRLRLMKGSDAIGLAPRAMEKCKSRA  229



>ref|XP_006418149.1| hypothetical protein EUTSA_v10008679mg [Eutrema salsugineum]
 dbj|BAJ33922.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ36502.1| hypothetical protein EUTSA_v10008679mg [Eutrema salsugineum]
Length=226

 Score =   182 bits (463),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 85/106 (80%), Positives = 98/106 (92%), Gaps = 1/106 (1%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQ-GMIDFMNERKLMDLLNSSEYVPTYED  526
            RKVDLKMY+SY +LS+AL+ MFSSFTMG YG + GMIDFMNERKLMDL+NS +YVP+YED
Sbjct  121  RKVDLKMYKSYDELSNALSNMFSSFTMGKYGGEEGMIDFMNERKLMDLVNSWDYVPSYED  180

Query  525  KDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  388
            KDGDWMLVGDVPW MFVD+CKRLR+MKGS+AIGLAPRA+EKCK+R 
Sbjct  181  KDGDWMLVGDVPWPMFVDTCKRLRLMKGSDAIGLAPRAMEKCKSRA  226



>gb|ADL70676.1| indole-3-acetic acid inducible 16 [Arabidopsis thaliana]
Length=149

 Score =   180 bits (457),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 82/98 (84%), Positives = 93/98 (95%), Gaps = 0/98 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RK+DLK+Y++YQ LS+AL+KMFSSFT+GNYG QGM DFMNE KL+DLLN S+YVPTYEDK
Sbjct  52   RKIDLKLYKTYQDLSNALSKMFSSFTIGNYGPQGMKDFMNESKLIDLLNGSDYVPTYEDK  111

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAV  409
            DGDWMLVGDVPWEMFVDSCKR+RIMKGSEAIGLAPRA+
Sbjct  112  DGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRAL  149



>ref|XP_008451270.1| PREDICTED: auxin-induced protein AUX28-like [Cucumis melo]
Length=230

 Score =   183 bits (464),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 87/105 (83%), Positives = 96/105 (91%), Gaps = 1/105 (1%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFT-MGNYGAQGMIDFMNERKLMDLLNSSEYVPTYED  526
            RKVDLKMY+SY+QLSDALA MF SFT +GN G+Q M DFMNE KLMDLL+ S+YVPTYED
Sbjct  125  RKVDLKMYKSYKQLSDALAAMFGSFTTIGNCGSQEMKDFMNESKLMDLLSGSDYVPTYED  184

Query  525  KDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            KDGDWMLVGDVPWEMFV+SCKR+RIMKG EAIGLAPRA+EKCKNR
Sbjct  185  KDGDWMLVGDVPWEMFVESCKRVRIMKGKEAIGLAPRAMEKCKNR  229



>ref|XP_008810170.1| PREDICTED: auxin-responsive protein IAA30-like [Phoenix dactylifera]
Length=241

 Score =   183 bits (464),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 95/106 (90%), Gaps = 2/106 (2%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMI--DFMNERKLMDLLNSSEYVPTYE  529
            RK+DLKMY SYQ+LS AL KMFSSFT+GN  +QG+   DFMNE KLMDLLN SEYVPTYE
Sbjct  135  RKIDLKMYSSYQELSVALEKMFSSFTIGNCSSQGIKGRDFMNESKLMDLLNGSEYVPTYE  194

Query  528  DKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAP+ +EKCKN+
Sbjct  195  DKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPKVMEKCKNQ  240



>gb|ADL70554.1| indole-3-acetic acid inducible 7 [Arabidopsis thaliana]
 gb|ADL70555.1| indole-3-acetic acid inducible 7 [Arabidopsis thaliana]
 gb|ADL70560.1| indole-3-acetic acid inducible 7 [Arabidopsis thaliana]
Length=94

 Score =   178 bits (451),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 86/92 (93%), Positives = 90/92 (98%), Gaps = 1/92 (1%)
 Frame = -1

Query  663  LSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWE  484
            LSDALAKMFSSFTMGNYGAQGMIDFMNE KLM+LLNSSEYVP+YEDKDGDWMLVGDVPWE
Sbjct  2    LSDALAKMFSSFTMGNYGAQGMIDFMNESKLMNLLNSSEYVPSYEDKDGDWMLVGDVPWE  61

