BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF027C08

Length=684
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009623182.1|  PREDICTED: 14-3-3-like protein 16R                 308   5e-102   Nicotiana tomentosiformis
gb|AGJ98234.1|  PIB67 14-3-3 protein                                    307   9e-102   Petunia x hybrida [garden petunia]
emb|CAC84142.3|  14-3-3 protein                                         306   5e-101   Nicotiana tabacum [American tobacco]
emb|CDP01506.1|  unnamed protein product                                304   2e-100   Coffea canephora [robusta coffee]
ref|XP_009589383.1|  PREDICTED: 14-3-3-like protein F                   303   4e-100   Nicotiana tomentosiformis
dbj|BAD12178.1|  14-3-3 f-1 protein                                     303   5e-100   Nicotiana tabacum [American tobacco]
gb|AAR98782.1|  14-3-3 protein isoform 20R                              303   6e-100   Solanum tuberosum [potatoes]
gb|AAS78777.1|  14-3-3 protein                                          301   2e-99    Solanum chacoense
sp|P93210.1|14335_SOLLC  RecName: Full=14-3-3 protein 5                 301   3e-99    Solanum lycopersicum
gb|EPS60562.1|  14-3-3 h-1 protein                                      301   4e-99    Genlisea aurea
sp|Q43643.1|14332_SOLTU  RecName: Full=14-3-3-like protein RA215        301   4e-99    Solanum tuberosum [potatoes]
ref|XP_011097537.1|  PREDICTED: 14-3-3-like protein 16R                 300   5e-99    Sesamum indicum [beniseed]
ref|NP_001234107.1|  14-3-3 family protein                              300   7e-99    
ref|NP_001275062.1|  14-3-3-like protein 16R                            300   1e-98    Solanum tuberosum [potatoes]
ref|NP_001274876.1|  14-3-3-like protein RA215                          300   1e-98    Solanum tuberosum [potatoes]
ref|XP_006472571.1|  PREDICTED: 14-3-3-like protein-like                298   4e-98    Citrus sinensis [apfelsine]
ref|NP_001234097.1|  14-3-3 protein 6                                   298   4e-98    Solanum lycopersicum
gb|EYU34581.1|  hypothetical protein MIMGU_mgv1a012286mg                298   5e-98    Erythranthe guttata [common monkey flower]
gb|ABA81882.1|  14-3-3 protein-like                                     298   6e-98    Solanum tuberosum [potatoes]
gb|KDO81026.1|  hypothetical protein CISIN_1g024620mg                   298   8e-98    Citrus sinensis [apfelsine]
ref|XP_009799312.1|  PREDICTED: 14-3-3-like protein F                   297   9e-98    Nicotiana sylvestris
gb|KDP41413.1|  hypothetical protein JCGZ_15820                         297   1e-97    Jatropha curcas
ref|XP_009786458.1|  PREDICTED: 14-3-3-like protein A                   297   1e-97    Nicotiana sylvestris
gb|EPS73301.1|  14-3-3 h-1 protein                                      296   3e-97    Genlisea aurea
ref|XP_010098629.1|  14-3-3-like protein                                296   4e-97    Morus notabilis
gb|EYU30984.1|  hypothetical protein MIMGU_mgv1a012292mg                295   5e-97    Erythranthe guttata [common monkey flower]
gb|AIJ04691.1|  14-3-3b                                                 295   1e-96    Morus alba var. atropurpurea
ref|XP_004299669.1|  PREDICTED: 14-3-3-like protein                     295   1e-96    Fragaria vesca subsp. vesca
ref|XP_009609727.1|  PREDICTED: 14-3-3-like protein A                   294   2e-96    Nicotiana tomentosiformis
ref|NP_001267852.1|  14-3-3 protein                                     294   3e-96    Vitis vinifera
gb|ACQ45021.1|  14-3-3                                                  293   3e-96    Cicer arietinum [garbanzo]
gb|ACD69679.1|  14-3-3                                                  293   3e-96    Mangifera indica
ref|NP_001275217.1|  14-3-3 protein 2-like                              293   6e-96    Solanum tuberosum [potatoes]
gb|KJB58994.1|  hypothetical protein B456_009G234600                    293   7e-96    Gossypium raimondii
gb|ABY65001.1|  14-3-3b protein                                         293   7e-96    Gossypium hirsutum [American cotton]
gb|KHG20751.1|  Uncharacterized protein F383_04220                      293   8e-96    Gossypium arboreum [tree cotton]
gb|EYU36484.1|  hypothetical protein MIMGU_mgv1a011964mg                293   8e-96    Erythranthe guttata [common monkey flower]
gb|AIU34467.1|  putative 14-3-3 protein                                 292   8e-96    Taraxacum brevicorniculatum
ref|NP_001275270.1|  14-3-3-like protein C-like                         292   9e-96    Solanum tuberosum [potatoes]
ref|XP_010676024.1|  PREDICTED: 14-3-3-like protein                     292   1e-95    Beta vulgaris subsp. vulgaris [field beet]
sp|P93209.1|14333_SOLLC  RecName: Full=14-3-3 protein 3; AltName:...    292   1e-95    Solanum lycopersicum
ref|XP_003526571.1|  PREDICTED: 14-3-3-like protein-like                292   1e-95    
gb|AAT35546.1|  14-3-3 protein                                          291   2e-95    Tropaeolum majus
ref|XP_002262802.1|  PREDICTED: 14-3-3-like protein                     291   3e-95    Vitis vinifera
gb|AES73074.2|  general regulatory factor 2                             291   3e-95    Medicago truncatula
ref|XP_007018723.1|  General regulatory factor 2, OMEGA                 291   3e-95    Theobroma cacao [chocolate]
ref|NP_001234677.1|  14-3-3 protein 3                                   290   4e-95    
ref|XP_002513956.1|  14-3-3 protein, putative                           290   4e-95    Ricinus communis
ref|XP_010521176.1|  PREDICTED: 14-3-3-like protein GF14 omega          290   6e-95    Tarenaya hassleriana [spider flower]
ref|XP_002887733.1|  GF14 omega                                         290   9e-95    
ref|XP_009777542.1|  PREDICTED: 14-3-3-like protein B                   290   1e-94    Nicotiana sylvestris
ref|XP_009632004.1|  PREDICTED: 14-3-3-like protein B                   290   1e-94    Nicotiana tomentosiformis
ref|XP_010543865.1|  PREDICTED: 14-3-3-like protein GF14 omega          290   1e-94    Tarenaya hassleriana [spider flower]
gb|AFK34151.1|  unknown                                                 290   1e-94    Medicago truncatula
ref|XP_008386122.1|  PREDICTED: 14-3-3-like protein                     290   1e-94    Malus domestica [apple tree]
ref|XP_009757667.1|  PREDICTED: 14-3-3-like protein C                   289   1e-94    Nicotiana sylvestris
ref|XP_010535331.1|  PREDICTED: 14-3-3-like protein GF14 omega          289   1e-94    Tarenaya hassleriana [spider flower]
ref|XP_009619695.1|  PREDICTED: 14-3-3-like protein C                   289   1e-94    Nicotiana tomentosiformis
sp|P93342.1|1433A_TOBAC  RecName: Full=14-3-3-like protein A            289   2e-94    Nicotiana tabacum [American tobacco]
ref|XP_004252529.1|  PREDICTED: 14-3-3 protein 2                        289   2e-94    
ref|XP_010060042.1|  PREDICTED: 14-3-3-like protein                     289   2e-94    Eucalyptus grandis [rose gum]
ref|NP_001238389.1|  14-3-3 protein SGF14h                              289   2e-94    Glycine max [soybeans]
ref|XP_007136271.1|  hypothetical protein PHAVU_009G032500g             288   3e-94    Phaseolus vulgaris [French bean]
gb|AAA96253.1|  GF14omega isoform                                       288   3e-94    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008346360.1|  PREDICTED: 14-3-3-like protein                     288   3e-94    
dbj|BAB47119.1|  14-3-3 protein                                         288   3e-94    Vigna angularis [azuki bean]
gb|AAD27823.2|  14-3-3 protein                                          288   3e-94    Populus tremula x Populus alba [gray poplar]
ref|XP_011098686.1|  PREDICTED: 14-3-3-like protein C                   288   4e-94    Sesamum indicum [beniseed]
ref|XP_011016779.1|  PREDICTED: 14-3-3-like protein                     288   4e-94    Populus euphratica
ref|XP_002301071.1|  14-3-3 protein 32kDa endonuclease                  288   4e-94    Populus trichocarpa [western balsam poplar]
ref|NP_565176.1|  14-3-3-like protein GF14 omega                        288   4e-94    Arabidopsis thaliana [mouse-ear cress]
emb|CAB42546.2|  14-3-3-like protein                                    288   4e-94    Pisum sativum [garden pea]
ref|XP_003602823.1|  14-3-3-like protein                                290   5e-94    
ref|XP_002307363.1|  14-3-3 protein 32kDa endonuclease                  288   5e-94    Populus trichocarpa [western balsam poplar]
gb|KDP40925.1|  hypothetical protein JCGZ_24924                         288   5e-94    Jatropha curcas
emb|CDX79255.1|  BnaC06g20480D                                          288   5e-94    
ref|XP_011009578.1|  PREDICTED: 14-3-3-like protein isoform X2          288   6e-94    Populus euphratica
ref|XP_009373053.1|  PREDICTED: 14-3-3-like protein                     290   6e-94    Pyrus x bretschneideri [bai li]
ref|XP_010428953.1|  PREDICTED: 14-3-3-like protein GF14 omega          288   7e-94    Camelina sativa [gold-of-pleasure]
ref|XP_007223394.1|  hypothetical protein PRUPE_ppa010148mg             288   7e-94    Prunus persica
ref|XP_006302543.1|  hypothetical protein CARUB_v10020644mg             290   8e-94    
dbj|BAD12554.1|  14-3-3 f-2 protein                                     286   1e-93    Nicotiana tabacum [American tobacco]
gb|KHG14081.1|  Uncharacterized protein F383_17151                      287   1e-93    Gossypium arboreum [tree cotton]
ref|XP_010272995.1|  PREDICTED: LOW QUALITY PROTEIN: 14-3-3-like ...    288   1e-93    
ref|XP_008219335.1|  PREDICTED: 14-3-3-like protein                     287   1e-93    Prunus mume [ume]
gb|KCW66571.1|  hypothetical protein EUGRSUZ_F00370                     289   2e-93    Eucalyptus grandis [rose gum]
ref|XP_010534083.1|  PREDICTED: 14-3-3-like protein GF14 omega          286   2e-93    Tarenaya hassleriana [spider flower]
sp|P46266.1|1433_PEA  RecName: Full=14-3-3-like protein                 286   2e-93    Pisum sativum [garden pea]
ref|XP_007200586.1|  hypothetical protein PRUPE_ppa010141mg             286   3e-93    Prunus persica
sp|O65352.1|1433_HELAN  RecName: Full=14-3-3-like protein               285   4e-93    Helianthus annuus
ref|XP_006423811.1|  hypothetical protein CICLE_v10029087mg             285   5e-93    Citrus clementina [clementine]
gb|ABQ95992.1|  14-3-3-like protein                                     285   5e-93    Cicer arietinum [garbanzo]
ref|XP_008444853.1|  PREDICTED: 14-3-3-like protein                     285   5e-93    Cucumis melo [Oriental melon]
ref|XP_011074203.1|  PREDICTED: 14-3-3-like protein B                   285   7e-93    Sesamum indicum [beniseed]
ref|XP_004152627.1|  PREDICTED: 14-3-3-like protein-like                285   7e-93    Cucumis sativus [cucumbers]
ref|XP_003615160.1|  14-3-3 protein                                     285   8e-93    Medicago truncatula
ref|XP_009104576.1|  PREDICTED: 14-3-3-like protein GF14 omega          285   8e-93    Brassica rapa
gb|AFK35595.1|  unknown                                                 285   8e-93    Lotus japonicus
gb|AAK26634.1|AF342780_1  GF14 omega                                    285   9e-93    Brassica napus [oilseed rape]
gb|KJB12045.1|  hypothetical protein B456_002G141000                    285   2e-92    Gossypium raimondii
ref|XP_008466219.1|  PREDICTED: 14-3-3-like protein                     284   2e-92    Cucumis melo [Oriental melon]
ref|XP_004136278.1|  PREDICTED: 14-3-3-like protein-like                284   2e-92    Cucumis sativus [cucumbers]
ref|XP_007141044.1|  hypothetical protein PHAVU_008G162500g             284   2e-92    Phaseolus vulgaris [French bean]
gb|ADP24188.1|  14-3-3-like protein                                     283   3e-92    Galega orientalis
sp|P29307.2|1433_OENEH  RecName: Full=14-3-3-like protein               283   4e-92    Oenothera elata subsp. hookeri [Hooker's evening primrose]
ref|XP_009345790.1|  PREDICTED: 14-3-3-like protein 16R                 283   5e-92    Pyrus x bretschneideri [bai li]
gb|ABY65003.1|  14-3-3d protein                                         283   6e-92    Gossypium hirsutum [American cotton]
gb|EPS72907.1|  14-3-3 a-1 protein                                      282   7e-92    Genlisea aurea
ref|XP_009350360.1|  PREDICTED: 14-3-3-like protein 16R                 283   7e-92    Pyrus x bretschneideri [bai li]
ref|NP_001239690.1|  uncharacterized protein LOC100798989               282   8e-92    Glycine max [soybeans]
ref|XP_010025879.1|  PREDICTED: 14-3-3-like protein                     282   9e-92    Eucalyptus grandis [rose gum]
sp|P42653.1|1433A_VICFA  RecName: Full=14-3-3-like protein A; Alt...    282   1e-91    Vicia faba [broad bean]
gb|AFK37964.1|  unknown                                                 282   1e-91    Medicago truncatula
ref|XP_003544808.1|  PREDICTED: 14-3-3-like protein-like                282   1e-91    
gb|AGV54291.1|  14-3-3 protein                                          282   1e-91    Phaseolus vulgaris [French bean]
emb|CAB42547.1|  14-3-3-like protein                                    282   1e-91    Pisum sativum [garden pea]
ref|XP_009128290.1|  PREDICTED: 14-3-3-like protein GF14 omega          281   2e-91    Brassica rapa
gb|KHG29578.1|  Uncharacterized protein F383_10830                      281   2e-91    Gossypium arboreum [tree cotton]
ref|XP_006389998.1|  hypothetical protein EUTSA_v10019018mg             281   3e-91    Eutrema salsugineum [saltwater cress]
ref|XP_008387340.1|  PREDICTED: 14-3-3-like protein 16R                 281   3e-91    
gb|ADO95306.1|  14-3-3-like protein GF14 Omega                          281   3e-91    Eutrema salsugineum [saltwater cress]
ref|XP_009375314.1|  PREDICTED: 14-3-3-like protein 16R                 281   3e-91    Pyrus x bretschneideri [bai li]
gb|KJB12306.1|  hypothetical protein B456_002G012500                    281   4e-91    Gossypium raimondii
gb|KJB32075.1|  hypothetical protein B456_005G222600                    281   4e-91    Gossypium raimondii
gb|KHG12828.1|  Uncharacterized protein F383_00373                      281   4e-91    Gossypium arboreum [tree cotton]
ref|NP_001265880.1|  14-3-3-like protein A-like                         280   4e-91    Cicer arietinum [garbanzo]
gb|AEH50082.1|  14-3-3-like protein 2                                   280   5e-91    Gossypium hirsutum [American cotton]
ref|XP_008805904.1|  PREDICTED: 14-3-3 protein 6-like                   280   8e-91    Phoenix dactylifera
gb|KHG29579.1|  Uncharacterized protein F383_10830                      280   1e-90    Gossypium arboreum [tree cotton]
gb|KFK24544.1|  hypothetical protein AALP_AAs41798U000400               279   1e-90    Arabis alpina [alpine rockcress]
ref|XP_006303273.1|  hypothetical protein CARUB_v10010011mg             280   2e-90    Capsella rubella
ref|XP_009106540.1|  PREDICTED: 14-3-3-like protein GF14 omega          279   2e-90    Brassica rapa
ref|XP_008790917.1|  PREDICTED: 14-3-3 protein 6                        279   2e-90    Phoenix dactylifera
emb|CDX88436.1|  BnaC06g38800D                                          278   2e-90    
ref|XP_010455312.1|  PREDICTED: 14-3-3-like protein GF14 chi            279   3e-90    Camelina sativa [gold-of-pleasure]
ref|XP_006397430.1|  hypothetical protein EUTSA_v10001833mg             279   3e-90    Eutrema salsugineum [saltwater cress]
ref|XP_010421819.1|  PREDICTED: 14-3-3-like protein GF14 chi            278   3e-90    Camelina sativa [gold-of-pleasure]
gb|ABY65002.1|  14-3-3c protein                                         278   3e-90    Gossypium hirsutum [American cotton]
ref|NP_564453.1|  14-3-3-like protein GF14 phi                          278   4e-90    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002891161.1|  At1g35160/T32G9_30                                 278   4e-90    Arabidopsis lyrata subsp. lyrata
gb|AAK63949.1|  At1g35160/T32G9_30                                      278   4e-90    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006433941.1|  hypothetical protein CICLE_v10003615mg             283   4e-90    
gb|KJB79630.1|  hypothetical protein B456_013G059800                    278   5e-90    Gossypium raimondii
gb|AGC13184.1|  14-3-3 protein                                          278   6e-90    Spinacia oleracea
emb|CDX87455.1|  BnaA07g34180D                                          278   8e-90    
gb|ACN39847.1|  unknown                                                 277   9e-90    Picea sitchensis
ref|XP_010937379.1|  PREDICTED: 14-3-3-like protein B                   277   9e-90    Elaeis guineensis
gb|AEA03664.1|  14-3-3 protein 3                                        277   9e-90    Hevea brasiliensis [jebe]
sp|P29308.1|1433_SPIOL  RecName: Full=14-3-3-like protein               275   1e-89    Spinacia oleracea
ref|XP_010917299.1|  PREDICTED: 14-3-3-like protein                     277   1e-89    Elaeis guineensis
gb|ABE01401.1|  14-3-3 protein                                          277   1e-89    Camellia sinensis [black tea]
ref|XP_007042905.1|  General regulatory factor 2, OMEGA                 277   1e-89    Theobroma cacao [chocolate]
gb|AAD27827.2|  14-3-3 protein                                          275   4e-89    Picea glauca
ref|NP_567344.1|  14-3-3-like protein GF14 chi                          275   5e-89    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010530165.1|  PREDICTED: 14-3-3-like protein GF14 chi            275   5e-89    Tarenaya hassleriana [spider flower]
gb|KHG12867.1|  Uncharacterized protein F383_16851                      275   6e-89    Gossypium arboreum [tree cotton]
gb|KJB59911.1|  hypothetical protein B456_009G280500                    275   6e-89    Gossypium raimondii
gb|ADK93080.1|  14-3-3g protein                                         275   8e-89    Gossypium hirsutum [American cotton]
ref|XP_009388642.1|  PREDICTED: 14-3-3-like protein                     274   1e-88    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006659421.1|  PREDICTED: 14-3-3-like protein GF14-C-like         274   1e-88    Oryza brachyantha
ref|XP_009380873.1|  PREDICTED: 14-3-3 protein 6-like                   274   1e-88    Musa acuminata subsp. malaccensis [pisang utan]
gb|AGG10561.1|  14-3-3                                                  274   2e-88    Elaeis guineensis
ref|XP_010916166.1|  PREDICTED: 14-3-3-like protein                     274   2e-88    Elaeis guineensis
ref|XP_009408999.1|  PREDICTED: 14-3-3-like protein GF14-C              274   2e-88    Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX73313.1|  BnaC05g27930D                                          274   2e-88    
ref|XP_010436066.1|  PREDICTED: 14-3-3-like protein GF14 chi            273   3e-88    Camelina sativa [gold-of-pleasure]
ref|XP_008778192.1|  PREDICTED: 14-3-3 protein 6-like                   273   3e-88    Phoenix dactylifera
gb|AAA96254.1|  GF14chi isoform                                         273   3e-88    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006288456.1|  hypothetical protein CARUB_v10001717mg             273   4e-88    Capsella rubella
ref|XP_008782168.1|  PREDICTED: 14-3-3 protein 6-like                   273   4e-88    Phoenix dactylifera
dbj|BAF46314.1|  14-3-3 protein                                         273   4e-88    Ipomoea nil [qian niu]
gb|KJB10444.1|  hypothetical protein B456_001G201400                    273   5e-88    Gossypium raimondii
ref|XP_009114721.1|  PREDICTED: 14-3-3-like protein GF14 phi            273   5e-88    Brassica rapa
ref|XP_006650484.1|  PREDICTED: 14-3-3-like protein GF14-F-like         273   6e-88    Oryza brachyantha
ref|XP_009381498.1|  PREDICTED: 14-3-3 protein 6-like                   272   7e-88    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003560774.1|  PREDICTED: 14-3-3-like protein A                   272   7e-88    Brachypodium distachyon [annual false brome]
ref|XP_008775117.1|  PREDICTED: 14-3-3-like protein                     272   8e-88    
gb|AEX00343.1|  14-3-3 protein b                                        272   9e-88    Ipomoea batatas [batate]
ref|XP_010472047.1|  PREDICTED: 14-3-3-like protein GF14 omega          272   9e-88    Camelina sativa [gold-of-pleasure]
ref|XP_011011192.1|  PREDICTED: 14-3-3-like protein A                   272   1e-87    Populus euphratica
gb|AEX00342.1|  14-3-3 protein a                                        272   1e-87    Ipomoea batatas [batate]
ref|NP_001280837.1|  14-3-3-like protein A                              272   1e-87    Malus domestica [apple tree]
ref|XP_006659506.1|  PREDICTED: LOW QUALITY PROTEIN: 14-3-3-like ...    272   1e-87    Oryza brachyantha
ref|XP_008804781.1|  PREDICTED: 14-3-3 protein 6                        272   1e-87    Phoenix dactylifera
gb|ADP00759.1|  14-3-3 protein                                          272   1e-87    Litchi chinensis [litchi]
gb|AHB33318.1|  14-3-3a protein                                         271   1e-87    Pyrus pyrifolia [sha li]
gb|ADD79961.1|  14-3-3 family protein                                   271   1e-87    Dimocarpus longan [longan]
ref|XP_009419276.1|  PREDICTED: 14-3-3-like protein GF14-C              271   2e-87    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009357045.1|  PREDICTED: 14-3-3-like protein A                   271   2e-87    Pyrus x bretschneideri [bai li]
ref|XP_006346922.1|  PREDICTED: 14-3-3 protein 4-like                   271   2e-87    Solanum tuberosum [potatoes]
gb|EYU34391.1|  hypothetical protein MIMGU_mgv1a012246mg                271   2e-87    Erythranthe guttata [common monkey flower]
ref|XP_008362235.1|  PREDICTED: 14-3-3-like protein A                   271   2e-87    
ref|XP_009404035.1|  PREDICTED: 14-3-3 protein 6                        271   2e-87    Musa acuminata subsp. malaccensis [pisang utan]
gb|AEX00344.1|  14-3-3 protein c                                        271   2e-87    Ipomoea batatas [batate]
ref|XP_008230392.1|  PREDICTED: 14-3-3-like protein A                   271   2e-87    Prunus mume [ume]
ref|XP_010416813.1|  PREDICTED: 14-3-3-like protein GF14 omega          271   2e-87    Camelina sativa [gold-of-pleasure]
ref|NP_001051051.1|  Os03g0710800                                       271   2e-87    
gb|ABK21293.1|  unknown                                                 271   2e-87    Picea sitchensis
ref|XP_004234565.1|  PREDICTED: 14-3-3-like protein                     271   2e-87    Solanum lycopersicum
ref|NP_001061856.1|  Os08g0430500                                       271   2e-87    
ref|XP_010553922.1|  PREDICTED: 14-3-3-like protein GF14 psi            271   2e-87    Tarenaya hassleriana [spider flower]
ref|XP_006853053.1|  hypothetical protein AMTR_s00038p00055100          271   3e-87    Amborella trichopoda
gb|EAZ07074.1|  hypothetical protein OsI_29320                          271   3e-87    Oryza sativa Indica Group [Indian rice]
gb|KDP32938.1|  hypothetical protein JCGZ_12969                         271   3e-87    Jatropha curcas
ref|XP_002444843.1|  hypothetical protein SORBIDRAFT_07g029110          270   3e-87    Sorghum bicolor [broomcorn]
ref|XP_004501696.1|  PREDICTED: 14-3-3-like protein-like                271   3e-87    
ref|NP_001234007.1|  14-3-3 protein 4                                   270   3e-87    Solanum lycopersicum
ref|XP_002874496.1|  hypothetical protein ARALYDRAFT_911048             271   4e-87    Arabidopsis lyrata subsp. lyrata
ref|XP_009397483.1|  PREDICTED: 14-3-3-like protein                     270   4e-87    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010939692.1|  PREDICTED: 14-3-3 protein 6-like                   270   4e-87    Elaeis guineensis
ref|XP_011099565.1|  PREDICTED: 14-3-3-like protein                     270   4e-87    Sesamum indicum [beniseed]
ref|XP_004304139.1|  PREDICTED: 14-3-3-like protein A                   270   4e-87    Fragaria vesca subsp. vesca
gb|ACK76233.1|  14-3-3 protein                                          270   5e-87    Dimocarpus longan [longan]
gb|AAP48904.1|  14-3-3-like protein                                     270   6e-87    Saccharum hybrid cultivar CP65-357
ref|XP_004973733.1|  PREDICTED: 14-3-3-like protein GF14-A-like         270   6e-87    Setaria italica
ref|XP_009403466.1|  PREDICTED: 14-3-3-like protein                     270   6e-87    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008781204.1|  PREDICTED: 14-3-3-like protein                     270   6e-87    Phoenix dactylifera
gb|KHG19539.1|  Uncharacterized protein F383_05852                      270   7e-87    Gossypium arboreum [tree cotton]
ref|XP_006405765.1|  hypothetical protein EUTSA_v10027892mg             270   7e-87    Eutrema salsugineum [saltwater cress]
ref|XP_006430798.1|  hypothetical protein CICLE_v10012495mg             270   7e-87    Citrus clementina [clementine]
gb|AEG67284.1|  14-3-3 protein                                          270   7e-87    Pyrus pyrifolia [sha li]
gb|ADO95303.1|  14-3-3-like protein GF14 Psi                            270   7e-87    Eutrema salsugineum [saltwater cress]
ref|NP_001062060.1|  Os08g0480800                                       270   7e-87    
gb|ABY65004.1|  14-3-3e protein                                         270   8e-87    Gossypium hirsutum [American cotton]
ref|XP_010525152.1|  PREDICTED: 14-3-3-like protein                     270   8e-87    Tarenaya hassleriana [spider flower]
gb|KHG05238.1|  Uncharacterized protein F383_30797                      270   8e-87    Gossypium arboreum [tree cotton]
ref|XP_004137196.1|  PREDICTED: 14-3-3-like protein-like                270   9e-87    Cucumis sativus [cucumbers]
gb|AAC04811.1|  GF14 protein                                            269   1e-86    Fritillaria agrestis
ref|XP_011009577.1|  PREDICTED: 14-3-3-like protein isoform X1          270   1e-86    Populus euphratica
ref|XP_010680999.1|  PREDICTED: 14-3-3 protein 2-like isoform X2        269   1e-86    Beta vulgaris subsp. vulgaris [field beet]
gb|KJB64237.1|  hypothetical protein B456_010G038600                    269   1e-86    Gossypium raimondii
gb|AGJ98232.1|  PIB41 14-3-3 protein                                    269   1e-86    Petunia x hybrida [garden petunia]
gb|AIJ04690.1|  14-3-3a                                                 269   1e-86    Morus alba var. atropurpurea
gb|ABD96912.1|  hypothetical protein                                    269   1e-86    Tarenaya spinosa
sp|Q9SP07.1|1433_LILLO  RecName: Full=14-3-3-like protein               269   2e-86    Lilium longiflorum [Easter lily]
gb|KFK42215.1|  hypothetical protein AALP_AA2G226400                    269   2e-86    Arabis alpina [alpine rockcress]
sp|P42652.1|14334_SOLLC  RecName: Full=14-3-3 protein 4; AltName:...    269   2e-86    Solanum lycopersicum
ref|XP_010926139.1|  PREDICTED: 14-3-3-like protein                     268   2e-86    
gb|AAA32799.1|  GF14 psi chain                                          268   2e-86    Arabidopsis thaliana [mouse-ear cress]
ref|NP_568557.1|  14-3-3-like protein GF14 psi                          268   2e-86    Arabidopsis thaliana [mouse-ear cress]
gb|ACH63229.1|  14-3-3 protein                                          268   2e-86    Rheum australe [Himalayan rhubarb]
ref|XP_009800018.1|  PREDICTED: 14-3-3 protein 4-like                   268   3e-86    Nicotiana sylvestris
ref|XP_008801147.1|  PREDICTED: 14-3-3-like protein                     268   3e-86    Phoenix dactylifera
ref|XP_010908756.1|  PREDICTED: 14-3-3-like protein                     268   3e-86    Elaeis guineensis
ref|XP_004968972.1|  PREDICTED: 14-3-3-like protein GF14-C-like i...    268   3e-86    Setaria italica
dbj|BAM20996.1|  14-3-3 protein                                         268   4e-86    Marchantia polymorpha
gb|AFK46913.1|  unknown                                                 268   4e-86    Lotus japonicus
ref|XP_006384210.1|  hypothetical protein POPTR_0004s10120g             267   4e-86    
ref|XP_010528468.1|  PREDICTED: 14-3-3-like protein GF14 psi            268   4e-86    Tarenaya hassleriana [spider flower]
ref|XP_009615235.1|  PREDICTED: 14-3-3 protein 4-like                   268   5e-86    Nicotiana tomentosiformis
gb|AGZ13503.1|  14-3-3 protein                                          268   5e-86    Lilium regale
ref|XP_010558549.1|  PREDICTED: 14-3-3-like protein                     268   5e-86    Tarenaya hassleriana [spider flower]
ref|XP_011021224.1|  PREDICTED: 14-3-3-like protein                     267   6e-86    Populus euphratica
sp|P93259.1|1433_MESCR  RecName: Full=14-3-3-like protein; AltNam...    267   6e-86    Mesembryanthemum crystallinum
gb|EPS59645.1|  14-3-3 protein                                          267   7e-86    Genlisea aurea
pdb|2O98|A  Chain A, Structure Of The 14-3-3  H+-Atpase Plant Com...    266   7e-86    Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_008800764.1|  PREDICTED: 14-3-3-like protein                     267   7e-86    Phoenix dactylifera
ref|XP_008379530.1|  PREDICTED: 14-3-3-like protein A                   267   7e-86    
ref|XP_010265205.1|  PREDICTED: 14-3-3-like protein                     267   8e-86    Nelumbo nucifera [Indian lotus]
ref|XP_010461289.1|  PREDICTED: 14-3-3-like protein GF14 phi            267   8e-86    Camelina sativa [gold-of-pleasure]
gb|ADD92154.1|  14-3-3 protein                                          267   9e-86    Manihot esculenta [manioc]
ref|XP_009380212.1|  PREDICTED: 14-3-3-like protein                     267   1e-85    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002870838.1|  hypothetical protein ARALYDRAFT_494127             266   1e-85    
dbj|BAA03711.1|  brain specific protein                                 266   1e-85    Oryza sativa [red rice]
ref|XP_009387444.1|  PREDICTED: 14-3-3-like protein                     266   1e-85    Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001235653.1|  14-3-3-like protein A                              266   1e-85    Glycine max [soybeans]
gb|KHN24947.1|  14-3-3-like protein A                                   266   1e-85    Glycine soja [wild soybean]
ref|XP_006408411.1|  hypothetical protein EUTSA_v10021346mg             266   1e-85    Eutrema salsugineum [saltwater cress]
ref|XP_009139790.1|  PREDICTED: 14-3-3-like protein GF14 psi            266   2e-85    Brassica rapa
emb|CDY01659.1|  BnaC04g30930D                                          266   2e-85    
emb|CAA44259.1|  14-3-3 protein homologue                               266   2e-85    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009145139.1|  PREDICTED: 14-3-3-like protein GF14 phi            266   2e-85    Brassica rapa
emb|CDX74521.1|  BnaA04g08680D                                          266   2e-85    
gb|AAR89812.1|  14-3-3 protein                                          266   2e-85    Triticum aestivum [Canadian hard winter wheat]
sp|P29305.1|1433A_HORVU  RecName: Full=14-3-3-like protein A; Sho...    266   2e-85    Hordeum vulgare [barley]
ref|XP_009381101.1|  PREDICTED: 14-3-3-like protein                     266   2e-85    
ref|NP_001105677.1|  14-3-3-like protein                                266   2e-85    
ref|XP_010680998.1|  PREDICTED: 14-3-3 protein 2-like isoform X1        266   2e-85    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_001765070.1|  predicted protein                                  265   3e-85    
ref|XP_010501783.1|  PREDICTED: 14-3-3-like protein GF14 phi            266   3e-85    
gb|AAF76226.1|AF272572_1  14-3-3 protein                                265   3e-85    
gb|ADO95304.1|  14-3-3-like protein GF14 Chi                            266   4e-85    
emb|CDY71290.1|  BnaCnng72220D                                          265   5e-85    
ref|XP_004973494.1|  PREDICTED: 14-3-3-like protein GF14-C-like i...    265   5e-85    
gb|AEA03663.1|  14-3-3 protein 2                                        265   5e-85    
gb|AAY67798.1|  14-3-3 protein                                          265   5e-85    
ref|NP_001151592.1|  LOC100285226                                       265   6e-85    
ref|XP_002965976.1|  hypothetical protein SELMODRAFT_439395             265   6e-85    
ref|XP_006397240.1|  hypothetical protein EUTSA_v10028882mg             265   6e-85    
gb|ABO15466.1|  14-3-3 protein Lil 1433-1                               265   6e-85    
ref|NP_001149589.1|  14-3-3-like protein A                              265   6e-85    
ref|XP_010263205.1|  PREDICTED: 14-3-3-like protein                     265   6e-85    
gb|EYU44646.1|  hypothetical protein MIMGU_mgv1a012225mg                265   6e-85    
emb|CDX67405.1|  BnaA07g14450D                                          265   6e-85    
ref|XP_009147332.1|  PREDICTED: 14-3-3-like protein GF14 nu             265   7e-85    
ref|XP_009125075.1|  PREDICTED: 14-3-3-like protein GF14 psi            265   7e-85    
gb|ACN73536.1|  1433-3                                                  265   8e-85    
emb|CAB65693.1|  tft3 14-3-3 protein                                    263   9e-85    
ref|XP_009410139.1|  PREDICTED: 14-3-3-like protein 16R                 264   9e-85    
emb|CDY28698.1|  BnaCnng05840D                                          264   9e-85    
ref|XP_009388227.1|  PREDICTED: 14-3-3-like protein                     264   1e-84    
ref|XP_008664668.1|  PREDICTED: 14-3-3-like protein GF14-C              264   1e-84    
ref|XP_010496601.1|  PREDICTED: 14-3-3-like protein GF14 phi            264   1e-84    
gb|KJB12046.1|  hypothetical protein B456_002G141000                    265   1e-84    
ref|XP_006284363.1|  hypothetical protein CARUB_v10005536mg             263   2e-84    
ref|XP_010440961.1|  PREDICTED: 14-3-3-like protein GF14 psi            263   2e-84    
ref|XP_001765124.1|  predicted protein                                  263   2e-84    
ref|XP_004974053.1|  PREDICTED: 14-3-3-like protein GF14-C-like i...    263   2e-84    
ref|NP_001185138.1|  14-3-3-like protein GF14 phi                       265   3e-84    
dbj|BAD12182.1|  14-3-3 i-1 protein                                     263   3e-84    
emb|CBI33141.3|  unnamed protein product                                260   3e-84    
sp|Q96450.1|1433A_SOYBN  RecName: Full=14-3-3-like protein A; Alt...    263   3e-84    
gb|AGT17033.1|  14-3-3 protein                                          263   3e-84    
ref|XP_010032624.1|  PREDICTED: 14-3-3-like protein A                   263   3e-84    
ref|NP_001275262.1|  14-3-3-like protein                                263   3e-84    
ref|XP_002449656.1|  hypothetical protein SORBIDRAFT_05g021020          263   4e-84    
ref|XP_009617450.1|  PREDICTED: 14-3-3 protein 4                        263   4e-84    
ref|XP_003577480.1|  PREDICTED: 14-3-3-like protein GF14-D              263   4e-84    
ref|XP_010450904.1|  PREDICTED: 14-3-3-like protein GF14 psi            263   4e-84    
dbj|BAB11740.1|  TaWIN2                                                 263   4e-84    
gb|ACU19485.1|  unknown                                                 263   4e-84    
ref|XP_009770957.1|  PREDICTED: 14-3-3 protein 4                        263   4e-84    
gb|KJB10357.1|  hypothetical protein B456_001G197200                    263   4e-84    
ref|XP_007139133.1|  hypothetical protein PHAVU_008G004300g             262   5e-84    
ref|XP_006373446.1|  14-3-3 family protein                              262   6e-84    
ref|XP_004979440.1|  PREDICTED: LOW QUALITY PROTEIN: 14-3-3-like ...    262   6e-84    
gb|AGV54353.1|  14-3-3-like protein A                                   262   6e-84    
pdb|3M50|A  Chain A, Structure Of The 14-3-3/pma2 Complex Stabili...    261   6e-84    
gb|ACG24283.1|  14-3-3-like protein                                     262   7e-84    
gb|AGV54551.1|  14-3-3 family protein                                   262   7e-84    
ref|NP_001236005.1|  14-.3.3 protein                                    261   7e-84    
ref|XP_002283492.1|  PREDICTED: 14-3-3-like protein A                   262   8e-84    
ref|XP_006298337.1|  hypothetical protein CARUB_v10014407mg             262   9e-84    
ref|XP_003574663.1|  PREDICTED: 14-3-3-like protein GF14-A              262   9e-84    
ref|XP_010692757.1|  PREDICTED: 14-3-3-like protein                     262   1e-83    
emb|CAA53700.1|  14-3-3 protein 32kDa endonuclease                      262   1e-83    
ref|NP_001031982.1|  14-3-3-like protein GF14 psi                       261   1e-83    
ref|XP_006662988.1|  PREDICTED: 14-3-3-like protein GF14-D-like         262   1e-83    
ref|NP_001053003.1|  Os04g0462500                                       261   1e-83    
dbj|BAJ91347.1|  predicted protein                                      261   1e-83    
gb|ABC00200.1|  14-3-3D                                                 261   1e-83    
ref|NP_001068067.2|  Os11g0546900                                       261   1e-83    
ref|NP_001047234.1|  Os02g0580300                                       261   1e-83    
ref|XP_006647421.1|  PREDICTED: 14-3-3-like protein GF14-E-like         261   1e-83    
gb|ABR25750.1|  14-3-3-like protein                                     260   1e-83    
gb|AGT16964.1|  14-3-3 protein                                          261   2e-83    
ref|XP_004489124.1|  PREDICTED: 14-3-3-like protein A-like              261   2e-83    
ref|XP_009401429.1|  PREDICTED: 14-3-3-like protein                     261   2e-83    
gb|AIZ68200.1|  14-3-3-like protein                                     262   2e-83    
ref|XP_010435756.1|  PREDICTED: 14-3-3-like protein GF14 psi isof...    261   2e-83    
ref|XP_010463663.1|  PREDICTED: 14-3-3-like protein GF14 nu             261   2e-83    
ref|XP_002446626.1|  hypothetical protein SORBIDRAFT_06g019100          261   2e-83    
ref|XP_004952897.1|  PREDICTED: 14-3-3-like protein GF14-E-like         261   2e-83    
ref|XP_009134679.1|  PREDICTED: 14-3-3-like protein GF14 nu             261   3e-83    
ref|XP_010061867.1|  PREDICTED: 14-3-3-like protein GF14 psi            261   3e-83    
ref|XP_001771385.1|  predicted protein                                  260   3e-83    
ref|XP_008661810.1|  PREDICTED: 14-3-3-like protein GF14-12 isofo...    261   3e-83    
ref|XP_006652359.1|  PREDICTED: 14-3-3-like protein GF14-B-like i...    261   3e-83    
gb|KJB79631.1|  hypothetical protein B456_013G059800                    260   3e-83    
emb|CDX74252.1|  BnaA03g27950D                                          260   3e-83    
ref|NP_566174.1|  14-3-3-like protein GF14 nu                           261   3e-83    
gb|ACF84704.1|  unknown                                                 261   3e-83    
emb|CDX91996.1|  BnaC03g32980D                                          260   5e-83    
ref|NP_001154216.1|  14-3-3-like protein GF14 chi                       262   6e-83    
gb|ABC00201.1|  14-3-3E                                                 260   6e-83    
ref|NP_001105350.2|  14-3-3-like protein GF14-6                         259   6e-83    
ref|XP_010498313.1|  PREDICTED: 14-3-3-like protein GF14 nu             259   8e-83    
gb|ACU23290.1|  unknown                                                 259   9e-83    
ref|XP_003579911.1|  PREDICTED: 14-3-3-like protein GF14-B              259   9e-83    
tpg|DAA37434.1|  TPA: LOW QUALITY PROTEIN: general regulatory fac...    259   1e-82    
gb|ACG24337.1|  14-3-3-like protein                                     259   1e-82    
ref|XP_001771436.1|  predicted protein                                  259   1e-82    
ref|XP_004975868.1|  PREDICTED: 14-3-3-like protein GF14-12-like        259   1e-82    
gb|ABR25888.1|  14-3-3-like protein b                                   255   1e-82    
ref|XP_010435754.1|  PREDICTED: 14-3-3-like protein GF14 psi isof...    260   1e-82    
ref|XP_009110140.1|  PREDICTED: 14-3-3-like protein GF14 omega          258   2e-82    
ref|XP_010485561.1|  PREDICTED: 14-3-3-like protein GF14 nu             258   2e-82    
ref|XP_010420282.1|  PREDICTED: 14-3-3-like protein GF14 upsilon        258   2e-82    
emb|CDY41483.1|  BnaA08g20850D                                          258   2e-82    
ref|XP_008670779.1|  PREDICTED: 14-3-3-like protein                     263   2e-82    
gb|AET81041.1|  14-3-3 protein                                          258   2e-82    
emb|CDP01098.1|  unnamed protein product                                253   2e-82    
emb|CBI19195.3|  unnamed protein product                                254   3e-82    
ref|XP_006400137.1|  hypothetical protein EUTSA_v10014395mg             258   3e-82    
ref|XP_010695853.1|  PREDICTED: 14-3-3-like protein                     258   3e-82    
dbj|BAB11739.1|  TaWIN1                                                 258   3e-82    
ref|XP_010453757.1|  PREDICTED: 14-3-3-like protein GF14 upsilon ...    258   3e-82    
emb|CDX91676.1|  BnaC08g05950D                                          258   4e-82    
ref|NP_001160169.1|  14-3-3-like protein GF14-12                        257   5e-82    
ref|XP_010492477.1|  PREDICTED: 14-3-3-like protein GF14 upsilon        258   5e-82    
sp|Q01526.2|14332_MAIZE  RecName: Full=14-3-3-like protein GF14-12      257   6e-82    
ref|NP_568325.1|  14-3-3-like protein GF14 upsilon                      257   6e-82    
gb|AFW65503.1|  14-3-3-like protein                                     257   7e-82    
gb|KIZ00461.1|  14-3-3-like protein                                     257   8e-82    
ref|NP_001148842.1|  LOC100282460                                       257   8e-82    
ref|NP_001141053.1|  uncharacterized protein LOC100273134               257   8e-82    
gb|EMT12878.1|  14-3-3-like protein GF14-D                              259   1e-81    
ref|XP_002884324.1|  hypothetical protein ARALYDRAFT_477486             256   1e-81    
ref|XP_010473743.1|  PREDICTED: 14-3-3-like protein GF14 omega          252   1e-81    
ref|XP_002960748.1|  hypothetical protein SELMODRAFT_229825             256   1e-81    
ref|XP_006288457.1|  hypothetical protein CARUB_v10001718mg             256   2e-81    
ref|XP_002873753.1|  predicted protein                                  256   2e-81    
ref|XP_002445779.1|  hypothetical protein SORBIDRAFT_07g025680          256   2e-81    
ref|XP_001771622.1|  predicted protein                                  256   2e-81    
gb|ACG37368.1|  14-3-3-like protein GF14-6                              256   3e-81    
gb|AAP80863.1|  14-3-3 protein                                          254   7e-81    
emb|CAE54082.1|  14-3-3 protein                                         251   8e-81    
gb|AEQ53933.1|  14-3-3 protein                                          254   9e-81    
emb|CAA74592.1|  14-3-3 protein                                         254   1e-80    
gb|EMS56849.1|  14-3-3-like protein GF14-B                              254   1e-80    
sp|Q43470.1|1433B_HORVU  RecName: Full=14-3-3-like protein B; Sho...    254   1e-80    
emb|CDM81045.1|  unnamed protein product                                253   2e-80    
gb|AGA84102.1|  14-3-3 protein                                          253   2e-80    
gb|EMT28052.1|  14-3-3-like protein A                                   254   3e-80    
ref|XP_010103809.1|  14-3-3 protein 4                                   266   4e-80    
gb|EAZ43101.1|  hypothetical protein OsJ_27692                          252   6e-80    
ref|XP_007014931.1|  General regulatory factor 7, NU                    252   6e-80    
ref|XP_004973493.1|  PREDICTED: 14-3-3-like protein GF14-C-like i...    253   8e-80    
ref|XP_003575229.1|  PREDICTED: 14-3-3-like protein GF14-E              251   9e-80    
ref|XP_005645700.1|  14-3-3 protein                                     251   1e-79    
pdb|3AXY|C  Chain C, Structure Of Florigen Activation Complex Con...    250   2e-79    
tpg|DAA48307.1|  TPA: putative 14-3-3 protein                           250   3e-79    
gb|KIZ02947.1|  hypothetical protein MNEG_5014                          251   3e-79    
ref|XP_001771620.1|  predicted protein                                  250   3e-79    
ref|NP_001105278.1|  uncharacterized protein LOC542194                  250   3e-79    
gb|ACN28697.1|  unknown                                                 246   3e-79    
ref|XP_010094131.1|  14-3-3-like protein F                              250   4e-79    
pdb|4DX0|A  Chain A, Structure Of The 14-3-3PMA2 COMPLEX STABILIZ...    249   4e-79    
ref|XP_004968971.1|  PREDICTED: 14-3-3-like protein GF14-C-like i...    250   4e-79    
gb|ABA01096.1|  14-3-3-like protein-related protein                     249   6e-79    
ref|XP_001702812.1|  14-3-3 protein                                     249   6e-79    
ref|XP_004974054.1|  PREDICTED: 14-3-3-like protein GF14-C-like i...    249   6e-79    
gb|ACG37387.1|  14-3-3-like protein A                                   248   6e-79    
ref|XP_005846501.1|  hypothetical protein CHLNCDRAFT_31785              249   8e-79    
sp|O49997.1|1433E_TOBAC  RecName: Full=14-3-3-like protein E            249   9e-79    
emb|CDY46646.1|  BnaA07g10500D                                          249   1e-78    
ref|XP_008649843.1|  PREDICTED: 14-3-3-like protein GF14-C              248   2e-78    
emb|CDY00447.1|  BnaC07g13790D                                          248   2e-78    
ref|XP_004974055.1|  PREDICTED: 14-3-3-like protein GF14-C-like i...    246   3e-78    
ref|XP_008671782.1|  PREDICTED: 14-3-3-like protein GF14-A              245   3e-78    
gb|ABR25721.1|  14-3-3-like protein gf14-6                              243   3e-78    
ref|XP_003574509.1|  PREDICTED: 14-3-3-like protein GF14-C              248   3e-78    
emb|CDO97418.1|  unnamed protein product                                243   5e-78    
ref|XP_008648827.1|  PREDICTED: 14-3-3-like protein GF14-C              246   1e-77    
gb|KHN26095.1|  14-3-3-like protein                                     241   1e-77    
ref|XP_007894695.1|  PREDICTED: 14-3-3 protein epsilon isoform X1       246   2e-77    
gb|AAX77224.2|  14-3-3 protein                                          246   2e-77    
ref|NP_001080705.1|  tyrosine 3-monooxygenase/tryptophan 5-monoox...    245   2e-77    
emb|CDX81179.1|  BnaC03g04330D                                          245   3e-77    
gb|ACG30202.1|  14-3-3-like protein                                     245   3e-77    
gb|AIJ04692.1|  14-3-3c                                                 245   3e-77    
emb|CDX78381.1|  BnaA03g02930D                                          245   3e-77    
gb|AAU82115.1|  14-3-3 protein                                          245   3e-77    
dbj|BAJ97576.1|  predicted protein                                      244   4e-77    
gb|KFK25319.1|  hypothetical protein AALP_AA8G097300                    244   5e-77    
ref|NP_001031868.1|  14-3-3-like protein GF14 lambda                    244   6e-77    
ref|XP_006399540.1|  hypothetical protein EUTSA_v10014501mg             244   6e-77    
ref|XP_008354747.1|  PREDICTED: 14-3-3-like protein GF14 kappa is...    244   6e-77    
ref|XP_009131159.1|  PREDICTED: 14-3-3-like protein GF14 lambda         244   7e-77    
gb|AFW75562.1|  hypothetical protein ZEAMMB73_734327                    247   7e-77    
ref|XP_010729409.1|  PREDICTED: 14-3-3 protein epsilon isoform X1       244   7e-77    
ref|NP_569012.2|  14-3-3-like protein GF14 kappa                        244   7e-77    
ref|XP_009103239.1|  PREDICTED: 14-3-3-like protein GF14 omega          244   8e-77    
ref|XP_008276580.1|  PREDICTED: 14-3-3 protein epsilon isoform X2       243   1e-76    
dbj|BAH14572.1|  unnamed protein product                                240   1e-76    
ref|XP_010463102.1|  PREDICTED: 14-3-3-like protein GF14 kappa is...    243   1e-76    
ref|NP_001190276.1|  14-3-3-like protein GF14 lambda                    244   1e-76    
ref|XP_010444528.1|  PREDICTED: 14-3-3-like protein GF14 kappa is...    243   1e-76    
ref|XP_006280991.1|  hypothetical protein CARUB_v10026999mg             243   1e-76    
ref|XP_006641186.1|  PREDICTED: 14-3-3 protein epsilon-like             243   1e-76    
gb|EDL12838.1|  tyrosine 3-monooxygenase/tryptophan 5-monooxygena...    240   1e-76    
ref|XP_007229715.1|  PREDICTED: 14-3-3 protein epsilon-like isofo...    243   1e-76    
ref|XP_009150632.1|  PREDICTED: 14-3-3-like protein GF14 kappa is...    243   1e-76    
ref|XP_010422841.1|  PREDICTED: 14-3-3-like protein GF14 lambda i...    243   1e-76    
ref|XP_007245994.1|  PREDICTED: 14-3-3 protein epsilon-like isofo...    243   1e-76    
ref|XP_007229712.1|  PREDICTED: 14-3-3 protein epsilon-like isofo...    243   1e-76    
gb|EMS61396.1|  14-3-3-like protein A                                   243   2e-76    
ref|XP_010422840.1|  PREDICTED: 14-3-3-like protein GF14 lambda i...    243   2e-76    
ref|XP_010453069.1|  PREDICTED: 14-3-3-like protein GF14 lambda i...    243   2e-76    
ref|XP_006288536.1|  hypothetical protein CARUB_v10001809mg             243   2e-76    
ref|NP_568229.1|  14-3-3-like protein GF14 lambda                       243   2e-76    
ref|XP_009112185.1|  PREDICTED: 14-3-3-like protein GF14 kappa is...    243   2e-76    
ref|XP_010892107.1|  PREDICTED: 14-3-3 protein epsilon isoform X2       243   2e-76    
ref|XP_007229713.1|  PREDICTED: 14-3-3 protein epsilon-like isofo...    243   2e-76    
ref|XP_010862490.1|  PREDICTED: 14-3-3 protein epsilon isoform X1       243   2e-76    
ref|NP_997770.1|  14-3-3 protein epsilon                                243   2e-76    
ref|XP_002873459.1|  hypothetical protein ARALYDRAFT_909000             243   2e-76    
ref|XP_006399541.1|  hypothetical protein EUTSA_v10014501mg             243   2e-76    
ref|XP_009340978.1|  PREDICTED: 14-3-3-like protein GF14 kappa is...    243   2e-76    
ref|XP_007437318.1|  PREDICTED: 14-3-3 protein epsilon-like isofo...    242   2e-76    
ref|NP_851274.1|  14-3-3-like protein GF14 kappa                        243   2e-76    
gb|EDL12840.1|  tyrosine 3-monooxygenase/tryptophan 5-monooxygena...    240   2e-76    
ref|XP_006280992.1|  hypothetical protein CARUB_v10026999mg             242   2e-76    
ref|XP_002866671.1|  hypothetical protein ARALYDRAFT_496774             242   2e-76    
ref|XP_005975824.1|  PREDICTED: 14-3-3 protein epsilon                  242   3e-76    
gb|AFK34541.1|  unknown                                                 242   3e-76    
gb|EDM05238.1|  tyrosine 3-monooxygenase/tryptophan 5-monooxygena...    240   3e-76    
ref|XP_006394034.1|  hypothetical protein EUTSA_v10004688mg             244   3e-76    
ref|XP_010453070.1|  PREDICTED: 14-3-3-like protein GF14 lambda i...    242   3e-76    
ref|XP_010463095.1|  PREDICTED: 14-3-3-like protein GF14 kappa is...    242   4e-76    



