BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF027A13

Length=643
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAO49718.1|  nuclear pore complex protein Sec13d                    247   1e-77   Nicotiana benthamiana
ref|XP_009623350.1|  PREDICTED: protein SEC13 homolog                   247   1e-77   Nicotiana tomentosiformis
ref|XP_007024275.1|  Transducin family protein / WD-40 repeat fam...    247   2e-77   
ref|XP_009764554.1|  PREDICTED: protein SEC13 homolog                   246   4e-77   Nicotiana sylvestris
dbj|BAO49715.1|  nuclear pore complex protein Sec13a                    244   1e-76   Nicotiana benthamiana
gb|KHG11308.1|  Protein SEC13                                           244   1e-76   Gossypium arboreum [tree cotton]
gb|KJB45573.1|  hypothetical protein B456_007G314500                    244   2e-76   Gossypium raimondii
ref|XP_004232260.1|  PREDICTED: protein transport protein SEC13 h...    243   3e-76   Solanum lycopersicum
dbj|BAO49717.1|  nuclear pore complex protein Sec13c                    243   4e-76   Nicotiana benthamiana
ref|XP_010033246.1|  PREDICTED: protein SEC13 homolog                   243   5e-76   Eucalyptus grandis [rose gum]
gb|ACU20139.1|  unknown                                                 242   9e-76   Glycine max [soybeans]
ref|XP_006586096.1|  PREDICTED: protein SEC13 homolog isoform X1        242   1e-75   Glycine max [soybeans]
ref|XP_006426897.1|  hypothetical protein CICLE_v10026168mg             242   1e-75   Citrus clementina [clementine]
ref|XP_002281856.1|  PREDICTED: protein transport protein SEC13 h...    242   1e-75   Vitis vinifera
gb|KHM99522.1|  Protein SEC13 like                                      241   2e-75   Glycine soja [wild soybean]
ref|XP_006586103.1|  PREDICTED: protein SEC13 homolog isoform X2        243   2e-75   
ref|XP_003532149.2|  PREDICTED: protein SEC13 homolog isoform X1        243   2e-75   
ref|XP_006465678.1|  PREDICTED: protein SEC13 homolog                   241   3e-75   Citrus sinensis [apfelsine]
ref|XP_003551869.1|  PREDICTED: protein SEC13 homolog                   240   5e-75   Glycine max [soybeans]
ref|XP_010099520.1|  Protein SEC13-like protein                         240   7e-75   Morus notabilis
ref|XP_002266827.2|  PREDICTED: protein transport protein SEC13 h...    240   7e-75   Vitis vinifera
ref|XP_010929133.1|  PREDICTED: protein transport protein SEC13 h...    240   7e-75   Elaeis guineensis
ref|XP_007145729.1|  hypothetical protein PHAVU_007G263000g             239   9e-75   Phaseolus vulgaris [French bean]
emb|CAN63472.1|  hypothetical protein VITISV_000787                     239   1e-74   Vitis vinifera
ref|XP_002515980.1|  protein transport protein sec13, putative          239   1e-74   Ricinus communis
ref|XP_009335780.1|  PREDICTED: protein SEC13 homolog                   239   1e-74   Pyrus x bretschneideri [bai li]
ref|XP_008379297.1|  PREDICTED: protein SEC13 homolog                   239   1e-74   Malus domestica [apple tree]
gb|KDP43859.1|  hypothetical protein JCGZ_20869                         239   2e-74   Jatropha curcas
emb|CDP02169.1|  unnamed protein product                                238   2e-74   Coffea canephora [robusta coffee]
ref|XP_010942123.1|  PREDICTED: protein transport protein SEC13 h...    238   2e-74   Elaeis guineensis
emb|CAN79974.1|  hypothetical protein VITISV_009154                     238   3e-74   Vitis vinifera
ref|XP_002265971.1|  PREDICTED: protein transport protein SEC13 h...    238   4e-74   Vitis vinifera
ref|XP_010094976.1|  Protein SEC13-like protein                         238   4e-74   Morus notabilis
ref|XP_007144311.1|  hypothetical protein PHAVU_007G145400g             238   4e-74   Phaseolus vulgaris [French bean]
gb|KHN12541.1|  Protein SEC13 like                                      238   4e-74   Glycine soja [wild soybean]
ref|XP_011085795.1|  PREDICTED: protein transport protein SEC13 h...    238   5e-74   Sesamum indicum [beniseed]
ref|XP_011028666.1|  PREDICTED: protein transport protein SEC13 h...    238   6e-74   Populus euphratica
gb|KCW52832.1|  hypothetical protein EUGRSUZ_J02164                     238   7e-74   Eucalyptus grandis [rose gum]
gb|AGV54445.1|  protein transport SEC13-like protein                    237   8e-74   Phaseolus vulgaris [French bean]
gb|KCW84259.1|  hypothetical protein EUGRSUZ_B01116                     237   1e-73   Eucalyptus grandis [rose gum]
ref|XP_008230683.1|  PREDICTED: protein SEC13 homolog                   237   1e-73   Prunus mume [ume]
ref|XP_010272104.1|  PREDICTED: protein transport protein SEC13 h...    237   1e-73   Nelumbo nucifera [Indian lotus]
ref|XP_008790006.1|  PREDICTED: protein SEC13 homolog                   237   1e-73   Phoenix dactylifera
emb|CAN81348.1|  hypothetical protein VITISV_021485                     236   2e-73   Vitis vinifera
ref|XP_007215747.1|  hypothetical protein PRUPE_ppa009252mg             236   2e-73   Prunus persica
gb|EYU44682.1|  hypothetical protein MIMGU_mgv1a010776mg                236   2e-73   Erythranthe guttata [common monkey flower]
ref|XP_009759579.1|  PREDICTED: protein transport protein SEC13-like    236   2e-73   Nicotiana sylvestris
ref|XP_002321555.1|  hypothetical protein POPTR_0015s080101g            236   2e-73   
gb|ACU18089.1|  unknown                                                 236   2e-73   Glycine max [soybeans]
ref|XP_003551800.1|  PREDICTED: protein SEC13 homolog isoform X1        236   3e-73   
gb|AFK43784.1|  unknown                                                 231   4e-73   Lotus japonicus
ref|XP_004512728.1|  PREDICTED: protein SEC13 homolog isoform X1        235   6e-73   Cicer arietinum [garbanzo]
dbj|BAJ10727.1|  SEC13 family protein                                   235   6e-73   Lotus japonicus
ref|XP_006379798.1|  hypothetical protein POPTR_0008s14080g             234   6e-73   
ref|XP_011098538.1|  PREDICTED: protein transport protein SEC13 h...    234   1e-72   Sesamum indicum [beniseed]
ref|XP_004150601.1|  PREDICTED: protein SEC13 homolog                   233   2e-72   Cucumis sativus [cucumbers]
emb|CAN80755.1|  hypothetical protein VITISV_027966                     233   2e-72   Vitis vinifera
ref|XP_010524317.1|  PREDICTED: protein transport protein SEC13 h...    233   2e-72   Tarenaya hassleriana [spider flower]
ref|XP_009408052.1|  PREDICTED: protein SEC13 homolog                   233   4e-72   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDP21792.1|  unnamed protein product                                233   5e-72   Coffea canephora [robusta coffee]
gb|KDO51761.1|  hypothetical protein CISIN_1g036510mg                   232   6e-72   Citrus sinensis [apfelsine]
ref|NP_001275312.1|  protein transport SEC13-like protein               232   6e-72   Solanum tuberosum [potatoes]
dbj|BAO49716.1|  nuclear pore complex protein Sec13b                    232   8e-72   Nicotiana benthamiana
ref|XP_002315836.1|  transport protein SEC13                            232   8e-72   
ref|XP_011466267.1|  PREDICTED: protein transport protein SEC13 h...    231   1e-71   Fragaria vesca subsp. vesca
dbj|BAJ10728.1|  SEC13 family protein                                   231   2e-71   Lotus japonicus
ref|XP_010550097.1|  PREDICTED: protein transport protein SEC13 h...    231   2e-71   Tarenaya hassleriana [spider flower]
gb|AFK43487.1|  unknown                                                 229   3e-71   Lotus japonicus
gb|AFK33508.1|  unknown                                                 227   3e-71   Medicago truncatula
ref|XP_008380946.1|  PREDICTED: protein transport protein SEC13-like    231   3e-71   Malus domestica [apple tree]
ref|XP_010665916.1|  PREDICTED: protein transport protein SEC13 h...    230   3e-71   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007215469.1|  hypothetical protein PRUPE_ppa006517mg             233   7e-71   
ref|XP_007032314.1|  Transducin family protein / WD-40 repeat fam...    229   1e-70   
ref|XP_010687899.1|  PREDICTED: protein transport protein SEC13 h...    229   1e-70   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004141658.1|  PREDICTED: protein SEC13 homolog                   229   2e-70   Cucumis sativus [cucumbers]
ref|XP_008462440.1|  PREDICTED: protein SEC13 homolog                   228   2e-70   Cucumis melo [Oriental melon]
gb|KEH33918.1|  transducin/WD-like repeat-protein                       228   2e-70   Medicago truncatula
ref|XP_011021702.1|  PREDICTED: protein transport protein SEC13 h...    228   4e-70   Populus euphratica
ref|XP_010267185.1|  PREDICTED: protein transport protein SEC13 h...    227   7e-70   Nelumbo nucifera [Indian lotus]
ref|XP_011072420.1|  PREDICTED: protein transport protein SEC13 h...    227   9e-70   Sesamum indicum [beniseed]
gb|AFX66988.1|  protein transport SEC13-like protein                    226   2e-69   Solanum tuberosum [potatoes]
ref|XP_006470402.1|  PREDICTED: protein SEC13 homolog                   225   5e-69   
gb|KDP40875.1|  hypothetical protein JCGZ_24874                         225   5e-69   Jatropha curcas
ref|XP_006446433.1|  hypothetical protein CICLE_v10016079mg             225   6e-69   Citrus clementina [clementine]
ref|XP_002879246.1|  transducin family protein                          224   8e-69   Arabidopsis lyrata subsp. lyrata
ref|NP_180566.1|  transport protein SEC13A                              224   9e-69   Arabidopsis thaliana [mouse-ear cress]
emb|CDY10705.1|  BnaA05g12310D                                          226   1e-68   Brassica napus [oilseed rape]
ref|XP_004235651.1|  PREDICTED: protein transport protein SEC13 h...    224   2e-68   Solanum lycopersicum
emb|CDY24035.1|  BnaC03g16560D                                          224   2e-68   Brassica napus [oilseed rape]
emb|CDX84863.1|  BnaA03g13670D                                          223   2e-68   
gb|EPS72747.1|  hypothetical protein M569_02010                         222   7e-68   Genlisea aurea
emb|CDY02025.1|  BnaC04g14760D                                          222   7e-68   
ref|XP_009141033.1|  PREDICTED: protein SEC13 homolog                   222   8e-68   Brassica rapa
ref|XP_004968630.1|  PREDICTED: protein SEC13 homolog                   221   2e-67   Setaria italica
gb|AAM65095.1|  putative protein transport protein SEC13                221   2e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004302867.1|  PREDICTED: protein transport protein SEC13 h...    220   2e-67   Fragaria vesca subsp. vesca
ref|NP_001045820.1|  Os02g0135800                                       220   4e-67   
ref|XP_010469902.1|  PREDICTED: protein transport protein SEC13 h...    220   4e-67   Camelina sativa [gold-of-pleasure]
ref|XP_006646853.1|  PREDICTED: protein SEC13 homolog                   220   4e-67   Oryza brachyantha
gb|AGT16309.1|  SEC13-related protein                                   220   4e-67   Saccharum hybrid cultivar R570
ref|XP_010510416.1|  PREDICTED: protein transport protein SEC13 h...    220   4e-67   Camelina sativa [gold-of-pleasure]
ref|XP_006294683.1|  hypothetical protein CARUB_v10023720mg             220   4e-67   Capsella rubella
ref|XP_006646846.1|  PREDICTED: protein SEC13 homolog                   220   4e-67   Oryza brachyantha
ref|XP_010414320.1|  PREDICTED: protein transport protein SEC13 h...    221   4e-67   Camelina sativa [gold-of-pleasure]
emb|CDX97854.1|  BnaC04g40850D                                          220   5e-67   
ref|XP_011466664.1|  PREDICTED: protein transport protein SEC13 h...    220   5e-67   Fragaria vesca subsp. vesca
ref|XP_002454939.1|  hypothetical protein SORBIDRAFT_03g001760          220   6e-67   Sorghum bicolor [broomcorn]
ref|NP_001150249.1|  SEC13-related protein                              219   7e-67   Zea mays [maize]
ref|XP_011466663.1|  PREDICTED: protein transport protein SEC13 h...    219   8e-67   Fragaria vesca subsp. vesca
gb|AGT17401.1|  SEC13-related protein                                   219   1e-66   Saccharum hybrid cultivar R570
gb|ACG46695.1|  SEC13-related protein                                   219   1e-66   Zea mays [maize]
ref|NP_001149004.1|  SEC13-related protein                              219   1e-66   