Query  483  MFVDSCKRLRIMKGSEAIGLAPRAVEK-CKNR  391
            MFV+SCKRLRIMKGSEAIGLAPRA+EK CKNR
Sbjct  62   MFVESCKRLRIMKGSEAIGLAPRAMEKYCKNR  93



>gb|ACF87179.1| unknown [Zea mays]
 gb|ADX60115.1| AUX/IAA transcription factor [Zea mays]
Length=276

 Score =   184 bits (467),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 95/104 (91%), Gaps = 1/104 (1%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY SYQQLS AL  MFSSFT+G+ G+QGM + MNE KL+DLLN SEYVPTYEDK
Sbjct  173  RKVDLKMYRSYQQLSKALENMFSSFTIGSCGSQGM-NGMNESKLVDLLNGSEYVPTYEDK  231

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRA+EKCKNR
Sbjct  232  DGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNR  275



>ref|XP_009398568.1| PREDICTED: auxin-responsive protein IAA30-like [Musa acuminata 
subsp. malaccensis]
Length=248

 Score =   183 bits (464),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 89/106 (84%), Positives = 94/106 (89%), Gaps = 2/106 (2%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGM--IDFMNERKLMDLLNSSEYVPTYE  529
            RKVDLKMY SYQ+LS AL KMFSSFT  N G+QGM   DF NE KLMDL+N SEYVPTYE
Sbjct  142  RKVDLKMYRSYQELSMALEKMFSSFTSANCGSQGMNGRDFTNEGKLMDLINGSEYVPTYE  201

Query  528  DKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRA+EKCK+R
Sbjct  202  DKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSR  247



>ref|XP_007147174.1| hypothetical protein PHAVU_006G102100g [Phaseolus vulgaris]
 gb|ESW19168.1| hypothetical protein PHAVU_006G102100g [Phaseolus vulgaris]
Length=272

 Score =   184 bits (466),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 86/105 (82%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLK+Y+SYQ+LSD+LAKMFSSFT+    +QGM DFMNE KL+D LN S+YVPTYEDK
Sbjct  168  RKVDLKVYKSYQELSDSLAKMFSSFTIDKCESQGMKDFMNETKLIDFLNGSDYVPTYEDK  227

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  388
            DGDWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRAVEK KNR 
Sbjct  228  DGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAVEKRKNRS  272



>gb|ACU19136.1| unknown [Glycine max]
Length=243

 Score =   182 bits (463),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 85/104 (82%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLK+Y+SYQ+L DALAKMFSSFT+   G+QGM DFMNE KL+D  N S+YVPTYEDK
Sbjct  139  RKVDLKLYKSYQELLDALAKMFSSFTIDKCGSQGMKDFMNESKLIDFFNGSDYVPTYEDK  198

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            D DWMLVGDVPWEMFV+SCKRLRIMKG EAIGLAPRAVEKCKNR
Sbjct  199  DADWMLVGDVPWEMFVESCKRLRIMKGFEAIGLAPRAVEKCKNR  242



>ref|NP_001150626.1| IAA30 - auxin-responsive Aux/IAA family member [Zea mays]
 gb|ACG39802.1| IAA30 - auxin-responsive Aux/IAA family member [Zea mays]
Length=275

 Score =   183 bits (465),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 95/104 (91%), Gaps = 1/104 (1%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY SYQQLS AL  MFSSFT+G+ G+QGM + MNE KL+DLLN SEYVPTYEDK
Sbjct  172  RKVDLKMYRSYQQLSKALENMFSSFTIGSCGSQGM-NGMNESKLVDLLNGSEYVPTYEDK  230

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRA+EKCKNR
Sbjct  231  DGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNR  274



>ref|XP_003579189.1| PREDICTED: auxin-responsive protein IAA30-like [Brachypodium 
distachyon]
Length=249

 Score =   182 bits (463),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 95/104 (91%), Gaps = 1/104 (1%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDL MY++YQ LS AL KMFSSFT+GN G+QGM + MNE KLMDLLN SEYVPTYEDK
Sbjct  146  RKVDLNMYKTYQDLSMALHKMFSSFTIGNCGSQGM-NGMNESKLMDLLNGSEYVPTYEDK  204

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRA+EKCKNR
Sbjct  205  DGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNR  248