>ref|XP_009623182.1| PREDICTED: 14-3-3-like protein 16R [Nicotiana tomentosiformis]
 ref|XP_009773768.1| PREDICTED: 14-3-3-like protein 16R [Nicotiana sylvestris]
 dbj|BAD10939.1| 14-3-3 protein [Nicotiana tabacum]
 dbj|BAD12180.1| 14-3-3 h-1 protein [Nicotiana tabacum]
 dbj|BAD12181.1| 14-3-3 h-2 protein [Nicotiana tabacum]
Length=258

 Score =   308 bits (789),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 148/155 (95%), Positives = 152/155 (98%), Gaps = 0/155 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            NGILKLLDSKLIGAA +G+SKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQ+
Sbjct  102  NGILKLLDSKLIGAAATGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQD  161

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  162  IANTELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  221

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  220
            TLIMQLLRDNLTLWTSDMQDDG DEIKEA+KPDNE
Sbjct  222  TLIMQLLRDNLTLWTSDMQDDGTDEIKEAAKPDNE  256



>gb|AGJ98234.1| PIB67 14-3-3 protein [Petunia x hybrida]
Length=256

 Score =   307 bits (787),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 147/155 (95%), Positives = 152/155 (98%), Gaps = 0/155 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            NGILKLLDSKLIG+A +G+SKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQ+
Sbjct  102  NGILKLLDSKLIGSAATGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQD  161

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  162  IANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  221

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  220
            TLIMQLLRDNLTLWTSDMQDDG DEIKEA+KPDNE
Sbjct  222  TLIMQLLRDNLTLWTSDMQDDGTDEIKEAAKPDNE  256



>emb|CAC84142.3| 14-3-3 protein [Nicotiana tabacum]
Length=258

 Score =   306 bits (783),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 147/155 (95%), Positives = 151/155 (97%), Gaps = 0/155 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            NGILKLLDSKLIGAA +G+SKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQ+
Sbjct  102  NGILKLLDSKLIGAAATGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQD  161

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN ELAPTHPIRLGLALNFSVFYYEILNS DRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  162  IANTELAPTHPIRLGLALNFSVFYYEILNSSDRACNLAKQAFDEAIAELDTLGEESYKDS  221

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  220
            TLIMQLLRDNLTLWTSDMQDDG DEIKEA+KPDNE
Sbjct  222  TLIMQLLRDNLTLWTSDMQDDGTDEIKEAAKPDNE  256



>emb|CDP01506.1| unnamed protein product [Coffea canephora]
Length=256

 Score =   304 bits (778),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 145/155 (94%), Positives = 152/155 (98%), Gaps = 0/155 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLDSKLIG+A +G+SKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYK+AQ+
Sbjct  102  DGILKLLDSKLIGSAATGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKAAQD  161

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  162  IANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  221

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  220
            TLIMQLLRDNLTLWTSDMQDDG +EIKEASKPDNE
Sbjct  222  TLIMQLLRDNLTLWTSDMQDDGTEEIKEASKPDNE  256



>ref|XP_009589383.1| PREDICTED: 14-3-3-like protein F [Nicotiana tomentosiformis]
Length=258

 Score =   303 bits (777),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 144/155 (93%), Positives = 151/155 (97%), Gaps = 0/155 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            NGILKLLDS LIGAA++G+SKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE
Sbjct  102  NGILKLLDSNLIGAASTGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  161

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  162  IANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  221

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  220
            TLIMQLLRDNLTLWTSDMQD+G +E+KE +KPDNE
Sbjct  222  TLIMQLLRDNLTLWTSDMQDEGTEEMKEVAKPDNE  256



>dbj|BAD12178.1| 14-3-3 f-1 protein [Nicotiana tabacum]
Length=258

 Score =   303 bits (776),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 144/155 (93%), Positives = 151/155 (97%), Gaps = 0/155 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            NGILKLLDS LIGAA++G+SKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE
Sbjct  102  NGILKLLDSNLIGAASTGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  161

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  162  IANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  221

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  220
            TLIMQLLRDNLTLWTSDMQD+G +E+KE +KPDNE
Sbjct  222  TLIMQLLRDNLTLWTSDMQDEGTEEMKEVAKPDNE  256



>gb|AAR98782.1| 14-3-3 protein isoform 20R [Solanum tuberosum]
Length=255

 Score =   303 bits (775),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 146/155 (94%), Positives = 151/155 (97%), Gaps = 0/155 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            NGILKLLDSKLIG+A +G+SKVFYLKMKGDY+RYLAEFKTG ERKEAAENTLSAYKSAQ+
Sbjct  101  NGILKLLDSKLIGSAATGDSKVFYLKMKGDYYRYLAEFKTGTERKEAAENTLSAYKSAQD  160

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  161  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  220

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  220
            TLIMQLLRDNLTLWTSDMQDDGADEIKE SK DNE
Sbjct  221  TLIMQLLRDNLTLWTSDMQDDGADEIKEPSKADNE  255



>gb|AAS78777.1| 14-3-3 protein [Solanum chacoense]
Length=255

 Score =   301 bits (771),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 145/155 (94%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            NGILKLLDSKLIG+A +G+SKVFYLKMKGDY+RYLAEFKTG ERKEAAENTLSAYKSAQ+
Sbjct  101  NGILKLLDSKLIGSAATGDSKVFYLKMKGDYYRYLAEFKTGTERKEAAENTLSAYKSAQD  160

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  161  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  220

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  220
            TLIMQLLRDNLTLWTSDMQDDG DEIKE SK DNE
Sbjct  221  TLIMQLLRDNLTLWTSDMQDDGTDEIKEPSKADNE  255



>sp|P93210.1|14335_SOLLC RecName: Full=14-3-3 protein 5 [Solanum lycopersicum]
 emb|CAA65148.1| 14-3-3 protein [Solanum lycopersicum]
Length=255

 Score =   301 bits (771),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 145/155 (94%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            NGILKLLDSKLIG+A +G+SKVFYLKMKGDY+RYLAEFKTG ERKEAAENTLSAYKSAQ+
Sbjct  101  NGILKLLDSKLIGSAATGDSKVFYLKMKGDYYRYLAEFKTGTERKEAAENTLSAYKSAQD  160

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  161  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  220

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  220
            TLIMQLLRDNLTLWTSDMQDDG DEIKE SK DNE
Sbjct  221  TLIMQLLRDNLTLWTSDMQDDGTDEIKEPSKADNE  255



>gb|EPS60562.1| 14-3-3 h-1 protein [Genlisea aurea]
Length=255

 Score =   301 bits (770),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 144/155 (93%), Positives = 151/155 (97%), Gaps = 0/155 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLDSKLIG+A+SG+SKVFYLKMKGDYHRYLAEFK GAERKEAAENTLSAYKSAQ+
Sbjct  101  DGILKLLDSKLIGSASSGDSKVFYLKMKGDYHRYLAEFKVGAERKEAAENTLSAYKSAQD  160

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  161  IANSELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  220

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  220
            TLIMQLLRDNLTLWTSDMQDD ++EIKEA KPDNE
Sbjct  221  TLIMQLLRDNLTLWTSDMQDDNSEEIKEAPKPDNE  255



>sp|Q43643.1|14332_SOLTU RecName: Full=14-3-3-like protein RA215 [Solanum tuberosum]
 emb|CAA60800.1| 14-3-3 protein [Solanum tuberosum]
Length=254

 Score =   301 bits (770),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 144/155 (93%), Positives = 151/155 (97%), Gaps = 0/155 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            NGILKLLDSKLIG+A +G+SKVFYLKMKGDY+RYLAEFKTG ERKEAAENTLSAYKSAQ+
Sbjct  100  NGILKLLDSKLIGSAATGDSKVFYLKMKGDYYRYLAEFKTGTERKEAAENTLSAYKSAQD  159

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIA++DTLGEESYKDS
Sbjct  160  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIADVDTLGEESYKDS  219

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  220
            TLIMQLLRDNLTLWTSDMQDDGADEIKE SK DNE
Sbjct  220  TLIMQLLRDNLTLWTSDMQDDGADEIKEPSKADNE  254



>ref|XP_011097537.1| PREDICTED: 14-3-3-like protein 16R [Sesamum indicum]
Length=255

 Score =   300 bits (769),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 143/155 (92%), Positives = 152/155 (98%), Gaps = 0/155 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLD+KLIG+A++G+SKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQ+
Sbjct  101  DGILKLLDTKLIGSASNGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQD  160

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  161  IANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  220

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  220
            TLIMQLLRDNLTLWTSDMQDD ++EIKEA KPDNE
Sbjct  221  TLIMQLLRDNLTLWTSDMQDDNSEEIKEAPKPDNE  255



>ref|NP_001234107.1| 14-3-3 family protein [Solanum lycopersicum]
 gb|AAL04426.1| 14-3-3 family protein [Solanum lycopersicum]
Length=256

 Score =   300 bits (768),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 145/155 (94%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            NGILKLLDSKLIG+A +G+SKVFYLKMKGDY+RYLAEFKTG ERKEAAENTLSAYKSAQ+
Sbjct  102  NGILKLLDSKLIGSAATGDSKVFYLKMKGDYYRYLAEFKTGTERKEAAENTLSAYKSAQD  161

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  162  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  221

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  220
            TLIMQLLRDNLTLWTSDMQDDG DEIKE SK DNE
Sbjct  222  TLIMQLLRDNLTLWTSDMQDDGTDEIKEPSKADNE  256



>ref|NP_001275062.1| 14-3-3-like protein 16R [Solanum tuberosum]
 sp|P93784.1|14335_SOLTU RecName: Full=14-3-3-like protein 16R [Solanum tuberosum]
 emb|CAA72381.1| 14-3-3 protein [Solanum tuberosum]
 gb|AAL50217.1| 14-3-3 protein isoform 16R [Solanum tuberosum]
Length=258

 Score =   300 bits (767),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 145/155 (94%), Positives = 151/155 (97%), Gaps = 1/155 (1%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            NGILKLLDSKLIG+A +G+SKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYK+AQ+
Sbjct  102  NGILKLLDSKLIGSAATGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKAAQD  161

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  162  IANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  221

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEAS-KPDN  223
            TLIMQLLRDNLTLWTSDMQDDG DEIKEA+ KPDN
Sbjct  222  TLIMQLLRDNLTLWTSDMQDDGTDEIKEAAPKPDN  256



>ref|NP_001274876.1| 14-3-3-like protein RA215 [Solanum tuberosum]
 gb|ABC01910.1| 14-3-3 protein-like protein [Solanum tuberosum]
Length=255

 Score =   300 bits (767),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 144/155 (93%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            NGILKLLDSKLIG+A +G+SKVFYLKMKGDY+RYLAEFKTG ERKEAAENTLSAYKSAQ+
Sbjct  101  NGILKLLDSKLIGSAATGDSKVFYLKMKGDYYRYLAEFKTGTERKEAAENTLSAYKSAQD  160

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  161  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  220

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  220
            TLIMQLLRDNLTLWTSDMQDDG D+IKE SK DNE
Sbjct  221  TLIMQLLRDNLTLWTSDMQDDGTDDIKEPSKADNE  255



>ref|XP_006472571.1| PREDICTED: 14-3-3-like protein-like [Citrus sinensis]
Length=265

 Score =   298 bits (764),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 141/155 (91%), Positives = 153/155 (99%), Gaps = 0/155 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLDS+LI +A+SG+SKVFYLKMKGDYHRYLAEFKTGAERKEAAE+TL+AYK+AQ+
Sbjct  109  DGILKLLDSRLIPSASSGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLTAYKAAQD  168

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  169  IANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  228

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  220
            TLIMQLLRDNLTLWTSDMQDDGADEIKEA+KP++E
Sbjct  229  TLIMQLLRDNLTLWTSDMQDDGADEIKEAAKPESE  263



>ref|NP_001234097.1| 14-3-3 protein 6 [Solanum lycopersicum]
 sp|P93211.2|14336_SOLLC RecName: Full=14-3-3 protein 6 [Solanum lycopersicum]
 gb|AAL04424.1| 14-3-3 family protein [Solanum lycopersicum]
 emb|CAA65149.2| 14-3-3 protein [Solanum lycopersicum]
Length=258

 Score =   298 bits (763),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 144/155 (93%), Positives = 151/155 (97%), Gaps = 1/155 (1%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            NGILKLLDSKLIG+A +G+SKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYK+AQ+
Sbjct  102  NGILKLLDSKLIGSAATGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKAAQD  161

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  162  IANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  221

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEAS-KPDN  223
            TLIMQLLRDNLTLWTSDMQDDG DEIKEA+ KPD+
Sbjct  222  TLIMQLLRDNLTLWTSDMQDDGTDEIKEATPKPDD  256



>gb|EYU34581.1| hypothetical protein MIMGU_mgv1a012286mg [Erythranthe guttata]
Length=255

 Score =   298 bits (763),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 142/155 (92%), Positives = 151/155 (97%), Gaps = 0/155 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLDSKLIG+A  G+SKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYK+AQ+
Sbjct  101  DGILKLLDSKLIGSAAGGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKAAQD  160

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN +LAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  161  IANADLAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  220

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  220
            TLIMQLLRDNLTLWTSDMQDD ++EIKEA+KPDNE
Sbjct  221  TLIMQLLRDNLTLWTSDMQDDNSEEIKEAAKPDNE  255



>gb|ABA81882.1| 14-3-3 protein-like [Solanum tuberosum]
Length=255

 Score =   298 bits (762),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 143/155 (92%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            NGILKLLDSKLIG+A +G+SKVFYLKMKGDY+RYLAEFKTG ERKEAAENTLSAYKSAQ+
Sbjct  101  NGILKLLDSKLIGSAATGDSKVFYLKMKGDYYRYLAEFKTGTERKEAAENTLSAYKSAQD  160

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  161  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  220

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  220
            TLIMQLLRDNLTLWTS+MQDDG D+IKE SK DNE
Sbjct  221  TLIMQLLRDNLTLWTSNMQDDGTDDIKEPSKADNE  255



>gb|KDO81026.1| hypothetical protein CISIN_1g024620mg [Citrus sinensis]
Length=265

 Score =   298 bits (762),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 141/155 (91%), Positives = 152/155 (98%), Gaps = 0/155 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLDS+LI  A+SG+SKVFYLKMKGDYHRYLAEFKTGAERKEAAE+TL+AYK+AQ+
Sbjct  109  DGILKLLDSRLIPCASSGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLTAYKAAQD  168

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  169  IANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  228

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  220
            TLIMQLLRDNLTLWTSDMQDDGADEIKEA+KP++E
Sbjct  229  TLIMQLLRDNLTLWTSDMQDDGADEIKEAAKPESE  263



>ref|XP_009799312.1| PREDICTED: 14-3-3-like protein F [Nicotiana sylvestris]
 sp|O49998.1|1433F_TOBAC RecName: Full=14-3-3-like protein F [Nicotiana tabacum]
 gb|AAC49895.1| 14-3-3 isoform f [Nicotiana tabacum]
 dbj|BAD10941.1| 14-3-3 protein [Nicotiana tabacum]
Length=258

 Score =   297 bits (761),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 141/155 (91%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            NGILKLLDS LI AA++G+SKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLS+YKSAQ+
Sbjct  102  NGILKLLDSNLIRAASTGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSSYKSAQD  161

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  162  IANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  221

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  220
            TLIMQLLRDNLTLWTSDMQD+G +E+KE +KPDNE
Sbjct  222  TLIMQLLRDNLTLWTSDMQDEGTEEMKEVAKPDNE  256



>gb|KDP41413.1| hypothetical protein JCGZ_15820 [Jatropha curcas]
Length=260

 Score =   297 bits (761),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 141/155 (91%), Positives = 151/155 (97%), Gaps = 0/155 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLD++LI +A+SG+SKVFYLKMKGDYHRYLAEFKTGAERKEAAE+TL+AYKSAQ+
Sbjct  104  DGILKLLDTRLIPSASSGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLTAYKSAQD  163

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  164  IANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  223

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  220
            TLIMQLLRDNLTLWTSDMQDDGADEIKEA+KP  E
Sbjct  224  TLIMQLLRDNLTLWTSDMQDDGADEIKEAAKPTEE  258



>ref|XP_009786458.1| PREDICTED: 14-3-3-like protein A [Nicotiana sylvestris]
Length=255

 Score =   297 bits (760),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 143/155 (92%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            NGILKLLDSKLIG A +G+SKVFYLKMKGDY+RYLAEFKTGAERKEAAENTLSAYKSAQ+
Sbjct  100  NGILKLLDSKLIGTAATGDSKVFYLKMKGDYYRYLAEFKTGAERKEAAENTLSAYKSAQD  159

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  160  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  219

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  220
            TLIMQLLRDNLTLWTSDMQDDG DEIKE SK + +
Sbjct  220  TLIMQLLRDNLTLWTSDMQDDGTDEIKEPSKAEEQ  254



>gb|EPS73301.1| 14-3-3 h-1 protein [Genlisea aurea]
Length=255

 Score =   296 bits (757),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 142/155 (92%), Positives = 151/155 (97%), Gaps = 0/155 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLDSKLI +A++G+SKVFYLKMKGDYHRYLAEFK GAERKEAAE+TLSAYKSAQ+
Sbjct  101  DGILKLLDSKLIVSASNGDSKVFYLKMKGDYHRYLAEFKIGAERKEAAESTLSAYKSAQD  160

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  161  IANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  220

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  220
            TLIMQLLRDNLTLWTSDMQDD +DEIKEASKP+NE
Sbjct  221  TLIMQLLRDNLTLWTSDMQDDNSDEIKEASKPENE  255



>ref|XP_010098629.1| 14-3-3-like protein [Morus notabilis]
 gb|EXB75368.1| 14-3-3-like protein [Morus notabilis]
Length=257

 Score =   296 bits (757),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 140/155 (90%), Positives = 152/155 (98%), Gaps = 0/155 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLD++LI +ATSG+SKVFYLKMKGDYHRYLAEFKTG+ERKEAAE+TL+AYK+AQ+
Sbjct  101  DGILKLLDTRLIPSATSGDSKVFYLKMKGDYHRYLAEFKTGSERKEAAESTLAAYKAAQD  160