gb|ACN59487.1|  SEC13                                                   216   1e-65   Triticum aestivum [Canadian hard winter wheat]
gb|EMT07862.1|  hypothetical protein F775_17938                         216   1e-65   
dbj|BAJ89756.1|  predicted protein                                      216   2e-65   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_186783.1|  transport protein SEC13B                              216   2e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006410057.1|  hypothetical protein EUTSA_v10016789mg             218   4e-65   
gb|EMS54340.1|  Protein SEC13-like protein                              215   4e-65   Triticum urartu
emb|CDY29706.1|  BnaA04g17210D                                          224   4e-65   Brassica napus [oilseed rape]
gb|EYU21504.1|  hypothetical protein MIMGU_mgv1a010808mg                215   4e-65   Erythranthe guttata [common monkey flower]
ref|XP_006410056.1|  hypothetical protein EUTSA_v10016789mg             217   4e-65   
ref|XP_006854548.1|  hypothetical protein AMTR_s00030p00063600          214   6e-65   Amborella trichopoda
gb|ABK26393.1|  unknown                                                 213   8e-65   Picea sitchensis
ref|XP_006408491.1|  hypothetical protein EUTSA_v10021223mg             214   9e-65   Eutrema salsugineum [saltwater cress]
gb|ABK22893.1|  unknown                                                 214   1e-64   Picea sitchensis
emb|CDY49046.1|  BnaC05g48740D                                          214   1e-64   Brassica napus [oilseed rape]
ref|XP_003565584.1|  PREDICTED: protein transport protein SEC13 h...    213   2e-64   Brachypodium distachyon [annual false brome]
ref|XP_004956945.1|  PREDICTED: protein SEC13 homolog                   213   2e-64   Setaria italica
emb|CDY37530.1|  BnaA05g33950D                                          213   3e-64   Brassica napus [oilseed rape]
ref|XP_009147418.1|  PREDICTED: protein SEC13 homolog                   213   3e-64   Brassica rapa
ref|XP_010463534.1|  PREDICTED: protein transport protein SEC13 h...    213   3e-64   Camelina sativa [gold-of-pleasure]
ref|XP_011080528.1|  PREDICTED: protein transport protein SEC13 h...    212   5e-64   Sesamum indicum [beniseed]
gb|KHG02181.1|  Protein SEC13                                           212   6e-64   Gossypium arboreum [tree cotton]
ref|XP_006836221.1|  hypothetical protein AMTR_s00101p00099400          211   9e-64   Amborella trichopoda
ref|XP_006298213.1|  hypothetical protein CARUB_v10014264mg             211   9e-64   Capsella rubella
ref|XP_010485502.1|  PREDICTED: protein transport protein SEC13 h...    211   1e-63   Camelina sativa [gold-of-pleasure]
gb|KJB40797.1|  hypothetical protein B456_007G077700                    209   5e-63   Gossypium raimondii
ref|XP_010914535.1|  PREDICTED: protein transport protein SEC13 h...    208   1e-62   Elaeis guineensis
ref|XP_010500953.1|  PREDICTED: protein transport protein SEC13 h...    207   4e-62   Camelina sativa [gold-of-pleasure]
gb|AAM65185.1|  transport protein SEC13, putative                       207   5e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002460282.1|  hypothetical protein SORBIDRAFT_02g025945          206   7e-62   
gb|ADC80686.1|  Sec13-like protein                                      198   1e-60   Populus tremula x Populus alba [gray poplar]
gb|ADC80685.1|  Sec13-like protein                                      198   1e-60   Populus tremula x Populus alba [gray poplar]
gb|ADC80678.1|  Sec13-like protein                                      198   2e-60   Eperua grandiflora
gb|ADC80672.1|  Sec13-like protein                                      198   2e-60   Eperua falcata
gb|ADC80677.1|  Sec13-like protein                                      197   2e-60   Eperua falcata
gb|ADC80666.1|  Sec13-like protein                                      197   4e-60   Phanera guianensis
gb|ADC80670.1|  Sec13-like protein                                      197   4e-60   Bauhinia purpurea
gb|ADC80667.1|  Sec13-like protein                                      197   4e-60   Bauhinia purpurea
gb|ADC80661.1|  Sec13-like protein                                      197   4e-60   Phanera guianensis
gb|ADC80692.1|  Sec13-like protein                                      197   4e-60   Tachigali melinonii
gb|ADC80659.1|  Sec13-like protein                                      197   5e-60   Phanera guianensis
gb|ADC80690.1|  Sec13-like protein                                      197   5e-60   Tachigali melinonii
ref|XP_010249546.1|  PREDICTED: protein transport protein SEC13 h...    201   7e-60   
gb|ADC80676.1|  Sec13-like protein                                      196   7e-60   Eperua falcata
gb|KHM99531.1|  Protein SEC13 like                                      203   8e-60   Glycine soja [wild soybean]
gb|ADC80669.1|  Sec13-like protein                                      196   9e-60   Bauhinia purpurea
gb|ADC80660.1|  Sec13-like protein                                      196   9e-60   Phanera guianensis
gb|ADC80693.1|  Sec13-like protein                                      196   1e-59   Tachigali melinonii
gb|ADC80673.1|  Sec13-like protein                                      196   1e-59   Eperua falcata
gb|ADC80684.1|  Sec13-like protein                                      195   2e-59   Populus tremula x Populus alba [gray poplar]
gb|ADC80683.1|  Sec13-like protein                                      195   2e-59   Populus tremula x Populus alba [gray poplar]
ref|XP_002979018.1|  hypothetical protein SELMODRAFT_109958             200   3e-59   
ref|XP_002988399.1|  hypothetical protein SELMODRAFT_128111             200   3e-59   
ref|XP_010551882.1|  PREDICTED: protein transport protein SEC13 h...    199   3e-59   Tarenaya hassleriana [spider flower]
gb|ADC80658.1|  Sec13-like protein                                      194   4e-59   Phanera guianensis
gb|ADC80668.1|  Sec13-like protein                                      194   5e-59   Bauhinia purpurea
gb|ADC80691.1|  Sec13-like protein                                      194   8e-59   Tachigali melinonii
gb|ADC80662.1|  Sec13-like protein                                      193   1e-58   Phanera guianensis
gb|EMT13956.1|  hypothetical protein F775_31904                         194   4e-57   
gb|EMT33754.1|  hypothetical protein F775_27473                         192   9e-57   
ref|XP_001768123.1|  predicted protein                                  190   1e-55   
ref|XP_001781370.1|  predicted protein                                  190   2e-55   
ref|XP_001774339.1|  predicted protein                                  183   7e-53   
ref|XP_001767345.1|  predicted protein                                  169   1e-47   
ref|XP_008443459.1|  PREDICTED: protein SEC13 homolog                   166   4e-46   Cucumis melo [Oriental melon]
ref|XP_002971002.1|  hypothetical protein SELMODRAFT_94917              165   6e-46   Selaginella moellendorffii
ref|XP_002962084.1|  hypothetical protein SELMODRAFT_76631              165   6e-46   Selaginella moellendorffii
ref|XP_006650845.1|  PREDICTED: protein SEC13 homolog                   164   2e-45   Oryza brachyantha
ref|NP_001051797.1|  Os03g0831800                                       161   2e-44   
ref|XP_004169158.1|  PREDICTED: protein SEC13 homolog                   160   4e-44   
gb|AAF64424.1|AF206628_1  sec13-like protein                            155   5e-44   Cucumis melo [Oriental melon]
ref|XP_004147452.1|  PREDICTED: protein SEC13 homolog                   160   5e-44   Cucumis sativus [cucumbers]
gb|EPS72324.1|  hypothetical protein M569_02435                         159   6e-44   Genlisea aurea
ref|NP_001059284.1|  Os07g0246300                                       159   2e-43   
ref|NP_001149986.1|  SEC13-related protein                              158   4e-43   Zea mays [maize]
gb|ACN31668.1|  unknown                                                 158   4e-43   Zea mays [maize]
ref|XP_010098129.1|  Protein SEC13-like protein                         159   7e-43   
ref|XP_006657588.1|  PREDICTED: protein SEC13 homolog                   157   1e-42   Oryza brachyantha
ref|XP_004955890.1|  PREDICTED: protein SEC13 homolog                   156   2e-42   Setaria italica
ref|XP_008651486.1|  PREDICTED: SEC13-related protein isoform X2        158   3e-42   
ref|NP_001146460.1|  SEC13 protein                                      155   4e-42   Zea mays [maize]
gb|ABK26766.1|  unknown                                                 147   2e-41   Picea sitchensis
ref|XP_010228200.1|  PREDICTED: protein transport protein SEC13 h...    152   5e-41   
dbj|BAJ95085.1|  predicted protein                                      151   2e-40   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003563373.1|  PREDICTED: protein transport protein SEC13 h...    147   6e-39   Brachypodium distachyon [annual false brome]
gb|EEE60233.1|  hypothetical protein OsJ_13231                          142   6e-39   Oryza sativa Japonica Group [Japonica rice]
gb|KIY93193.1|  SEC13-related protein                                   138   2e-37   Monoraphidium neglectum
ref|XP_008303630.1|  PREDICTED: protein SEC13 homolog                   139   1e-36   Stegastes partitus
ref|XP_010001682.1|  PREDICTED: protein SEC13 homolog                   140   2e-36   Chaetura pelagica
gb|KFU93946.1|  Protein SEC13                                           140   2e-36   Chaetura pelagica
gb|KFV05646.1|  Protein SEC13                                           138   2e-36   Tauraco erythrolophus
ref|NP_998500.1|  protein SEC13 homolog                                 140   2e-36   Danio rerio [leopard danio]
ref|XP_009988542.1|  PREDICTED: protein SEC13 homolog                   138   2e-36   Tauraco erythrolophus
ref|XP_006631140.1|  PREDICTED: protein SEC13 homolog                   140   3e-36   
ref|XP_008319422.1|  PREDICTED: protein SEC13 homolog                   140   3e-36   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_010745417.1|  PREDICTED: protein SEC13 homolog                   139   6e-36   
ref|XP_008303874.1|  PREDICTED: protein SEC13 homolog                   139   7e-36   Stegastes partitus
ref|XP_005754890.1|  PREDICTED: protein SEC13 homolog                   139   7e-36   Pundamilia nyererei
ref|XP_007569682.1|  PREDICTED: protein SEC13 homolog                   139   8e-36   Poecilia formosa
ref|XP_004559093.1|  PREDICTED: protein SEC13 homolog                   139   8e-36   Maylandia zebra
ref|XP_005997883.1|  PREDICTED: protein SEC13 homolog                   139   9e-36   Latimeria chalumnae
ref|XP_010388584.1|  PREDICTED: protein SEC13 homolog                   138   1e-35   
ref|XP_009512940.1|  PREDICTED: protein SEC13 homolog                   139   1e-35   Phalacrocorax carbo [common cormorant]
ref|XP_009564163.1|  PREDICTED: protein SEC13 homolog                   139   1e-35   Cuculus canorus
ref|XP_005240252.1|  PREDICTED: protein SEC13 homolog                   139   1e-35   
ref|XP_010123453.1|  PREDICTED: protein SEC13 homolog                   138   1e-35   Chlamydotis macqueenii
ref|XP_008939207.1|  PREDICTED: protein SEC13 homolog                   138   1e-35   Merops nubicus
ref|XP_010022441.1|  PREDICTED: protein SEC13 homolog                   138   1e-35   Nestor notabilis
gb|KFR14993.1|  Protein SEC13                                           138   1e-35   Opisthocomus hoazin [hoatzin]
gb|KFV45554.1|  Protein SEC13                                           139   1e-35   Gavia stellata
gb|KFP91989.1|  Protein SEC13                                           139   1e-35   Apaloderma vittatum
gb|KFQ30001.1|  Protein SEC13                                           139   1e-35   Mesitornis unicolor
gb|KFM01351.1|  Protein SEC13                                           139   1e-35   Aptenodytes forsteri
gb|EMC83360.1|  Protein SEC13 like protein                              139   1e-35   
ref|XP_010085319.1|  PREDICTED: protein SEC13 homolog                   139   1e-35   Pterocles gutturalis
ref|XP_009080512.1|  PREDICTED: protein SEC13 homolog                   139   1e-35   Acanthisitta chloris
ref|XP_010134784.1|  PREDICTED: protein SEC13 homolog                   138   1e-35   Buceros rhinoceros silvestris