>ref|XP_007162490.1| hypothetical protein PHAVU_001G156600g [Phaseolus vulgaris]
 gb|ESW34484.1| hypothetical protein PHAVU_001G156600g [Phaseolus vulgaris]
Length=246

 Score =   182 bits (462),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 87/107 (81%), Positives = 96/107 (90%), Gaps = 2/107 (2%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY+SY++LSD+L KMFSSFT+GN  +QGM DFMNE KLMDLLNSS+YVPTYEDK
Sbjct  140  RKVDLKMYQSYRELSDSLGKMFSSFTIGNCESQGMKDFMNESKLMDLLNSSDYVPTYEDK  199

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAI--GLAPRAVEKCKNRC  388
            DGDWMLVGDVPWEMFV+SCKRLRIMKG EAI  GLAPRA+ K KNR 
Sbjct  200  DGDWMLVGDVPWEMFVESCKRLRIMKGKEAIGLGLAPRAMAKSKNRS  246



>ref|XP_011026048.1| PREDICTED: auxin-induced protein AUX28-like [Populus euphratica]
Length=237

 Score =   181 bits (460),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY++YQ+LS AL +MFSSFT+GN G+ G+ DF+NE KL+DLLN ++YVPTYEDK
Sbjct  131  RKVDLKMYKTYQELSGALEEMFSSFTIGNCGSHGLKDFLNESKLIDLLNGTDYVPTYEDK  190

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPW+MFV+SCKRLRIMKG+EA GLAPRA+EKCKNR
Sbjct  191  DGDWMLVGDVPWDMFVESCKRLRIMKGTEATGLAPRAMEKCKNR  234



>ref|XP_010475075.1| PREDICTED: auxin-responsive protein IAA17-like [Camelina sativa]
Length=230

 Score =   181 bits (459),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/105 (80%), Positives = 98/105 (93%), Gaps = 1/105 (1%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQ-GMIDFMNERKLMDLLNSSEYVPTYED  526
            RKVDL+MY+SY +LS+AL+ MFSSFTMG YG + GMIDFMNERKLMDL+NS +YVP+YED
Sbjct  125  RKVDLRMYKSYDELSNALSNMFSSFTMGKYGGEEGMIDFMNERKLMDLVNSWDYVPSYED  184

Query  525  KDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            KDGDWMLVGDVPW MFVD+CKRLR+MKGS+AIGLAPRA+EKCK+R
Sbjct  185  KDGDWMLVGDVPWPMFVDTCKRLRLMKGSDAIGLAPRAMEKCKSR  229



>ref|XP_010457463.1| PREDICTED: auxin-responsive protein IAA17 [Camelina sativa]
Length=229

 Score =   181 bits (459),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/105 (80%), Positives = 98/105 (93%), Gaps = 1/105 (1%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQ-GMIDFMNERKLMDLLNSSEYVPTYED  526
            RKVDL+MY+SY +LS+AL+ MFSSFTMG YG + GMIDFMNERKLMDL+NS +YVP+YED
Sbjct  124  RKVDLRMYKSYDELSNALSNMFSSFTMGKYGGEEGMIDFMNERKLMDLVNSWDYVPSYED  183

Query  525  KDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            KDGDWMLVGDVPW MFVD+CKRLR+MKGS+AIGLAPRA+EKCK+R
Sbjct  184  KDGDWMLVGDVPWPMFVDTCKRLRLMKGSDAIGLAPRAMEKCKSR  228



>ref|NP_001236693.1| auxin-induced protein AUX28 [Glycine max]
 sp|P13089.1|AUX28_SOYBN RecName: Full=Auxin-induced protein AUX28 [Glycine max]
 gb|AAA33945.1| auxin-regulated protein (Aux28) [Glycine max]
Length=243

 Score =   181 bits (459),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 95/106 (90%), Gaps = 2/106 (2%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY+SY++LSD+L KMFSSFT GN  +QGM DFMNE KL DLLNSS+YVPTYEDK
Sbjct  137  RKVDLKMYKSYRELSDSLGKMFSSFTFGNCESQGMKDFMNESKLNDLLNSSDYVPTYEDK  196

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAI--GLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFV+SCKRLRIMKG EAI  GLAPRA+ KCKNR
Sbjct  197  DGDWMLVGDVPWEMFVESCKRLRIMKGKEAIGLGLAPRAMAKCKNR  242