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN ELAPTHPIRLGLALNFSVFYYEILNSPDRAC+LAKQAFDEAIAELDTLGEESYKDS
Sbjct  161  IANAELAPTHPIRLGLALNFSVFYYEILNSPDRACSLAKQAFDEAIAELDTLGEESYKDS  220

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  220
            TLIMQLLRDNLTLWTSDMQDDGADEIKEASKP +E
Sbjct  221  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPSDE  255



>gb|EYU30984.1| hypothetical protein MIMGU_mgv1a012292mg [Erythranthe guttata]
Length=255

 Score =   295 bits (756),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 141/155 (91%), Positives = 152/155 (98%), Gaps = 0/155 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLD+KLIG+A++G+SKVFYLKMKGDY+RYLAEFKTGAERK+AAENTLSAYKSAQ+
Sbjct  101  DGILKLLDTKLIGSASTGDSKVFYLKMKGDYYRYLAEFKTGAERKDAAENTLSAYKSAQD  160

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  161  IANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  220

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  220
            TLIMQLLRDNLTLWTSDMQDD ++EIKEA KPDNE
Sbjct  221  TLIMQLLRDNLTLWTSDMQDDMSEEIKEAPKPDNE  255



>gb|AIJ04691.1| 14-3-3b [Morus alba var. atropurpurea]
Length=257

 Score =   295 bits (754),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 139/155 (90%), Positives = 152/155 (98%), Gaps = 0/155 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLD++LI +A+SG+SKVFYLKMKGDYHRYLAEFKTG+ERKEAAE+TL+AYK+AQ+
Sbjct  101  DGILKLLDTRLIPSASSGDSKVFYLKMKGDYHRYLAEFKTGSERKEAAESTLAAYKAAQD  160

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN ELAPTHPIRLGLALNFSVFYYEILNSPDRAC+LAKQAFDEAIAELDTLGEESYKDS
Sbjct  161  IANAELAPTHPIRLGLALNFSVFYYEILNSPDRACSLAKQAFDEAIAELDTLGEESYKDS  220

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  220
            TLIMQLLRDNLTLWTSDMQDDGADEIKEASKP +E
Sbjct  221  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPSDE  255



>ref|XP_004299669.1| PREDICTED: 14-3-3-like protein [Fragaria vesca subsp. vesca]
Length=260

 Score =   295 bits (754),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 142/158 (90%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLDS+LI +A SG+SKVFYLKMKGDYHRYLAEFKTGAERKEAAE+TL+AYK+AQ+
Sbjct  103  DGILKLLDSRLIPSACSGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLTAYKAAQD  162

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  163  IANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  222

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE*SQ  211
            TLIMQLLRDNLTLWTSDMQDDGADEIKEA KP  E  Q
Sbjct  223  TLIMQLLRDNLTLWTSDMQDDGADEIKEAPKPAEEAKQ  260



>ref|XP_009609727.1| PREDICTED: 14-3-3-like protein A [Nicotiana tomentosiformis]
 ref|XP_009622063.1| PREDICTED: 14-3-3-like protein A [Nicotiana tomentosiformis]
 dbj|BAD12168.1| 14-3-3 a-1 protein [Nicotiana tabacum]
Length=255

 Score =   294 bits (752),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 142/155 (92%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            NGILKLLDSKLIG A +G+SKVFYLKMKGDY+RYLAEFKTGAERKEAAENTLSAYKSAQ+
Sbjct  100  NGILKLLDSKLIGTAATGDSKVFYLKMKGDYYRYLAEFKTGAERKEAAENTLSAYKSAQD  159

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  160  IANVELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  219

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  220
            TLIMQLLRDNLTLWTSDMQDDG DEIKE SK + +
Sbjct  220  TLIMQLLRDNLTLWTSDMQDDGTDEIKEPSKAEEQ  254



>ref|NP_001267852.1| 14-3-3 protein [Vitis vinifera]
 gb|ACO40495.1| 14-3-3 protein [Vitis vinifera]
Length=260

 Score =   294 bits (752),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 141/155 (91%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLDS+LI +A+SG+SKVFYLKMKGDYHRYLAEFKTGAERKEAAE+TL+AYKSAQ+
Sbjct  104  DGILKLLDSRLIPSASSGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLTAYKSAQD  163

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  164  IANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  223

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  220
            TLIMQLLRDN TLWTSDMQDDGADEIKEA K D+E
Sbjct  224  TLIMQLLRDNHTLWTSDMQDDGADEIKEAPKRDDE  258



>gb|ACQ45021.1| 14-3-3 [Cicer arietinum]
Length=261

 Score =   293 bits (751),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 143/154 (93%), Positives = 150/154 (97%), Gaps = 1/154 (1%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLDS+LI +A+SG+SKVFYLKMKGDYHRYLAEFKTGAERKEAAE+TLSAYKSAQ+
Sbjct  104  DGILKLLDSRLIPSASSGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLSAYKSAQD  163

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN EL PTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  164  IANAELPPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  223

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEA-SKPD  226
            TLIMQLLRDNLTLWTSDMQDDGADEIKEA SKPD
Sbjct  224  TLIMQLLRDNLTLWTSDMQDDGADEIKEAPSKPD  257



>gb|ACD69679.1| 14-3-3, partial [Mangifera indica]
Length=261

 Score =   293 bits (751),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 140/155 (90%), Positives = 151/155 (97%), Gaps = 0/155 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKL DS+LI +A+SG+SKVFYLKMKGDYHRYLAEFKTGAERKEAAE+TL+AYKSAQ+
Sbjct  105  DGILKLPDSRLIPSASSGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLTAYKSAQD  164

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  165  IANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  224

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  220
            TLIMQLLRDNLTLWTSD+ DDGADEIKEA+KPD+E
Sbjct  225  TLIMQLLRDNLTLWTSDIPDDGADEIKEATKPDSE  259



>ref|NP_001275217.1| 14-3-3 protein 2-like [Solanum tuberosum]
 emb|CAA72382.1| 14-3-3 protein [Solanum tuberosum]
 dbj|BAM28646.1| putative 14-3-3 protein, partial [Solanum tuberosum]
Length=254

 Score =   293 bits (749),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 142/155 (92%), Positives = 151/155 (97%), Gaps = 1/155 (1%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLDS LI +A++G+SKVFYLKMKGDYHRYLAEFKTGAERKEAAE+TLSAYK+AQ+
Sbjct  99   DGILKLLDSNLIPSASNGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLSAYKAAQD  158

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  159  IANTELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  218

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  220
            TLIMQLLRDNLTLWTSDMQDDGADEIKE +KPDNE
Sbjct  219  TLIMQLLRDNLTLWTSDMQDDGADEIKE-TKPDNE  252



>gb|KJB58994.1| hypothetical protein B456_009G234600 [Gossypium raimondii]
 gb|KJB58995.1| hypothetical protein B456_009G234600 [Gossypium raimondii]
 gb|KJB58996.1| hypothetical protein B456_009G234600 [Gossypium raimondii]
Length=268

 Score =   293 bits (750),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 139/153 (91%), Positives = 149/153 (97%), Gaps = 0/153 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            NGILKLLD++L+ +A+SG+SKVFYLKMKGDYHRYLAEFKTGAERKEAAE+TL+AYKSAQ+
Sbjct  106  NGILKLLDTRLVPSASSGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLTAYKSAQD  165

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  166  IANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  225

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPD  226
            TLIMQLLRDNLTLWTSDMQDDGAD+IKEA K D
Sbjct  226  TLIMQLLRDNLTLWTSDMQDDGADDIKEAPKRD  258



>gb|ABY65001.1| 14-3-3b protein [Gossypium hirsutum]
Length=268

 Score =   293 bits (750),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 139/153 (91%), Positives = 149/153 (97%), Gaps = 0/153 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            NGILKLLD++L+ +A+SG+SKVFYLKMKGDYHRYLAEFKTGAERKEAAE+TL+AYKSAQ+
Sbjct  106  NGILKLLDTRLVPSASSGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLTAYKSAQD  165

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  166  IANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  225

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPD  226
            TLIMQLLRDNLTLWTSDMQDDGAD+IKEA K D
Sbjct  226  TLIMQLLRDNLTLWTSDMQDDGADDIKEAPKRD  258



>gb|KHG20751.1| Uncharacterized protein F383_04220 [Gossypium arboreum]
Length=269

 Score =   293 bits (750),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 139/153 (91%), Positives = 149/153 (97%), Gaps = 0/153 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            NGILKLLD++L+ +A+SG+SKVFYLKMKGDYHRYLAEFKTGAERKEAAE+TL+AYKSAQ+
Sbjct  106  NGILKLLDTRLVPSASSGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLTAYKSAQD  165

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  166  IANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  225

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPD  226
            TLIMQLLRDNLTLWTSDMQDDGAD+IKEA K D
Sbjct  226  TLIMQLLRDNLTLWTSDMQDDGADDIKEAPKRD  258



>gb|EYU36484.1| hypothetical protein MIMGU_mgv1a011964mg [Erythranthe guttata]
Length=265

 Score =   293 bits (749),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 139/153 (91%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLD++LI AA++G+SKVFYLKMKGDYHRYLAEFKTGAERKEAAE+TL+AYK+AQ+
Sbjct  106  DGILKLLDTRLIPAASAGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLTAYKAAQD  165

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  166  IANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  225

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPD  226
            TLIMQLLRDNLTLWTSDMQDDGADEIKEA+KP+
Sbjct  226  TLIMQLLRDNLTLWTSDMQDDGADEIKEAAKPE  258



>gb|AIU34467.1| putative 14-3-3 protein, partial [Taraxacum brevicorniculatum]
Length=258

 Score =   292 bits (748),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 140/153 (92%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLDSKLIG+A+SG+SKVFYLKMKGDY+RYLAEFKTG+ERKEAAENTLSAYK+AQ+
Sbjct  105  DGILKLLDSKLIGSASSGDSKVFYLKMKGDYYRYLAEFKTGSERKEAAENTLSAYKAAQD  164

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGE+SYKDS
Sbjct  165  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEDSYKDS  224

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPD  226
            TLIMQLLRDNLTLWTSDMQDD A+EIKEA K D
Sbjct  225  TLIMQLLRDNLTLWTSDMQDDSAEEIKEAPKAD  257



>ref|NP_001275270.1| 14-3-3-like protein C-like [Solanum tuberosum]
 emb|CAA72383.1| 14-3-3 protein [Solanum tuberosum]
Length=259

 Score =   292 bits (748),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 140/153 (92%), Positives = 149/153 (97%), Gaps = 0/153 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLDSKLI +ATSG+SKVFYLKMKGDYHRYLAEFKTGAERKEAAE+TL+AYK+AQ+
Sbjct  104  DGILKLLDSKLIPSATSGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLTAYKAAQD  163

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IA+ ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  164  IASAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  223

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPD  226
            TLIMQLLRDNLTLWTSDMQDDGADEIKE  KP+
Sbjct  224  TLIMQLLRDNLTLWTSDMQDDGADEIKEDPKPE  256



>ref|XP_010676024.1| PREDICTED: 14-3-3-like protein [Beta vulgaris subsp. vulgaris]
Length=261

 Score =   292 bits (748),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 139/151 (92%), Positives = 148/151 (98%), Gaps = 0/151 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLD+KLI AA++G+SKVFYLKMKGDYHRYLAEFKTG ERKEAAE+TL+AYK AQ+
Sbjct  103  DGILKLLDTKLIPAASAGDSKVFYLKMKGDYHRYLAEFKTGTERKEAAESTLTAYKGAQD  162

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  163  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  222

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASK  232
            TLIMQLLRDNLTLWTSDMQDDGADEIKEA+K
Sbjct  223  TLIMQLLRDNLTLWTSDMQDDGADEIKEAAK  253



>sp|P93209.1|14333_SOLLC RecName: Full=14-3-3 protein 3; AltName: Full=PBLT3 [Solanum 
lycopersicum]
 emb|CAA65147.1| 14-3-3 protein [Solanum lycopersicum]
Length=260

 Score =   292 bits (748),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 140/153 (92%), Positives = 149/153 (97%), Gaps = 0/153 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLDSKLI +ATSG+SKVFYLKMKGDYHRYLAEFKTGAERKEAAE+TL+AYK+AQ+
Sbjct  105  DGILKLLDSKLIPSATSGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLTAYKAAQD  164

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IA+ ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  165  IASAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  224

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPD  226
            TLIMQLLRDNLTLWTSDMQDDGADEIKE  KP+
Sbjct  225  TLIMQLLRDNLTLWTSDMQDDGADEIKEDPKPE  257



>ref|XP_003526571.1| PREDICTED: 14-3-3-like protein-like [Glycine max]
Length=259

 Score =   292 bits (747),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 141/156 (90%), Positives = 152/156 (97%), Gaps = 1/156 (1%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLDS+LI +A+SG+SKVFYLKMKGDYHRYLAEFKTGAERKEAAE+TLSAYK+AQ+
Sbjct  104  DGILKLLDSRLIPSASSGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLSAYKAAQD  163

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN EL PTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  164  IANAELPPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  223

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEAS-KPDNE  220
            TLIMQLLRDNLTLWTSDMQDDGADEIKEA+ KPD++
Sbjct  224  TLIMQLLRDNLTLWTSDMQDDGADEIKEAAPKPDDQ  259



>gb|AAT35546.1| 14-3-3 protein [Tropaeolum majus]
Length=259

 Score =   291 bits (746),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 138/152 (91%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLD++LI +A+SG+SKVFYLKMKGDYHRYLAEFKTGAERKEAAE+TL+AYK+AQ+
Sbjct  101  DGILKLLDTRLIPSASSGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLTAYKAAQD  160

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  161  IANSELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  220

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKP  229
            TLIMQLLRDNLTLWTSDMQDDGADEIKEA+ P
Sbjct  221  TLIMQLLRDNLTLWTSDMQDDGADEIKEAAAP  252



>ref|XP_002262802.1| PREDICTED: 14-3-3-like protein [Vitis vinifera]
 emb|CAN64479.1| hypothetical protein VITISV_032972 [Vitis vinifera]
Length=255

 Score =   291 bits (744),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 140/155 (90%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GIL+LLDS+LI +ATSG+SKVFYLKMKGDYHRYLAEFKTGAERKEAAE+TL+AYKSAQ+
Sbjct  101  DGILRLLDSRLIPSATSGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLAAYKSAQD  160

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IA  ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  161  IATVELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  220

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  220
            TLIMQLLRDNLTLWTSDMQDDG DEIKEA K D E
Sbjct  221  TLIMQLLRDNLTLWTSDMQDDGGDEIKEAPKHDEE  255



>gb|AES73074.2| general regulatory factor 2 [Medicago truncatula]
Length=260

 Score =   291 bits (745),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 141/156 (90%), Positives = 150/156 (96%), Gaps = 1/156 (1%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLDS+LI +A SG+SKVFYLKMKGDYHRYLAEFKTGAERKEAAE+TL+AYKSAQ+
Sbjct  104  DGILKLLDSRLIPSAASGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLAAYKSAQD  163

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN EL PTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  164  IANAELPPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  223

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEAS-KPDNE  220
            TLIMQLLRDNLTLWTSDMQDDGADEIKEA+ KPD +
Sbjct  224  TLIMQLLRDNLTLWTSDMQDDGADEIKEAAPKPDEQ  259



>ref|XP_007018723.1| General regulatory factor 2, OMEGA [Theobroma cacao]
 gb|EOY15948.1| General regulatory factor 2, OMEGA [Theobroma cacao]
Length=267

 Score =   291 bits (745),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 139/151 (92%), Positives = 148/151 (98%), Gaps = 0/151 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLDS+LI +A++G+SKVFYLKMKGDYHRYLAEFKTGAERKEAAE+TL+AYKSAQ+
Sbjct  104  DGILKLLDSRLIPSASAGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLTAYKSAQD  163

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  164  IANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  223

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASK  232
            TLIMQLLRDNLTLWTSDMQDDGADEIKEA K
Sbjct  224  TLIMQLLRDNLTLWTSDMQDDGADEIKEAPK  254



>ref|NP_001234677.1| 14-3-3 protein 3 [Solanum lycopersicum]
 gb|AAA99430.1| 14-3-3 protein homologue [Solanum lycopersicum]
 prf||2019487A 14-3-3 protein
Length=229

 Score =   290 bits (741),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 139/153 (91%), Positives = 148/153 (97%), Gaps = 0/153 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLDSKLI +ATSG+SKVFYLKMKGDYHRYLAEFKTGAERKEAAE+TL+ YK+AQ+
Sbjct  74   DGILKLLDSKLIPSATSGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLTGYKAAQD  133

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IA+ ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  134  IASAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  193

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPD  226
            TLIMQLLRDNLTLWTSDMQDDGADEIKE  KP+
Sbjct  194  TLIMQLLRDNLTLWTSDMQDDGADEIKEDPKPE  226



>ref|XP_002513956.1| 14-3-3 protein, putative [Ricinus communis]
 gb|EEF48539.1| 14-3-3 protein, putative [Ricinus communis]
Length=257

 Score =   290 bits (743),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 140/156 (90%), Positives = 151/156 (97%), Gaps = 1/156 (1%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLD++LI +A +G+SKVFYLKMKGDYHRYLAEFKTGAERKEAAE+TL+AYKSAQ+
Sbjct  100  DGILKLLDTRLIPSAAAGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLTAYKSAQD  159

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  160  IANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  219

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEAS-KPDNE  220
            TLIMQLLRDNLTLWTSDMQDDGADEIKEA+ KP +E
Sbjct  220  TLIMQLLRDNLTLWTSDMQDDGADEIKEAAPKPSDE  255



>ref|XP_010521176.1| PREDICTED: 14-3-3-like protein GF14 omega [Tarenaya hassleriana]
Length=260

 Score =   290 bits (743),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 142/157 (90%), Positives = 148/157 (94%), Gaps = 2/157 (1%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLDS+LI +A SG+SKVFYLKMKGDYHRYLAEFKTG ERK+AAENTLSAYKSAQ+
Sbjct  102  DGILKLLDSRLIPSAASGDSKVFYLKMKGDYHRYLAEFKTGQERKDAAENTLSAYKSAQD  161

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  162  IANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  221

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKE--ASKPDNE  220
            TLIMQLLRDNLTLWTSDMQDD ADEIKE  ASKP  E
Sbjct  222  TLIMQLLRDNLTLWTSDMQDDAADEIKEAAASKPVEE  258



>ref|XP_002887733.1| GF14 omega [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63992.1| GF14 omega [Arabidopsis lyrata subsp. lyrata]
Length=260

 Score =   290 bits (742),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 139/152 (91%), Positives = 146/152 (96%), Gaps = 0/152 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLDS+LI AA SG+SKVFYLKMKGDYHRYLAEFKTG ERK+AAE+TLSAYKSAQ+
Sbjct  102  DGILKLLDSRLIPAAASGDSKVFYLKMKGDYHRYLAEFKTGQERKDAAEHTLSAYKSAQD  161

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  162  IANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  221

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKP  229
            TLIMQLLRDNLTLWTSDMQDD ADEIKEA+ P
Sbjct  222  TLIMQLLRDNLTLWTSDMQDDAADEIKEAAAP  253



>ref|XP_009777542.1| PREDICTED: 14-3-3-like protein B [Nicotiana sylvestris]
 sp|O49995.1|1433B_TOBAC RecName: Full=14-3-3-like protein B [Nicotiana tabacum]
 gb|AAC49891.1| 14-3-3 isoform b [Nicotiana tabacum]
 dbj|BAD12169.1| 14-3-3 b-1 protein [Nicotiana tabacum]
Length=255

 Score =   290 bits (741),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/155 (91%), Positives = 150/155 (97%), Gaps = 1/155 (1%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLDS LI +A++G+SKVFYLKMKGDYHRYLAEFKTGAERKEAAE+TLSAYK+AQ+
Sbjct  100  DGILKLLDSCLIPSASAGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLSAYKAAQD  159

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  160  IANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  219

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  220
            TLIMQLLRDNLTLWTSDMQDDGADEIKE +K DNE
Sbjct  220  TLIMQLLRDNLTLWTSDMQDDGADEIKE-TKTDNE  253



>ref|XP_009632004.1| PREDICTED: 14-3-3-like protein B [Nicotiana tomentosiformis]
 dbj|BAB68526.1| 14-3-3 protein [Nicotiana tabacum]
 dbj|BAD12170.1| 14-3-3 b-2 protein [Nicotiana tabacum]
Length=255

 Score =   290 bits (741),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/155 (91%), Positives = 150/155 (97%), Gaps = 1/155 (1%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLDS LI +A++G+SKVFYLKMKGDYHRYLAEFKTGAERKEAAE+TLSAYK+AQ+
Sbjct  100  DGILKLLDSCLIPSASAGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLSAYKAAQD  159

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  160  IANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  219

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  220
            TLIMQLLRDNLTLWTSDMQDDGADEIKE +K DNE
Sbjct  220  TLIMQLLRDNLTLWTSDMQDDGADEIKE-TKADNE  253



>ref|XP_010543865.1| PREDICTED: 14-3-3-like protein GF14 omega [Tarenaya hassleriana]
Length=262

 Score =   290 bits (741),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/156 (90%), Positives = 150/156 (96%), Gaps = 1/156 (1%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLDS+LI AA+SG+SKVFYLKMKGDYHRYLAEFKTG ERK+AAENTL+AYKSAQ+
Sbjct  103  DGILKLLDSRLIPAASSGDSKVFYLKMKGDYHRYLAEFKTGQERKDAAENTLNAYKSAQD  162

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  163  IANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  222

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEAS-KPDNE  220
            TLIMQLLRDNLTLWTSDMQDDG DEIKEA+ KP +E
Sbjct  223  TLIMQLLRDNLTLWTSDMQDDGVDEIKEATPKPADE  258



>gb|AFK34151.1| unknown [Medicago truncatula]
Length=260

 Score =   290 bits (741),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 140/156 (90%), Positives = 149/156 (96%), Gaps = 1/156 (1%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLDS+LI +A SG+SKVFYLKMKGDYHRYLAEFKTGAERKEAAE+TL+AYKSAQ+
Sbjct  104  DGILKLLDSRLIPSAASGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLAAYKSAQD  163

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN EL PTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  164  IANAELPPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  223

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEAS-KPDNE  220
            TLIMQL RDNLTLWTSDMQDDGADEIKEA+ KPD +
Sbjct  224  TLIMQLFRDNLTLWTSDMQDDGADEIKEAAPKPDEQ  259



>ref|XP_008386122.1| PREDICTED: 14-3-3-like protein [Malus domestica]
Length=264

 Score =   290 bits (741),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 137/152 (90%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLDS+LI +A +G+SKVFYLKMKGDYHRYLAEFKTGAERKEAAE+TLSAYK+AQ+
Sbjct  105  DGILKLLDSRLIPSAVAGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLSAYKAAQD  164

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  165  IANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  224

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKP  229
            TLIMQLLRDNLTLWTSDMQDD ADE+KEA+ P
Sbjct  225  TLIMQLLRDNLTLWTSDMQDDAADEVKEAAAP  256



>ref|XP_009757667.1| PREDICTED: 14-3-3-like protein C [Nicotiana sylvestris]
 dbj|BAD12172.1| 14-3-3 c-2 protein [Nicotiana tabacum]
Length=260

 Score =   289 bits (740),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 139/153 (91%), Positives = 147/153 (96%), Gaps = 0/153 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLD+KLI +A SG+SKVFYLKMKGDYHRYLAEFKTGAERKEAAE+TL+AYK+AQ+
Sbjct  104  DGILKLLDAKLIPSAASGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLTAYKAAQD  163

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IA  ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  164  IATTELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  223

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPD  226
            TLIMQLLRDNLTLWTSDMQDDGADEIKE  KPD
Sbjct  224  TLIMQLLRDNLTLWTSDMQDDGADEIKEDPKPD  256



>ref|XP_010535331.1| PREDICTED: 14-3-3-like protein GF14 omega [Tarenaya hassleriana]
Length=259

 Score =   289 bits (740),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/156 (90%), Positives = 148/156 (95%), Gaps = 1/156 (1%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLDS+LI +A SG+SKVFYLKMKGDYHRYLAEFKTG ERK+AAE+TLSAYKSAQE
Sbjct  102  DGILKLLDSRLIPSAASGDSKVFYLKMKGDYHRYLAEFKTGQERKDAAEHTLSAYKSAQE  161

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  162  IANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  221

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKE-ASKPDNE  220
            TLIMQLLRDNLTLWTSDMQDD ADEIKE A+KP  E
Sbjct  222  TLIMQLLRDNLTLWTSDMQDDAADEIKEAAAKPGEE  257



>ref|XP_009619695.1| PREDICTED: 14-3-3-like protein C [Nicotiana tomentosiformis]
 sp|P93343.1|1433C_TOBAC RecName: Full=14-3-3-like protein C; AltName: Full=14-3-3-like 
protein B [Nicotiana tabacum]
 pdb|1O9C|A Chain A, Structural View Of A Fungal Toxin Acting On A 14-3-3 
Regulatory Complex
 pdb|1O9D|A Chain A, Structural View Of A Fungal Toxin Acting On A 14-3-3 
Regulatory Complex
 pdb|1O9E|A Chain A, Structural View Of A Fungal Toxin Acting On A 14-3-3 
Regulatory Complex
 pdb|1O9F|A Chain A, Structural View Of A Fungal Toxin Acting On A 14-3-3 
Regulatory Complex
 pdb|3E6Y|A Chain A, Structure Of 14-3-3 In Complex With The Differentiation-Inducing 
Agent Cotylenin A
 pdb|3E6Y|B Chain B, Structure Of 14-3-3 In Complex With The Differentiation-Inducing 
Agent Cotylenin A
 emb|CAA72094.1| 14-3-3-like protein B [Nicotiana tabacum]
 gb|AAC49892.1| 14-3-3 isoform c [Nicotiana tabacum]
 dbj|BAD10940.1| 14-3-3 protein [Nicotiana tabacum]
 dbj|BAD12171.1| 14-3-3 c-1 protein [Nicotiana tabacum]
Length=260

 Score =   289 bits (740),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 139/153 (91%), Positives = 147/153 (96%), Gaps = 0/153 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLD+KLI +A SG+SKVFYLKMKGDYHRYLAEFKTGAERKEAAE+TL+AYK+AQ+
Sbjct  104  DGILKLLDAKLIPSAASGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLTAYKAAQD  163

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IA  ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  164  IATTELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  223

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPD  226
            TLIMQLLRDNLTLWTSDMQDDGADEIKE  KPD
Sbjct  224  TLIMQLLRDNLTLWTSDMQDDGADEIKEDPKPD  256



>sp|P93342.1|1433A_TOBAC RecName: Full=14-3-3-like protein A [Nicotiana tabacum]
 emb|CAA72095.1| 14-3-3-like protein A [Nicotiana tabacum]
Length=255

 Score =   289 bits (740),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 140/155 (90%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            NGILKLLDSKLIG A +G+SKVFYLKMKGDY+RYLAEFKTGAERKEAAENTLSAYKSAQ+
Sbjct  100  NGILKLLDSKLIGTAATGDSKVFYLKMKGDYYRYLAEFKTGAERKEAAENTLSAYKSAQD  159

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAEL TLGEESYKDS
Sbjct  160  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELGTLGEESYKDS  219

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  220
            TLIMQL  DNLTLWTSDMQDDG DEIKE SK + +
Sbjct  220  TLIMQLFCDNLTLWTSDMQDDGTDEIKEPSKAEEQ  254



>ref|XP_004252529.1| PREDICTED: 14-3-3 protein 2 [Solanum lycopersicum]
 sp|P93208.2|14332_SOLLC RecName: Full=14-3-3 protein 2 [Solanum lycopersicum]
 emb|CAA65146.2| 14-3-3 protein [Solanum lycopersicum]
Length=254

 Score =   289 bits (739),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 141/155 (91%), Positives = 150/155 (97%), Gaps = 1/155 (1%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLDS LI +A++G+SKVFYLKMKGDYHRYLAEFKTGAERKEAAE+TLSAYK+AQ+
Sbjct  99   DGILKLLDSNLIPSASNGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLSAYKAAQD  158

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  159  IANTELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  218

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  220
            TLIMQLLRDNLTLWTSDMQDDGADEIKE +K DNE
Sbjct  219  TLIMQLLRDNLTLWTSDMQDDGADEIKE-TKNDNE  252



>ref|XP_010060042.1| PREDICTED: 14-3-3-like protein [Eucalyptus grandis]
Length=262

 Score =   289 bits (739),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 139/154 (90%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = -1

Query  681  GILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQEI  502
            GILKLLDS+LI AA SG+SKVFYLKMKGDYHRYLAEFKTGAERKEAAE+TL+AYK+AQ+I
Sbjct  108  GILKLLDSRLIPAAASGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLTAYKAAQDI  167

Query  501  ANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDST  322
            AN ELAPTHPIRLGLALNFSVFYYEILNSPDRAC+LAKQAFDEAIAELDTLGEESYKDST
Sbjct  168  ANTELAPTHPIRLGLALNFSVFYYEILNSPDRACSLAKQAFDEAIAELDTLGEESYKDST  227

Query  321  LIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  220
            LIMQLLRDNLTLWTSDMQ+DGADEIKEA K D +
Sbjct  228  LIMQLLRDNLTLWTSDMQEDGADEIKEAPKADEQ  261



>ref|NP_001238389.1| 14-3-3 protein SGF14h [Glycine max]
 gb|ADU60526.1| SGF14h [Glycine max]
 gb|KHN19782.1| 14-3-3-like protein [Glycine soja]
Length=259

 Score =   289 bits (739),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 138/150 (92%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLDS+LI +A+SG+SKVFYLKMKGDYHRYLAEFKTGAERKEAAE+TLSAYK+AQ+
Sbjct  104  DGILKLLDSRLIPSASSGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLSAYKAAQD  163

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN EL PTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  164  IANAELPPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  223

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEAS  235
            TLIMQLLRDNLTLWTSDMQDDGADEIKEA+
Sbjct  224  TLIMQLLRDNLTLWTSDMQDDGADEIKEAA  253



>ref|XP_007136271.1| hypothetical protein PHAVU_009G032500g [Phaseolus vulgaris]
 ref|XP_007136272.1| hypothetical protein PHAVU_009G032500g [Phaseolus vulgaris]
 gb|AGV54448.1| 14-3-3 protein [Phaseolus vulgaris]
 gb|ESW08265.1| hypothetical protein PHAVU_009G032500g [Phaseolus vulgaris]
 gb|ESW08266.1| hypothetical protein PHAVU_009G032500g [Phaseolus vulgaris]
Length=259

 Score =   288 bits (738),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 138/150 (92%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLDS+LI +A+SG+SKVFYLKMKGDYHRYLAEFKTGAERKEAAE+TL+AYKSAQ+
Sbjct  104  DGILKLLDSRLIPSASSGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLAAYKSAQD  163

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN EL PTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  164  IANAELPPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  223

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEAS  235
            TLIMQLLRDNLTLWTSDMQDDGADEIKEA+
Sbjct  224  TLIMQLLRDNLTLWTSDMQDDGADEIKEAA  253



>gb|AAA96253.1| GF14omega isoform [Arabidopsis thaliana]
Length=259

 Score =   288 bits (738),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 138/152 (91%), Positives = 146/152 (96%), Gaps = 0/152 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLDS+LI AA SG+SKVFYLKMKGDYHRYLAEFKTG ERK+AAE+TL+AYKSAQ+
Sbjct  101  DGILKLLDSRLIPAAASGDSKVFYLKMKGDYHRYLAEFKTGQERKDAAEHTLAAYKSAQD  160

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  161  IANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  220

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKP  229
            TLIMQLLRDNLTLWTSDMQDD ADEIKEA+ P
Sbjct  221  TLIMQLLRDNLTLWTSDMQDDAADEIKEAAAP  252



>ref|XP_008346360.1| PREDICTED: 14-3-3-like protein [Malus domestica]
 ref|XP_008356357.1| PREDICTED: 14-3-3-like protein [Malus domestica]
Length=263

 Score =   288 bits (738),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 141/159 (89%), Positives = 150/159 (94%), Gaps = 1/159 (1%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLDS+LI +A  G+SKVFYLKMKGDYHRYLAEFKTGAERKEAAE+TLSAYK+AQ+
Sbjct  105  DGILKLLDSRLIPSACPGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLSAYKAAQD  164

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN ELAPTHPIRLGLALNFSVFYYEILNSPDRAC+LAKQAFDEAIAELDTLGEESYKDS
Sbjct  165  IANAELAPTHPIRLGLALNFSVFYYEILNSPDRACSLAKQAFDEAIAELDTLGEESYKDS  224

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEAS-KPDNE*SQ  211
            TLIMQLLRDNLTLWTSDMQDDGADEIKEA+ KP  E  Q
Sbjct  225  TLIMQLLRDNLTLWTSDMQDDGADEIKEAAPKPTEEPKQ  263



>dbj|BAB47119.1| 14-3-3 protein [Vigna angularis]
Length=259

 Score =   288 bits (738),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 138/150 (92%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLDS+LI +A+SG+SKVFYLKMKGDYHRYLAEFKTGAERKEAAE+TL+AYKSAQ+
Sbjct  104  DGILKLLDSRLIPSASSGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLAAYKSAQD  163

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN EL PTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  164  IANAELPPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  223

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEAS  235
            TLIMQLLRDNLTLWTSDMQDDGADEIKEA+
Sbjct  224  TLIMQLLRDNLTLWTSDMQDDGADEIKEAA  253



>gb|AAD27823.2| 14-3-3 protein [Populus tremula x Populus alba]
Length=261

 Score =   288 bits (738),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 139/156 (89%), Positives = 151/156 (97%), Gaps = 1/156 (1%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLDS+LI  A++G+SKVFYLKMKGDYHRYLAEFKTGAERKEAAE+TL+AYK+AQ+
Sbjct  104  DGILKLLDSRLIPTASAGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLTAYKAAQD  163

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN ELAPTHPIRLGLALNFSVFYYEILNSPDRAC+LAKQAFDEAIAELDTLGEESYKDS
Sbjct  164  IANAELAPTHPIRLGLALNFSVFYYEILNSPDRACSLAKQAFDEAIAELDTLGEESYKDS  223

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEAS-KPDNE  220
            TLIMQLLRDNLTLWTSDMQDDGADEIKEA+ KP +E
Sbjct  224  TLIMQLLRDNLTLWTSDMQDDGADEIKEAAPKPGDE  259



>ref|XP_011098686.1| PREDICTED: 14-3-3-like protein C [Sesamum indicum]
 ref|XP_011098695.1| PREDICTED: 14-3-3-like protein C [Sesamum indicum]
 ref|XP_011098703.1| PREDICTED: 14-3-3-like protein C [Sesamum indicum]
Length=257

 Score =   288 bits (737),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 137/153 (90%), Positives = 147/153 (96%), Gaps = 0/153 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLD +LI +A  G+SKVFYLKMKGDYHRYLAEFKTGAERKEAAE+TL+AYK+AQ+
Sbjct  101  DGILKLLDDRLIPSAAGGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLTAYKAAQD  160

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  161  IANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  220

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPD  226
            TLIMQLLRDNLTLWTSDMQDDGAD+IKEA KP+
Sbjct  221  TLIMQLLRDNLTLWTSDMQDDGADDIKEAPKPE  253



>ref|XP_011016779.1| PREDICTED: 14-3-3-like protein [Populus euphratica]
Length=261

 Score =   288 bits (738),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 139/156 (89%), Positives = 151/156 (97%), Gaps = 1/156 (1%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLDS+LI  A++G+SKVFYLKMKGDYHRYLAEFKTGAERKEAAE+TL+AYK+AQ+
Sbjct  104  DGILKLLDSRLIPTASAGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLTAYKAAQD  163