gb|KFZ64786.1|  Protein SEC13                                           139   1e-35   Antrostomus carolinensis
gb|KFP72681.1|  Protein SEC13                                           139   1e-35   Acanthisitta chloris
gb|KFQ30347.1|  Protein SEC13                                           138   1e-35   Merops nubicus
ref|XP_009490110.1|  PREDICTED: protein SEC13 homolog                   139   1e-35   Pelecanus crispus
ref|XP_009925138.1|  PREDICTED: LOW QUALITY PROTEIN: protein SEC1...    139   1e-35   Haliaeetus albicilla
ref|XP_002741141.1|  PREDICTED: protein SEC13 homolog                   137   1e-35   Saccoglossus kowalevskii
gb|KFO59722.1|  Protein SEC13                                           139   1e-35   Corvus brachyrhynchos
ref|XP_005145852.1|  PREDICTED: protein SEC13 homolog                   139   1e-35   Melopsittacus undulatus
ref|XP_009704500.1|  PREDICTED: protein SEC13 homolog                   139   1e-35   Cariama cristata
ref|XP_010172929.1|  PREDICTED: protein SEC13 homolog                   139   1e-35   Antrostomus carolinensis
ref|XP_005509092.1|  PREDICTED: protein SEC13 homolog                   139   1e-35   
ref|XP_010159209.1|  PREDICTED: protein SEC13 homolog                   139   1e-35   Eurypyga helias
ref|XP_009816902.1|  PREDICTED: LOW QUALITY PROTEIN: protein SEC1...    139   1e-35   Gavia stellata
ref|XP_010281426.1|  PREDICTED: protein SEC13 homolog                   139   1e-35   Phaethon lepturus
ref|XP_009946398.1|  PREDICTED: protein SEC13 homolog                   138   1e-35   Leptosomus discolor
ref|XP_009282024.1|  PREDICTED: protein SEC13 homolog                   139   1e-35   Aptenodytes forsteri
ref|XP_007451615.1|  PREDICTED: protein SEC13 homolog                   134   1e-35   Lipotes vexillifer [baiji]
ref|XP_009938282.1|  PREDICTED: protein SEC13 homolog                   139   1e-35   Opisthocomus hoazin [hoatzin]
ref|XP_009874190.1|  PREDICTED: protein SEC13 homolog                   139   1e-35   Apaloderma vittatum
emb|CDQ92083.1|  unnamed protein product                                139   1e-35   Oncorhynchus mykiss
ref|XP_008632704.1|  PREDICTED: protein SEC13 homolog                   139   2e-35   
gb|KFV70045.1|  Protein SEC13                                           137   2e-35   Picoides pubescens
ref|XP_005522008.1|  PREDICTED: protein SEC13 homolog                   138   2e-35   Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_009881170.1|  PREDICTED: protein SEC13 homolog                   138   2e-35   Charadrius vociferus
ref|XP_009318389.1|  PREDICTED: protein SEC13 homolog                   138   2e-35   Pygoscelis adeliae
gb|KFP30820.1|  Protein SEC13                                           138   2e-35   Colius striatus
ref|XP_006132885.1|  PREDICTED: protein SEC13 homolog                   139   2e-35   Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_005012129.1|  PREDICTED: protein SEC13 homolog                   138   2e-35   
ref|XP_009577357.1|  PREDICTED: protein SEC13 homolog                   138   2e-35   Fulmarus glacialis
ref|XP_005288532.1|  PREDICTED: protein SEC13 homolog                   138   2e-35   Chrysemys picta bellii
ref|NP_001264770.1|  protein SEC13 homolog                              138   2e-35   Gallus gallus [bantam]
ref|XP_009097616.1|  PREDICTED: LOW QUALITY PROTEIN: protein SEC1...    138   2e-35   
ref|XP_010300088.1|  PREDICTED: LOW QUALITY PROTEIN: protein SEC1...    139   2e-35   Balearica regulorum gibbericeps
ref|XP_007060002.1|  PREDICTED: protein SEC13 homolog                   138   2e-35   Chelonia mydas [green seaturtle]
ref|XP_005053372.1|  PREDICTED: protein SEC13 homolog                   138   2e-35   Ficedula albicollis
ref|XP_005797173.1|  PREDICTED: protein SEC13 homolog                   138   2e-35   Xiphophorus maculatus
ref|XP_009963519.1|  PREDICTED: LOW QUALITY PROTEIN: protein SEC1...    138   2e-35   Tyto alba [Schleiereule]
emb|CAF89860.1|  unnamed protein product                                138   2e-35   Tetraodon nigroviridis
ref|XP_005426717.1|  PREDICTED: LOW QUALITY PROTEIN: protein SEC1...    139   2e-35   
ref|XP_004084891.1|  PREDICTED: protein SEC13 homolog                   138   2e-35   Oryzias latipes [Japanese rice fish]
ref|XP_009468260.1|  PREDICTED: LOW QUALITY PROTEIN: protein SEC1...    139   2e-35   Nipponia nippon
ref|XP_002187493.1|  PREDICTED: protein SEC13 homolog                   138   2e-35   
ref|XP_005490235.1|  PREDICTED: protein SEC13 homolog                   138   2e-35   
ref|XP_003976966.1|  PREDICTED: protein SEC13 homolog                   138   3e-35   
gb|EKC37734.1|  SEC13-like protein                                      143   3e-35   Crassostrea gigas
ref|NP_001187522.1|  protein SEC13 homolog                              137   3e-35   Ictalurus punctatus
ref|XP_006024214.1|  PREDICTED: protein SEC13 homolog                   137   3e-35   
ref|XP_007888672.1|  PREDICTED: protein SEC13 homolog                   137   3e-35   Callorhinchus milii [Australian ghost shark]
ref|XP_006274225.1|  PREDICTED: protein SEC13 homolog                   137   3e-35   
ref|XP_009902360.1|  PREDICTED: protein SEC13 homolog                   137   4e-35   Picoides pubescens
ref|XP_007251556.1|  PREDICTED: protein SEC13 homolog                   137   4e-35   
ref|XP_010862020.1|  PREDICTED: protein SEC13 homolog                   137   4e-35   
ref|XP_003224930.2|  PREDICTED: protein SEC13 homolog                   138   4e-35   
ref|XP_002949031.1|  hypothetical protein VOLCADRAFT_80440              137   4e-35   
ref|XP_001509095.2|  PREDICTED: protein SEC13 homolog                   137   4e-35   
gb|KFW82958.1|  Protein SEC13                                           137   5e-35   
ref|XP_008924583.1|  PREDICTED: protein SEC13 homolog                   137   5e-35   
ref|XP_006739072.1|  PREDICTED: protein SEC13 homolog                   133   7e-35   
gb|KFV84534.1|  Protein SEC13                                           137   7e-35   
ref|XP_011448139.1|  PREDICTED: protein SEC13 homolog                   136   8e-35   
ref|XP_003762460.1|  PREDICTED: protein SEC13 homolog                   136   8e-35   
ref|XP_001375694.2|  PREDICTED: protein SEC13 homolog                   136   9e-35   
ref|XP_009679424.1|  PREDICTED: LOW QUALITY PROTEIN: protein SEC1...    136   1e-34   
ref|XP_003785487.1|  PREDICTED: protein SEC13 homolog isoform 1         136   1e-34   
ref|XP_003785488.1|  PREDICTED: protein SEC13 homolog isoform 2         136   1e-34   
gb|ADO28267.1|  sec13-like                                              136   1e-34   
ref|XP_005846000.1|  hypothetical protein CHLNCDRAFT_31922              135   1e-34   
ref|XP_005600431.1|  PREDICTED: protein SEC13 homolog isoform X2        135   1e-34   
ref|XP_003464126.1|  PREDICTED: protein SEC13 homolog                   135   2e-34   
ref|XP_004443648.1|  PREDICTED: protein SEC13 homolog isoform 1         135   2e-34   
gb|ETE71337.1|  Protein SEC13-like protein                              135   2e-34   
ref|XP_008587479.1|  PREDICTED: protein SEC13 homolog                   135   2e-34   
ref|XP_004581358.1|  PREDICTED: protein SEC13 homolog                   135   2e-34   
ref|XP_005333860.1|  PREDICTED: protein SEC13 homolog                   135   2e-34   
ref|XP_007423317.1|  PREDICTED: protein SEC13 homolog                   135   2e-34   
ref|XP_005632224.1|  PREDICTED: protein SEC13 homolog isoform X2        135   2e-34   
ref|XP_008980398.1|  PREDICTED: protein SEC13 homolog                   135   2e-34   
ref|XP_004392738.1|  PREDICTED: protein SEC13 homolog isoform 2         135   2e-34   
ref|XP_004392737.1|  PREDICTED: protein SEC13 homolog isoform 1         135   2e-34   
ref|XP_850437.1|  PREDICTED: protein SEC13 homolog isoformX1            135   2e-34   
ref|XP_004274880.1|  PREDICTED: protein SEC13 homolog isoform 3         135   2e-34   
ref|XP_005696117.1|  PREDICTED: protein SEC13 homolog                   135   2e-34   
ref|XP_005956736.1|  PREDICTED: protein SEC13 homolog                   135   2e-34   
ref|NP_001080442.1|  SEC13 homolog                                      135   2e-34   
ref|XP_010951346.1|  PREDICTED: protein SEC13 homolog                   135   2e-34   
ref|XP_004274879.1|  PREDICTED: protein SEC13 homolog isoform 2         135   2e-34   
ref|XP_004018574.1|  PREDICTED: protein SEC13 homolog                   135   2e-34   
gb|KFP06692.1|  Protein SEC13                                           135   2e-34   
ref|XP_010617575.1|  PREDICTED: protein SEC13 homolog                   135   2e-34   
ref|XP_006077544.1|  PREDICTED: protein SEC13 homolog                   135   2e-34   
ref|XP_004274878.1|  PREDICTED: protein SEC13 homolog isoform 1         135   3e-34   
ref|XP_008499612.1|  PREDICTED: protein SEC13 homolog                   135   3e-34   
ref|XP_005650517.1|  WD40 repeat-like protein                           134   3e-34   
ref|XP_003927110.1|  PREDICTED: protein SEC13 homolog                   135   3e-34   
ref|NP_988967.1|  SEC13 homolog                                         135   3e-34   
gb|EDK99502.1|  SEC13-like 1 (S. cerevisiae), isoform CRA_b             135   3e-34   
dbj|BAB26480.1|  unnamed protein product                                135   3e-34   
ref|NP_077168.2|  protein SEC13 homolog                                 135   3e-34   
ref|XP_005066189.1|  PREDICTED: protein SEC13 homolog isoform X2        135   3e-34   
gb|ELR56129.1|  Protein SEC13-like protein                              135   3e-34   
ref|XP_005547864.1|  PREDICTED: protein SEC13 homolog isoform X4        134   3e-34   
gb|AAH73381.1|  Unknown (protein for MGC:80813)                         135   4e-34   
ref|NP_001006979.1|  protein SEC13 homolog                              135   4e-34   
ref|XP_005365083.1|  PREDICTED: protein SEC13 homolog                   135   4e-34   
ref|XP_010983235.1|  PREDICTED: protein SEC13 homolog                   135   4e-34   
ref|XP_006994752.1|  PREDICTED: protein SEC13 homolog                   135   4e-34   
ref|XP_005896173.1|  PREDICTED: protein SEC13 homolog                   135   4e-34   
ref|XP_005066188.1|  PREDICTED: protein SEC13 homolog isoform X1        135   4e-34   
ref|XP_004651480.1|  PREDICTED: protein SEC13 homolog                   135   4e-34   
ref|XP_007983413.1|  PREDICTED: protein SEC13 homolog isoform X4        134   4e-34   
gb|AAH02128.1|  Sec13 protein                                           135   4e-34   
ref|XP_007983412.1|  PREDICTED: protein SEC13 homolog isoform X3        134   4e-34   
ref|XP_006173389.1|  PREDICTED: protein SEC13 homolog                   135   4e-34   
ref|NP_001253899.1|  protein SEC13 homolog                              134   4e-34   
ref|XP_005413135.1|  PREDICTED: protein SEC13 homolog                   134   4e-34   
ref|XP_007983411.1|  PREDICTED: protein SEC13 homolog isoform X2        134   5e-34   
ref|NP_001069033.1|  protein SEC13 homolog                              134   6e-34   
ref|XP_004368382.1|  PREDICTED: protein SEC13 homolog isoform 1         134   6e-34   
ref|XP_007983410.1|  PREDICTED: protein SEC13 homolog isoform X1        135   6e-34   
ref|XP_004901951.1|  PREDICTED: protein SEC13 homolog                   134   7e-34   
ref|XP_004368383.1|  PREDICTED: protein SEC13 homolog isoform 2         134   7e-34   
ref|XP_003894158.1|  PREDICTED: protein SEC13 homolog isoform X1        135   7e-34   
gb|EMS55260.1|  Protein SEC13-like protein                              134   8e-34   
gb|AFQ91077.1|  SEC13-like protein                                      132   8e-34   
ref|XP_004692285.1|  PREDICTED: protein SEC13 homolog                   135   9e-34   
gb|AFQ91079.1|  SEC13-like protein                                      132   9e-34   
ref|XP_011230339.1|  PREDICTED: protein SEC13 homolog isoform X2        133   1e-33   
ref|XP_006917678.1|  PREDICTED: protein SEC13 homolog                   134   1e-33   
ref|XP_002925064.1|  PREDICTED: protein SEC13 homolog isoform X1        134   1e-33   
ref|XP_010588271.1|  PREDICTED: protein SEC13 homolog                   133   1e-33   
ref|XP_011368966.1|  PREDICTED: protein SEC13 homolog                   133   1e-33   