>ref|XP_006304183.1| hypothetical protein CARUB_v10010236mg [Capsella rubella]
 gb|EOA37081.1| hypothetical protein CARUB_v10010236mg [Capsella rubella]
Length=224

 Score =   180 bits (457),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/105 (80%), Positives = 97/105 (92%), Gaps = 1/105 (1%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQ-GMIDFMNERKLMDLLNSSEYVPTYED  526
            RKVDL+MY+SY +LS AL+ MFSSFTMG YG + GMIDFMNERKLMDL+NS +YVP+YED
Sbjct  119  RKVDLRMYKSYDELSTALSNMFSSFTMGKYGGEEGMIDFMNERKLMDLVNSWDYVPSYED  178

Query  525  KDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            KDGDWMLVGDVPW MFVD+CKRLR+MKGS+AIGLAPRA+EKCK+R
Sbjct  179  KDGDWMLVGDVPWPMFVDTCKRLRLMKGSDAIGLAPRAMEKCKSR  223



>gb|ACU21378.1| unknown [Glycine max]
Length=252

 Score =   181 bits (459),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 95/106 (90%), Gaps = 2/106 (2%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY+SY++LSD+L KMFSSFT GN  +QGM DFMNE KL DLLNSS+YVPTYEDK
Sbjct  146  RKVDLKMYKSYRELSDSLGKMFSSFTFGNCESQGMKDFMNESKLNDLLNSSDYVPTYEDK  205

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAI--GLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFV+SCKRLRIMKG EAI  GLAPRA+ KCKNR
Sbjct  206  DGDWMLVGDVPWEMFVESCKRLRIMKGKEAIGLGLAPRAMAKCKNR  251



>gb|KHN02537.1| Auxin-induced protein AUX28 [Glycine soja]
Length=252

 Score =   181 bits (459),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 95/106 (90%), Gaps = 2/106 (2%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY+SY++LSD+L KMFSSFT GN  +QGM DFMNE KL DLLNSS+YVPTYEDK
Sbjct  146  RKVDLKMYKSYRELSDSLGKMFSSFTFGNCESQGMKDFMNESKLNDLLNSSDYVPTYEDK  205

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAI--GLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFV+SCKRLRIMKG EAI  GLAPRA+ KCKNR
Sbjct  206  DGDWMLVGDVPWEMFVESCKRLRIMKGKEAIGLGLAPRAMAKCKNR  251



>gb|KEH42778.1| auxin-responsive AUX/IAA family protein [Medicago truncatula]
Length=239

 Score =   181 bits (458),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 85/94 (90%), Positives = 88/94 (94%), Gaps = 0/94 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDL MY++Y+ LSDALAKMFSSFT GNYGAQGMIDFMNE KLMDLLNSSEYVPTYEDK
Sbjct  132  RKVDLTMYKTYKDLSDALAKMFSSFTTGNYGAQGMIDFMNESKLMDLLNSSEYVPTYEDK  191

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLA  421
            DGDWMLVGDVPWEMFV SCKRLRIMKGSEAIGL 
Sbjct  192  DGDWMLVGDVPWEMFVGSCKRLRIMKGSEAIGLG  225



>ref|XP_010483317.1| PREDICTED: auxin-responsive protein IAA17-like [Camelina sativa]
Length=229

 Score =   180 bits (456),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 83/105 (79%), Positives = 98/105 (93%), Gaps = 1/105 (1%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQ-GMIDFMNERKLMDLLNSSEYVPTYED  526
            RKVDL+MY+SY +LS+AL+ MFSSFT+G YG + GMIDFMNERKLMDL+NS +YVP+YED
Sbjct  124  RKVDLRMYKSYDELSNALSNMFSSFTLGKYGGEEGMIDFMNERKLMDLVNSWDYVPSYED  183

Query  525  KDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            KDGDWMLVGDVPW MFVD+CKRLR+MKGS+AIGLAPRA+EKCK+R
Sbjct  184  KDGDWMLVGDVPWPMFVDTCKRLRLMKGSDAIGLAPRAMEKCKSR  228



>gb|EYU46510.1| hypothetical protein MIMGU_mgv1a013084mg [Erythranthe guttata]
Length=231