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN ELAPTHPIRLGLALNFSVFYYEILNSPDRAC+LAKQAFDEAIAELDTLGEESYKDS
Sbjct  164  IANAELAPTHPIRLGLALNFSVFYYEILNSPDRACSLAKQAFDEAIAELDTLGEESYKDS  223

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEAS-KPDNE  220
            TLIMQLLRDNLTLWTSDMQDDGADEIKEA+ KP +E
Sbjct  224  TLIMQLLRDNLTLWTSDMQDDGADEIKEAAPKPADE  259



>ref|XP_002301071.1| 14-3-3 protein 32kDa endonuclease [Populus trichocarpa]
 gb|ABK93142.1| unknown [Populus trichocarpa]
 gb|EEE80344.1| 14-3-3 protein 32kDa endonuclease [Populus trichocarpa]
Length=261

 Score =   288 bits (738),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 139/156 (89%), Positives = 151/156 (97%), Gaps = 1/156 (1%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLDS+LI  A++G+SKVFYLKMKGDYHRYLAEFKTGAERKEAAE+TL+AYK+AQ+
Sbjct  104  DGILKLLDSRLIPTASAGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLTAYKAAQD  163

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN ELAPTHPIRLGLALNFSVFYYEILNSPDRAC+LAKQAFDEAIAELDTLGEESYKDS
Sbjct  164  IANAELAPTHPIRLGLALNFSVFYYEILNSPDRACSLAKQAFDEAIAELDTLGEESYKDS  223

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEAS-KPDNE  220
            TLIMQLLRDNLTLWTSDMQDDGADEIKEA+ KP +E
Sbjct  224  TLIMQLLRDNLTLWTSDMQDDGADEIKEAAPKPGDE  259



>ref|NP_565176.1| 14-3-3-like protein GF14 omega [Arabidopsis thaliana]
 sp|Q01525.2|14332_ARATH RecName: Full=14-3-3-like protein GF14 omega; AltName: Full=General 
regulatory factor 2 [Arabidopsis thaliana]
 gb|AAF71808.1|AC013430_17 F3F9.16 [Arabidopsis thaliana]
 gb|AAL58901.1|AF462807_1 At1g78300/F3F9_16 [Arabidopsis thaliana]
 gb|AAA32798.1| GF14 [Arabidopsis thaliana]
 gb|AAL76145.1| At1g78300/F3F9_16 [Arabidopsis thaliana]
 gb|AAM67316.1| 14-3-3 protein GF14omega (grf2) [Arabidopsis thaliana]
 gb|AEE36093.1| 14-3-3-like protein GF14 omega [Arabidopsis thaliana]
Length=259

 Score =   288 bits (737),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 138/152 (91%), Positives = 146/152 (96%), Gaps = 0/152 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLDS+LI AA SG+SKVFYLKMKGDYHRYLAEFKTG ERK+AAE+TL+AYKSAQ+
Sbjct  101  DGILKLLDSRLIPAAASGDSKVFYLKMKGDYHRYLAEFKTGQERKDAAEHTLAAYKSAQD  160

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  161  IANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  220

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKP  229
            TLIMQLLRDNLTLWTSDMQDD ADEIKEA+ P
Sbjct  221  TLIMQLLRDNLTLWTSDMQDDAADEIKEAAAP  252



>emb|CAB42546.2| 14-3-3-like protein [Pisum sativum]
Length=260

 Score =   288 bits (737),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 138/155 (89%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLD++LI +A+SG+SKVFYLKMKGDYHRYLAEFKTGAERKEAAE+TL+AYKSAQ+
Sbjct  104  DGILKLLDTRLIPSASSGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLAAYKSAQD  163

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN EL PTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  164  IANAELPPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  223

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  220
            TLIMQLLRDNLTLWTSDMQDDGADEIKEA+   +E
Sbjct  224  TLIMQLLRDNLTLWTSDMQDDGADEIKEAAPKADE  258



>ref|XP_003602823.1| 14-3-3-like protein [Medicago truncatula]
Length=303

 Score =   290 bits (741),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 141/156 (90%), Positives = 150/156 (96%), Gaps = 1/156 (1%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLDS+LI +A SG+SKVFYLKMKGDYHRYLAEFKTGAERKEAAE+TL+AYKSAQ+
Sbjct  104  DGILKLLDSRLIPSAASGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLAAYKSAQD  163

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN EL PTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  164  IANAELPPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  223

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEAS-KPDNE  220
            TLIMQLLRDNLTLWTSDMQDDGADEIKEA+ KPD +
Sbjct  224  TLIMQLLRDNLTLWTSDMQDDGADEIKEAAPKPDEQ  259



>ref|XP_002307363.1| 14-3-3 protein 32kDa endonuclease [Populus trichocarpa]
 gb|ABK93650.1| unknown [Populus trichocarpa]
 gb|EEE94359.1| 14-3-3 protein 32kDa endonuclease [Populus trichocarpa]
Length=260

 Score =   288 bits (737),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 137/150 (91%), Positives = 146/150 (97%), Gaps = 0/150 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLD++LI  A+SG+SKVFYLKMKGDYHRYLAEFKTGAERKEAAE+TL+AYKSAQ+
Sbjct  104  DGILKLLDTRLIPTASSGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLTAYKSAQD  163

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  164  IANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  223

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEAS  235
            TLIMQLLRDNLTLWTSDMQDD ADEIKEA+
Sbjct  224  TLIMQLLRDNLTLWTSDMQDDAADEIKEAA  253



>gb|KDP40925.1| hypothetical protein JCGZ_24924 [Jatropha curcas]
Length=261

 Score =   288 bits (737),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 139/157 (89%), Positives = 147/157 (94%), Gaps = 0/157 (0%)
 Frame = -1

Query  681  GILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQEI  502
            GILKLLD KL+ AA +G+SKVFYLKMKGDYHRYLAEFKTG ERKEAAENTLSAYKSAQ+I
Sbjct  105  GILKLLDEKLVPAAATGDSKVFYLKMKGDYHRYLAEFKTGNERKEAAENTLSAYKSAQDI  164

Query  501  ANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDST  322
            AN ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAI+ELDTLGE+SYKDST
Sbjct  165  ANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAISELDTLGEDSYKDST  224

Query  321  LIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE*SQ  211
            LIMQLLRDNLTLWTSDMQDDG DEIK+ASK + E  Q
Sbjct  225  LIMQLLRDNLTLWTSDMQDDGTDEIKDASKKEEEQKQ  261



>emb|CDX79255.1| BnaC06g20480D [Brassica napus]
 emb|CDX68022.1| BnaA07g20620D [Brassica napus]
Length=260

 Score =   288 bits (736),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 137/152 (90%), Positives = 146/152 (96%), Gaps = 0/152 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLDS+L+ AA SG+SKVFYLKMKGDYHRYLAEFKTG ERK+AAENTLSAYK+AQ+
Sbjct  102  DGILKLLDSRLVPAAASGDSKVFYLKMKGDYHRYLAEFKTGQERKDAAENTLSAYKAAQD  161

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN ELAPTHPIRLGLALNFSVFYYEILNSPDRAC+LAKQAFD+AIAELDTLGEESYKDS
Sbjct  162  IANAELAPTHPIRLGLALNFSVFYYEILNSPDRACSLAKQAFDDAIAELDTLGEESYKDS  221

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKP  229
            TLIMQLLRDNLTLWTSDMQDD ADEIKEAS P
Sbjct  222  TLIMQLLRDNLTLWTSDMQDDAADEIKEASAP  253



>ref|XP_011009578.1| PREDICTED: 14-3-3-like protein isoform X2 [Populus euphratica]
Length=260

 Score =   288 bits (736),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 137/150 (91%), Positives = 146/150 (97%), Gaps = 0/150 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLDS+LI  A++G+SKVFYLKMKGDYHRYLAEFKTGAERKEAAE+TL+AYKSAQ+
Sbjct  104  DGILKLLDSRLIPTASAGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLTAYKSAQD  163

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  164  IANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  223

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEAS  235
            TLIMQLLRDNLTLWTSDMQDD ADEIKEA+
Sbjct  224  TLIMQLLRDNLTLWTSDMQDDAADEIKEAA  253



>ref|XP_009373053.1| PREDICTED: 14-3-3-like protein [Pyrus x bretschneideri]
Length=319

 Score =   290 bits (741),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 140/159 (88%), Positives = 151/159 (95%), Gaps = 1/159 (1%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLDS+LI +A +G+SKVFYLKMKGDYHRYLAEFKTGAERKEAAE+TLSAYK+AQ+
Sbjct  161  DGILKLLDSRLIPSACAGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLSAYKAAQD  220

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN ELAPTHPIRLGLALNFSVFYYEILNSPDRAC+LAKQAFDEAIAELDTLGEESYKDS
Sbjct  221  IANAELAPTHPIRLGLALNFSVFYYEILNSPDRACSLAKQAFDEAIAELDTLGEESYKDS  280

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEAS-KPDNE*SQ  211
            TLIMQLLRDNLTLWTSDMQDDGAD+IKEA+ KP  E  Q
Sbjct  281  TLIMQLLRDNLTLWTSDMQDDGADDIKEAAPKPTEEPKQ  319



>ref|XP_010428953.1| PREDICTED: 14-3-3-like protein GF14 omega [Camelina sativa]
Length=260

 Score =   288 bits (736),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 138/152 (91%), Positives = 145/152 (95%), Gaps = 0/152 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLDS+LI AA SG+SKVFYLKMKGDYHRYLAEFKT  ERK+AAE+TLSAYKSAQ+
Sbjct  102  DGILKLLDSRLIPAAASGDSKVFYLKMKGDYHRYLAEFKTSEERKDAAEHTLSAYKSAQD  161

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  162  IANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  221

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKP  229
            TLIMQLLRDNLTLWTSDMQDD ADEIKEA+ P
Sbjct  222  TLIMQLLRDNLTLWTSDMQDDAADEIKEAAAP  253



>ref|XP_007223394.1| hypothetical protein PRUPE_ppa010148mg [Prunus persica]
 gb|EMJ24593.1| hypothetical protein PRUPE_ppa010148mg [Prunus persica]
Length=262

 Score =   288 bits (736),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 139/154 (90%), Positives = 149/154 (97%), Gaps = 1/154 (1%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLDS+LI +A +G+SKVFYLKMKGDYHRYLAEFKTG ERKEAAE+TLSAYK+AQ+
Sbjct  105  DGILKLLDSRLIPSAFAGDSKVFYLKMKGDYHRYLAEFKTGTERKEAAESTLSAYKAAQD  164

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  165  IANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  224

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEAS-KPD  226
            TLIMQLLRDNLTLWTSDMQDDGADEIKEA+ KP+
Sbjct  225  TLIMQLLRDNLTLWTSDMQDDGADEIKEAAPKPE  258



>ref|XP_006302543.1| hypothetical protein CARUB_v10020644mg, partial [Capsella rubella]
 gb|EOA35441.1| hypothetical protein CARUB_v10020644mg, partial [Capsella rubella]
Length=327

 Score =   290 bits (741),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 139/152 (91%), Positives = 146/152 (96%), Gaps = 0/152 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLDS+LI AA SG+SKVFYLKMKGDYHRYLAEFKTG ERK+AAE+TLSAYKSAQ+
Sbjct  166  DGILKLLDSRLIPAAASGDSKVFYLKMKGDYHRYLAEFKTGQERKDAAEHTLSAYKSAQD  225

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  226  IANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  285

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKP  229
            TLIMQLLRDNLTLWTSDMQDD ADEIKEA+ P
Sbjct  286  TLIMQLLRDNLTLWTSDMQDDAADEIKEAAAP  317



>dbj|BAD12554.1| 14-3-3 f-2 protein [Nicotiana tabacum]
Length=243

 Score =   286 bits (733),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 136/150 (91%), Positives = 145/150 (97%), Gaps = 0/150 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            NGILKLLDS LI AA++G+SKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLS+YKSAQ+
Sbjct  94   NGILKLLDSNLIRAASTGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSSYKSAQD  153

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  154  IANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  213

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEAS  235
            TLIMQLLRDNLTLWTSDMQD+G +E+KE +
Sbjct  214  TLIMQLLRDNLTLWTSDMQDEGTEEMKEVA  243



>gb|KHG14081.1| Uncharacterized protein F383_17151 [Gossypium arboreum]
Length=269

 Score =   287 bits (735),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 138/154 (90%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = -1

Query  681  GILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQEI  502
            GILKLLDS+LI +A + +SKVFYLKMKGDYHRYLAEFKTGAERKEAAE+TL+AYKSAQ+I
Sbjct  106  GILKLLDSRLIPSAAAKDSKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLTAYKSAQDI  165

Query  501  ANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDST  322
            AN ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDST
Sbjct  166  ANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDST  225

Query  321  LIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  220
            LIMQLLRDNLTLWTSD+QDDGADEIKEA K + E
Sbjct  226  LIMQLLRDNLTLWTSDLQDDGADEIKEAPKQEEE  259



>ref|XP_010272995.1| PREDICTED: LOW QUALITY PROTEIN: 14-3-3-like protein [Nelumbo 
nucifera]
Length=300

 Score =   288 bits (737),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 140/156 (90%), Positives = 150/156 (96%), Gaps = 1/156 (1%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GIL+LLD +LI +A+SG+SKVFYLKMKGDYHRYLAEFKTGAERKEAAE+TLSAYKSAQ+
Sbjct  107  DGILRLLDQRLIPSASSGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLSAYKSAQD  166

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN ELAPTHPIRLGLALNFSVFYYEILNSPDRAC LAKQAFDEAIAELDTLGEESYKDS
Sbjct  167  IANAELAPTHPIRLGLALNFSVFYYEILNSPDRACTLAKQAFDEAIAELDTLGEESYKDS  226

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEAS-KPDNE  220
            TLIMQLLRDNLTLWTSDMQDDGADEIKEA+ K D+E
Sbjct  227  TLIMQLLRDNLTLWTSDMQDDGADEIKEAAPKRDDE  262



>ref|XP_008219335.1| PREDICTED: 14-3-3-like protein [Prunus mume]
Length=262

 Score =   287 bits (734),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 139/154 (90%), Positives = 149/154 (97%), Gaps = 1/154 (1%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLDS+LI +A +G+SKVFYLKMKGDYHRYLAEFKTG ERKEAAE+TLSAYK+AQ+
Sbjct  105  DGILKLLDSRLIPSAFAGDSKVFYLKMKGDYHRYLAEFKTGNERKEAAESTLSAYKAAQD  164

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  165  IANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  224

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEAS-KPD  226
            TLIMQLLRDNLTLWTSDMQDDGADEIKEA+ KP+
Sbjct  225  TLIMQLLRDNLTLWTSDMQDDGADEIKEAAPKPE  258



>gb|KCW66571.1| hypothetical protein EUGRSUZ_F00370 [Eucalyptus grandis]
 gb|KCW66572.1| hypothetical protein EUGRSUZ_F00370 [Eucalyptus grandis]
Length=332

 Score =   289 bits (740),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 139/154 (90%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = -1

Query  681  GILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQEI  502
            GILKLLDS+LI AA SG+SKVFYLKMKGDYHRYLAEFKTGAERKEAAE+TL+AYK+AQ+I
Sbjct  178  GILKLLDSRLIPAAASGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLTAYKAAQDI  237

Query  501  ANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDST  322
            AN ELAPTHPIRLGLALNFSVFYYEILNSPDRAC+LAKQAFDEAIAELDTLGEESYKDST
Sbjct  238  ANTELAPTHPIRLGLALNFSVFYYEILNSPDRACSLAKQAFDEAIAELDTLGEESYKDST  297

Query  321  LIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  220
            LIMQLLRDNLTLWTSDMQ+DGADEIKEA K D +
Sbjct  298  LIMQLLRDNLTLWTSDMQEDGADEIKEAPKADEQ  331



>ref|XP_010534083.1| PREDICTED: 14-3-3-like protein GF14 omega [Tarenaya hassleriana]
Length=259

 Score =   286 bits (733),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 139/156 (89%), Positives = 148/156 (95%), Gaps = 1/156 (1%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLDS++I +A SG+SKVFYLKMKGDYHRYLAEFKTG ERK+AAE+TLSAYKSAQE
Sbjct  102  DGILKLLDSRIIPSAASGDSKVFYLKMKGDYHRYLAEFKTGQERKDAAEHTLSAYKSAQE  161

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN ELAPTHPIRLGLALNFSVFYYEIL+SPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  162  IANAELAPTHPIRLGLALNFSVFYYEILSSPDRACNLAKQAFDEAIAELDTLGEESYKDS  221

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEAS-KPDNE  220
            TLIMQLLRDNLTLWTSDMQDD ADEIKEA+ KP  E
Sbjct  222  TLIMQLLRDNLTLWTSDMQDDAADEIKEAAPKPAEE  257



>sp|P46266.1|1433_PEA RecName: Full=14-3-3-like protein [Pisum sativum]
 gb|AAA85817.1| 14-3-3-like protein [Pisum sativum]
Length=260

 Score =   286 bits (733),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 137/155 (88%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLD++LI +A+SG+SKVFYLKMKGDYHRYLAEFKTGAERKEAAE+TL+ YKSAQ+
Sbjct  104  DGILKLLDTRLIPSASSGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLTGYKSAQD  163

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN EL PTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  164  IANAELPPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  223

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  220
            TLIMQLLRDNLTLWTSDMQDDGADEIKEA+   +E
Sbjct  224  TLIMQLLRDNLTLWTSDMQDDGADEIKEAAPKADE  258



>ref|XP_007200586.1| hypothetical protein PRUPE_ppa010141mg [Prunus persica]
 ref|XP_008237283.1| PREDICTED: 14-3-3-like protein 16R [Prunus mume]
 gb|EMJ01785.1| hypothetical protein PRUPE_ppa010141mg [Prunus persica]
Length=262

 Score =   286 bits (732),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 140/158 (89%), Positives = 148/158 (94%), Gaps = 1/158 (1%)
 Frame = -1

Query  681  GILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQEI  502
            GILKLLDSKL+ +A  G+SKVFYLKMKGDYHRYLAEFKTG ERKEAAENTL+AYK+AQ+I
Sbjct  105  GILKLLDSKLVPSANVGDSKVFYLKMKGDYHRYLAEFKTGNERKEAAENTLNAYKAAQDI  164

Query  501  ANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDST  322
            AN ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGE+SYKDST
Sbjct  165  ANSELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEDSYKDST  224

Query  321  LIMQLLRDNLTLWTSDMQDDGADEIKEAS-KPDNE*SQ  211
            LIMQLLRDNLTLWTSDMQDDGADEIKEA+ KP  E  Q
Sbjct  225  LIMQLLRDNLTLWTSDMQDDGADEIKEAAPKPQAEQQQ  262



>sp|O65352.1|1433_HELAN RecName: Full=14-3-3-like protein [Helianthus annuus]
 gb|AAC17447.1| 14-3-3-like protein [Helianthus annuus]
Length=259

 Score =   285 bits (730),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 136/155 (88%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILK+LDSKLIG+A+ G+SKVFYLKMKGDY+RYLAEFKTG ERK AAENTLSAYK+AQ+
Sbjct  105  DGILKVLDSKLIGSASGGDSKVFYLKMKGDYYRYLAEFKTGDERKLAAENTLSAYKAAQD  164

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGE+SYKDS
Sbjct  165  IANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEDSYKDS  224

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  220
            TLIMQLLRDNLTLWTSDMQDD A+E+KEA KPD++
Sbjct  225  TLIMQLLRDNLTLWTSDMQDDTAEEVKEAPKPDDQ  259



>ref|XP_006423811.1| hypothetical protein CICLE_v10029087mg [Citrus clementina]
 ref|XP_006492624.1| PREDICTED: 14-3-3 protein 6-like [Citrus sinensis]
 gb|ESR37051.1| hypothetical protein CICLE_v10029087mg [Citrus clementina]
 gb|KDO45012.1| hypothetical protein CISIN_1g024897mg [Citrus sinensis]
Length=261

 Score =   285 bits (730),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 137/157 (87%), Positives = 145/157 (92%), Gaps = 0/157 (0%)
 Frame = -1

Query  681  GILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQEI  502
            GILKLLD KL+ AA + +SKVFYLKMKGDYHRYLAEFKTG ERK AAENTL+AYKSAQ+I
Sbjct  105  GILKLLDQKLVPAAAAADSKVFYLKMKGDYHRYLAEFKTGDERKVAAENTLNAYKSAQDI  164

Query  501  ANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDST  322
            AN ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAI+ELDTLGE+SYKDST
Sbjct  165  ANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAISELDTLGEDSYKDST  224

Query  321  LIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE*SQ  211
            LIMQLLRDNLTLWTSDMQDDG DEIKEA KP+ E  Q
Sbjct  225  LIMQLLRDNLTLWTSDMQDDGTDEIKEAPKPEEEKKQ  261



>gb|ABQ95992.1| 14-3-3-like protein [Cicer arietinum]
 gb|ABQ95994.1| 14-3-3-like protein [Cicer arietinum]
Length=261

 Score =   285 bits (730),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 148/158 (94%), Gaps = 0/158 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            NGILKLLDS+LI +A SG+SKVFYLKMKGDYHRYLAEFK+GAERK+AAE+TL+AYKSAQ+
Sbjct  104  NGILKLLDSRLIPSAASGDSKVFYLKMKGDYHRYLAEFKSGAERKDAAESTLTAYKSAQD  163

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN EL PTHPIRLGLALNFSVFYYEILNSPDRAC LAKQAFDEAIAELDTLGEESYKDS
Sbjct  164  IANSELPPTHPIRLGLALNFSVFYYEILNSPDRACGLAKQAFDEAIAELDTLGEESYKDS  223

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE*SQ  211
            TLIMQLLRDNLTLWTSDMQDDGADEIKEA+   N+  Q
Sbjct  224  TLIMQLLRDNLTLWTSDMQDDGADEIKEAAPKGNDEPQ  261



>ref|XP_008444853.1| PREDICTED: 14-3-3-like protein [Cucumis melo]
Length=261

 Score =   285 bits (730),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 136/149 (91%), Positives = 145/149 (97%), Gaps = 0/149 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLDS+LI +A SG+SKVFYLKMKGDYHRYLAEFKTGAERKEAAE+TL+AYK+AQ+
Sbjct  104  DGILKLLDSRLIPSAASGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLTAYKAAQD  163

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN EL PTHPIRLGLALNFSVFYYEILNSPDRAC+LAKQAFDEAIAELDTLGEESYKDS
Sbjct  164  IANAELPPTHPIRLGLALNFSVFYYEILNSPDRACSLAKQAFDEAIAELDTLGEESYKDS  223

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEA  238
            TLIMQLLRDNLTLWTSDMQDDGADEIKEA
Sbjct  224  TLIMQLLRDNLTLWTSDMQDDGADEIKEA  252



>ref|XP_011074203.1| PREDICTED: 14-3-3-like protein B [Sesamum indicum]
Length=264

 Score =   285 bits (730),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 134/153 (88%), Positives = 148/153 (97%), Gaps = 0/153 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GIL+LLD +LI +A++ +SKVFYLKMKGDYHRYLAEFKTGAERKEAAE+TL+AYK+AQ+
Sbjct  105  DGILQLLDKRLIPSASASDSKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLTAYKAAQD  164

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  165  IANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  224

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPD  226
            TLIMQLLRDNLTLWTSDMQD+GAD+IKEA KP+
Sbjct  225  TLIMQLLRDNLTLWTSDMQDEGADDIKEAPKPE  257



>ref|XP_004152627.1| PREDICTED: 14-3-3-like protein-like [Cucumis sativus]
 ref|XP_004162227.1| PREDICTED: 14-3-3-like protein-like [Cucumis sativus]
 gb|KGN62706.1| hypothetical protein Csa_2G369070 [Cucumis sativus]
Length=261

 Score =   285 bits (729),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 136/149 (91%), Positives = 145/149 (97%), Gaps = 0/149 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLDS+LI +A SG+SKVFYLKMKGDYHRYLAEFKTGAERKEAAE+TL+AYK+AQ+
Sbjct  104  DGILKLLDSRLIPSAASGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLTAYKAAQD  163

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN EL PTHPIRLGLALNFSVFYYEILNSPDRAC+LAKQAFDEAIAELDTLGEESYKDS
Sbjct  164  IANSELPPTHPIRLGLALNFSVFYYEILNSPDRACSLAKQAFDEAIAELDTLGEESYKDS  223

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEA  238
            TLIMQLLRDNLTLWTSDMQDDGADEIKEA
Sbjct  224  TLIMQLLRDNLTLWTSDMQDDGADEIKEA  252



>ref|XP_003615160.1| 14-3-3 protein [Medicago truncatula]
 gb|ACJ84712.1| unknown [Medicago truncatula]
 gb|AES98118.1| general regulatory factor 2 [Medicago truncatula]
Length=260

 Score =   285 bits (729),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 136/150 (91%), Positives = 145/150 (97%), Gaps = 0/150 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            NGILKLLDS+LI +A SG+SKVFYLKMKGDYHRYLAEFK+GAERK+AAE+TL+AYKSAQ+
Sbjct  104  NGILKLLDSRLIPSAASGDSKVFYLKMKGDYHRYLAEFKSGAERKDAAESTLTAYKSAQD  163

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN EL PTHPIRLGLALNFSVFYYEILNSPDRAC LAKQAFDEAIAELDTLGEESYKDS
Sbjct  164  IANSELPPTHPIRLGLALNFSVFYYEILNSPDRACGLAKQAFDEAIAELDTLGEESYKDS  223

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEAS  235
            TLIMQLLRDNLTLWTSDMQDDGADEIKEA+
Sbjct  224  TLIMQLLRDNLTLWTSDMQDDGADEIKEAA  253



>ref|XP_009104576.1| PREDICTED: 14-3-3-like protein GF14 omega [Brassica rapa]
Length=260

 Score =   285 bits (729),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 136/152 (89%), Positives = 145/152 (95%), Gaps = 0/152 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLDS+L+ AA SG+SKVFYLKMKGDYHRYLAEFKTG ERK+AAENTLSAYK+AQ+
Sbjct  102  DGILKLLDSRLVPAAASGDSKVFYLKMKGDYHRYLAEFKTGQERKDAAENTLSAYKAAQD  161

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN ELAPTHPIRLGLALNFSVFYYEILNSPDRAC+LAK AFD+AIAELDTLGEESYKDS
Sbjct  162  IANAELAPTHPIRLGLALNFSVFYYEILNSPDRACSLAKPAFDDAIAELDTLGEESYKDS  221

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKP  229
            TLIMQLLRDNLTLWTSDMQDD ADEIKEAS P
Sbjct  222  TLIMQLLRDNLTLWTSDMQDDAADEIKEASAP  253



>gb|AFK35595.1| unknown [Lotus japonicus]
Length=259

 Score =   285 bits (728),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 138/156 (88%), Positives = 149/156 (96%), Gaps = 1/156 (1%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLDS+LI AA SG+SKVFYLKMKGDYHRYLAEFKTG ERK+AAE+TL+AYKSAQ+
Sbjct  104  DGILKLLDSRLIPAAASGDSKVFYLKMKGDYHRYLAEFKTGTERKDAAESTLAAYKSAQD  163

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN EL PTHPIRLGLALNFSVFYYEILNSPDRAC+LAKQAFDEAIAELDTLGEESYKDS
Sbjct  164  IANSELPPTHPIRLGLALNFSVFYYEILNSPDRACSLAKQAFDEAIAELDTLGEESYKDS  223

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEAS-KPDNE  220
            TLIMQLLRDNLTLWTSDMQD+GADEIKEA+ KPD +
Sbjct  224  TLIMQLLRDNLTLWTSDMQDEGADEIKEAAPKPDEQ  259



>gb|AAK26634.1|AF342780_1 GF14 omega [Brassica napus]
Length=260

 Score =   285 bits (728),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 136/152 (89%), Positives = 145/152 (95%), Gaps = 0/152 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLDS+L+ AA SG+SKVFYLKMKGDYHRYLAEFKTG ERK+AAENTLSAYK+AQ+
Sbjct  102  DGILKLLDSRLVPAAASGDSKVFYLKMKGDYHRYLAEFKTGQERKDAAENTLSAYKAAQD  161

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN ELAPTHPIRLGLALNFSVFYYEILNSPDRAC+LAKQAFD+AIAELDTLGE SYKDS
Sbjct  162  IANAELAPTHPIRLGLALNFSVFYYEILNSPDRACSLAKQAFDDAIAELDTLGEGSYKDS  221

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKP  229
            TLIMQLLRDNLTLWTSDMQDD ADEIKEAS P
Sbjct  222  TLIMQLLRDNLTLWTSDMQDDAADEIKEASAP  253



>gb|KJB12045.1| hypothetical protein B456_002G141000 [Gossypium raimondii]
 gb|KJB12047.1| hypothetical protein B456_002G141000 [Gossypium raimondii]
 gb|KJB12048.1| hypothetical protein B456_002G141000 [Gossypium raimondii]
Length=269

 Score =   285 bits (728),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 136/148 (92%), Positives = 144/148 (97%), Gaps = 0/148 (0%)
 Frame = -1

Query  681  GILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQEI  502
            GILKLLDS+LI +A + +SKVFYLKMKGDYHRYLAEFKTGAERKEAAE+TL+AYKSAQ+I
Sbjct  106  GILKLLDSRLIPSAAAKDSKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLTAYKSAQDI  165

Query  501  ANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDST  322
            AN ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDST
Sbjct  166  ANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDST  225

Query  321  LIMQLLRDNLTLWTSDMQDDGADEIKEA  238
            LIMQLLRDNLTLWTSD+QDDGADEIKEA
Sbjct  226  LIMQLLRDNLTLWTSDLQDDGADEIKEA  253



>ref|XP_008466219.1| PREDICTED: 14-3-3-like protein [Cucumis melo]
Length=258

 Score =   284 bits (726),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 140/156 (90%), Positives = 150/156 (96%), Gaps = 2/156 (1%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLDS+LI +A SG+SKVFYLKMKGDYHRYLAEFKTGAERKEAAE+TL+AYKSAQ+
Sbjct  104  DGILKLLDSRLISSAASGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLTAYKSAQD  163

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN ELAPTHPIRLGLALNFSVFYYEILNSPDRAC+LAKQAFDEAIAELDTLGEESYKDS
Sbjct  164  IANAELAPTHPIRLGLALNFSVFYYEILNSPDRACSLAKQAFDEAIAELDTLGEESYKDS  223

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEAS-KPDNE  220
            TLIMQLLRDNLTLWTSDMQDDG DEIKEA+ K D+E
Sbjct  224  TLIMQLLRDNLTLWTSDMQDDG-DEIKEAAPKRDDE  258



>ref|XP_004136278.1| PREDICTED: 14-3-3-like protein-like [Cucumis sativus]
 ref|XP_004169036.1| PREDICTED: 14-3-3-like protein-like [Cucumis sativus]
 gb|KGN60225.1| hypothetical protein Csa_3G889810 [Cucumis sativus]
Length=258

 Score =   284 bits (726),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 140/156 (90%), Positives = 150/156 (96%), Gaps = 2/156 (1%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLDS+LI +A SG+SKVFYLKMKGDYHRYLAEFKTGAERKEAAE+TL+AYKSAQ+
Sbjct  104  DGILKLLDSRLISSAASGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLTAYKSAQD  163

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN ELAPTHPIRLGLALNFSVFYYEILNSPDRAC+LAKQAFDEAIAELDTLGEESYKDS
Sbjct  164  IANSELAPTHPIRLGLALNFSVFYYEILNSPDRACSLAKQAFDEAIAELDTLGEESYKDS  223

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEAS-KPDNE  220
            TLIMQLLRDNLTLWTSDMQDDG DEIKEA+ K D+E
Sbjct  224  TLIMQLLRDNLTLWTSDMQDDG-DEIKEAAPKRDDE  258



>ref|XP_007141044.1| hypothetical protein PHAVU_008G162500g [Phaseolus vulgaris]
 gb|ESW13038.1| hypothetical protein PHAVU_008G162500g [Phaseolus vulgaris]
Length=261

 Score =   284 bits (726),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 138/156 (88%), Positives = 148/156 (95%), Gaps = 1/156 (1%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLDS+L+ +A SG+SKVFYLKMKGDYHRYLAEFKTG +RKEAAE+TLSAYKSAQ+
Sbjct  104  DGILKLLDSRLVPSAASGDSKVFYLKMKGDYHRYLAEFKTGGDRKEAAESTLSAYKSAQD  163

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN EL PTHPIRLGLALNFSVFYYEILNSPDRAC+LAKQAFDEAIAELDTLGEESYKDS
Sbjct  164  IANSELPPTHPIRLGLALNFSVFYYEILNSPDRACSLAKQAFDEAIAELDTLGEESYKDS  223

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEAS-KPDNE  220
            TLIMQLLRDNLTLWTSDMQDDGADEIKEA+ K D E
Sbjct  224  TLIMQLLRDNLTLWTSDMQDDGADEIKEAAPKADGE  259



>gb|ADP24188.1| 14-3-3-like protein [Galega orientalis]
Length=260

 Score =   283 bits (725),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 136/155 (88%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            NGILKLLDS+LI +A SG+SKVFYLKMKGDYHRYLAEFK+G+ERK+AAE+TL+AYKSAQ+
Sbjct  105  NGILKLLDSRLIPSAASGDSKVFYLKMKGDYHRYLAEFKSGSERKDAAESTLTAYKSAQD  164

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN EL PTHPIRLGLALNFSVFYYEILNSPDRAC LAKQAFDEAIAELDTLGEESYKDS
Sbjct  165  IANSELPPTHPIRLGLALNFSVFYYEILNSPDRACGLAKQAFDEAIAELDTLGEESYKDS  224

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  220
            TLIMQLLRDNLTLWTSDMQDDGADEIKEA+   +E
Sbjct  225  TLIMQLLRDNLTLWTSDMQDDGADEIKEAAPKGDE  259



>sp|P29307.2|1433_OENEH RecName: Full=14-3-3-like protein [Oenothera elata subsp. hookeri]
 emb|CAA44642.1| protein kinase C inhibitor homologue [Oenothera elata subsp. 
hookeri]
Length=260

 Score =   283 bits (724),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 138/155 (89%), Positives = 147/155 (95%), Gaps = 1/155 (1%)
 Frame = -1

Query  681  GILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQEI  502
            GILKLLDS+LI +A SG+SKVFYLKMKGDYHRYLAEFKTGAERKEAAE+TLSAYK+AQ+I
Sbjct  105  GILKLLDSRLIPSAASGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLSAYKAAQDI  164

Query  501  ANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDST  322
            AN ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLA +AFDEAIAELDTL EESYKDST
Sbjct  165  ANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLANEAFDEAIAELDTLEEESYKDST  224

Query  321  LIMQLLRDNLTLWTSDMQDDGADEIKEAS-KPDNE  220
            LIMQLLRDNLTLWTSDMQDDG DEIKEA+ KPD +
Sbjct  225  LIMQLLRDNLTLWTSDMQDDGGDEIKEAAPKPDEQ  259



>ref|XP_009345790.1| PREDICTED: 14-3-3-like protein 16R [Pyrus x bretschneideri]
Length=261

 Score =   283 bits (723),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 136/157 (87%), Positives = 145/157 (92%), Gaps = 0/157 (0%)
 Frame = -1

Query  681  GILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQEI  502
            GILK+L+SKL+ +A  G SKVFYLKMKGDYHRYLAEFKTG ERKEAAENTL+AYK+AQ+I
Sbjct  105  GILKVLESKLVPSAKVGESKVFYLKMKGDYHRYLAEFKTGDERKEAAENTLNAYKAAQDI  164