ref|XP_008853100.1|  PREDICTED: protein SEC13 homolog isoform X2        133   1e-33   
gb|ELU04892.1|  hypothetical protein CAPTEDRAFT_149284                  133   1e-33   
ref|XP_007075532.1|  PREDICTED: protein SEC13 homolog isoform X2        133   1e-33   
ref|XP_007075531.1|  PREDICTED: protein SEC13 homolog isoform X1        133   1e-33   
ref|XP_005870132.1|  PREDICTED: protein SEC13 homolog                   133   1e-33   
ref|XP_003982518.1|  PREDICTED: protein SEC13 homolog                   133   1e-33   
ref|XP_006083906.1|  PREDICTED: protein SEC13 homolog                   133   1e-33   
ref|XP_004616069.1|  PREDICTED: protein SEC13 homolog                   133   1e-33   
gb|AAH06167.1|  SEC13 protein                                           132   2e-33   
gb|EMT21065.1|  hypothetical protein F775_28222                         134   2e-33   
ref|XP_008853099.1|  PREDICTED: protein SEC13 homolog isoform X1        133   2e-33   
gb|ELK07876.1|  Protein SEC13 like protein                              134   2e-33   
ref|XP_008057837.1|  PREDICTED: protein SEC13 homolog                   132   2e-33   
ref|XP_004452753.1|  PREDICTED: protein SEC13 homolog                   132   2e-33   
gb|EPQ10095.1|  Protein SEC13 like protein                              133   2e-33   
pdb|3BG0|A  Chain A, Architecture Of A Coat For The Nuclear Pore ...    132   2e-33   
ref|XP_009044725.1|  hypothetical protein LOTGIDRAFT_207505             132   2e-33   
ref|XP_009236979.1|  PREDICTED: protein SEC13 homolog isoform X4        132   2e-33   
ref|XP_002813485.1|  PREDICTED: protein SEC13 homolog isoform X3        132   2e-33   
ref|XP_004033648.1|  PREDICTED: protein SEC13 homolog isoform 4         132   2e-33   
ref|XP_002813484.1|  PREDICTED: protein SEC13 homolog isoform X2        132   3e-33   
ref|XP_001631519.1|  predicted protein                                  132   3e-33   
ref|XP_003826328.1|  PREDICTED: protein SEC13 homolog isoform X2        132   3e-33   
ref|NP_001267197.1|  protein SEC13 homolog                              132   3e-33   
ref|NP_001129704.1|  protein SEC13 homolog isoform 2                    132   3e-33   
ref|NP_899195.1|  protein SEC13 homolog isoform 1                       132   3e-33   
ref|NP_109598.2|  protein SEC13 homolog isoform 4                       132   3e-33   
ref|XP_010197940.1|  PREDICTED: protein SEC13 homolog                   132   3e-33   
ref|XP_003826330.1|  PREDICTED: protein SEC13 homolog isoform X1        133   4e-33   
ref|XP_009236976.1|  PREDICTED: protein SEC13 homolog isoform X1        133   4e-33   
ref|XP_004033647.1|  PREDICTED: protein SEC13 homolog isoform 3         133   4e-33   
ref|XP_003265017.1|  PREDICTED: protein SEC13 homolog                   133   4e-33   
ref|XP_007145725.1|  hypothetical protein PHAVU_007G2627000g            125   4e-33   
ref|XP_008150256.1|  PREDICTED: protein SEC13 homolog                   132   4e-33   
ref|NP_001129498.1|  protein SEC13 homolog isoform 3                    133   4e-33   
ref|XP_005265435.1|  PREDICTED: protein SEC13 homolog isoform X2        132   4e-33   
gb|AFQ91080.1|  SEC13-like protein                                      130   4e-33   
gb|AFQ91076.1|  SEC13-like protein                                      130   5e-33   
gb|AFQ91078.1|  SEC13-like protein                                      130   5e-33   
gb|AEK51848.1|  SEC13-like protein                                      129   5e-33   
ref|XP_006900603.1|  PREDICTED: protein SEC13 homolog                   131   6e-33   
ref|XP_007944008.1|  PREDICTED: protein SEC13 homolog                   131   6e-33   
gb|ERE66932.1|  plasma membrane calcium-transporting ATPase 2 iso...    137   6e-33   
gb|AEK51849.1|  SEC13-like protein                                      129   7e-33   
gb|ERE66934.1|  plasma membrane calcium-transporting ATPase 2 iso...    137   8e-33   
ref|XP_008248147.1|  PREDICTED: protein SEC13 homolog                   131   8e-33   
ref|XP_007517208.1|  PREDICTED: protein SEC13 homolog                   132   8e-33   
ref|XP_001700438.1|  COP-II coat subunit                                130   8e-33   
ref|XP_006152053.1|  PREDICTED: protein SEC13 homolog                   131   9e-33   
emb|CEF99747.1|  WD40 repeat                                            131   9e-33   
dbj|BAD96739.1|  SEC13-like 1 isoform b variant                         130   1e-32   
ref|XP_001420555.1|  predicted protein                                  130   1e-32   
ref|XP_003082148.1|  Sec13l1 protein (ISS)                              131   2e-32   
ref|XP_002127937.1|  PREDICTED: protein SEC13 homolog                   130   2e-32   
ref|XP_008899468.1|  protein transporter SEC13                          128   2e-32   
ref|XP_005106911.1|  PREDICTED: protein SEC13 homolog                   129   4e-32   
gb|ETI55052.1|  hypothetical protein F443_02234                         128   7e-32   
gb|AFQ91075.1|  SEC13-like protein                                      126   8e-32   
ref|XP_002599724.1|  hypothetical protein BRAFLDRAFT_287194             128   9e-32   
ref|XP_001953926.1|  GF16993                                            129   1e-31   
ref|XP_004702300.1|  PREDICTED: protein SEC13 homolog isoform X2        128   1e-31   
ref|XP_004702299.1|  PREDICTED: protein SEC13 homolog isoform X1        128   1e-31   
ref|XP_001982150.1|  GG11201                                            128   1e-31   
ref|XP_002098417.1|  GE10367                                            128   2e-31   
ref|XP_008899868.1|  hypothetical protein PPTG_22013                    129   2e-31   
ref|XP_002900105.1|  protein transport protein SEC13                    127   2e-31   
ref|XP_006902250.1|  PREDICTED: protein SEC13 homolog                   127   2e-31   
ref|XP_003061851.1|  predicted protein                                  127   3e-31   
ref|XP_004345908.1|  SEC13, putative                                    127   3e-31   
ref|XP_002111934.1|  hypothetical protein TRIADDRAFT_24138              127   3e-31   
ref|XP_788763.1|  PREDICTED: protein SEC13 homolog                      127   3e-31   
ref|XP_785328.3|  PREDICTED: protein SEC13 homolog                      127   3e-31   
ref|XP_002032337.1|  GM26501                                            127   4e-31   
ref|NP_651977.1|  Sec13 ortholog, isoform A                             127   4e-31   
ref|XP_001357877.2|  GA19854                                            127   5e-31   
ref|XP_002020068.1|  GL13786                                            127   5e-31   
gb|AAD46849.2|AF160909_1  LD03471p                                      127   5e-31   
ref|XP_001990865.1|  GH19595                                            126   6e-31   
ref|XP_003287675.1|  hypothetical protein DICPUDRAFT_151816             125   7e-31   
ref|XP_004358973.1|  WD40 repeat-containing protein                     125   9e-31   
ref|XP_002052974.1|  GJ23624                                            125   1e-30   
dbj|GAM20430.1|  hypothetical protein SAMD00019534_036050               125   1e-30   
ref|XP_002072125.1|  GK22486                                            125   2e-30   
ref|XP_001998472.1|  moj137                                             125   3e-30   
ref|XP_006680582.1|  hypothetical protein BATDEDRAFT_90115              122   9e-30   
gb|KDO31944.1|  hypothetical protein SPRG_03160                         122   1e-29   
ref|XP_629794.1|  WD40 repeat-containing protein                        122   1e-29   
ref|XP_002509166.1|  predicted protein                                  122   1e-29   
ref|XP_001662344.1|  AAEL012240-PA                                      122   2e-29   
ref|XP_001742270.1|  hypothetical protein                               121   2e-29   
gb|EFA85457.1|  WD40 repeat-containing protein                          121   3e-29   
ref|XP_008863897.1|  hypothetical protein H310_02232                    121   4e-29   
ref|XP_312881.4|  AGAP003183-PA                                         121   4e-29   
ref|XP_002429091.1|  protein transport protein sec13, putative          121   6e-29   
emb|CEP11970.1|  hypothetical protein                                   120   7e-29   
ref|XP_006957939.1|  WD40 repeat-like protein                           120   7e-29   
ref|XP_008615576.1|  hypothetical protein SDRG_11321                    120   7e-29   
emb|CCI42360.1|  unnamed protein product                                120   8e-29   
ref|XP_004314700.1|  PREDICTED: protein SEC13 homolog                   117   8e-29   
gb|KFH71651.1|  protein transporter SEC13                               120   9e-29   
dbj|BAN21266.1|  protein transport protein sec13                        119   1e-28   
ref|XP_005706288.1|  transducin family protein / WD-40 repeat fam...    119   2e-28   
ref|XP_009351269.1|  PREDICTED: protein SEC13 homolog                   119   2e-28   
gb|EIE85683.1|  hypothetical protein RO3G_10393                         118   2e-28   
gb|EPB81697.1|  hypothetical protein HMPREF1544_11583                   119   2e-28   
ref|XP_004530380.1|  PREDICTED: protein SEC13 homolog                   115   2e-28   
ref|XP_004625281.1|  PREDICTED: protein SEC13 homolog                   119   3e-28   
ref|XP_969127.1|  PREDICTED: protein SEC13 homolog                      118   3e-28   
ref|XP_005186970.1|  PREDICTED: protein SEC13 homolog                   118   3e-28   
gb|ABQ22887.1|  SEC13-related protein-like protein                      114   3e-28   
emb|CDR46355.1|  CYFA0S23e00144g1_1                                     118   4e-28   
ref|XP_007124682.1|  PREDICTED: protein SEC13 homolog isoform X2        117   7e-28   
ref|XP_007124681.1|  PREDICTED: protein SEC13 homolog isoform X1        117   8e-28   
ref|XP_009824525.1|  hypothetical protein H257_02541                    117   8e-28   
ref|XP_004213038.1|  PREDICTED: protein SEC13 homolog                   114   9e-28   
gb|EFX87077.1|  hypothetical protein DAPPUDRAFT_221812                  117   9e-28   
emb|CCA17819.1|  protein transport protein SEC13 putative               118   9e-28   
gb|EHJ78717.1|  putative protein transport protein sec13                117   9e-28   
dbj|BAM20542.1|  protein transport protein sec13                        114   1e-27   
gb|ETN66954.1|  transport protein SEC13                                 117   1e-27   
emb|CEI91318.1|  Putative Protein transporter SEC13                     117   1e-27   
emb|CEG77402.1|  Putative WD40 repeat-like protein                      117   1e-27   
ref|XP_004738581.1|  PREDICTED: protein SEC13 homolog isoform X1        117   1e-27   
dbj|GAN06362.1|  WD40 repeat-like protein                               117   1e-27   
ref|XP_010375603.1|  PREDICTED: protein SEC13 homolog                   117   1e-27   
ref|NP_001134240.1|  protein SEC13 homolog                              116   2e-27   
gb|EQB76972.1|  protein SEC13-like protein                              117   2e-27   
emb|CEG72260.1|  Putative WD40 repeat-like protein                      116   2e-27   
emb|CEG81796.1|  Putative WD40 repeat-like protein                      116   2e-27   
ref|XP_004923349.1|  PREDICTED: protein SEC13 homolog                   116   2e-27   
ref|XP_002406173.1|  vesicle coat complex COPII, subunit SEC13, p...    116   2e-27   
gb|ACO13052.1|  SEC13 homolog                                           116   2e-27   
gb|KFB48498.1|  AGAP003183-PA-like protein                              116   2e-27   
ref|XP_002680179.1|  sec13 protein                                      116   3e-27   
ref|XP_009023571.1|  hypothetical protein HELRODRAFT_157480             115   6e-27   
ref|XP_006206940.1|  PREDICTED: LOW QUALITY PROTEIN: protein SEC1...    116   6e-27   
ref|XP_009649670.1|  transport protein SEC13                            114   8e-27   
ref|XP_011211710.1|  PREDICTED: protein SEC13 homolog                   114   1e-26   
gb|ACO10389.1|  SEC13 homolog                                           114   1e-26   
ref|XP_004365458.2|  protein transporter SEC13                          114   1e-26   
gb|EPZ32794.1|  hypothetical protein O9G_000869                         114   1e-26   