 Score =   180 bits (456),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY++Y++LSDAL KMFSSFT+G   +QGM+DFM+E KLMDLLNSS+YVPTYEDK
Sbjct  127  RKVDLKMYKTYKELSDALGKMFSSFTIGKCDSQGMMDFMSESKLMDLLNSSDYVPTYEDK  186

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFV SCKRLRIMKG+EA GLAP+A++KCK R
Sbjct  187  DGDWMLVGDVPWEMFVGSCKRLRIMKGTEAKGLAPKAMDKCKTR  230



>ref|XP_002889499.1| hypothetical protein ARALYDRAFT_470401 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65758.1| hypothetical protein ARALYDRAFT_470401 [Arabidopsis lyrata subsp. 
lyrata]
Length=229

 Score =   180 bits (456),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 83/105 (79%), Positives = 98/105 (93%), Gaps = 1/105 (1%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQ-GMIDFMNERKLMDLLNSSEYVPTYED  526
            RKVDL+MY+SY +LS+AL+ MFSSFTMG +G + GMIDFMNERKLMDL+NS +YVP+YED
Sbjct  124  RKVDLRMYKSYDELSNALSNMFSSFTMGKHGGEEGMIDFMNERKLMDLVNSWDYVPSYED  183

Query  525  KDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            KDGDWMLVGDVPW MFVD+CKRLR+MKGS+AIGLAPRA+EKCK+R
Sbjct  184  KDGDWMLVGDVPWPMFVDTCKRLRLMKGSDAIGLAPRAMEKCKSR  228



>ref|XP_011042427.1| PREDICTED: auxin-induced protein AUX28-like [Populus euphratica]
Length=237

 Score =   180 bits (456),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY++Y +LSDAL +MFSSFT+GN G+ GM DF+NE KL+DLL  ++YVPTYEDK
Sbjct  131  RKVDLKMYKTYHELSDALGEMFSSFTIGNCGSHGMKDFLNESKLIDLLTGTDYVPTYEDK  190

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPW+MFV+SCKRLRIMKG+EA GLAPRA+EKCK+R
Sbjct  191  DGDWMLVGDVPWDMFVESCKRLRIMKGTEATGLAPRAMEKCKSR  234



>gb|EEE53551.1| hypothetical protein OsJ_36765 [Oryza sativa Japonica Group]
Length=183

 Score =   178 bits (451),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 85/104 (82%), Positives = 94/104 (90%), Gaps = 1/104 (1%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY+SY +LS AL KMFSSFT+GN G+ G ++ MNE K+ DLLN SEYVPTYEDK
Sbjct  80   RKVDLKMYKSYLELSKALEKMFSSFTIGNCGSHG-VNGMNESKIADLLNGSEYVPTYEDK  138

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            DGDWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRA+EKCKNR
Sbjct  139  DGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNR  182



>gb|AAC39440.1| IAA17/AXR3-1 protein [Arabidopsis thaliana]
Length=229

 Score =   179 bits (454),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 82/105 (78%), Positives = 98/105 (93%), Gaps = 1/105 (1%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQ-GMIDFMNERKLMDLLNSSEYVPTYED  526
            RK+DL+MY+SY +LS+AL+ MFSSFTMG +G + GMIDFMNERKLMDL+NS +YVP+YED
Sbjct  124  RKIDLRMYKSYDELSNALSNMFSSFTMGKHGGEEGMIDFMNERKLMDLVNSWDYVPSYED  183

Query  525  KDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            KDGDWMLVGDVPW MFVD+CKRLR+MKGS+AIGLAPRA+EKCK+R
Sbjct  184  KDGDWMLVGDVPWPMFVDTCKRLRLMKGSDAIGLAPRAMEKCKSR  228



>gb|AAM64837.1| putative auxin-induced protein, IAA17/AXR3-1 [Arabidopsis thaliana]
Length=228

 Score =   179 bits (454),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 82/105 (78%), Positives = 98/105 (93%), Gaps = 1/105 (1%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQ-GMIDFMNERKLMDLLNSSEYVPTYED  526
            RK+DL+MY+SY +LS+AL+ MFSSFTMG +G + GMIDFMNERKLMDL+NS +YVP+YED
Sbjct  123  RKIDLRMYKSYDELSNALSNMFSSFTMGKHGGEEGMIDFMNERKLMDLVNSWDYVPSYED  182