Query  501  ANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDST  322
            A  ELAPTHPIRLGLALNFSVFYYEILNSPDRAC+LAKQAFDEAIAELDTLGE+SYKDST
Sbjct  165  ATSELAPTHPIRLGLALNFSVFYYEILNSPDRACSLAKQAFDEAIAELDTLGEDSYKDST  224

Query  321  LIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE*SQ  211
            LIMQLLRDNLTLWTSDMQDDG DEIKEASKP  E  Q
Sbjct  225  LIMQLLRDNLTLWTSDMQDDGTDEIKEASKPQAEPQQ  261



>gb|ABY65003.1| 14-3-3d protein [Gossypium hirsutum]
 gb|KJB77547.1| hypothetical protein B456_012G142900 [Gossypium raimondii]
Length=261

 Score =   283 bits (723),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 136/154 (88%), Positives = 145/154 (94%), Gaps = 0/154 (0%)
 Frame = -1

Query  681  GILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQEI  502
            GILKLLD KL+ AA +G+SKVFYLKMKGDYHRYLAEFKTG +RK AAENTL+AYKSAQ+I
Sbjct  105  GILKLLDEKLVPAAGNGDSKVFYLKMKGDYHRYLAEFKTGDDRKSAAENTLTAYKSAQDI  164

Query  501  ANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDST  322
            A  ELAPTHPIRLGLALNFSVFYYEILNSPDRAC+LAKQAFDEAIAELDTLGE+SYKDST
Sbjct  165  AVAELAPTHPIRLGLALNFSVFYYEILNSPDRACSLAKQAFDEAIAELDTLGEDSYKDST  224

Query  321  LIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  220
            LIMQLLRDNLTLWTSDMQDDG DEIKEASKP+ E
Sbjct  225  LIMQLLRDNLTLWTSDMQDDGTDEIKEASKPEEE  258



>gb|EPS72907.1| 14-3-3 a-1 protein [Genlisea aurea]
Length=255

 Score =   282 bits (722),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 140/155 (90%), Positives = 146/155 (94%), Gaps = 2/155 (1%)
 Frame = -1

Query  681  GILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE-  505
            GILKLLDSKL+G A SG+SKVFYLKMKGDYHRYLAEFK GAERKEAAENTL+AYKSAQ+ 
Sbjct  102  GILKLLDSKLVGTAASGDSKVFYLKMKGDYHRYLAEFKIGAERKEAAENTLAAYKSAQQD  161

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN ELAPTHPIRLGLALNFSVFYYEIL+SPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  162  IANSELAPTHPIRLGLALNFSVFYYEILSSPDRACNLAKQAFDEAIAELDTLGEESYKDS  221

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  220
            TLIMQLLRDNLTLWTSDMQDD  DEIKEA+K D E
Sbjct  222  TLIMQLLRDNLTLWTSDMQDD-TDEIKEANKADKE  255



>ref|XP_009350360.1| PREDICTED: 14-3-3-like protein 16R [Pyrus x bretschneideri]
Length=261

 Score =   283 bits (723),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 136/157 (87%), Positives = 144/157 (92%), Gaps = 0/157 (0%)
 Frame = -1

Query  681  GILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQEI  502
            GILK+L+SKL+ AA  G SKVFYLKMKGDYHRYLAEFKTG ERKEAAENTL++YKSAQ+I
Sbjct  105  GILKVLESKLVPAANVGESKVFYLKMKGDYHRYLAEFKTGDERKEAAENTLNSYKSAQDI  164

Query  501  ANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDST  322
            A  ELAPTHPIRLGLALNFSVFYYEILNSPDRAC+LAKQAFDEAIAELDTLGE+SYKDST
Sbjct  165  ATSELAPTHPIRLGLALNFSVFYYEILNSPDRACSLAKQAFDEAIAELDTLGEDSYKDST  224

Query  321  LIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE*SQ  211
            LIMQLLRDNLTLWTSDMQDDG DEIKEA KP  E  Q
Sbjct  225  LIMQLLRDNLTLWTSDMQDDGTDEIKEAPKPQAEAQQ  261



>ref|NP_001239690.1| uncharacterized protein LOC100798989 [Glycine max]
 gb|ACU21064.1| unknown [Glycine max]
Length=262

 Score =   282 bits (722),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 134/150 (89%), Positives = 146/150 (97%), Gaps = 0/150 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLD++L+ +A SG+SKVFYLKMKGDYHRYLAEFKTGA+RKEAAE+TLSAYK+AQ+
Sbjct  105  DGILKLLDTRLVPSAASGDSKVFYLKMKGDYHRYLAEFKTGADRKEAAESTLSAYKAAQD  164

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN EL PTHPIRLGLALNFSVFYYEILNSPDRAC+LAKQAFDEAIAELDTLGEESYKDS
Sbjct  165  IANTELPPTHPIRLGLALNFSVFYYEILNSPDRACSLAKQAFDEAIAELDTLGEESYKDS  224

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEAS  235
            TLIMQLLRDNLTLWTSDMQDDGADEIKEA+
Sbjct  225  TLIMQLLRDNLTLWTSDMQDDGADEIKEAA  254



>ref|XP_010025879.1| PREDICTED: 14-3-3-like protein [Eucalyptus grandis]
 gb|KCW83076.1| hypothetical protein EUGRSUZ_B00034 [Eucalyptus grandis]
Length=263

 Score =   282 bits (722),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GIL LLD++LI AA+ G+SKVFYLKMKGDYHRYLAEFKTG ERKEAAE+TL+AYK+AQ+
Sbjct  109  DGILGLLDTRLIPAASVGDSKVFYLKMKGDYHRYLAEFKTGTERKEAAESTLTAYKAAQD  168

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN ELAPTHPIRLGLALNFSVFYYEILNSPDRAC LAKQAFDEAIAELDTLGEESYKDS
Sbjct  169  IANSELAPTHPIRLGLALNFSVFYYEILNSPDRACGLAKQAFDEAIAELDTLGEESYKDS  228

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  220
            TLIMQLLRDNLTLWTSDMQDDG DEIKE +K D +
Sbjct  229  TLIMQLLRDNLTLWTSDMQDDGVDEIKETAKADEQ  263



>sp|P42653.1|1433A_VICFA RecName: Full=14-3-3-like protein A; AltName: Full=VFA-1433A 
[Vicia faba]
 emb|CAA88415.1| 14-3-3 brain protein homolog [Vicia faba]
Length=261

 Score =   282 bits (722),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 137/158 (87%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            NGILKLLDS+LI +A  G+SKVFYLKMKGDYHRYLAEFK+GAERK+AAE+TL+AYKSAQ+
Sbjct  104  NGILKLLDSRLIPSAALGDSKVFYLKMKGDYHRYLAEFKSGAERKDAAESTLTAYKSAQD  163

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN EL PTHPIRLGLALNFSVFYYEILNSPDRAC LAKQAFDEAIAELDTLGEESYKDS
Sbjct  164  IANTELPPTHPIRLGLALNFSVFYYEILNSPDRACGLAKQAFDEAIAELDTLGEESYKDS  223

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE*SQ  211
            TLIMQLLRDNLTLWTSDMQDDGADEIKEA+   N+  Q
Sbjct  224  TLIMQLLRDNLTLWTSDMQDDGADEIKEAAPKGNDEPQ  261



>gb|AFK37964.1| unknown [Medicago truncatula]
Length=260

 Score =   282 bits (721),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 135/150 (90%), Positives = 144/150 (96%), Gaps = 0/150 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            NGILKLL S+LI +A SG+SKVFYLKMKGDYHRYLAEFK+GAERK+AAE+TL+AYKSAQ+
Sbjct  104  NGILKLLGSRLIPSAASGDSKVFYLKMKGDYHRYLAEFKSGAERKDAAESTLTAYKSAQD  163

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN EL PTHPIRLGLALNFSVFYYEILNSPDRAC LAKQAFDEAIAELDTLGEESYKDS
Sbjct  164  IANSELPPTHPIRLGLALNFSVFYYEILNSPDRACGLAKQAFDEAIAELDTLGEESYKDS  223

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEAS  235
            TLIMQLLRDNLTLWTSDMQDDGADEIKEA+
Sbjct  224  TLIMQLLRDNLTLWTSDMQDDGADEIKEAA  253



>ref|XP_003544808.1| PREDICTED: 14-3-3-like protein-like [Glycine max]
Length=261

 Score =   282 bits (721),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 134/150 (89%), Positives = 146/150 (97%), Gaps = 0/150 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLD++L+ +A SG+SKVFYLKMKGDYHRYLAEFKTGA+RKEAAE+TLSAYK+AQ+
Sbjct  104  DGILKLLDTRLVPSAASGDSKVFYLKMKGDYHRYLAEFKTGADRKEAAESTLSAYKAAQD  163

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN EL PTHPIRLGLALNFSVFYYEILNSPDRAC+LAKQAFDEAIAELDTLGEESYKDS
Sbjct  164  IANTELPPTHPIRLGLALNFSVFYYEILNSPDRACSLAKQAFDEAIAELDTLGEESYKDS  223

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEAS  235
            TLIMQLLRDNLTLWTSDMQDDGADEIKEA+
Sbjct  224  TLIMQLLRDNLTLWTSDMQDDGADEIKEAA  253



>gb|AGV54291.1| 14-3-3 protein [Phaseolus vulgaris]
Length=261

 Score =   282 bits (721),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 134/150 (89%), Positives = 145/150 (97%), Gaps = 0/150 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLDS+L+ +A SG+SKVFYLKMKGDYHRYLAEFKTG +RKEAAE+TLSAYKSAQ+
Sbjct  104  DGILKLLDSRLVPSAASGDSKVFYLKMKGDYHRYLAEFKTGGDRKEAAESTLSAYKSAQD  163

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN EL PTHPIRLGLALNFSVFYYEILNSPDRAC+LAKQAFDEAIAELDTLGEESY+DS
Sbjct  164  IANSELPPTHPIRLGLALNFSVFYYEILNSPDRACSLAKQAFDEAIAELDTLGEESYRDS  223

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEAS  235
            TLIMQLLRDNLTLWTSDMQDDGADEIKEA+
Sbjct  224  TLIMQLLRDNLTLWTSDMQDDGADEIKEAA  253



>emb|CAB42547.1| 14-3-3-like protein [Pisum sativum]
Length=261

 Score =   282 bits (721),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 137/158 (87%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            NGILKLLDS+LI +A  G+SKVFYLKMKGDYHRYLAEFK+GAERK+AAE+TL+AYKSAQ+
Sbjct  104  NGILKLLDSRLIPSAALGDSKVFYLKMKGDYHRYLAEFKSGAERKDAAESTLTAYKSAQD  163

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN EL PTHPIRLGLALNFSVFYYEILNSPDRAC LAKQAFDEAIAELDTLGEESYKDS
Sbjct  164  IANTELPPTHPIRLGLALNFSVFYYEILNSPDRACGLAKQAFDEAIAELDTLGEESYKDS  223

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE*SQ  211
            TLIMQLLRDNLTLWTSDMQDDGADEIKEA+   N+  Q
Sbjct  224  TLIMQLLRDNLTLWTSDMQDDGADEIKEAAPKGNDEPQ  261



>ref|XP_009128290.1| PREDICTED: 14-3-3-like protein GF14 omega [Brassica rapa]
 emb|CDY14618.1| BnaC02g24950D [Brassica napus]
Length=260

 Score =   281 bits (720),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 137/152 (90%), Positives = 144/152 (95%), Gaps = 1/152 (1%)
 Frame = -1

Query  681  GILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQEI  502
            GILKLLDS+L+ AA SG+SKVFYLKMKGDYHRYLAEFKTG ERK+AAENTLSAYKSAQ+I
Sbjct  102  GILKLLDSRLVPAAASGDSKVFYLKMKGDYHRYLAEFKTGQERKDAAENTLSAYKSAQDI  161

Query  501  ANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDST  322
            AN ELAPTHPIRLGLALNFSVFYYEILNSPDRAC+LAKQAFD+AIAELDTLGEESYKDST
Sbjct  162  ANAELAPTHPIRLGLALNFSVFYYEILNSPDRACSLAKQAFDDAIAELDTLGEESYKDST  221

Query  321  LIMQLLRDNLTLWTSDMQDDGAD-EIKEASKP  229
            LIMQLLRDNLTLWTSDMQDD AD EIKE S P
Sbjct  222  LIMQLLRDNLTLWTSDMQDDAADEEIKEESAP  253



>gb|KHG29578.1| Uncharacterized protein F383_10830 [Gossypium arboreum]
Length=261

 Score =   281 bits (719),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 136/154 (88%), Positives = 144/154 (94%), Gaps = 0/154 (0%)
 Frame = -1

Query  681  GILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQEI  502
            GILKLLD KL+ AA +G+SKVFYLKMKGDYHRYLAEFKTG +RK AAENTL+AYKSAQ+I
Sbjct  105  GILKLLDEKLVPAAGNGDSKVFYLKMKGDYHRYLAEFKTGDDRKSAAENTLTAYKSAQDI  164

Query  501  ANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDST  322
            A  ELAPTHPIRLGLALNFSVFYYEILNSPDRAC+LAKQAFDEAIAELDTLGE+SYKDST
Sbjct  165  AVAELAPTHPIRLGLALNFSVFYYEILNSPDRACSLAKQAFDEAIAELDTLGEDSYKDST  224

Query  321  LIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  220
            LIMQLLRDNLTLWTSDMQDDG DEIKEASKP  E
Sbjct  225  LIMQLLRDNLTLWTSDMQDDGTDEIKEASKPAEE  258



>ref|XP_006389998.1| hypothetical protein EUTSA_v10019018mg [Eutrema salsugineum]
 gb|ABY86894.1| 14-3-3 protein GF14 omega [Eutrema halophilum]
 gb|ESQ27284.1| hypothetical protein EUTSA_v10019018mg [Eutrema salsugineum]
Length=260

 Score =   281 bits (719),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 135/152 (89%), Positives = 143/152 (94%), Gaps = 0/152 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLDS LI AA SG+SKVFYLKMKGDYHRYLAEFKTG ERK+AAE+TLSAYK+AQ+
Sbjct  102  DGILKLLDSTLIPAAASGDSKVFYLKMKGDYHRYLAEFKTGQERKDAAEHTLSAYKAAQD  161

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN ELAPTHPIRLGLALNFSVFYYEILNSPDRAC LAKQAFD+AIAELDTLGEESYKDS
Sbjct  162  IANAELAPTHPIRLGLALNFSVFYYEILNSPDRACTLAKQAFDDAIAELDTLGEESYKDS  221

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKP  229
            TLIMQLLRDNLTLWTSDMQDD  +EIKEAS P
Sbjct  222  TLIMQLLRDNLTLWTSDMQDDAPEEIKEASAP  253



>ref|XP_008387340.1| PREDICTED: 14-3-3-like protein 16R [Malus domestica]
Length=261

 Score =   281 bits (718),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 135/157 (86%), Positives = 144/157 (92%), Gaps = 0/157 (0%)
 Frame = -1

Query  681  GILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQEI  502
            GILK+L+SKL+ +A  G SKVFYLKMKGDYHRYLAEFKTG ERKEAAENTL+AYK+AQ+I
Sbjct  105  GILKVLESKLVPSAKVGESKVFYLKMKGDYHRYLAEFKTGDERKEAAENTLNAYKAAQDI  164

Query  501  ANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDST  322
            A  ELAPTHPIRLGLALNFSVFYYEILNSPDRAC+LAKQAFDEAIAELDTLGE+SYKDST
Sbjct  165  ATSELAPTHPIRLGLALNFSVFYYEILNSPDRACSLAKQAFDEAIAELDTLGEDSYKDST  224

Query  321  LIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE*SQ  211
            LIMQLLRDNLTLWTSDMQDDG DEIKEA KP  E  Q
Sbjct  225  LIMQLLRDNLTLWTSDMQDDGTDEIKEAPKPQAEPQQ  261



>gb|ADO95306.1| 14-3-3-like protein GF14 Omega [Eutrema salsugineum]
Length=260

 Score =   281 bits (718),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 135/152 (89%), Positives = 143/152 (94%), Gaps = 0/152 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLDS LI AA SG+SKVFYLKMKGDYHRYLAEFKTG ERK+AAE+TLSAYK+AQ+
Sbjct  102  DGILKLLDSTLIPAAASGDSKVFYLKMKGDYHRYLAEFKTGQERKDAAEHTLSAYKAAQD  161

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN ELAPTHPIRLGLALNFSVFYYEILNSPDRAC LAKQAFD+AIAELDTLGEESYKDS
Sbjct  162  IANAELAPTHPIRLGLALNFSVFYYEILNSPDRACTLAKQAFDDAIAELDTLGEESYKDS  221

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKP  229
            TLIMQLLRDNLTLWTSDMQDD  +EIKEAS P
Sbjct  222  TLIMQLLRDNLTLWTSDMQDDAPEEIKEASAP  253



>ref|XP_009375314.1| PREDICTED: 14-3-3-like protein 16R [Pyrus x bretschneideri]
Length=261

 Score =   281 bits (718),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 135/157 (86%), Positives = 144/157 (92%), Gaps = 0/157 (0%)
 Frame = -1

Query  681  GILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQEI  502
            GILK+L+SKL+ +A  G SKVFYLKMKGDYHRYLAEFKTG ERKEAAENTL+AYK+AQ+I
Sbjct  105  GILKVLESKLVPSAKVGESKVFYLKMKGDYHRYLAEFKTGDERKEAAENTLNAYKAAQDI  164

Query  501  ANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDST  322
            A  ELAPTHPIRLGLALNFSVFYYEILNSPDRAC+LAKQAFDEAIAELDTLGE+SYKDST
Sbjct  165  ATSELAPTHPIRLGLALNFSVFYYEILNSPDRACSLAKQAFDEAIAELDTLGEDSYKDST  224

Query  321  LIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE*SQ  211
            LIMQLLRDNLTLWTSDMQDDG DEIKEA KP  E  Q
Sbjct  225  LIMQLLRDNLTLWTSDMQDDGTDEIKEAPKPQAEPQQ  261



>gb|KJB12306.1| hypothetical protein B456_002G012500 [Gossypium raimondii]
Length=261

 Score =   281 bits (718),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 135/157 (86%), Positives = 147/157 (94%), Gaps = 0/157 (0%)
 Frame = -1

Query  681  GILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQEI  502
            GILKLL+ KL+ AA +G+SKVFYLKMKGDYHRYLAEFKTG +RK AAENTLSAYKSAQ+I
Sbjct  105  GILKLLEEKLVPAAGNGDSKVFYLKMKGDYHRYLAEFKTGDDRKAAAENTLSAYKSAQDI  164

Query  501  ANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDST  322
            A  ELAPTHPIRLGLALNFSVFYYEILNSPDRAC+LAKQAFDEAI+ELDTLGE+SYKDST
Sbjct  165  AVSELAPTHPIRLGLALNFSVFYYEILNSPDRACSLAKQAFDEAISELDTLGEDSYKDST  224

Query  321  LIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE*SQ  211
            LIMQLLRDNLTLWTSDMQ+DG DEIKEASKP++E  Q
Sbjct  225  LIMQLLRDNLTLWTSDMQEDGTDEIKEASKPEDEKQQ  261



>gb|KJB32075.1| hypothetical protein B456_005G222600 [Gossypium raimondii]
Length=261

 Score =   281 bits (718),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 135/154 (88%), Positives = 144/154 (94%), Gaps = 0/154 (0%)
 Frame = -1

Query  681  GILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQEI  502
            GILKLLD KL+ AA +G+SKVFYLKMKGDYHRYLAEFKTG +RK AAENTL+AYKSAQ+I
Sbjct  105  GILKLLDEKLVPAAGTGDSKVFYLKMKGDYHRYLAEFKTGDDRKAAAENTLTAYKSAQDI  164

Query  501  ANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDST  322
            AN ELAPTHPIRLGLALNFSVFYYEILNSPDRAC LAKQAFDEAIAELDTLGE+SYKDST
Sbjct  165  ANAELAPTHPIRLGLALNFSVFYYEILNSPDRACTLAKQAFDEAIAELDTLGEDSYKDST  224

Query  321  LIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  220
            LIMQLLRDNLTLWTSDMQDDG DEIKEA K ++E
Sbjct  225  LIMQLLRDNLTLWTSDMQDDGTDEIKEAPKQEDE  258



>gb|KHG12828.1| Uncharacterized protein F383_00373 [Gossypium arboreum]
Length=261

 Score =   281 bits (718),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 135/157 (86%), Positives = 147/157 (94%), Gaps = 0/157 (0%)
 Frame = -1

Query  681  GILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQEI  502
            GILKLL+ KL+ AA +G+SKVFYLKMKGDYHRYLAEFKTG +RK AAENTLSAYKSAQ+I
Sbjct  105  GILKLLEEKLVPAAGNGDSKVFYLKMKGDYHRYLAEFKTGDDRKAAAENTLSAYKSAQDI  164

Query  501  ANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDST  322
            A  ELAPTHPIRLGLALNFSVFYYEILNSPDRAC+LAKQAFDEAI+ELDTLGE+SYKDST
Sbjct  165  AVSELAPTHPIRLGLALNFSVFYYEILNSPDRACSLAKQAFDEAISELDTLGEDSYKDST  224

Query  321  LIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE*SQ  211
            LIMQLLRDNLTLWTSDMQ+DG DEIKEASKP++E  Q
Sbjct  225  LIMQLLRDNLTLWTSDMQEDGTDEIKEASKPEDEKQQ  261



>ref|NP_001265880.1| 14-3-3-like protein A-like [Cicer arietinum]
 gb|AEE60912.1| 14.3.3-like protein [Cicer arietinum]
Length=261

 Score =   280 bits (717),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 136/158 (86%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            NGILKLLDS+LI +A SG+SKVFYLKMKGDYHRYLA FK+GAERK+AAE+TL+AYKSAQ+
Sbjct  104  NGILKLLDSRLIPSAASGDSKVFYLKMKGDYHRYLAGFKSGAERKDAAESTLTAYKSAQD  163

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN EL PTHPIRLGLALNFSVFYYEILNSPDRAC LAKQAFDEAIAELDTLGEESYKDS
Sbjct  164  IANSELPPTHPIRLGLALNFSVFYYEILNSPDRACGLAKQAFDEAIAELDTLGEESYKDS  223

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE*SQ  211
            TLIMQLLRDNLTLWTSDM+DDGADEIKEA+   N+  Q
Sbjct  224  TLIMQLLRDNLTLWTSDMRDDGADEIKEAAPKGNDEPQ  261



>gb|AEH50082.1| 14-3-3-like protein 2 [Gossypium hirsutum]
Length=261

 Score =   280 bits (717),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 135/157 (86%), Positives = 147/157 (94%), Gaps = 0/157 (0%)
 Frame = -1

Query  681  GILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQEI  502
            GILKLL+ KL+ AA +G+SKVFYLKMKGDYHRYLAEFKTG +RK AAENTLSAYKSAQ+I
Sbjct  105  GILKLLEEKLVPAAGNGDSKVFYLKMKGDYHRYLAEFKTGDDRKAAAENTLSAYKSAQDI  164

Query  501  ANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDST  322
            A  ELAPTHPIRLGLALNFSVFYYEILNSPDRAC+LAKQAFDEAI+ELDTLGE+SYKDST
Sbjct  165  AVSELAPTHPIRLGLALNFSVFYYEILNSPDRACSLAKQAFDEAISELDTLGEDSYKDST  224

Query  321  LIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE*SQ  211
            LIMQLLRDNLTLWTSDMQ+DG DEIKEASKP++E  Q
Sbjct  225  LIMQLLRDNLTLWTSDMQEDGTDEIKEASKPEDEKQQ  261



>ref|XP_008805904.1| PREDICTED: 14-3-3 protein 6-like [Phoenix dactylifera]
Length=258

 Score =   280 bits (715),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 133/155 (86%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            NGILKLLDS+L+ +A + +SKVFYLKMKGDYHRYLAEFK G++RK+AAENTL+AYKSAQ+
Sbjct  103  NGILKLLDSRLVPSAATADSKVFYLKMKGDYHRYLAEFKIGSDRKDAAENTLNAYKSAQD  162

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IA  ELAPTHPIRLGLALNFSVFYYEILNSPDRAC+LAKQAFDEAIAELDTLGEESYKDS
Sbjct  163  IALAELAPTHPIRLGLALNFSVFYYEILNSPDRACSLAKQAFDEAIAELDTLGEESYKDS  222

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  220
            TLIMQLLRDNLTLWTSDMQDDGADEIKE +K ++E
Sbjct  223  TLIMQLLRDNLTLWTSDMQDDGADEIKETTKHEDE  257



>gb|KHG29579.1| Uncharacterized protein F383_10830 [Gossypium arboreum]
Length=280

 Score =   280 bits (716),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 136/154 (88%), Positives = 144/154 (94%), Gaps = 0/154 (0%)
 Frame = -1

Query  681  GILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQEI  502
            GILKLLD KL+ AA +G+SKVFYLKMKGDYHRYLAEFKTG +RK AAENTL+AYKSAQ+I
Sbjct  105  GILKLLDEKLVPAAGNGDSKVFYLKMKGDYHRYLAEFKTGDDRKSAAENTLTAYKSAQDI  164

Query  501  ANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDST  322
            A  ELAPTHPIRLGLALNFSVFYYEILNSPDRAC+LAKQAFDEAIAELDTLGE+SYKDST
Sbjct  165  AVAELAPTHPIRLGLALNFSVFYYEILNSPDRACSLAKQAFDEAIAELDTLGEDSYKDST  224

Query  321  LIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  220
            LIMQLLRDNLTLWTSDMQDDG DEIKEASKP  E
Sbjct  225  LIMQLLRDNLTLWTSDMQDDGTDEIKEASKPAEE  258



>gb|KFK24544.1| hypothetical protein AALP_AAs41798U000400 [Arabis alpina]
Length=264

 Score =   279 bits (714),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 131/152 (86%), Positives = 145/152 (95%), Gaps = 0/152 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLD++LI A+ +G+SKVFYLKMKGDYHRYLAEFKT  ERK+AAE+TL+AYK+AQ+
Sbjct  104  DGILKLLDTRLIPASAAGDSKVFYLKMKGDYHRYLAEFKTSQERKDAAEHTLTAYKAAQD  163

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  164  IANSELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  223

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKP  229
            TLIMQLLRDNLTLWTSDMQD+G +EIKEA+ P
Sbjct  224  TLIMQLLRDNLTLWTSDMQDEGTEEIKEAAAP  255



>ref|XP_006303273.1| hypothetical protein CARUB_v10010011mg [Capsella rubella]
 gb|EOA36171.1| hypothetical protein CARUB_v10010011mg [Capsella rubella]
Length=270

 Score =   280 bits (715),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 130/152 (86%), Positives = 146/152 (96%), Gaps = 0/152 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLD++L+ A+ +G+SKVFYLKMKGDYHRYLAEFKTG ERK++AE+TL+AYK+AQ+
Sbjct  110  DGILKLLDTRLVPASANGDSKVFYLKMKGDYHRYLAEFKTGQERKDSAEHTLTAYKAAQD  169

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  170  IANSELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  229

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKP  229
            TLIMQLLRDNLTLWTSDMQD+G +EIKEA+ P
Sbjct  230  TLIMQLLRDNLTLWTSDMQDEGTEEIKEAAAP  261



>ref|XP_009106540.1| PREDICTED: 14-3-3-like protein GF14 omega [Brassica rapa]
Length=260

 Score =   279 bits (713),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 136/153 (89%), Positives = 145/153 (95%), Gaps = 1/153 (1%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLD +L+ AA SG+SKVFYLKMKGDYHRYLAEFKTG ERK+AAENTLSAYK+AQ+
Sbjct  102  DGILKLLDDRLVPAAGSGDSKVFYLKMKGDYHRYLAEFKTGQERKDAAENTLSAYKAAQD  161

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN ELAPTHPIRLGLALNFSVFYYEILNSPDRAC+LAKQAFDEAIAELDTLGEESYKDS
Sbjct  162  IANAELAPTHPIRLGLALNFSVFYYEILNSPDRACSLAKQAFDEAIAELDTLGEESYKDS  221

Query  324  TLIMQLLRDNLTLWTSDMQDDGA-DEIKEASKP  229
            TLIMQLLRDNLTLWTSDMQDD A +EIKEAS P
Sbjct  222  TLIMQLLRDNLTLWTSDMQDDDAGEEIKEASAP  254



>ref|XP_008790917.1| PREDICTED: 14-3-3 protein 6 [Phoenix dactylifera]
Length=264

 Score =   279 bits (713),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 132/155 (85%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLDS+L+ +A   +SKVFYLKMKGDY+RYLAEFKTG+ERK+AAENTL+AYK+AQ+
Sbjct  109  DGILKLLDSRLVPSAAVADSKVFYLKMKGDYYRYLAEFKTGSERKDAAENTLNAYKAAQD  168

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IA+ ELAPTHPIRLGLALNFSVFYYEILNSPDRAC LAKQAFDEAIAELDTLGEESYKDS
Sbjct  169  IASAELAPTHPIRLGLALNFSVFYYEILNSPDRACTLAKQAFDEAIAELDTLGEESYKDS  228

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  220
            TLIMQLLRDNLTLWTSDMQDDGAD+IKE +K D+E
Sbjct  229  TLIMQLLRDNLTLWTSDMQDDGADDIKETTKNDDE  263



>emb|CDX88436.1| BnaC06g38800D [Brassica napus]
Length=260

 Score =   278 bits (712),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 136/153 (89%), Positives = 145/153 (95%), Gaps = 1/153 (1%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLD +L+ AA SG+SKVFYLKMKGDYHRYLAEFKTG ERK+AAENTLSAYK+AQ+
Sbjct  102  DGILKLLDDRLVPAAGSGDSKVFYLKMKGDYHRYLAEFKTGQERKDAAENTLSAYKAAQD  161

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN ELAPTHPIRLGLALNFSVFYYEILNSPDRAC+LAKQAFDEAIAELDTLGEESYKDS
Sbjct  162  IANAELAPTHPIRLGLALNFSVFYYEILNSPDRACSLAKQAFDEAIAELDTLGEESYKDS  221

Query  324  TLIMQLLRDNLTLWTSDMQDDGA-DEIKEASKP  229
            TLIMQLLRDNLTLWTSDMQDD A +EIKEAS P
Sbjct  222  TLIMQLLRDNLTLWTSDMQDDDAGEEIKEASAP  254



>ref|XP_010455312.1| PREDICTED: 14-3-3-like protein GF14 chi [Camelina sativa]
Length=265

 Score =   279 bits (713),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 135/159 (85%), Positives = 147/159 (92%), Gaps = 1/159 (1%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLD+ L+ AA SG+SKVFYLKMKGDYHRYLAEFK+G ERK+AAE+TL+AYK+AQ+
Sbjct  106  DGILKLLDTILVPAAASGDSKVFYLKMKGDYHRYLAEFKSGQERKDAAEHTLTAYKAAQD  165

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN EL PTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  166  IANSELPPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  225

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEAS-KPDNE*SQ  211
            TLIMQLLRDNLTLWTSDMQDD AD+IKEA+ KP  E  Q
Sbjct  226  TLIMQLLRDNLTLWTSDMQDDAADDIKEAALKPAEEQQQ  264



>ref|XP_006397430.1| hypothetical protein EUTSA_v10001833mg [Eutrema salsugineum]
 gb|ADO95302.1| 14-3-3-like protein GF14 Phi [Eutrema salsugineum]
 gb|ESQ38883.1| hypothetical protein EUTSA_v10001833mg [Eutrema salsugineum]
Length=267

 Score =   279 bits (713),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 131/152 (86%), Positives = 145/152 (95%), Gaps = 0/152 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLD++LI A+ +G+SKVFYLKMKGDYHRYLAEFKTG ERK+AAE+TL+AYK+AQ+
Sbjct  107  DGILKLLDTRLIPASANGDSKVFYLKMKGDYHRYLAEFKTGQERKDAAEHTLAAYKAAQD  166

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN EL PTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  167  IANTELPPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  226

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKP  229
            TLIMQLLRDNLTLWTSDMQD+G +EIKEA+ P
Sbjct  227  TLIMQLLRDNLTLWTSDMQDEGTEEIKEAAAP  258



>ref|XP_010421819.1| PREDICTED: 14-3-3-like protein GF14 chi [Camelina sativa]
Length=265

 Score =   278 bits (712),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 135/159 (85%), Positives = 147/159 (92%), Gaps = 1/159 (1%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLD+ L+ AA SG+SKVFYLKMKGDYHRYLAEFK+G ERK+AAE+TL+AYK+AQ+
Sbjct  106  DGILKLLDTILVPAAASGDSKVFYLKMKGDYHRYLAEFKSGQERKDAAEHTLTAYKAAQD  165

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN EL PTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  166  IANSELPPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  225

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEAS-KPDNE*SQ  211
            TLIMQLLRDNLTLWTSDMQDD AD+IKEA+ KP  E  Q
Sbjct  226  TLIMQLLRDNLTLWTSDMQDDAADDIKEAAPKPAEEQQQ  264



>gb|ABY65002.1| 14-3-3c protein [Gossypium hirsutum]
Length=261

 Score =   278 bits (712),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 133/154 (86%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = -1

Query  681  GILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQEI  502
            GILKLLD KL+ AA +G+SKVFYLKMKGDYHRYLAEFKTG +RK AAENTL+AYKSAQEI
Sbjct  105  GILKLLDEKLVPAAKTGDSKVFYLKMKGDYHRYLAEFKTGDDRKAAAENTLTAYKSAQEI  164

Query  501  ANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDST  322
            A  ELAPTHPIRLGLALNFSVFYYEILNSPDRAC+LAKQAFDEAI+ELDTLGE+SYKDST
Sbjct  165  ATSELAPTHPIRLGLALNFSVFYYEILNSPDRACSLAKQAFDEAISELDTLGEDSYKDST  224

Query  321  LIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  220
            LIMQLLRDNLTLWTSDMQDD  DEIKEA K + E
Sbjct  225  LIMQLLRDNLTLWTSDMQDDATDEIKEAPKREEE  258



>ref|NP_564453.1| 14-3-3-like protein GF14 phi [Arabidopsis thaliana]
 sp|P46077.2|14334_ARATH RecName: Full=14-3-3-like protein GF14 phi; AltName: Full=General 
regulatory factor 4 [Arabidopsis thaliana]
 gb|AAG50610.1|AC079605_15 14-3-3 protein, putative [Arabidopsis thaliana]
 gb|AAB06231.1| GF14 protein phi chain [Arabidopsis thaliana]
 gb|AAB62224.1| 14-3-3-like protein GF14 phi [Arabidopsis thaliana]
 gb|AAM60925.1| 14-3-3 protein GF14phi (grf4) [Arabidopsis thaliana]
 gb|AEE31760.1| 14-3-3-like protein GF14 phi [Arabidopsis thaliana]
Length=267

 Score =   278 bits (712),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 130/152 (86%), Positives = 145/152 (95%), Gaps = 0/152 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLD++L+ A+ +G+SKVFYLKMKGDYHRYLAEFKTG ERK+AAE+TL+AYK+AQ+
Sbjct  107  DGILKLLDTRLVPASANGDSKVFYLKMKGDYHRYLAEFKTGQERKDAAEHTLTAYKAAQD  166

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  167  IANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  226

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKP  229
            TLIMQLLRDNLTLWTSDMQD+  +EIKEA+ P
Sbjct  227  TLIMQLLRDNLTLWTSDMQDESPEEIKEAAAP  258



>ref|XP_002891161.1| At1g35160/T32G9_30 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67420.1| At1g35160/T32G9_30 [Arabidopsis lyrata subsp. lyrata]
Length=267