>dbj|BAO49718.1| nuclear pore complex protein Sec13d [Nicotiana benthamiana]
Length=302

 Score =   247 bits (631),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 120/134 (90%), Positives = 124/134 (93%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            SMAPGAL GSG+ +PVQKLAS GCDNTVKVWKLYNG+WKMDCFPALQMHT WVRDVAWAP
Sbjct  161  SMAPGALVGSGVLEPVQKLASGGCDNTVKVWKLYNGIWKMDCFPALQMHTNWVRDVAWAP  220

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIASASEDG VVIWTVAKEGDQWEGKVL DF TPVWRVSWSLTGN LAV +GD
Sbjct  221  NLGLPKSTIASASEDGTVVIWTVAKEGDQWEGKVLKDFKTPVWRVSWSLTGNLLAVAAGD  280

Query  283  NNVTLWNEAVDGEW  242
            NNVTLW EAVDGEW
Sbjct  281  NNVTLWKEAVDGEW  294



>ref|XP_009623350.1| PREDICTED: protein SEC13 homolog [Nicotiana tomentosiformis]
Length=302

 Score =   247 bits (630),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 121/134 (90%), Positives = 124/134 (93%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            SMAPGAL GSG+ +PVQKLAS GCDNTVKVWKLYNGVWKMDCFPALQMHT WVRDVAWAP
Sbjct  161  SMAPGALVGSGVLEPVQKLASGGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAP  220

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIASASEDG VVIWTVAKEGDQWEGKVL DF TPVWRVSWSLTGN LAV +GD
Sbjct  221  NLGLPKSTIASASEDGTVVIWTVAKEGDQWEGKVLKDFKTPVWRVSWSLTGNLLAVAAGD  280

Query  283  NNVTLWNEAVDGEW  242
            NNVTLW EAVDGEW
Sbjct  281  NNVTLWKEAVDGEW  294



>ref|XP_007024275.1| Transducin family protein / WD-40 repeat family protein [Theobroma 
cacao]
 gb|EOY26897.1| Transducin family protein / WD-40 repeat family protein [Theobroma 
cacao]
Length=312

 Score =   247 bits (631),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 119/134 (89%), Positives = 124/134 (93%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            S APGAL GSGL DPVQKL S GCDNTVKVWKLYNG+WKMDCFPALQMHT WVRDVAWAP
Sbjct  160  STAPGALVGSGLLDPVQKLCSGGCDNTVKVWKLYNGIWKMDCFPALQMHTDWVRDVAWAP  219