Query  525  KDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            KDGDWMLVGDVPW MFVD+CKRLR+MKGS+AIGLAPRA+EKCK+R
Sbjct  183  KDGDWMLVGDVPWPMFVDTCKRLRLMKGSDAIGLAPRAMEKCKSR  227



>ref|NP_171921.1| auxin-responsive protein IAA17 [Arabidopsis thaliana]
 sp|P93830.2|IAA17_ARATH RecName: Full=Auxin-responsive protein IAA17; AltName: Full=Auxin 
response 3; AltName: Full=Indoleacetic acid-induced protein 
17 [Arabidopsis thaliana]
 gb|AAG53997.1|AF336916_1 auxin-induced protein, IAA17/AXR3-1 [Arabidopsis thaliana]
 gb|AAB84354.1| IAA17 [Arabidopsis thaliana]
 gb|AAC39439.1| IAA17/AXR3 protein [Arabidopsis thaliana]
 gb|AAB70451.2| Identical to Arabidopsis gb|AF040632 and gb|U49073 IAA17/AXR3 
gene. ESTs gb|H36782 and gb|F14074 come from this gene [Arabidopsis 
thaliana]
 gb|AAL49831.1| auxin-induced protein IAA17/AXR3-1 [Arabidopsis thaliana]
 gb|AAM51258.1| auxin-induced protein IAA17/AXR3-1 [Arabidopsis thaliana]
 gb|AEE27674.1| auxin-responsive protein IAA17 [Arabidopsis thaliana]
 gb|AGZ13682.1| IAA17 [Cloning vector pAW8ENdeI-cHAIAA17]
 gb|AGZ59820.1| IAA17 [Cloning vector pAW8ENdeI-cHAIAA17-spo5DSR]
Length=229

 Score =   179 bits (454),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 82/105 (78%), Positives = 98/105 (93%), Gaps = 1/105 (1%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQ-GMIDFMNERKLMDLLNSSEYVPTYED  526
            RK+DL+MY+SY +LS+AL+ MFSSFTMG +G + GMIDFMNERKLMDL+NS +YVP+YED
Sbjct  124  RKIDLRMYKSYDELSNALSNMFSSFTMGKHGGEEGMIDFMNERKLMDLVNSWDYVPSYED  183

Query  525  KDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  391
            KDGDWMLVGDVPW MFVD+CKRLR+MKGS+AIGLAPRA+EKCK+R
Sbjct  184  KDGDWMLVGDVPWPMFVDTCKRLRLMKGSDAIGLAPRAMEKCKSR  228



>ref|XP_004495391.1| PREDICTED: auxin-responsive protein IAA14-like isoform X1 [Cicer 
arietinum]
Length=244

 Score =   179 bits (455),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 84/94 (89%), Positives = 87/94 (93%), Gaps = 0/94 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDL MY +Y+ LSDALAKMFSSFT G YGAQGMIDFMNE KLMDLLNSSEYVPTYEDK
Sbjct  136  RKVDLTMYNTYKDLSDALAKMFSSFTTGKYGAQGMIDFMNESKLMDLLNSSEYVPTYEDK  195

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLA  421
            DGDWMLVGDVPWEMFV+SCKRLRIMKGSEAIGL 
Sbjct  196  DGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLG  229



>emb|CAB46059.1| IAA7 like protein [Arabidopsis thaliana]
 emb|CAB78497.1| IAA7 like protein [Arabidopsis thaliana]
Length=234

 Score =   179 bits (453),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/94 (89%), Positives = 89/94 (95%), Gaps = 0/94 (0%)
 Frame = -1

Query  702  RKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  523
            RKVDLKMY SY+ LSDALAKMFSSFTMG+YGAQGMIDFMNE K+MDLLNSSEYVP+YEDK
Sbjct  124  RKVDLKMYTSYKDLSDALAKMFSSFTMGSYGAQGMIDFMNESKVMDLLNSSEYVPSYEDK  183

Query  522  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLA  421
            DGDWMLVGDVPW MFV+SCKRLRIMKGSEAIGL 
Sbjct  184  DGDWMLVGDVPWPMFVESCKRLRIMKGSEAIGLG  217



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1193157586335