 Score =   278 bits (712),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 130/152 (86%), Positives = 145/152 (95%), Gaps = 0/152 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLD++L+ A+ +G+SKVFYLKMKGDYHRYLAEFKTG ERK+AAE+TL+AYK+AQ+
Sbjct  107  DGILKLLDTRLVPASANGDSKVFYLKMKGDYHRYLAEFKTGQERKDAAEHTLTAYKAAQD  166

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  167  IANSELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  226

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKP  229
            TLIMQLLRDNLTLWTSDMQD+  +EIKEA+ P
Sbjct  227  TLIMQLLRDNLTLWTSDMQDESPEEIKEAAAP  258



>gb|AAK63949.1| At1g35160/T32G9_30 [Arabidopsis thaliana]
 gb|AAL31165.1| At1g35160/T32G9_30 [Arabidopsis thaliana]
Length=267

 Score =   278 bits (711),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 130/152 (86%), Positives = 145/152 (95%), Gaps = 0/152 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLD++L+ A+ +G+SKVFYLKMKGDYHRYLAEFKTG ERK+AAE+TL+AYK+AQ+
Sbjct  107  DGILKLLDTRLVPASANGDSKVFYLKMKGDYHRYLAEFKTGQERKDAAEHTLTAYKAAQD  166

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  167  IANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  226

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKP  229
            TLIMQLLRDNLTLWTSDMQD+  +EIKEA+ P
Sbjct  227  TLIMQLLRDNLTLWTSDMQDESPEEIKEAAAP  258



>ref|XP_006433941.1| hypothetical protein CICLE_v10003615mg, partial [Citrus clementina]
 gb|ESR47181.1| hypothetical protein CICLE_v10003615mg, partial [Citrus clementina]
Length=398

 Score =   283 bits (723),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 141/185 (76%), Positives = 152/185 (82%), Gaps = 30/185 (16%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLDS+LI  A+SG+SKVFYLKMKGDYHRYLAEFKTGAERKEAAE+TL+AYK+AQ+
Sbjct  212  DGILKLLDSRLIPCASSGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLTAYKAAQD  271

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  272  IANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  331

Query  324  TLIMQLLRDNLTLWTSDM------------------------------QDDGADEIKEAS  235
            TLIMQLLRDNLTLWTSDM                              QDDGADEIKEA+
Sbjct  332  TLIMQLLRDNLTLWTSDMQVLYSVCFSTHFCTFRNDVCFDVEQFLVFDQDDGADEIKEAA  391

Query  234  KPDNE  220
            KP++E
Sbjct  392  KPESE  396



>gb|KJB79630.1| hypothetical protein B456_013G059800 [Gossypium raimondii]
Length=261

 Score =   278 bits (710),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 133/154 (86%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = -1

Query  681  GILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQEI  502
            GILKLLD KL+ AA +G+SKVFYLKMKGDYHRYLAEFKTG +RK AAENTL+AYKSAQEI
Sbjct  105  GILKLLDEKLVPAAKTGDSKVFYLKMKGDYHRYLAEFKTGDDRKAAAENTLTAYKSAQEI  164

Query  501  ANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDST  322
            A  ELAPTHPIRLGLALNFSVFYYEILNSPDRAC+LAKQAFDEAI+ELDTLGE+SYKDST
Sbjct  165  ATSELAPTHPIRLGLALNFSVFYYEILNSPDRACSLAKQAFDEAISELDTLGEDSYKDST  224

Query  321  LIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  220
            LIMQLLRDNLTLWTSDMQDD  DEIKEA K + E
Sbjct  225  LIMQLLRDNLTLWTSDMQDDATDEIKEAPKREEE  258



>gb|AGC13184.1| 14-3-3 protein [Spinacia oleracea]
Length=266

 Score =   278 bits (710),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 131/148 (89%), Positives = 143/148 (97%), Gaps = 0/148 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLD+KL+ AA+SG+SKVFYLKMKGDYHRYLAEFKTGA+RKEAAE+TL+AYK+AQ+
Sbjct  103  DGILKLLDTKLVPAASSGDSKVFYLKMKGDYHRYLAEFKTGAQRKEAAESTLTAYKAAQD  162

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAF EAIAELDTLGE+SYKDS
Sbjct  163  IANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFVEAIAELDTLGEDSYKDS  222

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKE  241
            TLIMQLLRDNLTLWTSDMQD+ ADEI E
Sbjct  223  TLIMQLLRDNLTLWTSDMQDEAADEITE  250



>emb|CDX87455.1| BnaA07g34180D [Brassica napus]
Length=299

 Score =   278 bits (712),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 135/153 (88%), Positives = 145/153 (95%), Gaps = 1/153 (1%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLD +L+ AA SG+SKVFYLKMKGDYHRYLAEFKTG ERK+AAENTLSAYK+AQ+
Sbjct  141  DGILKLLDDRLVPAAGSGDSKVFYLKMKGDYHRYLAEFKTGQERKDAAENTLSAYKAAQD  200

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN ELAPTHPIRLGLALNFSVFYYEILNSPDRAC+LAKQAFDEAIAELDTLGEESYKDS
Sbjct  201  IANAELAPTHPIRLGLALNFSVFYYEILNSPDRACSLAKQAFDEAIAELDTLGEESYKDS  260

Query  324  TLIMQLLRDNLTLWTSDMQDDGA-DEIKEASKP  229
            TLIMQLLRDNLTLWTSDMQDD A +EIKE+S P
Sbjct  261  TLIMQLLRDNLTLWTSDMQDDDAGEEIKESSAP  293



>gb|ACN39847.1| unknown [Picea sitchensis]
 gb|ACN39934.1| unknown [Picea sitchensis]
 gb|ACN40751.1| unknown [Picea sitchensis]
Length=264

 Score =   277 bits (709),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 133/152 (88%), Positives = 141/152 (93%), Gaps = 0/152 (0%)
 Frame = -1

Query  681  GILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQEI  502
            GIL+LLDS LI ++T+  SKVFYLKMKGDYHRYLAEFKTGAERKEAAENTL AYKSAQ+I
Sbjct  108  GILRLLDSHLIPSSTAAESKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLLAYKSAQDI  167

Query  501  ANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDST  322
            A  ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGE+SYKDST
Sbjct  168  AAAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEDSYKDST  227

Query  321  LIMQLLRDNLTLWTSDMQDDGADEIKEASKPD  226
            LIMQLLRDNLTLWTSDMQ++  DEIKE SK D
Sbjct  228  LIMQLLRDNLTLWTSDMQEEAGDEIKETSKRD  259



>ref|XP_010937379.1| PREDICTED: 14-3-3-like protein B [Elaeis guineensis]
Length=261

 Score =   277 bits (709),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 132/155 (85%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            NGILKLLDS L+ +A + +SKVFYLKMKGDYHRYLAEFK G++RK+AAENTL+AYK+AQ+
Sbjct  104  NGILKLLDSCLVPSAAAADSKVFYLKMKGDYHRYLAEFKIGSDRKDAAENTLNAYKAAQD  163

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IA  ELAPTHPIRLGLALNFSVFYYEILNSPDRAC+LAKQAFDEAIAELDTLGEESYKDS
Sbjct  164  IALAELAPTHPIRLGLALNFSVFYYEILNSPDRACSLAKQAFDEAIAELDTLGEESYKDS  223

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  220
            TLIMQLLRDNLTLWTSDMQDDGADEIKE +K ++E
Sbjct  224  TLIMQLLRDNLTLWTSDMQDDGADEIKETTKREDE  258



>gb|AEA03664.1| 14-3-3 protein 3 [Hevea brasiliensis]
Length=264

 Score =   277 bits (709),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 132/154 (86%), Positives = 145/154 (94%), Gaps = 0/154 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLD++LI  A+ G+SKVFYLKMKGDYHRYLAEFKTGAERKEAAE+TL+AYKSAQ+
Sbjct  104  DGILKLLDTRLIPPASPGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLTAYKSAQD  163

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IA  ELAPTHPIRLGLALNFSVFYYEILNSPDRAC+LAKQAFDEAIAELDTLGEESYKDS
Sbjct  164  IATAELAPTHPIRLGLALNFSVFYYEILNSPDRACSLAKQAFDEAIAELDTLGEESYKDS  223

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDN  223
            TLIMQLLRDNLTLWTSD+ D+  DEIKEASK ++
Sbjct  224  TLIMQLLRDNLTLWTSDIADEAGDEIKEASKRES  257



>sp|P29308.1|1433_SPIOL RecName: Full=14-3-3-like protein, partial [Spinacia oleracea]
 emb|CAA44641.1| protein kinase C inhibitor homologue [Spinacia oleracea]
Length=220

 Score =   275 bits (704),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 131/148 (89%), Positives = 143/148 (97%), Gaps = 0/148 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLD+KL+ AA+SG+SKVFYLKMKGDYHRYLAEFKTGA+RKEAAE+TL+AYK+AQ+
Sbjct  57   DGILKLLDTKLVPAASSGDSKVFYLKMKGDYHRYLAEFKTGAQRKEAAESTLTAYKAAQD  116

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAF EAIAELDTLGE+SYKDS
Sbjct  117  IANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFVEAIAELDTLGEDSYKDS  176

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKE  241
            TLIMQLLRDNLTLWTSDMQD+ ADEI E
Sbjct  177  TLIMQLLRDNLTLWTSDMQDEAADEITE  204



>ref|XP_010917299.1| PREDICTED: 14-3-3-like protein [Elaeis guineensis]
Length=258

 Score =   277 bits (708),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 133/154 (86%), Positives = 144/154 (94%), Gaps = 0/154 (0%)
 Frame = -1

Query  681  GILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQEI  502
            GILKLLD+ LI +A+S  SKVFY KMKGDYHRYLAEFKTG+ERK+AAE+TL+AYKSAQ+I
Sbjct  103  GILKLLDASLIPSASSAESKVFYHKMKGDYHRYLAEFKTGSERKDAAESTLAAYKSAQDI  162

Query  501  ANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDST  322
            A  ELAPTHPIRLGL+LNFSVFYYEILNSPDRAC LAKQAFDEAIAELDTLGEESYKDST
Sbjct  163  AVAELAPTHPIRLGLSLNFSVFYYEILNSPDRACTLAKQAFDEAIAELDTLGEESYKDST  222

Query  321  LIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  220
            LIMQLLRDNLTLWTSDMQDDGADEIKEA K ++E
Sbjct  223  LIMQLLRDNLTLWTSDMQDDGADEIKEAPKHEDE  256



>gb|ABE01401.1| 14-3-3 protein [Camellia sinensis]
Length=260

 Score =   277 bits (708),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLD+KLI +AT+G+SKVFYLKMKGDYHRYLAEFKTG+ERKEAAENTL+AYK+AQ+
Sbjct  104  DGILKLLDTKLIPSATAGDSKVFYLKMKGDYHRYLAEFKTGSERKEAAENTLNAYKAAQD  163

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN ELAPTHPIRLGLALNFSVFYYEILNSPDRAC+LAKQAFDEAIAELDTL E+SYKDS
Sbjct  164  IANTELAPTHPIRLGLALNFSVFYYEILNSPDRACSLAKQAFDEAIAELDTLVEDSYKDS  223

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  220
            TLIMQLLRDNLTL TSD QDDGA+EIKEA K + E
Sbjct  224  TLIMQLLRDNLTLRTSDTQDDGAEEIKEAPKHEEE  258



>ref|XP_007042905.1| General regulatory factor 2, OMEGA [Theobroma cacao]
 gb|EOX98736.1| General regulatory factor 2, OMEGA [Theobroma cacao]
Length=261

 Score =   277 bits (708),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 133/157 (85%), Positives = 145/157 (92%), Gaps = 0/157 (0%)
 Frame = -1

Query  681  GILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQEI  502
            GIL LL+ KL+ AA +G+SKVFYLKMKGDYHRYLAEFKTG +RK AAENTL+AYKSAQ+I
Sbjct  105  GILNLLEEKLVPAAGTGDSKVFYLKMKGDYHRYLAEFKTGDDRKAAAENTLTAYKSAQDI  164

Query  501  ANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDST  322
            AN ELAPTHPIRLGLALNFSVFYYEILNSPDRAC+LAKQAFDEAI+ELDTLGE+SYKDST
Sbjct  165  ANAELAPTHPIRLGLALNFSVFYYEILNSPDRACSLAKQAFDEAISELDTLGEDSYKDST  224

Query  321  LIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE*SQ  211
            LIMQLLRDNLTLWTSDMQDDG DEIKEA K ++E  Q
Sbjct  225  LIMQLLRDNLTLWTSDMQDDGTDEIKEAPKREDEKQQ  261



>gb|AAD27827.2| 14-3-3 protein [Picea glauca]
Length=259

 Score =   275 bits (704),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 133/152 (88%), Positives = 140/152 (92%), Gaps = 0/152 (0%)
 Frame = -1

Query  681  GILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQEI  502
            GIL+LLDS LI ++T+  SKVFYLKMKGDYHRYLAEFKTGAERKEAAENTL AYKSAQ+I
Sbjct  103  GILRLLDSHLIPSSTAAESKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLLAYKSAQDI  162

Query  501  ANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDST  322
            A  ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAF EAIAELDTLGE+SYKDST
Sbjct  163  AAAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFGEAIAELDTLGEDSYKDST  222

Query  321  LIMQLLRDNLTLWTSDMQDDGADEIKEASKPD  226
            LIMQLLRDNLTLWTSDMQ+D  DEIKE SK D
Sbjct  223  LIMQLLRDNLTLWTSDMQEDAGDEIKETSKRD  254



>ref|NP_567344.1| 14-3-3-like protein GF14 chi [Arabidopsis thaliana]
 sp|P42643.3|14331_ARATH RecName: Full=14-3-3-like protein GF14 chi; AltName: Full=General 
regulatory factor 1 [Arabidopsis thaliana]
 gb|AAL06520.1|AF412067_1 AT4g09000/F23J3_30 [Arabidopsis thaliana]
 emb|CAB78024.1| 14-3-3-like protein [Arabidopsis thaliana]
 gb|AAL57697.1| AT4g09000/F23J3_30 [Arabidopsis thaliana]
 gb|AAM63348.1| 14-3-3 protein GF14chi (grf1) [Arabidopsis thaliana]
 gb|ABD19670.1| At4g09000 [Arabidopsis thaliana]
 gb|AEE82709.1| 14-3-3-like protein GF14 chi [Arabidopsis thaliana]
Length=267

 Score =   275 bits (704),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 131/148 (89%), Positives = 142/148 (96%), Gaps = 0/148 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLD+ L+ AA SG+SKVFYLKMKGDYHRYLAEFK+G ERK+AAE+TL+AYK+AQ+
Sbjct  106  DGILKLLDTILVPAAASGDSKVFYLKMKGDYHRYLAEFKSGQERKDAAEHTLTAYKAAQD  165

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  166  IANSELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  225

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKE  241
            TLIMQLLRDNLTLWTSDMQDD AD+IKE
Sbjct  226  TLIMQLLRDNLTLWTSDMQDDVADDIKE  253



>ref|XP_010530165.1| PREDICTED: 14-3-3-like protein GF14 chi [Tarenaya hassleriana]
Length=260

 Score =   275 bits (703),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 136/156 (87%), Positives = 148/156 (95%), Gaps = 3/156 (2%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLD++LI  A++G+SKVFYLKMKGDYHRYLAEFKTG ERK+AAE+TL+AYKSAQ+
Sbjct  103  DGILKLLDTRLIPGASAGDSKVFYLKMKGDYHRYLAEFKTGQERKDAAEHTLNAYKSAQD  162

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  163  IANTELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  222

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEAS-KPDNE  220
            TLIMQLLRDNLTLWTSDMQDD  DEIKEA+ KP +E
Sbjct  223  TLIMQLLRDNLTLWTSDMQDD--DEIKEAAPKPADE  256



>gb|KHG12867.1| Uncharacterized protein F383_16851 [Gossypium arboreum]
Length=266

 Score =   275 bits (704),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 131/146 (90%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLD +LI AA++  SKVFYLKMKGDYHRYLAEFK GAERKEAAE+TLSAYKSAQ+
Sbjct  106  DGILKLLDKRLIPAASAAESKVFYLKMKGDYHRYLAEFKAGAERKEAAESTLSAYKSAQD  165

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IA  EL PTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  166  IATAELPPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  225

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEI  247
            TLIMQLLRDNLTLWTSD+QDDGADEI
Sbjct  226  TLIMQLLRDNLTLWTSDLQDDGADEI  251



>gb|KJB59911.1| hypothetical protein B456_009G280500 [Gossypium raimondii]
Length=266

 Score =   275 bits (703),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 131/146 (90%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLD +LI AA++  SKVFYLKMKGDYHRYLAEFK GAERKEAAE+TLSAYKSAQ+
Sbjct  106  DGILKLLDKRLIPAASAAESKVFYLKMKGDYHRYLAEFKAGAERKEAAESTLSAYKSAQD  165

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IA  EL PTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  166  IATAELPPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  225

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEI  247
            TLIMQLLRDNLTLWTSD+QDDGADEI
Sbjct  226  TLIMQLLRDNLTLWTSDLQDDGADEI  251



>gb|ADK93080.1| 14-3-3g protein [Gossypium hirsutum]
 gb|KHG21797.1| Uncharacterized protein F383_27919 [Gossypium arboreum]
Length=262

 Score =   275 bits (703),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 132/154 (86%), Positives = 144/154 (94%), Gaps = 0/154 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GIL LL+S LI +A+S  SKVFYLKMKGDYHRYLAEFKTGAERKEAAE+TL AYKSAQ+
Sbjct  104  DGILSLLESHLIPSASSAESKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLLAYKSAQD  163

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IA G+LAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAI+ELDTLGEESYKDS
Sbjct  164  IALGDLAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAISELDTLGEESYKDS  223

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDN  223
            TLIMQLLRDNLTLWTSD+ D+  DEIKEASKP++
Sbjct  224  TLIMQLLRDNLTLWTSDITDEAGDEIKEASKPES  257



>ref|XP_009388642.1| PREDICTED: 14-3-3-like protein [Musa acuminata subsp. malaccensis]
 ref|XP_009388643.1| PREDICTED: 14-3-3-like protein [Musa acuminata subsp. malaccensis]
 ref|XP_009388644.1| PREDICTED: 14-3-3-like protein [Musa acuminata subsp. malaccensis]
 ref|XP_009388645.1| PREDICTED: 14-3-3-like protein [Musa acuminata subsp. malaccensis]
 ref|XP_009388647.1| PREDICTED: 14-3-3-like protein [Musa acuminata subsp. malaccensis]
Length=261

 Score =   274 bits (701),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 132/154 (86%), Positives = 143/154 (93%), Gaps = 0/154 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLDS L+ +ATS  SKVFYLKMKGDYHRYLAEFKTGAERKEAAE+TL AYKSAQ+
Sbjct  104  DGILKLLDSHLVPSATSAESKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLVAYKSAQD  163

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IA  ELAPTHPIRLGLALNFSVFYYEILNSPDRAC+LAKQAFDEAI+ELDTLGEESYKDS
Sbjct  164  IALAELAPTHPIRLGLALNFSVFYYEILNSPDRACSLAKQAFDEAISELDTLGEESYKDS  223

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDN  223
            TLIMQLLRDNLTLWTSD+ +DGADEIKE  K ++
Sbjct  224  TLIMQLLRDNLTLWTSDITEDGADEIKETPKKES  257



>ref|XP_006659421.1| PREDICTED: 14-3-3-like protein GF14-C-like [Oryza brachyantha]
Length=256

 Score =   274 bits (701),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 130/153 (85%), Positives = 144/153 (94%), Gaps = 0/153 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLDS L+ ++T+  SKVFYLKMKGDYHRYLAEFKTGAERKEAAE+T+ AYK+AQ+
Sbjct  99   DGILKLLDSHLVPSSTAAESKVFYLKMKGDYHRYLAEFKTGAERKEAAESTMVAYKAAQD  158

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IA  ELAPTHPIRLGLALNFSVFYYEILNSPD+ACNLAKQAFDEAI+ELDTLGEESYKDS
Sbjct  159  IALAELAPTHPIRLGLALNFSVFYYEILNSPDKACNLAKQAFDEAISELDTLGEESYKDS  218

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPD  226
            TLIMQLLRDNLTLWTSD+ +DGADE+KEASK D
Sbjct  219  TLIMQLLRDNLTLWTSDLTEDGADEVKEASKGD  251



>ref|XP_009380873.1| PREDICTED: 14-3-3 protein 6-like [Musa acuminata subsp. malaccensis]
Length=256

 Score =   274 bits (701),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 131/154 (85%), Positives = 144/154 (94%), Gaps = 0/154 (0%)
 Frame = -1

Query  681  GILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQEI  502
            GIL+LL+ +LI AA + +SKVFYLKMKGDYHRYLAEF TG+ERK+AAENTL+AYK+AQ+I
Sbjct  103  GILRLLEDRLIPAAAAADSKVFYLKMKGDYHRYLAEFTTGSERKDAAENTLAAYKAAQDI  162

Query  501  ANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDST  322
            +  EL PTHPIRLGLALNFSVFYYEILNSPDRAC+LAKQAFDEAIAELDTLGEESYKDST
Sbjct  163  SLAELPPTHPIRLGLALNFSVFYYEILNSPDRACSLAKQAFDEAIAELDTLGEESYKDST  222

Query  321  LIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  220
            LIMQLLRDNLTLWTSDMQDDG DEIKEASK D+E
Sbjct  223  LIMQLLRDNLTLWTSDMQDDGMDEIKEASKLDDE  256



>gb|AGG10561.1| 14-3-3 [Elaeis guineensis]
Length=258

 Score =   274 bits (700),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 131/155 (85%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            NGILKLLDS+L+ +A + +SKVFYLKMKGDYHRYLAEFK G++RK+AAENTL+AYKSAQ+
Sbjct  102  NGILKLLDSRLVPSAAAADSKVFYLKMKGDYHRYLAEFKIGSDRKDAAENTLNAYKSAQD  161

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IA  ELAPTHPIRLGL+LNFSVFYYEILNSPDRAC LAKQAFDEAIAELDTLGEESYKDS
Sbjct  162  IAVAELAPTHPIRLGLSLNFSVFYYEILNSPDRACALAKQAFDEAIAELDTLGEESYKDS  221

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  220
            TLIMQLLRDNLTLWTSDMQDDG DE KEA K + E
Sbjct  222  TLIMQLLRDNLTLWTSDMQDDGVDEFKEAPKHEGE  256



>ref|XP_010916166.1| PREDICTED: 14-3-3-like protein [Elaeis guineensis]
Length=261

 Score =   274 bits (700),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 132/154 (86%), Positives = 144/154 (94%), Gaps = 0/154 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLDS LI +AT+  SKVFYLKMKGDYHRYLAEFKTGAERKEAAE+TL AYKSAQ+
Sbjct  104  DGILKLLDSHLIPSATAAESKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLLAYKSAQD  163

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IA  ELAPTHPIRLGLALNFSVFYYEILNSPDRAC+LAKQAFDEAI+ELDTLGEESYKDS
Sbjct  164  IALAELAPTHPIRLGLALNFSVFYYEILNSPDRACSLAKQAFDEAISELDTLGEESYKDS  223

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDN  223
            TLIMQLLRDNLTLWTSD+ +DG DEIKEA+K ++
Sbjct  224  TLIMQLLRDNLTLWTSDITEDGGDEIKEATKRES  257



>ref|XP_009408999.1| PREDICTED: 14-3-3-like protein GF14-C [Musa acuminata subsp. 
malaccensis]
Length=261

 Score =   274 bits (700),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 131/154 (85%), Positives = 144/154 (94%), Gaps = 0/154 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLDS L+ +A++  SKVFYLKMKGDYHRYLAEFKTGAERKEAAE+TL AYKSAQ+
Sbjct  104  DGILKLLDSHLVPSASAAESKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLVAYKSAQD  163

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IA  ELAPTHPIRLGLALNFSVFYYEILNSPDRAC+LAKQAFDEAI+ELDTLGEESYKDS
Sbjct  164  IALAELAPTHPIRLGLALNFSVFYYEILNSPDRACSLAKQAFDEAISELDTLGEESYKDS  223

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDN  223
            TLIMQLLRDNLTLWTSD+ +DGADEIKEA K ++
Sbjct  224  TLIMQLLRDNLTLWTSDITEDGADEIKEAPKKES  257



>emb|CDX73313.1| BnaC05g27930D [Brassica napus]
Length=265

 Score =   274 bits (700),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 131/157 (83%), Positives = 146/157 (93%), Gaps = 2/157 (1%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLD++LI A+ +G+SKVFYLKMKGDYHRYLAEFKT  ERK+AAE+TL+AYK+AQ+
Sbjct  105  DGILKLLDTRLIPASANGDSKVFYLKMKGDYHRYLAEFKTAQERKDAAEHTLTAYKAAQD  164

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN EL PTHPIRLGLALNFSVFYYEILNSPDRAC+LAKQAFDEAIAELDTLGEESYKDS
Sbjct  165  IANSELPPTHPIRLGLALNFSVFYYEILNSPDRACSLAKQAFDEAIAELDTLGEESYKDS  224

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKE--ASKPDNE  220
            TLIMQLLRDNLTLWTSDMQD+G +EIKE  A+KP  E
Sbjct  225  TLIMQLLRDNLTLWTSDMQDEGTEEIKEAAATKPAEE  261



>ref|XP_010436066.1| PREDICTED: 14-3-3-like protein GF14 chi [Camelina sativa]
Length=268

 Score =   273 bits (699),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 129/146 (88%), Positives = 140/146 (96%), Gaps = 0/146 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLD+ L+ AA SG+SKVFYLKMKGDYHRYLAEFK+G ERK+AAE+TL+AYK+AQ+
Sbjct  106  DGILKLLDTILVPAAASGDSKVFYLKMKGDYHRYLAEFKSGQERKDAAEHTLTAYKAAQD  165

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  166  IANSELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  225

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEI  247
            TLIMQLLRDNLTLWTSDMQDD AD+I
Sbjct  226  TLIMQLLRDNLTLWTSDMQDDAADDI  251



>ref|XP_008778192.1| PREDICTED: 14-3-3 protein 6-like [Phoenix dactylifera]
Length=262

 Score =   273 bits (699),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 130/155 (84%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +G LKLLD+ LI +A+  +SKVFYLKMKGDYHRYLAEFKTG++RK+AAE+TL+AYKSAQ+
Sbjct  106  SGFLKLLDASLIPSASVSDSKVFYLKMKGDYHRYLAEFKTGSDRKDAAESTLAAYKSAQD  165

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IA  ELAPTHPIRLGL+LNFSVFYYEILNSPDRAC LAKQAFDEAIAELDTLGEESYKDS
Sbjct  166  IAAAELAPTHPIRLGLSLNFSVFYYEILNSPDRACTLAKQAFDEAIAELDTLGEESYKDS  225

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  220
            TLIMQLLRDNLTLWTSDMQDDG DEIKEA K ++E
Sbjct  226  TLIMQLLRDNLTLWTSDMQDDGVDEIKEAPKHEDE  260



>gb|AAA96254.1| GF14chi isoform [Arabidopsis thaliana]
 gb|AAA96323.1| GF14 chi chain [Arabidopsis thaliana]
Length=267

 Score =   273 bits (699),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 130/148 (88%), Positives = 141/148 (95%), Gaps = 0/148 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLD+ L+ AA SG+SKVFYLKMKGDYHRYLAEFK+G ERK+AAE+TL+AYK+AQ+
Sbjct  106  DGILKLLDTILVPAAASGDSKVFYLKMKGDYHRYLAEFKSGQERKDAAEHTLTAYKAAQD  165

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  166  IANSELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  225

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKE  241
            TLIMQLLRDNLTLW SDMQDD AD+IKE
Sbjct  226  TLIMQLLRDNLTLWASDMQDDVADDIKE  253



>ref|XP_006288456.1| hypothetical protein CARUB_v10001717mg [Capsella rubella]
 gb|EOA21354.1| hypothetical protein CARUB_v10001717mg [Capsella rubella]
Length=268

 Score =   273 bits (699),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 129/146 (88%), Positives = 140/146 (96%), Gaps = 0/146 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLD+ L+ AA SG+SKVFYLKMKGDYHRYLAEFK+G ERK+AAE+TL+AYK+AQ+
Sbjct  106  DGILKLLDTILVPAAASGDSKVFYLKMKGDYHRYLAEFKSGQERKDAAEHTLTAYKAAQD  165

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  166  IANSELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  225

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEI  247
            TLIMQLLRDNLTLWTSDMQDD AD+I
Sbjct  226  TLIMQLLRDNLTLWTSDMQDDAADDI  251



>ref|XP_008782168.1| PREDICTED: 14-3-3 protein 6-like [Phoenix dactylifera]
Length=258

 Score =   273 bits (698),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 131/154 (85%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = -1

Query  681  GILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQEI  502
            GILKLL+  LI +A++  SKVFYLKM GDYHRYLAEFKTG++RK+AAE+TLSAYKSAQEI
Sbjct  103  GILKLLEVSLIPSASAAESKVFYLKMTGDYHRYLAEFKTGSDRKDAAESTLSAYKSAQEI  162

Query  501  ANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDST  322
            A  EL+PTHPIRLGL+LNFSVFYYEILNSPDRAC LAKQAFDEAIAELDTLGEESYKDST
Sbjct  163  AVAELSPTHPIRLGLSLNFSVFYYEILNSPDRACALAKQAFDEAIAELDTLGEESYKDST  222

Query  321  LIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  220
            LIMQLLRDNLTLWTSDMQDDG DEIKEA K D+E
Sbjct  223  LIMQLLRDNLTLWTSDMQDDGVDEIKEAPKHDDE  256



>dbj|BAF46314.1| 14-3-3 protein [Ipomoea nil]
Length=262

 Score =   273 bits (698),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 132/154 (86%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GIL LL+S L+ +A++  SKVFYLKMKGDYHRYLAEFKTGAERKEAAE+TL AYKSAQ+
Sbjct  104  DGILSLLESHLVPSASTAESKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLLAYKSAQD  163

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IA GELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAI ELDTLGEESYKDS
Sbjct  164  IALGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAILELDTLGEESYKDS  223

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDN  223
            TLIMQLLRDNLTLWTSD  DDG DEIKEASK ++
Sbjct  224  TLIMQLLRDNLTLWTSDTADDGGDEIKEASKRES  257



>gb|KJB10444.1| hypothetical protein B456_001G201400 [Gossypium raimondii]
Length=262

 Score =   273 bits (697),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 131/154 (85%), Positives = 143/154 (93%), Gaps = 0/154 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GIL LL+S LI +A+S  SKVFYLKMKGDYHRYLAEFKT AERKEAAE+TL AYKSAQ+
Sbjct  104  DGILSLLESHLIPSASSAESKVFYLKMKGDYHRYLAEFKTAAERKEAAESTLLAYKSAQD  163

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IA G+LAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAI+ELDTLGEESYKDS
Sbjct  164  IALGDLAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAISELDTLGEESYKDS  223

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDN  223
            TLIMQLLRDNLTLWTSD+ D+  DEIKEASKP++
Sbjct  224  TLIMQLLRDNLTLWTSDITDEAGDEIKEASKPES  257



>ref|XP_009114721.1| PREDICTED: 14-3-3-like protein GF14 phi [Brassica rapa]
 emb|CDY12024.1| BnaAnng02090D [Brassica napus]
Length=261

 Score =   273 bits (697),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 128/152 (84%), Positives = 143/152 (94%), Gaps = 0/152 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLD++LI A+ +G+SKVFYLKMKGDYHRYLAEFKT  ERK+AAE+TL+AYK+AQ+
Sbjct  101  DGILKLLDTRLIPASANGDSKVFYLKMKGDYHRYLAEFKTAQERKDAAEHTLTAYKAAQD  160

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN ELAPTHPIRLGLALNFSVFYYEILNSPDRAC+LAKQAFDEAIAELDTLGEESYKDS
Sbjct  161  IANSELAPTHPIRLGLALNFSVFYYEILNSPDRACSLAKQAFDEAIAELDTLGEESYKDS  220

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKP  229
            TLIMQLLRDNLTLWTSDMQD+  +EIKE + P
Sbjct  221  TLIMQLLRDNLTLWTSDMQDESTEEIKEDAAP  252



>ref|XP_006650484.1| PREDICTED: 14-3-3-like protein GF14-F-like [Oryza brachyantha]
Length=260

 Score =   273 bits (697),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 132/155 (85%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLDS L+ +AT+  SKVFYLKMKGDYHRYLAEFK+GAERKEAAENTL AYKSAQ+
Sbjct  104  DGILKLLDSHLVPSATAAESKVFYLKMKGDYHRYLAEFKSGAERKEAAENTLVAYKSAQD  163

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IA  EL  THPIRLGLALNFSVFYYEILNSPDRACNLAKQAFD+AIAELDTLGEESYKDS
Sbjct  164  IALAELPTTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDDAIAELDTLGEESYKDS  223

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  220
            TLIMQLLRDNLTLWTSD  +DG DEIKEA+KP+ E
Sbjct  224  TLIMQLLRDNLTLWTSDNAEDGGDEIKEAAKPEGE  258



>ref|XP_009381498.1| PREDICTED: 14-3-3 protein 6-like [Musa acuminata subsp. malaccensis]
Length=257

 Score =   272 bits (696),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 128/153 (84%), Positives = 144/153 (94%), Gaps = 0/153 (0%)
 Frame = -1

Query  681  GILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQEI  502
            GIL+LLDS+LI AA + +SKVFYLKMKGDY+RYLAEFKTG+ERK+AAENT SAYK+AQ++
Sbjct  103  GILRLLDSRLIPAAAAADSKVFYLKMKGDYYRYLAEFKTGSERKDAAENTFSAYKTAQDV  162

Query  501  ANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDST  322
            A  ELAPTHPIRLGLALNFSVFYYEILNS D+AC+LAKQAFDEAIAELDTLGEESYKDST
Sbjct  163  ALAELAPTHPIRLGLALNFSVFYYEILNSSDKACDLAKQAFDEAIAELDTLGEESYKDST  222

Query  321  LIMQLLRDNLTLWTSDMQDDGADEIKEASKPDN  223
            LIMQLLRDNLTLWTSDMQ+DG DE++E SKPD+
Sbjct  223  LIMQLLRDNLTLWTSDMQEDGVDEMRETSKPDD  255



>ref|XP_003560774.1| PREDICTED: 14-3-3-like protein A [Brachypodium distachyon]
 ref|XP_010231073.1| PREDICTED: 14-3-3-like protein A [Brachypodium distachyon]
Length=260

 Score =   272 bits (696),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 132/155 (85%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLDS L+ +AT+  SKVFYLKMKGDYHRYLAEFK GAERKEAAENTL AYKSAQ+
Sbjct  104  DGILKLLDSHLVPSATAAESKVFYLKMKGDYHRYLAEFKAGAERKEAAENTLVAYKSAQD  163

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IA  +L  THPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELD+LGEESYKDS
Sbjct  164  IALADLPTTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDSLGEESYKDS  223

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  220
            TLIMQLLRDNLTLWTSD  D+G DEIKEASKP+ E
Sbjct  224  TLIMQLLRDNLTLWTSDNADEGGDEIKEASKPEGE  258



>ref|XP_008775117.1| PREDICTED: 14-3-3-like protein [Phoenix dactylifera]
 ref|XP_008775124.1| PREDICTED: 14-3-3-like protein [Phoenix dactylifera]
Length=262

 Score =   272 bits (696),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 132/154 (86%), Positives = 143/154 (93%), Gaps = 0/154 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLDS LI +AT+  SKVFYLKMKGDYHRYLAEFKTGAERKEAAE+TL AYKSAQ+
Sbjct  104  DGILKLLDSHLIPSATAAESKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLLAYKSAQD  163