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIASAS+DGKV+IWTVAKEGDQWEGKVL+DFNTPVWRVSWSLTGN LAV  G+
Sbjct  220  NLGLPKSTIASASQDGKVIIWTVAKEGDQWEGKVLHDFNTPVWRVSWSLTGNILAVADGN  279

Query  283  NNVTLWNEAVDGEW  242
            NNVTLW EAVDGEW
Sbjct  280  NNVTLWKEAVDGEW  293


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 42/124 (34%), Positives = 61/124 (49%), Gaps = 14/124 (11%)
 Frame = -1

Query  595  QKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWA-PNLGLPKSTIASASED  419
            +++AS   D T+K+  + N   +      L  H   V  VAWA P  G   S +AS S D
Sbjct  24   KRIASASSDTTIKIAGVSNNTHQH--LATLSAHQGPVWQVAWAHPKFG---SLLASCSYD  78

Query  418  GKVVIWTVAKEGDQWE---GKVLYDFNTPVWRVSWS--LTGNXLAVXSGDNNVTLWNEAV  254
            G+V+IW   KEG+Q E     V  D  + V  ++W+    G  LA  S D N++++    
Sbjct  79   GRVIIW---KEGNQNEWSQAHVFEDHKSSVNSIAWAPHELGLCLACGSSDGNISVFTARA  135

Query  253  DGEW  242
            DG W
Sbjct  136  DGGW  139



>ref|XP_009764554.1| PREDICTED: protein SEC13 homolog [Nicotiana sylvestris]
Length=302

 Score =   246 bits (627),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 120/134 (90%), Positives = 124/134 (93%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            SMAPGAL GSG+ +PVQKLAS GCDNTVKVWKLYNGVWKMDCFPALQMHT WVRDVAWAP
Sbjct  161  SMAPGALVGSGVLEPVQKLASGGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAP  220

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIASASEDG VVIWTVAKEGDQWEGKVL DF TPVWRVSWSLTGN LAV +GD
Sbjct  221  NLGLPKSTIASASEDGTVVIWTVAKEGDQWEGKVLKDFKTPVWRVSWSLTGNLLAVAAGD  280

Query  283  NNVTLWNEAVDGEW  242
            N+VTLW EAVDGEW
Sbjct  281  NDVTLWKEAVDGEW  294



>dbj|BAO49715.1| nuclear pore complex protein Sec13a [Nicotiana benthamiana]
Length=302

 Score =   244 bits (624),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 119/134 (89%), Positives = 122/134 (91%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            SMAPGAL GSG  +PVQKLAS GCDNTVKVWKLYNG+WKMDCFPALQMHT WVRDVAWAP
Sbjct  161  SMAPGALVGSGALEPVQKLASGGCDNTVKVWKLYNGIWKMDCFPALQMHTNWVRDVAWAP  220

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIASASEDG VVIWTVAKEGDQWEG VL DF TPVWRVSWSLTGN LAV +GD
Sbjct  221  NLGLPKSTIASASEDGTVVIWTVAKEGDQWEGNVLKDFKTPVWRVSWSLTGNLLAVAAGD  280

Query  283  NNVTLWNEAVDGEW  242
            NNVTLW EAVDGEW
Sbjct  281  NNVTLWKEAVDGEW  294



>gb|KHG11308.1| Protein SEC13 [Gossypium arboreum]
Length=314

 Score =   244 bits (624),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 118/134 (88%), Positives = 123/134 (92%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            S APGAL GSGL DPVQKL S GCDNTVKVWKLYNG+WKMDCFPALQMHT WVRDVAWAP
Sbjct  173  STAPGALVGSGLLDPVQKLCSGGCDNTVKVWKLYNGIWKMDCFPALQMHTDWVRDVAWAP  232

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIASAS+DGKV+IWTVAKEGDQWEGKVL+DF TPVWRVSWSLTGN LAV  G+
Sbjct  233  NLGLPKSTIASASQDGKVIIWTVAKEGDQWEGKVLHDFGTPVWRVSWSLTGNILAVADGN  292

Query  283  NNVTLWNEAVDGEW  242
            NNVTLW EAVDGEW
Sbjct  293  NNVTLWKEAVDGEW  306



>gb|KJB45573.1| hypothetical protein B456_007G314500 [Gossypium raimondii]
 gb|KJB45574.1| hypothetical protein B456_007G314500 [Gossypium raimondii]
Length=301

 Score =   244 bits (623),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 118/134 (88%), Positives = 123/134 (92%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            S APGAL GSGL DPVQKL S GCDNTVKVWKLYNG+WKMDCFPALQMHT WVRDVAWAP
Sbjct  160  STAPGALVGSGLLDPVQKLCSGGCDNTVKVWKLYNGIWKMDCFPALQMHTDWVRDVAWAP  219

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIASAS+DGKV+IWTVAKEGDQWEGKVL+DF TPVWRVSWSLTGN LAV  G+
Sbjct  220  NLGLPKSTIASASQDGKVIIWTVAKEGDQWEGKVLHDFGTPVWRVSWSLTGNILAVADGN  279

Query  283  NNVTLWNEAVDGEW  242
            NNVTLW EAVDGEW
Sbjct  280  NNVTLWKEAVDGEW  293



>ref|XP_004232260.1| PREDICTED: protein transport protein SEC13 homolog B [Solanum 
lycopersicum]
Length=302

 Score =   243 bits (621),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 118/134 (88%), Positives = 123/134 (92%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            SMAPGAL G+G+ +PVQKLAS GCDNTVKVWKLYNGVWKMDCFPALQMHT WVRDVAWAP
Sbjct  161  SMAPGALVGAGVLEPVQKLASGGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAP  220

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIASASEDG VVIWTV KEGDQWEGKVL DF +PVWRVSWSLTGN LAV +GD
Sbjct  221  NLGLPKSTIASASEDGTVVIWTVGKEGDQWEGKVLKDFKSPVWRVSWSLTGNLLAVAAGD  280

Query  283  NNVTLWNEAVDGEW  242
            NNVTLW EAVDGEW
Sbjct  281  NNVTLWKEAVDGEW  294



>dbj|BAO49717.1| nuclear pore complex protein Sec13c [Nicotiana benthamiana]
Length=302

 Score =   243 bits (620),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 119/134 (89%), Positives = 123/134 (92%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            SMAPGAL GSG+ +PVQKLAS GCDNTVKVWKLYNGVWKMDCFPALQ HT WVRDVAWAP
Sbjct  161  SMAPGALVGSGVLEPVQKLASGGCDNTVKVWKLYNGVWKMDCFPALQKHTNWVRDVAWAP  220

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIASASEDG VVIWTVAKEGDQWEGKVL DF TPVWRVSWSLTGN LAV +GD
Sbjct  221  NLGLPKSTIASASEDGTVVIWTVAKEGDQWEGKVLKDFKTPVWRVSWSLTGNLLAVAAGD  280

Query  283  NNVTLWNEAVDGEW  242
            N+VTLW EAVDGEW
Sbjct  281  NDVTLWKEAVDGEW  294



>ref|XP_010033246.1| PREDICTED: protein SEC13 homolog [Eucalyptus grandis]
 ref|XP_010033247.1| PREDICTED: protein SEC13 homolog [Eucalyptus grandis]
 ref|XP_010033248.1| PREDICTED: protein SEC13 homolog [Eucalyptus grandis]
 gb|KCW52833.1| hypothetical protein EUGRSUZ_J02164 [Eucalyptus grandis]
 gb|KCW52834.1| hypothetical protein EUGRSUZ_J02164 [Eucalyptus grandis]
Length=302

 Score =   243 bits (619),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 118/134 (88%), Positives = 123/134 (92%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            SMAPGAL GSGL DPVQKLAS GCDNTVKVWKLYNG WKMDCFPALQMH+ WVRDVAWAP
Sbjct  161  SMAPGALVGSGLLDPVQKLASGGCDNTVKVWKLYNGTWKMDCFPALQMHSDWVRDVAWAP  220

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIASAS+DG VVIWTVAKEG+QW+GKVL DF TPVWRVSWSLTGN LAV  G+
Sbjct  221  NLGLPKSTIASASQDGTVVIWTVAKEGEQWQGKVLKDFKTPVWRVSWSLTGNLLAVADGN  280

Query  283  NNVTLWNEAVDGEW  242
            NNVTLWNEAVDGEW
Sbjct  281  NNVTLWNEAVDGEW  294



>gb|ACU20139.1| unknown [Glycine max]
Length=301

 Score =   242 bits (618),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 118/134 (88%), Positives = 123/134 (92%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            SMAPGAL G+GL DPVQKL S GCDNTVKVWKL NG+WKMDCFPALQMHT WVRDVAWAP
Sbjct  160  SMAPGALVGAGLLDPVQKLCSGGCDNTVKVWKLNNGLWKMDCFPALQMHTDWVRDVAWAP  219

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIASAS+DGKV+IWTVAKEGDQWEGKVL DFNTPVWRVSWSLTGN LAV  G+
Sbjct  220  NLGLPKSTIASASQDGKVIIWTVAKEGDQWEGKVLNDFNTPVWRVSWSLTGNILAVADGN  279

Query  283  NNVTLWNEAVDGEW  242
            NNVTLW EAVDGEW
Sbjct  280  NNVTLWKEAVDGEW  293



>ref|XP_006586096.1| PREDICTED: protein SEC13 homolog isoform X1 [Glycine max]
 ref|XP_006586097.1| PREDICTED: protein SEC13 homolog isoform X2 [Glycine max]
Length=301

 Score =   242 bits (618),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 118/134 (88%), Positives = 123/134 (92%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            SMAPGAL G+GL DPVQKL S GCDNTVKVWKL NG+WKMDCFPALQMHT WVRDVAWAP
Sbjct  160  SMAPGALVGAGLLDPVQKLCSGGCDNTVKVWKLNNGLWKMDCFPALQMHTDWVRDVAWAP  219

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIASAS+DGKV+IWTVAKEGDQWEGKVL DFNTPVWRVSWSLTGN LAV  G+
Sbjct  220  NLGLPKSTIASASQDGKVIIWTVAKEGDQWEGKVLNDFNTPVWRVSWSLTGNILAVADGN  279

Query  283  NNVTLWNEAVDGEW  242
            NNVTLW EAVDGEW
Sbjct  280  NNVTLWKEAVDGEW  293



>ref|XP_006426897.1| hypothetical protein CICLE_v10026168mg [Citrus clementina]
 gb|ESR40137.1| hypothetical protein CICLE_v10026168mg [Citrus clementina]
Length=301

 Score =   242 bits (617),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 116/134 (87%), Positives = 122/134 (91%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            S APGAL GSG  DPVQKL S GCDNTVKVWKLYNG+WKMDCFPALQMHT WVRDVAWAP
Sbjct  160  STAPGALVGSGFLDPVQKLCSGGCDNTVKVWKLYNGIWKMDCFPALQMHTDWVRDVAWAP  219