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IA  ELAPTHPIRLGLALNFSVFYYEILNSPDRAC+LAKQAFDEAI+ELDTLGEESYKDS
Sbjct  164  IALAELAPTHPIRLGLALNFSVFYYEILNSPDRACSLAKQAFDEAISELDTLGEESYKDS  223

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDN  223
            TLIMQLLRDNLTLWTSD+ +DG DEIKEA K ++
Sbjct  224  TLIMQLLRDNLTLWTSDITEDGGDEIKEAPKRES  257



>gb|AEX00343.1| 14-3-3 protein b [Ipomoea batatas]
Length=262

 Score =   272 bits (695),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 132/154 (86%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GIL LL+S LI +A++  SKVFYLKMKGDYHRYLAEFKTGAERKEAAE+TL AYKSAQ+
Sbjct  104  DGILNLLESHLIPSASTAESKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLLAYKSAQD  163

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IA GELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAI+ELDTLGEESYKDS
Sbjct  164  IALGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAISELDTLGEESYKDS  223

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDN  223
            TLIMQLLRDNLTLWTSD  DD  DEIKEASK ++
Sbjct  224  TLIMQLLRDNLTLWTSDTADDAGDEIKEASKRES  257



>ref|XP_010472047.1| PREDICTED: 14-3-3-like protein GF14 omega [Camelina sativa]
Length=262

 Score =   272 bits (695),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 130/141 (92%), Positives = 136/141 (96%), Gaps = 0/141 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLDS+LI AA SG+SKVFYLKMKGDYHRYLAEFKT  ERK+AAE+TLSAYKSAQ+
Sbjct  102  DGILKLLDSRLIPAAASGDSKVFYLKMKGDYHRYLAEFKTAQERKDAAEHTLSAYKSAQD  161

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  162  IANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  221

Query  324  TLIMQLLRDNLTLWTSDMQDD  262
            TLIMQLLRDNLTLWTSDMQDD
Sbjct  222  TLIMQLLRDNLTLWTSDMQDD  242



>ref|XP_011011192.1| PREDICTED: 14-3-3-like protein A [Populus euphratica]
Length=262

 Score =   272 bits (695),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 132/154 (86%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GIL LL+S LI +A+S  SKVFYLKMKGDYHRYLAEFKTGAERKEAAE+TL AYKSAQ+
Sbjct  104  DGILNLLESHLIPSASSAESKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLLAYKSAQD  163

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IA  ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAI+ELDTLGEESYKDS
Sbjct  164  IALAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAISELDTLGEESYKDS  223

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDN  223
            TLIMQLLRDNLTLWTSD+ DD  DEIKEASK ++
Sbjct  224  TLIMQLLRDNLTLWTSDITDDAGDEIKEASKRES  257



>gb|AEX00342.1| 14-3-3 protein a [Ipomoea batatas]
Length=262

 Score =   272 bits (695),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 132/154 (86%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GIL LL+S LI +A++  SKVFYLKMKGDYHRYLAEFKTGAERKEAAE+TL AYKSAQ+
Sbjct  104  DGILNLLESHLIPSASTAESKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLLAYKSAQD  163

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IA GELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAI+ELDTLGEESYKDS
Sbjct  164  IALGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAISELDTLGEESYKDS  223

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDN  223
            TLIMQLLRDNLTLWTSD  DD  DEIKEASK ++
Sbjct  224  TLIMQLLRDNLTLWTSDTADDAGDEIKEASKRES  257



>ref|NP_001280837.1| 14-3-3-like protein A [Malus domestica]
 gb|AAV50005.1| 14-3-3 family protein [Malus domestica]
Length=262

 Score =   272 bits (695),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GIL LL+S LI +A+S  SKVFYLKMKGDYHRYLAEFKTG ERKEAAE+TL AYKSAQ+
Sbjct  104  DGILNLLESHLIPSASSAESKVFYLKMKGDYHRYLAEFKTGGERKEAAESTLLAYKSAQD  163

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IA  ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAI+ELDTLGEESYKDS
Sbjct  164  IALAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAISELDTLGEESYKDS  223

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE*SQ  211
            TLIMQLLRDNLTLWTSD+ DD  DEIKEASK ++  +Q
Sbjct  224  TLIMQLLRDNLTLWTSDITDDAGDEIKEASKRESSETQ  261



>ref|XP_006659506.1| PREDICTED: LOW QUALITY PROTEIN: 14-3-3-like protein GF14-A-like 
[Oryza brachyantha]
Length=264

 Score =   272 bits (695),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 126/154 (82%), Positives = 145/154 (94%), Gaps = 0/154 (0%)
 Frame = -1

Query  681  GILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQEI  502
            GIL+LLD +L+ AA + ++KVFYLKMKGDYHRYLAEFKTGAERK+AA+ TL+AY++AQ+I
Sbjct  110  GILRLLDERLVPAAVAVDAKVFYLKMKGDYHRYLAEFKTGAERKDAADATLAAYQAAQDI  169

Query  501  ANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDST  322
            A  EL+PTHPIRLGLALNFSVFYYEILNSPDRAC LAKQAFDEAI+ELDTLGEESYKDST
Sbjct  170  AMKELSPTHPIRLGLALNFSVFYYEILNSPDRACTLAKQAFDEAISELDTLGEESYKDST  229

Query  321  LIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  220
            LIMQLLRDNLTLWTSDMQDDG DE+++A+KPD+E
Sbjct  230  LIMQLLRDNLTLWTSDMQDDGGDEMRDATKPDDE  263



>ref|XP_008804781.1| PREDICTED: 14-3-3 protein 6 [Phoenix dactylifera]
 ref|XP_008804782.1| PREDICTED: 14-3-3 protein 6 [Phoenix dactylifera]
Length=260

 Score =   272 bits (695),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 130/155 (84%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLD+ LI +A+  +SKVFYLKMKGDYHRYLAEFKTG++RK+AAE+TL+AYKSAQ+
Sbjct  104  SGILKLLDASLIPSASVSDSKVFYLKMKGDYHRYLAEFKTGSDRKDAAESTLAAYKSAQD  163

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IA  ELAPTHPIRLGL+LNFSVFYYEILNSPD AC LAKQAFDEAIAELDTLGEESYKDS
Sbjct  164  IAAAELAPTHPIRLGLSLNFSVFYYEILNSPDLACTLAKQAFDEAIAELDTLGEESYKDS  223

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  220
            TLIMQLLRDNLTLWTSDMQDDG DEIKEA K ++E
Sbjct  224  TLIMQLLRDNLTLWTSDMQDDGVDEIKEAPKHEDE  258



>gb|ADP00759.1| 14-3-3 protein [Litchi chinensis]
Length=261

 Score =   272 bits (695),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 132/154 (86%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GIL LL+S LI +A+S  SKVFYLKMKGDYHRYLAEFKTGAERKEAAE+TL AYKSAQ+
Sbjct  104  DGILGLLESHLIPSASSAESKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLLAYKSAQD  163

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IA  ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAI+ELDTLGEESYKDS
Sbjct  164  IALAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAISELDTLGEESYKDS  223

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDN  223
            TLIMQLLRDNLTLWTSD+ DD  DEIKEASK ++
Sbjct  224  TLIMQLLRDNLTLWTSDITDDAGDEIKEASKRES  257



>gb|AHB33318.1| 14-3-3a protein [Pyrus pyrifolia]
Length=261

 Score =   271 bits (694),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GIL LL+S LI +A+S  SKVFYLKMKGDYHRYLAEFKTG ERKEAAE+TL AYKSAQ+
Sbjct  104  DGILNLLESHLIPSASSAESKVFYLKMKGDYHRYLAEFKTGGERKEAAESTLLAYKSAQD  163

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IA  ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAI+ELDTLGEESYKDS
Sbjct  164  IALAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAISELDTLGEESYKDS  223

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE*SQ  211
            TLIMQLLRDNLTLWTSD+ DD  DEIKEASK ++  +Q
Sbjct  224  TLIMQLLRDNLTLWTSDITDDAGDEIKEASKRESSEAQ  261



>gb|ADD79961.1| 14-3-3 family protein [Dimocarpus longan]
 gb|ADD79962.1| 14-3-3 family protein [Dimocarpus longan]
Length=261

 Score =   271 bits (694),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 132/154 (86%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GIL LL+S LI +A+S  SKVFYLKMKGDYHRYLAEFKTGAERKEAAE+TL AYKSAQ+
Sbjct  104  DGILGLLESHLIPSASSAESKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLLAYKSAQD  163

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IA  ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAI+ELDTLGEESYKDS
Sbjct  164  IALAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAISELDTLGEESYKDS  223

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDN  223
            TLIMQLLRDNLTLWTSD+ DD  DEIKEASK ++
Sbjct  224  TLIMQLLRDNLTLWTSDITDDAGDEIKEASKRES  257



>ref|XP_009419276.1| PREDICTED: 14-3-3-like protein GF14-C [Musa acuminata subsp. 
malaccensis]
 ref|XP_009419277.1| PREDICTED: 14-3-3-like protein GF14-C [Musa acuminata subsp. 
malaccensis]
Length=261

 Score =   271 bits (694),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 130/154 (84%), Positives = 144/154 (94%), Gaps = 0/154 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLD+ L+ +AT+  SKVFYLKMKGDYHRYLAEFKTGAERKEAAE+TL AYKSAQ+
Sbjct  104  DGILKLLDTHLVPSATTAESKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLLAYKSAQD  163

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IA  +LAPTHPIRLGLALNFSVFYYEILNSPDRAC+LAKQAFDEAI+ELDTLGEESYKDS
Sbjct  164  IALADLAPTHPIRLGLALNFSVFYYEILNSPDRACSLAKQAFDEAISELDTLGEESYKDS  223

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDN  223
            TLIMQLLRDNLTLWTSD+ +DGADEIKEA K ++
Sbjct  224  TLIMQLLRDNLTLWTSDITEDGADEIKEAPKKES  257



>ref|XP_009357045.1| PREDICTED: 14-3-3-like protein A [Pyrus x bretschneideri]
 ref|XP_009357046.1| PREDICTED: 14-3-3-like protein A [Pyrus x bretschneideri]
 ref|XP_009357047.1| PREDICTED: 14-3-3-like protein A [Pyrus x bretschneideri]
Length=262

 Score =   271 bits (694),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GIL LL+S LI +A+S  SKVFYLKMKGDYHRYLAEFKTG ERKEAAE+TL AYKSAQ+
Sbjct  104  DGILNLLESHLIPSASSAESKVFYLKMKGDYHRYLAEFKTGGERKEAAESTLLAYKSAQD  163

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IA  ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAI+ELDTLGEESYKDS
Sbjct  164  IALAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAISELDTLGEESYKDS  223

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE*SQ  211
            TLIMQLLRDNLTLWTSD+ DD  DEIKEASK ++  +Q
Sbjct  224  TLIMQLLRDNLTLWTSDITDDAGDEIKEASKRESSEAQ  261



>ref|XP_006346922.1| PREDICTED: 14-3-3 protein 4-like [Solanum tuberosum]
Length=260

 Score =   271 bits (693),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 131/154 (85%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GIL LL+S LI +A++  SKVFYLKMKGDYHRYLAEFKTG ERKEAAENTL AYKSAQ+
Sbjct  102  DGILSLLESNLIPSASTAESKVFYLKMKGDYHRYLAEFKTGTERKEAAENTLLAYKSAQD  161

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IA  ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAI+ELDTLGEESYKDS
Sbjct  162  IALAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAISELDTLGEESYKDS  221

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDN  223
            TLIMQLLRDNLTLWTSD  DD  D+IKEASKP++
Sbjct  222  TLIMQLLRDNLTLWTSDNADDAGDDIKEASKPES  255



>gb|EYU34391.1| hypothetical protein MIMGU_mgv1a012246mg [Erythranthe guttata]
Length=257

 Score =   271 bits (693),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 132/154 (86%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GIL LL+S LI +A+S  SKVFYLKMKGDYHRYLAEFKTG+ERKEAAE+TL AYKSAQ+
Sbjct  99   DGILGLLESHLIPSASSAESKVFYLKMKGDYHRYLAEFKTGSERKEAAESTLLAYKSAQD  158

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IA GELAPTHPIRLGLALNFSVFYYEILNSPDRAC LAKQAFDEAI+ELDTLGEESYKDS
Sbjct  159  IAVGELAPTHPIRLGLALNFSVFYYEILNSPDRACTLAKQAFDEAISELDTLGEESYKDS  218

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDN  223
            TLIMQLLRDNLTLWTSD  DD  DEIKEASK D+
Sbjct  219  TLIMQLLRDNLTLWTSDAADDAGDEIKEASKRDS  252



>ref|XP_008362235.1| PREDICTED: 14-3-3-like protein A [Malus domestica]
 ref|XP_008362236.1| PREDICTED: 14-3-3-like protein A [Malus domestica]
 ref|XP_008362237.1| PREDICTED: 14-3-3-like protein A [Malus domestica]
 ref|XP_008368488.1| PREDICTED: 14-3-3-like protein A [Malus domestica]
 ref|XP_008368489.1| PREDICTED: 14-3-3-like protein A [Malus domestica]
 ref|XP_008368490.1| PREDICTED: 14-3-3-like protein A [Malus domestica]
Length=261

 Score =   271 bits (693),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GIL LL+S LI +A+S  SKVFYLKMKGDYHRYLAEFKTG ERKEAAE+TL AYKSAQ+
Sbjct  104  DGILNLLESHLIPSASSAESKVFYLKMKGDYHRYLAEFKTGGERKEAAESTLLAYKSAQD  163

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IA  ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAI+ELDTLGEESYKDS
Sbjct  164  IALAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAISELDTLGEESYKDS  223

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE*SQ  211
            TLIMQLLRDNLTLWTSD+ DD  DEIKEASK ++  +Q
Sbjct  224  TLIMQLLRDNLTLWTSDITDDAGDEIKEASKRESSEAQ  261



>ref|XP_009404035.1| PREDICTED: 14-3-3 protein 6 [Musa acuminata subsp. malaccensis]
Length=256

 Score =   271 bits (693),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 127/154 (82%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = -1

Query  681  GILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQEI  502
            GIL+LLD +L+ +A++ +SKVFYLKMKGDYHRYLAEFKTG++RK+AAE+TL+AYKSAQ+I
Sbjct  103  GILRLLDERLVPSASAADSKVFYLKMKGDYHRYLAEFKTGSDRKDAAESTLAAYKSAQDI  162

Query  501  ANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDST  322
            A+ EL+ THPIRLGLALNFSVFYYEILNSPDRAC+LAKQAFDEAIAELDTLGEESYKDST
Sbjct  163  ASAELSSTHPIRLGLALNFSVFYYEILNSPDRACDLAKQAFDEAIAELDTLGEESYKDST  222

Query  321  LIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  220
            LIMQLLRDNLTLWTSDMQDDG DEIKEA K +++
Sbjct  223  LIMQLLRDNLTLWTSDMQDDGVDEIKEAPKGEDQ  256



>gb|AEX00344.1| 14-3-3 protein c [Ipomoea batatas]
Length=262

 Score =   271 bits (693),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 131/154 (85%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GIL LL+S LI +A++  SKVFYLKMKGDYHRYLAEFKTGAERKEAAE+TL AYKSAQ+
Sbjct  104  DGILNLLESHLIPSASTAESKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLLAYKSAQD  163

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IA GELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAI+E+DTLGEESYKDS
Sbjct  164  IALGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAISEIDTLGEESYKDS  223

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDN  223
            TLIMQLLRDNLTLWTSD  DD  DEIKEASK ++
Sbjct  224  TLIMQLLRDNLTLWTSDTADDAGDEIKEASKRES  257



>ref|XP_008230392.1| PREDICTED: 14-3-3-like protein A [Prunus mume]
Length=262

 Score =   271 bits (693),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 131/154 (85%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GIL LL+S LI +A+S  SKVFYLKMKGDYHRYLAEFKTG ERKEAAE+TL AYKSAQ+
Sbjct  104  DGILNLLESHLIPSASSAESKVFYLKMKGDYHRYLAEFKTGGERKEAAESTLLAYKSAQD  163

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IA  ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAI+ELDTLGEESYKDS
Sbjct  164  IALAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAISELDTLGEESYKDS  223

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDN  223
            TLIMQLLRDNLTLWTSD+ DD  DEIKEASK ++
Sbjct  224  TLIMQLLRDNLTLWTSDITDDAGDEIKEASKRES  257



>ref|XP_010416813.1| PREDICTED: 14-3-3-like protein GF14 omega [Camelina sativa]
Length=262

 Score =   271 bits (693),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 129/141 (91%), Positives = 136/141 (96%), Gaps = 0/141 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GIL+LLDS+LI AA SG+SKVFYLKMKGDYHRYLAEFKT  ERK+AAE+TLSAYKSAQ+
Sbjct  102  DGILRLLDSRLIPAAASGDSKVFYLKMKGDYHRYLAEFKTAQERKDAAEHTLSAYKSAQD  161

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  162  IANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  221

Query  324  TLIMQLLRDNLTLWTSDMQDD  262
            TLIMQLLRDNLTLWTSDMQDD
Sbjct  222  TLIMQLLRDNLTLWTSDMQDD  242



>ref|NP_001051051.1| Os03g0710800 [Oryza sativa Japonica Group]
 sp|Q06967.2|14336_ORYSJ RecName: Full=14-3-3-like protein GF14-F; AltName: Full=14-3-3-like 
protein S94; AltName: Full=G-box factor 14-3-3 homolog 
F; AltName: Full=OsGF14a; AltName: Full=Stress-regulated 14-3-3 
protein; Short=SR14-3-3 [Oryza sativa Japonica Group]
 gb|AAX95656.1| 14-3-3 protein [Oryza sativa Japonica Group]
 gb|ABF98505.1| 14-3-3-like protein S94, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABF98506.1| 14-3-3-like protein S94, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABF98507.1| 14-3-3-like protein S94, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF12965.1| Os03g0710800 [Oryza sativa Japonica Group]
 gb|EAY91605.1| hypothetical protein OsI_13240 [Oryza sativa Indica Group]
 gb|EAZ28334.1| hypothetical protein OsJ_12311 [Oryza sativa Japonica Group]
 gb|ACA50522.1| 14-3-3 protein [Oryza sativa Japonica Group]
 dbj|BAG88210.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG95867.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AGT42305.1| 14-3-3 protein [Oryza sativa Japonica Group]
Length=260

 Score =   271 bits (693),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 131/155 (85%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLDS L+ +AT+  SKVFYLKMKGDYHRYLAEFK+GAERKEAAENTL AYKSAQ+
Sbjct  104  DGILKLLDSHLVPSATAAESKVFYLKMKGDYHRYLAEFKSGAERKEAAENTLVAYKSAQD  163

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IA  +L  THPIRLGLALNFSVFYYEILNSPDRACNLAKQAFD+AIAELDTLGEESYKDS
Sbjct  164  IALADLPTTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDDAIAELDTLGEESYKDS  223

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  220
            TLIMQLLRDNLTLWTSD  +DG DEIKEA+KP+ E
Sbjct  224  TLIMQLLRDNLTLWTSDNAEDGGDEIKEAAKPEGE  258



>gb|ABK21293.1| unknown [Picea sitchensis]
 gb|ABK22857.1| unknown [Picea sitchensis]
 gb|ABK26815.1| unknown [Picea sitchensis]
 gb|ACN41067.1| unknown [Picea sitchensis]
Length=262

 Score =   271 bits (693),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 132/154 (86%), Positives = 143/154 (93%), Gaps = 1/154 (1%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GIL+LLD+ LI ++TSG SKVFYLKMKGDYHRYLAEFKTGAERKEAAE+TL AYK+AQ+
Sbjct  104  DGILRLLDTHLIPSSTSGESKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLLAYKAAQD  163

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IA  ELAPTHPIRLGLALNFSVFYYEILNSPDRAC LAKQAFDEAIAELDTLGEESYKDS
Sbjct  164  IAIAELAPTHPIRLGLALNFSVFYYEILNSPDRACTLAKQAFDEAIAELDTLGEESYKDS  223

Query  324  TLIMQLLRDNLTLWTSDMQDD-GADEIKEASKPD  226
            TLIMQLLRDNLTLWTSDMQ++ G DEIKEA K +
Sbjct  224  TLIMQLLRDNLTLWTSDMQEETGGDEIKEAPKKE  257



>ref|XP_004234565.1| PREDICTED: 14-3-3-like protein [Solanum lycopersicum]
Length=258

 Score =   271 bits (692),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 130/154 (84%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GIL LL+S L+ +A++  SKVFYLKMKGDYHRYLAEFKTGAERKEAAENTL AYKSAQ+
Sbjct  100  DGILSLLESHLVPSASTAESKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLLAYKSAQD  159

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IA  ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFD+AIAELDTLGEESYKDS
Sbjct  160  IALAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDDAIAELDTLGEESYKDS  219

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDN  223
            TLIMQLLRDNLTLWTSD  DD  DEI+EASK ++
Sbjct  220  TLIMQLLRDNLTLWTSDTTDDAGDEIREASKQES  253



>ref|NP_001061856.1| Os08g0430500 [Oryza sativa Japonica Group]
 sp|Q6ZKC0.1|14333_ORYSJ RecName: Full=14-3-3-like protein GF14-C; AltName: Full=G-box 
factor 14-3-3 homolog C [Oryza sativa Japonica Group]
 gb|AAB07457.1| GF14-c protein [Oryza sativa Japonica Group]
 dbj|BAD01170.1| GF14-c protein [Oryza sativa Japonica Group]
 dbj|BAF23770.1| Os08g0430500 [Oryza sativa Japonica Group]
 gb|EAZ42820.1| hypothetical protein OsJ_27405 [Oryza sativa Japonica Group]
 gb|ACJ54928.1| G-box binding factor [Oryza sativa Japonica Group]
 dbj|BAG89441.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00820.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH01420.1| unnamed protein product [Oryza sativa Japonica Group]
Length=256

 Score =   271 bits (692),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 128/153 (84%), Positives = 143/153 (93%), Gaps = 0/153 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLDS L+ ++T+  SKVFYLKMKGDYHRYLAEFKTGAERKEAAE+T+ AYK+AQ+
Sbjct  99   DGILKLLDSHLVPSSTAAESKVFYLKMKGDYHRYLAEFKTGAERKEAAESTMVAYKAAQD  158

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IA  +LAPTHPIRLGLALNFSVFYYEILNSPD+ACNLAKQAFDEAI+ELDTLGEESYKDS
Sbjct  159  IALADLAPTHPIRLGLALNFSVFYYEILNSPDKACNLAKQAFDEAISELDTLGEESYKDS  218

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPD  226
            TLIMQLLRDNLTLWTSD+ +DG DE+KEASK D
Sbjct  219  TLIMQLLRDNLTLWTSDLTEDGGDEVKEASKGD  251



>ref|XP_010553922.1| PREDICTED: 14-3-3-like protein GF14 psi [Tarenaya hassleriana]
 ref|XP_010553924.1| PREDICTED: 14-3-3-like protein GF14 psi [Tarenaya hassleriana]
Length=263

 Score =   271 bits (693),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 131/152 (86%), Positives = 139/152 (91%), Gaps = 0/152 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GIL LLDS LI AA+S  SKVFYLKMKGDYHRYLAEFKT AERKEAAE+TL AYKSAQ+
Sbjct  103  DGILNLLDSHLIPAASSAESKVFYLKMKGDYHRYLAEFKTSAERKEAAESTLLAYKSAQD  162

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IA  ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAI+ELDTLGEESYKDS
Sbjct  163  IAVTELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAISELDTLGEESYKDS  222

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKP  229
            TLIMQLLRDNLTLWTSD+ D+  DEIKE+ KP
Sbjct  223  TLIMQLLRDNLTLWTSDITDEAGDEIKESEKP  254



>ref|XP_006853053.1| hypothetical protein AMTR_s00038p00055100 [Amborella trichopoda]
 gb|ERN14520.1| hypothetical protein AMTR_s00038p00055100 [Amborella trichopoda]
Length=264

 Score =   271 bits (693),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 132/152 (87%), Positives = 141/152 (93%), Gaps = 2/152 (1%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GIL+LLDS LI ++T+  SKVFYLKMKGDYHRYLAEFKTGAERKEAAE+TL AYKSAQ+
Sbjct  104  DGILRLLDSHLIPSSTAAESKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLVAYKSAQD  163

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IA  EL PTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAI+ELDTLGEESYKDS
Sbjct  164  IALAELTPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAISELDTLGEESYKDS  223

Query  324  TLIMQLLRDNLTLWTSDMQD--DGADEIKEAS  235
            TLIMQLLRDNLTLWTSD+QD  DG DEIKEAS
Sbjct  224  TLIMQLLRDNLTLWTSDLQDQEDGGDEIKEAS  255



>gb|EAZ07074.1| hypothetical protein OsI_29320 [Oryza sativa Indica Group]
Length=256

 Score =   271 bits (692),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 128/153 (84%), Positives = 143/153 (93%), Gaps = 0/153 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLDS L+ ++T+  SKVFYLKMKGDYHRYLAEFKTGAERKEAAE+T+ AYK+AQ+
Sbjct  99   DGILKLLDSHLVPSSTAAESKVFYLKMKGDYHRYLAEFKTGAERKEAAESTMVAYKAAQD  158

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IA  +LAPTHPIRLGLALNFSVFYYEILNSPD+ACNLAKQAFDEAI+ELDTLGEESYKDS
Sbjct  159  IALADLAPTHPIRLGLALNFSVFYYEILNSPDKACNLAKQAFDEAISELDTLGEESYKDS  218

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPD  226
            TLIMQLLRDNLTLWTSD+ +DG DE+KEASK D
Sbjct  219  TLIMQLLRDNLTLWTSDLTEDGGDEVKEASKGD  251



>gb|KDP32938.1| hypothetical protein JCGZ_12969 [Jatropha curcas]
Length=264

 Score =   271 bits (692),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 131/154 (85%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GIL LL+S LI +A+S  SKVFYLKMKGDYHRYLAEFKTGAERKEAAE+TL AYKSAQ+
Sbjct  104  DGILSLLESHLIPSASSAESKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLLAYKSAQD  163

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IA  ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAI+ELDTLGEESYKDS
Sbjct  164  IALAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAISELDTLGEESYKDS  223

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDN  223
            TLIMQLLRDNLTLWTSD+ D+  DEIKEASK ++
Sbjct  224  TLIMQLLRDNLTLWTSDITDEAGDEIKEASKRES  257



>ref|XP_002444843.1| hypothetical protein SORBIDRAFT_07g029110 [Sorghum bicolor]
 gb|EES14338.1| hypothetical protein SORBIDRAFT_07g029110 [Sorghum bicolor]
Length=259

 Score =   270 bits (691),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = -1

Query  681  GILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQEI  502
            GIL+LLD +L+ AA + ++KVFYLKMKGDYHRYLAEFKT AERK+AA++TL+AY++AQ+I
Sbjct  106  GILRLLDDRLVPAAAAVDAKVFYLKMKGDYHRYLAEFKTAAERKDAADSTLAAYQAAQDI  165

Query  501  ANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDST  322
            A  EL PTHPIRLGLALNFSVFYYEILNSPDRAC+LAKQAFDEAI+ELDTLGEESYKDST
Sbjct  166  AVKELPPTHPIRLGLALNFSVFYYEILNSPDRACSLAKQAFDEAISELDTLGEESYKDST  225

Query  321  LIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  220
            LIMQLLRDNLTLWTSDMQ+DG+DE+++ASKPD+E
Sbjct  226  LIMQLLRDNLTLWTSDMQEDGSDEMRDASKPDDE  259



>ref|XP_004501696.1| PREDICTED: 14-3-3-like protein-like [Cicer arietinum]
Length=266

 Score =   271 bits (692),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 129/139 (93%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLDS+LI +A+SG+SKVFYLKMKGDYHRYLAEFKTGAERKEAAE+TLSAYKSAQ+
Sbjct  104  DGILKLLDSRLIPSASSGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLSAYKSAQD  163

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN EL PTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  164  IANAELPPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  223

Query  324  TLIMQLLRDNLTLWTSDMQ  268
            TLIMQLLRDNLTLWTSDMQ
Sbjct  224  TLIMQLLRDNLTLWTSDMQ  242



>ref|NP_001234007.1| 14-3-3 protein 4 [Solanum lycopersicum]
 emb|CAD43308.1| 14-3-3 protein [Solanum lycopersicum]
Length=260

 Score =   270 bits (691),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 131/154 (85%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GIL LL+S LI +A++  SKVFYLKMKGDYHRYLAEFKTG ERKEAAENTL AYKSAQ+
Sbjct  102  DGILSLLESNLIPSASTAESKVFYLKMKGDYHRYLAEFKTGTERKEAAENTLLAYKSAQD  161

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IA  ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAI+ELDTLGEESYKDS
Sbjct  162  IALAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAISELDTLGEESYKDS  221

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDN  223
            TLIMQLLRDNLTLWTSD  DD  D+IKEASKP++
Sbjct  222  TLIMQLLRDNLTLWTSDNADDVGDDIKEASKPES  255



>ref|XP_002874496.1| hypothetical protein ARALYDRAFT_911048 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50755.1| hypothetical protein ARALYDRAFT_911048 [Arabidopsis lyrata subsp. 
lyrata]
Length=266

 Score =   271 bits (692),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 139/146 (95%), Gaps = 0/146 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLD+ L+ AA SG+SKVFYLKMKGDYHRYLAEFK+G ERK+AAE+TL+AYK+AQ+
Sbjct  106  DGILKLLDTILVPAAASGDSKVFYLKMKGDYHRYLAEFKSGQERKDAAEHTLTAYKAAQD  165

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  166  IANSELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  225

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEI  247
            TLIMQLLRDNLTLWTSDMQDD  D+I
Sbjct  226  TLIMQLLRDNLTLWTSDMQDDTTDDI  251



>ref|XP_009397483.1| PREDICTED: 14-3-3-like protein [Musa acuminata subsp. malaccensis]
Length=261

 Score =   270 bits (691),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 131/154 (85%), Positives = 143/154 (93%), Gaps = 0/154 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLDS L+ +AT+  SKVFYLKM GDYHRYLAEFKTGAERKEAAE+TLSAYKSAQ+
Sbjct  104  DGILKLLDSHLVPSATATESKVFYLKMNGDYHRYLAEFKTGAERKEAAESTLSAYKSAQD  163

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IA  ELA THPIRLGLALNFSVFYYEILNSPDRAC+LAKQAFDEAI+ELDTLGEESYKDS
Sbjct  164  IALAELASTHPIRLGLALNFSVFYYEILNSPDRACSLAKQAFDEAISELDTLGEESYKDS  223

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDN  223
            TLIMQLLRDNLTLWTSD+ +DGADEIKEA K ++
Sbjct  224  TLIMQLLRDNLTLWTSDITEDGADEIKEAPKKES  257



>ref|XP_010939692.1| PREDICTED: 14-3-3 protein 6-like [Elaeis guineensis]
Length=257

 Score =   270 bits (691),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 128/155 (83%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLDS+L+ +A   +SKVFYLKMKGDY+RYLAEFKTG++RK+AAE+TL+AYK+AQ+
Sbjct  102  DGILKLLDSRLVPSAAVVDSKVFYLKMKGDYYRYLAEFKTGSDRKDAAESTLNAYKAAQD  161

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            +A  ELAPTHPIRLGLALNFSVFYYEILNSPDRAC LAKQAFDEAI+ELDTLGEESYKDS
Sbjct  162  MALSELAPTHPIRLGLALNFSVFYYEILNSPDRACTLAKQAFDEAISELDTLGEESYKDS  221

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  220
            TLIMQLLRDNLTLWTSDMQDDGAD+IKEA+K ++E
Sbjct  222  TLIMQLLRDNLTLWTSDMQDDGADDIKEATKHEDE  256



>ref|XP_011099565.1| PREDICTED: 14-3-3-like protein [Sesamum indicum]
Length=260

 Score =   270 bits (691),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 131/151 (87%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLL++ LI +A S  SKVFYLKMKGDYHRYLAEFKTGAERKEAAE+TL AYKSAQ+
Sbjct  104  DGILKLLETHLIPSAASAESKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLLAYKSAQD  163

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IA  ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  164  IALAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  223

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASK  232
            TLIMQLLRDNLTLWTSD+ DD  DEIKE +K
Sbjct  224  TLIMQLLRDNLTLWTSDIADDAGDEIKETAK  254



>ref|XP_004304139.1| PREDICTED: 14-3-3-like protein A [Fragaria vesca subsp. vesca]
Length=263

 Score =   270 bits (691),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 131/154 (85%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GIL LL+S LI +A+S  SKVFYLKMKGDYHRYLAEFKTG ERKEAAE+TL AYKSAQ+
Sbjct  104  DGILNLLESHLIPSASSAESKVFYLKMKGDYHRYLAEFKTGGERKEAAESTLLAYKSAQD  163

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IA  ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAI+ELDTLGEESYKDS
Sbjct  164  IALAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAISELDTLGEESYKDS  223

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDN  223
            TLIMQLLRDNLTLWTSD+ DD  DEIKEASK ++
Sbjct  224  TLIMQLLRDNLTLWTSDITDDAGDEIKEASKRES  257



>gb|ACK76233.1| 14-3-3 protein [Dimocarpus longan]
Length=261

 Score =   270 bits (690),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 131/154 (85%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GIL LL+S LI +A+S  SKVFYLKMKGDYHRYLAEFKTGAERKEAAE+TL AYKSAQ+
Sbjct  104  DGILGLLESHLIPSASSAESKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLLAYKSAQD  163

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IA  ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAI+ELDTLGEESYKDS
Sbjct  164  IALAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAISELDTLGEESYKDS  223

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDN  223
            TLIMQL RDNLTLWTSD+ DD  DEIKEASK ++
Sbjct  224  TLIMQLFRDNLTLWTSDITDDAGDEIKEASKRES  257



>gb|AAP48904.1| 14-3-3-like protein [Saccharum hybrid cultivar CP65-357]
 gb|AFO59571.1| 14-3-3-like protein [Saccharum hybrid cultivar GT28]
 gb|AHX42563.1| 14-3-3 protein [Saccharum hybrid cultivar ROC22]
Length=256

 Score =   270 bits (690),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 129/153 (84%), Positives = 143/153 (93%), Gaps = 0/153 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLDS L+ ++T+  SKVFYLKMKGDYHRYLAEFKTGAERKE+AE+T+ AYK+AQ+
Sbjct  99   DGILKLLDSHLVPSSTAAESKVFYLKMKGDYHRYLAEFKTGAERKESAESTMVAYKAAQD  158

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IA  ELAPTHPIRLGLALNFSVFYYEILNSPD+ACNLAKQAFDEAI+ELDTLGEESYKDS
Sbjct  159  IALAELAPTHPIRLGLALNFSVFYYEILNSPDKACNLAKQAFDEAISELDTLGEESYKDS  218

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPD  226
            TLIMQLLRDNLTLWTSD+ +DGADE KEASK D
Sbjct  219  TLIMQLLRDNLTLWTSDLTEDGADEGKEASKGD  251



>ref|XP_004973733.1| PREDICTED: 14-3-3-like protein GF14-A-like [Setaria italica]
Length=259

 Score =   270 bits (690),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 126/154 (82%), Positives = 145/154 (94%), Gaps = 0/154 (0%)
 Frame = -1

Query  681  GILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQEI  502
            GIL+LLD +L+ AA + ++KVFYLKMKGDYHRYLAEFKTGAERK+AA+ TL+AY++AQ+I
Sbjct  106  GILRLLDERLVPAAAAVDAKVFYLKMKGDYHRYLAEFKTGAERKDAADATLAAYQAAQDI  165

Query  501  ANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDST  322
            A  EL PTHPIRLGLALNFSVFYYEILNSPDRAC+LAKQAFDEAI+ELDTLGEESYKDST
Sbjct  166  AMKELPPTHPIRLGLALNFSVFYYEILNSPDRACSLAKQAFDEAISELDTLGEESYKDST  225