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIASASEDGKV+IWTVA+EGDQWEGKVL+DF TPV+RVSWSLTGN LAV  G+
Sbjct  220  NLGLPKSTIASASEDGKVIIWTVAREGDQWEGKVLHDFKTPVYRVSWSLTGNILAVADGN  279

Query  283  NNVTLWNEAVDGEW  242
            NNVTLW EAVDGEW
Sbjct  280  NNVTLWEEAVDGEW  293



>ref|XP_002281856.1| PREDICTED: protein transport protein SEC13 homolog B [Vitis vinifera]
 emb|CAN73348.1| hypothetical protein VITISV_040760 [Vitis vinifera]
Length=301

 Score =   242 bits (617),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 119/134 (89%), Positives = 121/134 (90%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            SMAPGAL GSGL DPVQKL S GCDNTVKVWKLYNG WKMDCFPALQMHT WVRDVAWAP
Sbjct  160  SMAPGALVGSGLLDPVQKLVSGGCDNTVKVWKLYNGNWKMDCFPALQMHTDWVRDVAWAP  219

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIASAS+DG VVIWTVAKEGDQWEGKVL DF TPVWRVSWSLTGN LAV  G+
Sbjct  220  NLGLPKSTIASASQDGTVVIWTVAKEGDQWEGKVLKDFKTPVWRVSWSLTGNLLAVADGN  279

Query  283  NNVTLWNEAVDGEW  242
            NNVTLW EAVDGEW
Sbjct  280  NNVTLWKEAVDGEW  293



>gb|KHM99522.1| Protein SEC13 like [Glycine soja]
Length=301

 Score =   241 bits (615),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/134 (88%), Positives = 122/134 (91%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            SMAPGAL G GL DPVQKL S GCDNTVKVWKL NG+WKMDCFPALQMHT WVRDVAWAP
Sbjct  160  SMAPGALVGGGLLDPVQKLCSGGCDNTVKVWKLNNGLWKMDCFPALQMHTDWVRDVAWAP  219

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIASAS+DGKV+IWTVAKEGDQWEGKVL DFNTPVWRVSWSLTGN LAV  G+
Sbjct  220  NLGLPKSTIASASQDGKVIIWTVAKEGDQWEGKVLNDFNTPVWRVSWSLTGNILAVADGN  279

Query  283  NNVTLWNEAVDGEW  242
            NNVTLW EAVDGEW
Sbjct  280  NNVTLWKEAVDGEW  293



>ref|XP_006586103.1| PREDICTED: protein SEC13 homolog isoform X2 [Glycine max]
Length=376

 Score =   243 bits (621),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/134 (88%), Positives = 123/134 (92%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            SMAPGAL G+GL DPVQKL S GCDNTVKVWKL NG+WKMDCFPALQMHT WVRDVAWAP
Sbjct  235  SMAPGALVGAGLLDPVQKLCSGGCDNTVKVWKLNNGLWKMDCFPALQMHTDWVRDVAWAP  294

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIASAS+DGKV+IWTVAKEGDQWEGKVL DFNTPVWRVSWSLTGN LAV  G+
Sbjct  295  NLGLPKSTIASASQDGKVIIWTVAKEGDQWEGKVLNDFNTPVWRVSWSLTGNILAVADGN  354

Query  283  NNVTLWNEAVDGEW  242
            NNVTLW EAVDGEW
Sbjct  355  NNVTLWKEAVDGEW  368



>ref|XP_003532149.2| PREDICTED: protein SEC13 homolog isoform X1 [Glycine max]
Length=375

 Score =   243 bits (621),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/134 (88%), Positives = 123/134 (92%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            SMAPGAL G+GL DPVQKL S GCDNTVKVWKL NG+WKMDCFPALQMHT WVRDVAWAP
Sbjct  234  SMAPGALVGAGLLDPVQKLCSGGCDNTVKVWKLNNGLWKMDCFPALQMHTDWVRDVAWAP  293

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIASAS+DGKV+IWTVAKEGDQWEGKVL DFNTPVWRVSWSLTGN LAV  G+
Sbjct  294  NLGLPKSTIASASQDGKVIIWTVAKEGDQWEGKVLNDFNTPVWRVSWSLTGNILAVADGN  353

Query  283  NNVTLWNEAVDGEW  242
            NNVTLW EAVDGEW
Sbjct  354  NNVTLWKEAVDGEW  367



>ref|XP_006465678.1| PREDICTED: protein SEC13 homolog [Citrus sinensis]
Length=301

 Score =   241 bits (614),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 115/134 (86%), Positives = 122/134 (91%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            S APGAL GSG  DPVQKL S GCDNTVKVWKLYNG+WKMDCFPALQMHT WVRDVAWAP
Sbjct  160  STAPGALVGSGFLDPVQKLCSGGCDNTVKVWKLYNGIWKMDCFPALQMHTDWVRDVAWAP  219

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIASASEDGKV+IWTVA+EGDQWEGKVL+DF TPV+RVSWSLTGN LAV  G+
Sbjct  220  NLGLPKSTIASASEDGKVIIWTVAREGDQWEGKVLHDFKTPVYRVSWSLTGNILAVADGN  279

Query  283  NNVTLWNEAVDGEW  242
            NNVTLW EAVDG+W
Sbjct  280  NNVTLWEEAVDGQW  293



>ref|XP_003551869.1| PREDICTED: protein SEC13 homolog [Glycine max]
 gb|KHN12525.1| Protein SEC13 like [Glycine soja]
Length=301

 Score =   240 bits (613),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 117/134 (87%), Positives = 122/134 (91%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            SMAPGAL G+GL DPVQKL S GCDNTVKVWKL NG+WKMDCFPALQMHT WVRDVAWAP
Sbjct  160  SMAPGALVGAGLLDPVQKLCSGGCDNTVKVWKLNNGLWKMDCFPALQMHTDWVRDVAWAP  219

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIASAS+DGKV+IWTVAKEGDQWEGKVL DF TPVWRVSWSLTGN LAV  G+
Sbjct  220  NLGLPKSTIASASQDGKVIIWTVAKEGDQWEGKVLNDFKTPVWRVSWSLTGNILAVADGN  279

Query  283  NNVTLWNEAVDGEW  242
            NNVTLW EAVDGEW
Sbjct  280  NNVTLWKEAVDGEW  293



>ref|XP_010099520.1| Protein SEC13-like protein [Morus notabilis]
 gb|EXB79400.1| Protein SEC13-like protein [Morus notabilis]
Length=302

 Score =   240 bits (612),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 116/134 (87%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            SMAPGAL GSGL DP+QKLAS GCDNTVKVWK YNG WKMDCFPALQMH  WVRDVAWAP
Sbjct  161  SMAPGALVGSGLTDPIQKLASGGCDNTVKVWKSYNGTWKMDCFPALQMHADWVRDVAWAP  220

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIASAS+DG VVIWTVAKEGDQWEGKVL DF TPVWRVSWSLTGN LAV  G+
Sbjct  221  NLGLPKSTIASASQDGTVVIWTVAKEGDQWEGKVLKDFKTPVWRVSWSLTGNLLAVADGN  280

Query  283  NNVTLWNEAVDGEW  242
            NNVTLW EA+DGEW
Sbjct  281  NNVTLWKEAIDGEW  294



>ref|XP_002266827.2| PREDICTED: protein transport protein SEC13 homolog B [Vitis vinifera]
 emb|CBI39765.3| unnamed protein product [Vitis vinifera]
Length=305

 Score =   240 bits (612),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 118/134 (88%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            SMAPGAL GSGL DPVQKL S GCDNTVKVWKLYNG WKMDCFPALQMHT WVRDVAWAP
Sbjct  160  SMAPGALVGSGLLDPVQKLVSGGCDNTVKVWKLYNGNWKMDCFPALQMHTDWVRDVAWAP  219

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIASAS+DG VVIWTV KEGDQWEGKVL DF TPVWRVSWSLTGN LAV  G+
Sbjct  220  NLGLPKSTIASASQDGTVVIWTVGKEGDQWEGKVLKDFKTPVWRVSWSLTGNLLAVADGN  279

Query  283  NNVTLWNEAVDGEW  242
            NNVTLW EAVDGEW
Sbjct  280  NNVTLWKEAVDGEW  293


 Score = 49.3 bits (116),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 59/121 (49%), Gaps = 8/121 (7%)
 Frame = -1

Query  595  QKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWA-PNLGLPKSTIASASED  419
            +++A+   D+TVK+  + N   +      L  H   V  VAWA P  G   S +AS S D
Sbjct  24   KRVATASSDSTVKIIGVSNNASQH--LATLTGHQGPVWQVAWAHPKFG---SILASCSCD  78

Query  418  GKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWS--LTGNXLAVXSGDNNVTLWNEAVDGE  245
            G+V+IW    + D  +  V  D  + V  ++W+    G  LA  S D N++++    DG 
Sbjct  79   GRVIIWKEGNQNDWTQAHVFSDRKSSVNSIAWAPHELGLCLACGSSDGNISVFTARSDGA  138

Query  244  W  242
            W
Sbjct  139  W  139



>ref|XP_010929133.1| PREDICTED: protein transport protein SEC13 homolog B-like [Elaeis 
guineensis]
Length=302

 Score =   240 bits (612),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 116/134 (87%), Positives = 121/134 (90%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            +MAPGAL GSG  DPVQKLAS GCDNTVKVWKLYNG WKMDCFPALQMH+ WVRDVAWAP
Sbjct  161  AMAPGALVGSGQLDPVQKLASGGCDNTVKVWKLYNGSWKMDCFPALQMHSDWVRDVAWAP  220

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIASAS+DG VVIWTVAKEGDQW+GKVLYDF  PVWRVSWSLTGN LAV  G+
Sbjct  221  NLGLPKSTIASASQDGTVVIWTVAKEGDQWQGKVLYDFKAPVWRVSWSLTGNILAVADGN  280

Query  283  NNVTLWNEAVDGEW  242
            NNVTLW EAVDGEW
Sbjct  281  NNVTLWKEAVDGEW  294



>ref|XP_007145729.1| hypothetical protein PHAVU_007G263000g [Phaseolus vulgaris]
 gb|ESW17723.1| hypothetical protein PHAVU_007G263000g [Phaseolus vulgaris]
Length=301

 Score =   239 bits (611),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 118/134 (88%), Positives = 121/134 (90%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            SMAPGAL GSGL DPVQKL S GCDNTVKVWKL NG+WKMDCFPAL MHT WVRDVAWAP
Sbjct  160  SMAPGALVGSGLLDPVQKLCSGGCDNTVKVWKLNNGLWKMDCFPALHMHTDWVRDVAWAP  219