Query  321  LIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  220
            LIMQLLRDNLTLWTSDMQDDG DE+++ASKP++E
Sbjct  226  LIMQLLRDNLTLWTSDMQDDGGDEMRDASKPEDE  259



>ref|XP_009403466.1| PREDICTED: 14-3-3-like protein [Musa acuminata subsp. malaccensis]
 ref|XP_009403467.1| PREDICTED: 14-3-3-like protein [Musa acuminata subsp. malaccensis]
Length=261

 Score =   270 bits (690),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLDS L  +ATS  SKVFYLKMKGDYHRYLAEFKTGAERKEAAE+TL AYKSAQ+
Sbjct  104  DGILKLLDSHLTPSATSAESKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLLAYKSAQD  163

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IA  ELA THPIRLGLALNFSVFYYEILNSPDRAC+LAKQAFDEAI+ELDTLGEESYKDS
Sbjct  164  IALAELASTHPIRLGLALNFSVFYYEILNSPDRACSLAKQAFDEAISELDTLGEESYKDS  223

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE*SQ  211
            TLIMQLLRDNLTLWTSD+ +DGADEI EA K ++E  Q
Sbjct  224  TLIMQLLRDNLTLWTSDITEDGADEINEAPKKESEEGQ  261



>ref|XP_008781204.1| PREDICTED: 14-3-3-like protein [Phoenix dactylifera]
Length=261

 Score =   270 bits (690),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 131/154 (85%), Positives = 143/154 (93%), Gaps = 0/154 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLDS LI +AT+  SKVFYLKMKGDYHRYLAEFKTGAERKEAAE+TL AYKSAQ+
Sbjct  104  DGILKLLDSHLIPSATAVESKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLLAYKSAQD  163

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IA  ELAPTHPIRLGLALNFSVFYYEILNSPDRAC+LAKQAFDEAI+ELD+LGEESYKDS
Sbjct  164  IALAELAPTHPIRLGLALNFSVFYYEILNSPDRACSLAKQAFDEAISELDSLGEESYKDS  223

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDN  223
            TLIMQLLRDNLTLWTSD+ +DG DEIKEA K ++
Sbjct  224  TLIMQLLRDNLTLWTSDITEDGGDEIKEAPKRES  257



>gb|KHG19539.1| Uncharacterized protein F383_05852 [Gossypium arboreum]
Length=262

 Score =   270 bits (690),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 131/154 (85%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GIL LL+S LI  A+S  SKVFYLKMKGDYHRYLAEFKTGAERKEAAE+TL AYKSAQ+
Sbjct  104  DGILSLLESHLIPLASSAESKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLLAYKSAQD  163

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IA  ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAI+ELDTLGEESYKDS
Sbjct  164  IALAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAISELDTLGEESYKDS  223

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDN  223
            TLIMQLLRDNLTLWTSD+ D+  DEIKEASK ++
Sbjct  224  TLIMQLLRDNLTLWTSDITDEAGDEIKEASKHES  257



>ref|XP_006405765.1| hypothetical protein EUTSA_v10027892mg [Eutrema salsugineum]
 gb|ESQ47218.1| hypothetical protein EUTSA_v10027892mg [Eutrema salsugineum]
Length=258

 Score =   270 bits (689),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 129/153 (84%), Positives = 140/153 (92%), Gaps = 0/153 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GIL +L++ LI +A+   SKVFYLKMKGDYHRYLAEFK GAERKEAAE+TL AYKSAQ+
Sbjct  103  DGILNVLEAHLIPSASPAESKVFYLKMKGDYHRYLAEFKAGAERKEAAESTLVAYKSAQD  162

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IA  ELAPTHPIRLGLALNFSVFYYEILNSPDRAC+LAKQAFDEAIAELDTLGEESYKDS
Sbjct  163  IAIAELAPTHPIRLGLALNFSVFYYEILNSPDRACSLAKQAFDEAIAELDTLGEESYKDS  222

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPD  226
            TLIMQLLRDNLTLWTSDM D+  DEIKEASKP+
Sbjct  223  TLIMQLLRDNLTLWTSDMTDEAGDEIKEASKPE  255



>ref|XP_006430798.1| hypothetical protein CICLE_v10012495mg [Citrus clementina]
 ref|XP_006430799.1| hypothetical protein CICLE_v10012495mg [Citrus clementina]
 ref|XP_006482271.1| PREDICTED: 14-3-3-like protein-like isoform X1 [Citrus sinensis]
 ref|XP_006482272.1| PREDICTED: 14-3-3-like protein-like isoform X2 [Citrus sinensis]
 gb|ESR44038.1| hypothetical protein CICLE_v10012495mg [Citrus clementina]
 gb|ESR44039.1| hypothetical protein CICLE_v10012495mg [Citrus clementina]
 gb|KDO58963.1| hypothetical protein CISIN_1g024714mg [Citrus sinensis]
 gb|KDO58964.1| hypothetical protein CISIN_1g024714mg [Citrus sinensis]
Length=263

 Score =   270 bits (690),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 130/150 (87%), Positives = 139/150 (93%), Gaps = 0/150 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GIL LL+S LI +A+S  SKVFYLKMKGDYHRYLAEFKTGAERKEAAE+TL AYKSAQ+
Sbjct  104  DGILSLLESHLIPSASSAESKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLLAYKSAQD  163

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IA  ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAI+ELDTLGEESYKDS
Sbjct  164  IALAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAISELDTLGEESYKDS  223

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEAS  235
            TLIMQLLRDNLTLWTSD+ DD  DEIKEA+
Sbjct  224  TLIMQLLRDNLTLWTSDITDDAGDEIKEAA  253



>gb|AEG67284.1| 14-3-3 protein [Pyrus pyrifolia]
Length=261

 Score =   270 bits (689),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GIL LL+S LI +A+S  SKVFYLKMKGDYHRYLAEFKTG ERKEAAE+TL AYKSAQ+
Sbjct  104  DGILNLLESHLIPSASSAESKVFYLKMKGDYHRYLAEFKTGGERKEAAESTLLAYKSAQD  163

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IA  ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAI+ELDTLGEESYKDS
Sbjct  164  IALAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAISELDTLGEESYKDS  223

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE*SQ  211
            TLIMQL RDNLTLWTSD+ DD  DEIKEASK ++  +Q
Sbjct  224  TLIMQLFRDNLTLWTSDITDDAGDEIKEASKRESSEAQ  261



>gb|ADO95303.1| 14-3-3-like protein GF14 Psi [Eutrema salsugineum]
Length=255

 Score =   270 bits (689),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 129/153 (84%), Positives = 140/153 (92%), Gaps = 0/153 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GIL +L++ LI +A+   SKVFYLKMKGDYHRYLAEFK GAERKEAAE+TL AYKSAQ+
Sbjct  100  DGILNVLEAHLIPSASPAESKVFYLKMKGDYHRYLAEFKAGAERKEAAESTLVAYKSAQD  159

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IA  ELAPTHPIRLGLALNFSVFYYEILNSPDRAC+LAKQAFDEAIAELDTLGEESYKDS
Sbjct  160  IAIAELAPTHPIRLGLALNFSVFYYEILNSPDRACSLAKQAFDEAIAELDTLGEESYKDS  219

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPD  226
            TLIMQLLRDNLTLWTSDM D+  DEIKEASKP+
Sbjct  220  TLIMQLLRDNLTLWTSDMTDEAGDEIKEASKPE  252



>ref|NP_001062060.1| Os08g0480800 [Oryza sativa Japonica Group]
 sp|Q84J55.1|14331_ORYSJ RecName: Full=14-3-3-like protein GF14-A; AltName: Full=G-box 
factor 14-3-3 homolog A [Oryza sativa Japonica Group]
 gb|AAO72553.1| WIN2-like protein [Oryza sativa Japonica Group]
 gb|AAO72644.1| TaWIN2-like protein [Oryza sativa Japonica Group]
 dbj|BAD09765.1| putative TaWIN2 [Oryza sativa Japonica Group]
 dbj|BAD10275.1| putative TaWIN2 [Oryza sativa Japonica Group]
 dbj|BAF23974.1| Os08g0480800 [Oryza sativa Japonica Group]
 gb|EAZ07375.1| hypothetical protein OsI_29626 [Oryza sativa Indica Group]
Length=264

 Score =   270 bits (690),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 145/154 (94%), Gaps = 0/154 (0%)
 Frame = -1

Query  681  GILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQEI  502
            GIL+LLD +L+ AA + ++KVFYLKMKGDYHRYLAEFKTGAERK+AA+ TL+AY++AQ+I
Sbjct  110  GILRLLDERLVPAAAAVDAKVFYLKMKGDYHRYLAEFKTGAERKDAADATLAAYQAAQDI  169

Query  501  ANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDST  322
            A  EL+PTHPIRLGLALNFSVFYYEILNSPDRAC LAKQAFDEAI+ELDTLGEESYKDST
Sbjct  170  AMKELSPTHPIRLGLALNFSVFYYEILNSPDRACTLAKQAFDEAISELDTLGEESYKDST  229

Query  321  LIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  220
            LIMQLLRDNLTLWTSDMQDDG DE+++A+KP++E
Sbjct  230  LIMQLLRDNLTLWTSDMQDDGGDEMRDATKPEDE  263



>gb|ABY65004.1| 14-3-3e protein [Gossypium hirsutum]
 gb|KJB08405.1| hypothetical protein B456_001G079900 [Gossypium raimondii]
 gb|KJB08406.1| hypothetical protein B456_001G079900 [Gossypium raimondii]
Length=262

 Score =   270 bits (689),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 131/154 (85%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GIL LL+S LI  A+S  SKVFYLKMKGDYHRYLAEFKTGAERKEAAE+TL AYKSAQ+
Sbjct  104  DGILSLLESHLIPLASSAESKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLLAYKSAQD  163

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IA  ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAI+ELDTLGEESYKDS
Sbjct  164  IALAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAISELDTLGEESYKDS  223

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDN  223
            TLIMQLLRDNLTLWTSD+ D+  DEIKEASK ++
Sbjct  224  TLIMQLLRDNLTLWTSDITDEAGDEIKEASKHES  257



>ref|XP_010525152.1| PREDICTED: 14-3-3-like protein [Tarenaya hassleriana]
 ref|XP_010525153.1| PREDICTED: 14-3-3-like protein [Tarenaya hassleriana]
 ref|XP_010525154.1| PREDICTED: 14-3-3-like protein [Tarenaya hassleriana]
 gb|ABD96957.1| hypothetical protein [Cleome spinosa]
Length=271

 Score =   270 bits (690),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GIL LL++ LI  A+S  SKVFYLKMKGDYHRYLAEFKTG ERKEAAENTL AYKSAQ+
Sbjct  104  DGILNLLETHLIPCASSAESKVFYLKMKGDYHRYLAEFKTGTERKEAAENTLLAYKSAQD  163

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IA  ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAI+ELDTLGEESYKDS
Sbjct  164  IALAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAISELDTLGEESYKDS  223

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE*SQ  211
            TLIMQLLRDNLTLWTSD+ D+  DEIK+ASK ++E  Q
Sbjct  224  TLIMQLLRDNLTLWTSDINDEAGDEIKDASKQESEEGQ  261



>gb|KHG05238.1| Uncharacterized protein F383_30797 [Gossypium arboreum]
Length=258

 Score =   270 bits (689),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 131/145 (90%), Positives = 137/145 (94%), Gaps = 2/145 (1%)
 Frame = -1

Query  681  GILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQEI  502
            GILKLLD+ LI +A+ G+SKVFYLKMKGDYHRYLAEFKT AERKEAAE+TL+AYKSAQEI
Sbjct  104  GILKLLDTTLIPSASGGDSKVFYLKMKGDYHRYLAEFKTSAERKEAAESTLTAYKSAQEI  163

Query  501  ANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDST  322
            AN ELAPTHPIRLGLALNFSVFYYEILNSPDRAC LAKQAFDEAIAELDTLGEESYKDST
Sbjct  164  ANAELAPTHPIRLGLALNFSVFYYEILNSPDRACELAKQAFDEAIAELDTLGEESYKDST  223

Query  321  LIMQLLRDNLTLWTSDMQDDGADEI  247
            LIMQLLRDNLTLWTSDMQDD  DEI
Sbjct  224  LIMQLLRDNLTLWTSDMQDD--DEI  246



>ref|XP_004137196.1| PREDICTED: 14-3-3-like protein-like [Cucumis sativus]
 ref|XP_004156536.1| PREDICTED: 14-3-3-like protein-like [Cucumis sativus]
 ref|XP_008455580.1| PREDICTED: 14-3-3-like protein [Cucumis melo]
 ref|XP_008455581.1| PREDICTED: 14-3-3-like protein [Cucumis melo]
 ref|XP_008455582.1| PREDICTED: 14-3-3-like protein [Cucumis melo]
 gb|KGN53640.1| hypothetical protein Csa_4G094520 [Cucumis sativus]
Length=263

 Score =   270 bits (689),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 131/154 (85%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GIL LL+S LI +A+S  SKVFYLKMKGDYHRYLAEFKTGAERKEAAE+TL AYKSAQ+
Sbjct  104  DGILSLLESHLIPSASSAESKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLLAYKSAQD  163

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IA  ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAI+ELDTLGEESYKDS
Sbjct  164  IALAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAISELDTLGEESYKDS  223

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDN  223
            TLIMQLLRDNLTLWTSD+ D+  DEIKEASK ++
Sbjct  224  TLIMQLLRDNLTLWTSDIGDEAGDEIKEASKRES  257



>gb|AAC04811.1| GF14 protein [Fritillaria agrestis]
Length=259

 Score =   269 bits (688),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLDS L+ ++T+  SKVFYLKMKGDYHRYLAEFK+GAERKEAAE+TL AYKSAQ+
Sbjct  104  DGILKLLDSHLVPSSTAAESKVFYLKMKGDYHRYLAEFKSGAERKEAAESTLLAYKSAQD  163

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IA  ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAI+ELDTLGEESYKDS
Sbjct  164  IALAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAISELDTLGEESYKDS  223

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASK  232
            TLIMQLLRDNLTLWTSD+ ++  DEIKEASK
Sbjct  224  TLIMQLLRDNLTLWTSDINEEAGDEIKEASK  254



>ref|XP_011009577.1| PREDICTED: 14-3-3-like protein isoform X1 [Populus euphratica]
Length=267

 Score =   270 bits (689),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 129/143 (90%), Positives = 138/143 (97%), Gaps = 0/143 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLDS+LI  A++G+SKVFYLKMKGDYHRYLAEFKTGAERKEAAE+TL+AYKSAQ+
Sbjct  104  DGILKLLDSRLIPTASAGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLTAYKSAQD  163

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  164  IANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  223

Query  324  TLIMQLLRDNLTLWTSDMQDDGA  256
            TLIMQLLRDNLTLWTSDMQ  G+
Sbjct  224  TLIMQLLRDNLTLWTSDMQVMGS  246



>ref|XP_010680999.1| PREDICTED: 14-3-3 protein 2-like isoform X2 [Beta vulgaris subsp. 
vulgaris]
Length=259

 Score =   269 bits (688),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 131/155 (85%), Positives = 146/155 (94%), Gaps = 1/155 (1%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLL+SKLI  A++ +SKVFYLKMKGDY+RYLAEF TG+ERKEAAENTLSAYK+AQ+
Sbjct  104  DGILKLLESKLIPVASNPDSKVFYLKMKGDYYRYLAEFTTGSERKEAAENTLSAYKAAQD  163

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN +L PTHPIRLGLALNFSVFYYEILNSPDRAC+LAKQAFDEAIAELDTLGE+SYKDS
Sbjct  164  IAN-DLPPTHPIRLGLALNFSVFYYEILNSPDRACSLAKQAFDEAIAELDTLGEDSYKDS  222

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  220
            TLIMQLLRDNLTLWTSDMQ+DGADEIKE+S   +E
Sbjct  223  TLIMQLLRDNLTLWTSDMQEDGADEIKESSNKQDE  257



>gb|KJB64237.1| hypothetical protein B456_010G038600 [Gossypium raimondii]
Length=258

 Score =   269 bits (688),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 131/145 (90%), Positives = 137/145 (94%), Gaps = 2/145 (1%)
 Frame = -1

Query  681  GILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQEI  502
            GILKLLD+ LI + + G+SKVFYLKMKGDYHRYLAEFKTGAERKEAAE+TL+AYKSAQEI
Sbjct  104  GILKLLDTTLIPSPSGGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLTAYKSAQEI  163

Query  501  ANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDST  322
            AN ELAPTHPIRLGLALNFSVFYYEILNSPDRAC LAKQAFDEAIAELDTLGEESYKDST
Sbjct  164  ANAELAPTHPIRLGLALNFSVFYYEILNSPDRACELAKQAFDEAIAELDTLGEESYKDST  223

Query  321  LIMQLLRDNLTLWTSDMQDDGADEI  247
            LIMQLLRDNLTLWTSDMQDD  DEI
Sbjct  224  LIMQLLRDNLTLWTSDMQDD--DEI  246



>gb|AGJ98232.1| PIB41 14-3-3 protein [Petunia x hybrida]
Length=260

 Score =   269 bits (688),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 131/154 (85%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GIL LL+S LI +A++  SKVFYLKMKGDYHRYLAEFKTGAERKEAAENTL AYKSAQ+
Sbjct  102  DGILSLLESHLIPSASTAESKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLLAYKSAQD  161

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IA  ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAI+ELDTLGEESYKDS
Sbjct  162  IALAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAISELDTLGEESYKDS  221

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDN  223
            TLIMQLLRDNLTLWTSD  DD  D+IKEA K D+
Sbjct  222  TLIMQLLRDNLTLWTSDNADDAGDDIKEAPKHDS  255



>gb|AIJ04690.1| 14-3-3a [Morus alba var. atropurpurea]
Length=262

 Score =   269 bits (688),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 130/154 (84%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GIL LL+S LI +A+S  SKVFYLKMKGDYHRYLAEFKTG+ERKEAAE+TL AYKSAQ+
Sbjct  104  DGILNLLESHLIPSASSAESKVFYLKMKGDYHRYLAEFKTGSERKEAAESTLLAYKSAQD  163

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IA  ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAI+ELDTLGE+SYKDS
Sbjct  164  IALAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAISELDTLGEDSYKDS  223

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDN  223
            TLIMQLLRDNLTLWTSD+ DD  DEIKEASK ++
Sbjct  224  TLIMQLLRDNLTLWTSDITDDAGDEIKEASKRES  257



>gb|ABD96912.1| hypothetical protein [Cleome spinosa]
Length=272

 Score =   269 bits (688),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 131/155 (85%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GIL LL+S LI +A+S  SKVFYLKMKGDYHRYLAEFKTGAERKEAAE+TL AYKSAQ+
Sbjct  104  DGILNLLESHLIPSASSAESKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLLAYKSAQD  163

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IA  ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAI+ELDTLGEESYKDS
Sbjct  164  IALTELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAISELDTLGEESYKDS  223

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  220
            TLIMQLLRDNLTLWTSD+ D+  DEIK+ASK ++E
Sbjct  224  TLIMQLLRDNLTLWTSDINDEAGDEIKDASKGESE  258



>sp|Q9SP07.1|1433_LILLO RecName: Full=14-3-3-like protein [Lilium longiflorum]
 gb|AAF05737.1|AF191746_1 14-3-3-like protein [Lilium longiflorum]
Length=259

 Score =   269 bits (687),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLDS L+ ++T+  SKVFYLKMKGDYHRYLAEFK+GAERKEAAE+TL AYKSAQ+
Sbjct  104  DGILKLLDSHLVPSSTAPESKVFYLKMKGDYHRYLAEFKSGAERKEAAESTLLAYKSAQD  163

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IA  ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAI+ELDTLGEESYKDS
Sbjct  164  IALAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAISELDTLGEESYKDS  223

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASK  232
            TLIMQLLRDNLTLWTSD+ ++  DEIKEASK
Sbjct  224  TLIMQLLRDNLTLWTSDINEEAGDEIKEASK  254



>gb|KFK42215.1| hypothetical protein AALP_AA2G226400 [Arabis alpina]
Length=262

 Score =   269 bits (687),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLDS+L+ AA SG+SKVFYLKMKGDYHRYLAEFKTG ERK+AAE+TLSAYKSAQ+
Sbjct  102  DGILKLLDSRLVPAAASGDSKVFYLKMKGDYHRYLAEFKTGQERKDAAEHTLSAYKSAQD  161

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IAN ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS
Sbjct  162  IANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  221

Query  324  TLIMQLLRDNLTLWTSDMQ  268
            TLIMQLLRDNLTLWTSDMQ
Sbjct  222  TLIMQLLRDNLTLWTSDMQ  240



>sp|P42652.1|14334_SOLLC RecName: Full=14-3-3 protein 4; AltName: Full=PBLT4 [Solanum 
lycopersicum]
 gb|AAA99431.1| 14-3-3 protein homologue [Solanum lycopersicum]
 prf||2019487B 14-3-3 protein
Length=260

 Score =   269 bits (687),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 130/154 (84%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GIL LL+S LI +A++  SKVF+LKMKGDYHRYLAEFKTG ERKEAAENTL AYKSAQ+
Sbjct  102  DGILSLLESNLIPSASTAESKVFHLKMKGDYHRYLAEFKTGTERKEAAENTLLAYKSAQD  161

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IA  ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAI+ELDTLGEESYKDS
Sbjct  162  IALAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAISELDTLGEESYKDS  221

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDN  223
            TLIMQLLRDNLTLWTSD  DD  D+IKEASKP++
Sbjct  222  TLIMQLLRDNLTLWTSDNADDVGDDIKEASKPES  255



>ref|XP_010926139.1| PREDICTED: 14-3-3-like protein [Elaeis guineensis]
 gb|AEZ00871.1| putative 14-3-3 regulatory [Elaeis guineensis]
Length=261

 Score =   268 bits (686),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 130/154 (84%), Positives = 143/154 (93%), Gaps = 0/154 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLL+S LI +AT+  SKVFYLKMKGDYHRYLAEFKTGAERKEAAE+TL AYKSAQ+
Sbjct  104  DGILKLLESHLIPSATAVESKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLLAYKSAQD  163

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IA  ELAPTHPIRLGLALNFSVFYYEILNSPDRAC+LAKQAFDEAI+ELD+LGEESYKDS
Sbjct  164  IALAELAPTHPIRLGLALNFSVFYYEILNSPDRACSLAKQAFDEAISELDSLGEESYKDS  223

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDN  223
            TLIMQLLRDNLTLWTSD+ +DG DEIKEA K ++
Sbjct  224  TLIMQLLRDNLTLWTSDITEDGGDEIKEAPKRES  257



>gb|AAA32799.1| GF14 psi chain [Arabidopsis thaliana]
 gb|AAA96252.1| GF14psi isoform [Arabidopsis thaliana]
Length=255

 Score =   268 bits (685),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 128/153 (84%), Positives = 139/153 (91%), Gaps = 0/153 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GIL +L++ LI +A+   SKVFYLKMKGDYHRYLAEFK GAERKEAAE+TL AYKSA +
Sbjct  100  DGILNVLEAHLIPSASPAESKVFYLKMKGDYHRYLAEFKAGAERKEAAESTLVAYKSASD  159

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IA  ELAPTHPIRLGLALNFSVFYYEILNSPDRAC+LAKQAFD+AIAELDTLGEESYKDS
Sbjct  160  IATAELAPTHPIRLGLALNFSVFYYEILNSPDRACSLAKQAFDDAIAELDTLGEESYKDS  219

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPD  226
            TLIMQLLRDNLTLWTSDM D+  DEIKEASKPD
Sbjct  220  TLIMQLLRDNLTLWTSDMTDEAGDEIKEASKPD  252



>ref|NP_568557.1| 14-3-3-like protein GF14 psi [Arabidopsis thaliana]
 sp|P42644.2|14333_ARATH RecName: Full=14-3-3-like protein GF14 psi; AltName: Full=General 
regulatory factor 3; AltName: Full=Protein RARE COLD INDUCIBLE 
1A [Arabidopsis thaliana]
 gb|AAL06546.1|AF412093_1 AT5g16050/F1N13_190 [Arabidopsis thaliana]
 emb|CAA52237.1| RCI14A [Arabidopsis thaliana]
 dbj|BAB10138.1| 14-3-3 protein homolog RCI1 [Arabidopsis thaliana]
 gb|AAM16237.1| AT5g16050/F1N13_190 [Arabidopsis thaliana]
 dbj|BAF00404.1| 14-3-3 protein homolog RCI1 [Arabidopsis thaliana]
 dbj|BAE98382.1| 14-3-3 protein homolog RCI1 [Arabidopsis thaliana]
 gb|AED94323.1| 14-3-3-like protein GF14 psi [Arabidopsis thaliana]
Length=255

 Score =   268 bits (685),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 128/153 (84%), Positives = 139/153 (91%), Gaps = 0/153 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GIL +L++ LI +A+   SKVFYLKMKGDYHRYLAEFK GAERKEAAE+TL AYKSA +
Sbjct  100  DGILNVLEAHLIPSASPAESKVFYLKMKGDYHRYLAEFKAGAERKEAAESTLVAYKSASD  159

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IA  ELAPTHPIRLGLALNFSVFYYEILNSPDRAC+LAKQAFD+AIAELDTLGEESYKDS
Sbjct  160  IATAELAPTHPIRLGLALNFSVFYYEILNSPDRACSLAKQAFDDAIAELDTLGEESYKDS  219

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPD  226
            TLIMQLLRDNLTLWTSDM D+  DEIKEASKPD
Sbjct  220  TLIMQLLRDNLTLWTSDMTDEAGDEIKEASKPD  252



>gb|ACH63229.1| 14-3-3 protein [Rheum australe]
Length=260

 Score =   268 bits (686),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GIL LLDS L+ +A S  SKVFYLKMKGDYHRYLAEFKTG ERKEAAENTL AYKSAQ+
Sbjct  103  DGILNLLDSHLVPSAASAESKVFYLKMKGDYHRYLAEFKTGTERKEAAENTLLAYKSAQD  162

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IA  +LAPTHPIRLGLALNFSVFYYEILNSPD+ACNLAKQAFDEAI+ELDTLGEESYKDS
Sbjct  163  IALADLAPTHPIRLGLALNFSVFYYEILNSPDKACNLAKQAFDEAISELDTLGEESYKDS  222

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASK  232
            TLIMQLLRDNLTLWTSD  ++GADEIKEA+K
Sbjct  223  TLIMQLLRDNLTLWTSDATEEGADEIKEATK  253



>ref|XP_009800018.1| PREDICTED: 14-3-3 protein 4-like [Nicotiana sylvestris]
 ref|XP_009800019.1| PREDICTED: 14-3-3 protein 4-like [Nicotiana sylvestris]
 dbj|BAD12176.1| 14-3-3 e-1 protein [Nicotiana tabacum]
Length=260

 Score =   268 bits (686),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 131/154 (85%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GIL LL+S LI  A++  SKVFYLKMKGDYHRYLAEFKTGAERKEAAENTL AYKSAQ+
Sbjct  102  DGILNLLESHLIPVASTAESKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLLAYKSAQD  161

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IA  ELAPTHPIRLGLALNFSVFYYEILNS DRACNLAKQAFD+AIAELDTLGEESYKDS
Sbjct  162  IALAELAPTHPIRLGLALNFSVFYYEILNSSDRACNLAKQAFDDAIAELDTLGEESYKDS  221

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDN  223
            TLIMQLLRDNLTLWTSD  DD  DEIKEASK ++
Sbjct  222  TLIMQLLRDNLTLWTSDTTDDAGDEIKEASKRES  255



>ref|XP_008801147.1| PREDICTED: 14-3-3-like protein [Phoenix dactylifera]
 ref|XP_008801148.1| PREDICTED: 14-3-3-like protein [Phoenix dactylifera]
 ref|XP_008801149.1| PREDICTED: 14-3-3-like protein [Phoenix dactylifera]
Length=261

 Score =   268 bits (685),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 129/153 (84%), Positives = 140/153 (92%), Gaps = 0/153 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLDS LI +A +  SKVFYLKMKGDYHRYLAEFKTG+ERK+AAENTL AYKSAQ+
Sbjct  104  DGILKLLDSHLIPSAAAAESKVFYLKMKGDYHRYLAEFKTGSERKDAAENTLMAYKSAQD  163

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IA  ELAPTHPIRLGLALNFSVFYYEILNSPDRAC+LAKQAFDEAI+ELDTLGEESYKDS
Sbjct  164  IALAELAPTHPIRLGLALNFSVFYYEILNSPDRACSLAKQAFDEAISELDTLGEESYKDS  223

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPD  226
            TLIMQLLRDNLTLWTSD+ +D  DEIKEA K +
Sbjct  224  TLIMQLLRDNLTLWTSDIMEDAGDEIKEAPKKE  256



>ref|XP_010908756.1| PREDICTED: 14-3-3-like protein [Elaeis guineensis]
 ref|XP_010908757.1| PREDICTED: 14-3-3-like protein [Elaeis guineensis]
Length=261

 Score =   268 bits (685),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 129/153 (84%), Positives = 139/153 (91%), Gaps = 0/153 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLDS +I +A +  SKVFYLKMKGDYHRYLAEFKTGAERKEAAENTL AYKSAQ+
Sbjct  104  DGILKLLDSHVIPSAAAAESKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLMAYKSAQD  163

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IA  ELAPTHPIRLGLALNFSVFYYEILNSPDRAC+LAKQAFDEAI+ELDTLGEESYKD 
Sbjct  164  IALAELAPTHPIRLGLALNFSVFYYEILNSPDRACSLAKQAFDEAISELDTLGEESYKDG  223

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPD  226
            TLIMQLLRDNLTLWTSD+ +D  DEIKEA K +
Sbjct  224  TLIMQLLRDNLTLWTSDITEDAGDEIKEAPKKE  256



>ref|XP_004968972.1| PREDICTED: 14-3-3-like protein GF14-C-like isoform X2 [Setaria 
italica]
Length=256

 Score =   268 bits (684),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 127/153 (83%), Positives = 142/153 (93%), Gaps = 0/153 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GILKLLDS L+ ++T+  SKVFYLKMKGDYHRYLAEFKTG ERKE+AE+T+ AYK+AQ+
Sbjct  99   DGILKLLDSHLVPSSTAAESKVFYLKMKGDYHRYLAEFKTGTERKESAESTMVAYKAAQD  158

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IA  E+APTHPIRLGLALNFSVFYYEILNSPD+ACNLAKQAFDEAI+ELDTLGEESYKDS
Sbjct  159  IALAEMAPTHPIRLGLALNFSVFYYEILNSPDKACNLAKQAFDEAISELDTLGEESYKDS  218

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPD  226
            TLIMQLLRDNLTLWTSD+ +DGADE KEASK D
Sbjct  219  TLIMQLLRDNLTLWTSDLTEDGADEGKEASKGD  251



>dbj|BAM20996.1| 14-3-3 protein [Marchantia polymorpha]
Length=260

 Score =   268 bits (684),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 130/154 (84%), Positives = 137/154 (89%), Gaps = 0/154 (0%)
 Frame = -1

Query  681  GILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQEI  502
             IL LLD+ LI  +T+G SKVFYLKMKGDYHRYLAEFKTGAERKEAAE+TL AYKSAQ+I
Sbjct  105  SILNLLDTHLIPTSTTGESKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLLAYKSAQDI  164

Query  501  ANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDST  322
            A  ELAPTHPIRLGLALNFSVFYYEILNSPDRAC LAKQAFDEAIAELDTLGEESYKDST
Sbjct  165  ALTELAPTHPIRLGLALNFSVFYYEILNSPDRACTLAKQAFDEAIAELDTLGEESYKDST  224

Query  321  LIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  220
            LIMQLLRDNLTLWTSDMQ+D  D+ KEA   D E
Sbjct  225  LIMQLLRDNLTLWTSDMQEDAGDDTKEAKTEDAE  258



>gb|AFK46913.1| unknown [Lotus japonicus]
Length=264

 Score =   268 bits (684),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 130/154 (84%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GIL LL+S LI +A +  SKVFYLKMKGDYHRYLAEFKTGAERKEAAE+TL AYKSAQ+
Sbjct  106  DGILNLLESNLIPSAAAPESKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLLAYKSAQD  165

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IA  ELAPTHPIRLGLALNFSVFYYEILN PDRACNLAKQAFDEAI+ELDTLGEESYKDS
Sbjct  166  IALAELAPTHPIRLGLALNFSVFYYEILNPPDRACNLAKQAFDEAISELDTLGEESYKDS  225

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDN  223
            TLIMQLLRDNLTLWTSD+ DD  DEIKE SKP +
Sbjct  226  TLIMQLLRDNLTLWTSDITDDAGDEIKETSKPQS  259



>ref|XP_006384210.1| hypothetical protein POPTR_0004s10120g [Populus trichocarpa]
 gb|ERP62007.1| hypothetical protein POPTR_0004s10120g [Populus trichocarpa]
Length=248

 Score =   267 bits (683),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 132/154 (86%), Positives = 143/154 (93%), Gaps = 1/154 (1%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GIL LL+S L+ +A+S  SKVFYLKMKGDYHRYLAEFKTGAERKEAAE+TL AYKSAQ+
Sbjct  91   DGILNLLESHLVPSASSAESKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLLAYKSAQD  150

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IA  ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAI+ELDTLGEESYKDS
Sbjct  151  IALTELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAISELDTLGEESYKDS  210

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDN  223
            TLIMQLLRDNLTLWTSD+ DD ADEIKEASK ++
Sbjct  211  TLIMQLLRDNLTLWTSDITDD-ADEIKEASKRES  243



>ref|XP_010528468.1| PREDICTED: 14-3-3-like protein GF14 psi [Tarenaya hassleriana]
Length=263

 Score =   268 bits (684),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 132/152 (87%), Positives = 141/152 (93%), Gaps = 1/152 (1%)
 Frame = -1

Query  681  GILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQEI  502
            GIL LLDS LI AA+S  SKVFYLKMKGDYHRYLAEFK GAERKEAAE+TL AYK+AQ+I
Sbjct  104  GILNLLDSHLIPAASSAESKVFYLKMKGDYHRYLAEFKAGAERKEAAESTLLAYKAAQDI  163

Query  501  ANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDST  322
            A  ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDST
Sbjct  164  ALVELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDST  223

Query  321  LIMQLLRDNLTLWTSDMQDDGADEIKEASKPD  226
            LIMQLLRDNLTLWTSD+ D+G DEIKE++KP+
Sbjct  224  LIMQLLRDNLTLWTSDITDEG-DEIKESAKPE  254



>ref|XP_009615235.1| PREDICTED: 14-3-3 protein 4-like [Nicotiana tomentosiformis]
 ref|XP_009615236.1| PREDICTED: 14-3-3 protein 4-like [Nicotiana tomentosiformis]
 dbj|BAD12177.1| 14-3-3 e-2 protein [Nicotiana tabacum]
Length=260

 Score =   268 bits (684),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 131/154 (85%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = -1

Query  684  NGILKLLDSKLIGAATSGNSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQE  505
            +GIL LL+S LI  A++  SKVFYLKMKGDYHRYLAEFKTGAERKEAAENTL AYKSAQ+
Sbjct  102  DGILNLLESHLIPVASTAESKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLLAYKSAQD  161

Query  504  IANGELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDS  325
            IA  ELAPTHPIRLGLALNFSVFYYEILNS DRACNLAKQAFD+AIAELDTLGEESYKDS
Sbjct  162  IALAELAPTHPIRLGLALNFSVFYYEILNSSDRACNLAKQAFDDAIAELDTLGEESYKDS  221

Query  324  TLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDN  223
            TLIMQLLRDNLTLWTSD  DD  DEIKEASK ++
Sbjct  222  TLIMQLLRDNLTLWTSDSTDDAGDEIKEASKRES  255



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1131443780880