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIASAS+DGKVVIWTVAKEGDQWEGKVL DF TPVWRVSWSLTGN LAV  G+
Sbjct  220  NLGLPKSTIASASQDGKVVIWTVAKEGDQWEGKVLNDFKTPVWRVSWSLTGNILAVADGN  279

Query  283  NNVTLWNEAVDGEW  242
            NNVTLW EAVDGEW
Sbjct  280  NNVTLWKEAVDGEW  293



>emb|CAN63472.1| hypothetical protein VITISV_000787 [Vitis vinifera]
Length=313

 Score =   239 bits (611),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 118/134 (88%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            SMAPGAL GSGL DPVQKL S GCDNTVKVWKLYNG WKMDCFPALQMHT WVRDVAWAP
Sbjct  160  SMAPGALVGSGLLDPVQKLVSGGCDNTVKVWKLYNGNWKMDCFPALQMHTDWVRDVAWAP  219

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIASAS+DG VVIWTV KEGDQWEGKVL DF TPVWRVSWSLTGN LAV  G+
Sbjct  220  NLGLPKSTIASASQDGTVVIWTVDKEGDQWEGKVLKDFKTPVWRVSWSLTGNLLAVADGN  279

Query  283  NNVTLWNEAVDGEW  242
            NNVTLW EAVDGEW
Sbjct  280  NNVTLWKEAVDGEW  293



>ref|XP_002515980.1| protein transport protein sec13, putative [Ricinus communis]
 gb|EEF46400.1| protein transport protein sec13, putative [Ricinus communis]
Length=301

 Score =   239 bits (610),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 116/134 (87%), Positives = 121/134 (90%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            S APGAL GSGL DPVQKL S GCDNTVKVWKLYNG WKMDCFPALQ+HT WVRDVAWAP
Sbjct  160  STAPGALVGSGLLDPVQKLCSGGCDNTVKVWKLYNGNWKMDCFPALQLHTDWVRDVAWAP  219

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIASAS+DGKV+IWTVAKEGDQWEGKVL+DF +PVWRVSWSLTGN LAV  G 
Sbjct  220  NLGLPKSTIASASQDGKVIIWTVAKEGDQWEGKVLHDFKSPVWRVSWSLTGNILAVAEGS  279

Query  283  NNVTLWNEAVDGEW  242
            NNVTLW EAVDGEW
Sbjct  280  NNVTLWKEAVDGEW  293



>ref|XP_009335780.1| PREDICTED: protein SEC13 homolog [Pyrus x bretschneideri]
 ref|XP_009335781.1| PREDICTED: protein SEC13 homolog [Pyrus x bretschneideri]
Length=300

 Score =   239 bits (610),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 115/134 (86%), Positives = 122/134 (91%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            +MAPGAL GSGL DPV KLAS GCDNTVKVWKLYNG+WKMDCFPALQMH+ WVRDVAWAP
Sbjct  159  AMAPGALVGSGLLDPVHKLASGGCDNTVKVWKLYNGIWKMDCFPALQMHSDWVRDVAWAP  218

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIASAS+DG VVIWTVAKEG+QWEGKVL DF TPVWRVSWSLTGN LAV  G+
Sbjct  219  NLGLPKSTIASASQDGTVVIWTVAKEGEQWEGKVLKDFKTPVWRVSWSLTGNLLAVADGN  278

Query  283  NNVTLWNEAVDGEW  242
            NNVTLW E+VDGEW
Sbjct  279  NNVTLWKESVDGEW  292


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 60/121 (50%), Gaps = 9/121 (7%)
 Frame = -1

Query  595  QKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWA-PNLGLPKSTIASASED  419
            ++LA+   D T+K+  + N    +     L +H+  V +VAWA P  G   S +AS S D
Sbjct  24   KRLATASSDATIKIIGVGNASQHL---ATLSVHSGPVWEVAWAHPKFG---SILASCSYD  77

Query  418  GKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWS--LTGNXLAVXSGDNNVTLWNEAVDGE  245
            G+V+IW      +  +  V  D  + V  +SW+    G  LA  S D N++++    DG 
Sbjct  78   GQVIIWKEGNPNEWQQAHVFNDHKSSVNSISWAPHELGLILACGSSDGNISVFTARADGG  137

Query  244  W  242
            W
Sbjct  138  W  138



>ref|XP_008379297.1| PREDICTED: protein SEC13 homolog [Malus domestica]
 ref|XP_008379298.1| PREDICTED: protein SEC13 homolog [Malus domestica]
 ref|XP_008348048.1| PREDICTED: protein SEC13 homolog [Malus domestica]
Length=300

 Score =   239 bits (610),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 115/134 (86%), Positives = 121/134 (90%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            +MAPGAL GSGL DPV KLAS GCDNTVKVWKLYNG+WKMDCFPALQMH+ WVRDVAWAP
Sbjct  159  AMAPGALVGSGLLDPVHKLASGGCDNTVKVWKLYNGIWKMDCFPALQMHSDWVRDVAWAP  218

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIASAS+DG VVIW VAKEG+QWEGKVL DF TPVWRVSWSLTGN LAV  GD
Sbjct  219  NLGLPKSTIASASQDGTVVIWIVAKEGEQWEGKVLKDFKTPVWRVSWSLTGNLLAVADGD  278

Query  283  NNVTLWNEAVDGEW  242
            NNVTLW E+VDGEW
Sbjct  279  NNVTLWKESVDGEW  292


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 59/121 (49%), Gaps = 9/121 (7%)
 Frame = -1

Query  595  QKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWA-PNLGLPKSTIASASED  419
            ++LA+   D T+K+  + N    +     L  H+  V +VAWA P  G   S +AS S D
Sbjct  24   KRLATASSDATIKIIGVGNASQHL---ATLSAHSGPVWEVAWAHPKFG---SILASCSYD  77

Query  418  GKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWS--LTGNXLAVXSGDNNVTLWNEAVDGE  245
            G+V+IW      +  +  V  D  + V  +SW+    G  LA  S D N++++    DG 
Sbjct  78   GQVIIWKEGNPNEWQQAHVFNDHKSSVNSISWAPHELGLILACGSSDGNISVFTARADGG  137

Query  244  W  242
            W
Sbjct  138  W  138



>gb|KDP43859.1| hypothetical protein JCGZ_20869 [Jatropha curcas]
Length=301

 Score =   239 bits (609),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/134 (86%), Positives = 119/134 (89%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            S APGAL GSGL DPVQKL S GCDNTVKVWKLYNG+WKMDCFPALQMHT WVRDVAWAP
Sbjct  160  STAPGALVGSGLLDPVQKLCSGGCDNTVKVWKLYNGIWKMDCFPALQMHTDWVRDVAWAP  219

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIASAS+DGKV+IW V KEGDQWEGKVL+DF  PVWRVSWSLTGN LAV  G 
Sbjct  220  NLGLPKSTIASASQDGKVIIWIVGKEGDQWEGKVLHDFKAPVWRVSWSLTGNILAVADGH  279

Query  283  NNVTLWNEAVDGEW  242
            NNVTLW EAVDGEW
Sbjct  280  NNVTLWKEAVDGEW  293



>emb|CDP02169.1| unnamed protein product [Coffea canephora]
Length=302

 Score =   238 bits (608),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 114/134 (85%), Positives = 121/134 (90%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            S APGAL G+ + DPVQKLAS GCDNTVKVWKLYNG+WKMDCFPALQMH  WVRDVAWAP
Sbjct  161  STAPGALVGTSILDPVQKLASGGCDNTVKVWKLYNGIWKMDCFPALQMHADWVRDVAWAP  220

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIASAS+DG VVIWTVAKEGDQWEGKVL DF TPVWRVSWSLTGN LAV +GD
Sbjct  221  NLGLPKSTIASASQDGTVVIWTVAKEGDQWEGKVLRDFKTPVWRVSWSLTGNLLAVAAGD  280

Query  283  NNVTLWNEAVDGEW  242
            NNV++W EAVDGEW
Sbjct  281  NNVSMWKEAVDGEW  294



>ref|XP_010942123.1| PREDICTED: protein transport protein SEC13 homolog B-like [Elaeis 
guineensis]
Length=302

 Score =   238 bits (608),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/134 (86%), Positives = 121/134 (90%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            +MAPGAL GSG  DPVQKLAS GCDNTVKVWKLYNG WK+DCFPALQMHT WVRDVAWAP
Sbjct  161  AMAPGALVGSGQFDPVQKLASGGCDNTVKVWKLYNGSWKLDCFPALQMHTDWVRDVAWAP  220

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPK+TIASAS+DG VVIWTVAKEGDQWEGKVL+DF  PVWRVSWSLTGN LAV  G+
Sbjct  221  NLGLPKTTIASASQDGTVVIWTVAKEGDQWEGKVLHDFKAPVWRVSWSLTGNILAVADGN  280

Query  283  NNVTLWNEAVDGEW  242
            NNVTLW EAVDGEW
Sbjct  281  NNVTLWKEAVDGEW  294



>emb|CAN79974.1| hypothetical protein VITISV_009154 [Vitis vinifera]
Length=312

 Score =   238 bits (608),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 116/134 (87%), Positives = 121/134 (90%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            SMAPGAL GSGL DPVQKL S GCDNTVKVWKLYNG WKMDCFPALQMHT WVRDVAWAP
Sbjct  160  SMAPGALVGSGLLDPVQKLVSGGCDNTVKVWKLYNGNWKMDCFPALQMHTDWVRDVAWAP  219

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIASAS+DG VVIWTVAKEGDQWEG+VL DF TPVWRVSWSLTGN LAV  G+
Sbjct  220  NLGLPKSTIASASQDGTVVIWTVAKEGDQWEGRVLKDFKTPVWRVSWSLTGNLLAVADGN  279

Query  283  NNVTLWNEAVDGEW  242
            NNVTLW ++VDGEW
Sbjct  280  NNVTLWKDSVDGEW  293


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 59/121 (49%), Gaps = 8/121 (7%)
 Frame = -1

Query  595  QKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWA-PNLGLPKSTIASASED  419
            +++A+   D+T+K+  + N   +      L  H   V  VAWA P  G   S +AS S D
Sbjct  24   KRVATASSDSTIKIIGVSNNASQH--LSTLTGHQGPVWQVAWAHPKFG---SILASCSHD  78

Query  418  GKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWS--LTGNXLAVXSGDNNVTLWNEAVDGE  245
            G+V+IW    + D  +  V  D  + V  ++W+    G  LA  S D N++++    DG 
Sbjct  79   GRVIIWKEGNQNDWTQAHVFSDHKSSVNSIAWAPHELGLCLACGSSDGNISVFTARSDGA  138

Query  244  W  242
            W
Sbjct  139  W  139



>ref|XP_002265971.1| PREDICTED: protein transport protein SEC13 homolog B [Vitis vinifera]
Length=301

 Score =   238 bits (607),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 118/134 (88%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            SMAPGAL GSGL D VQKL S GCDNTVKVWKLYNG WKMDCFPALQMHT WVRDVAWAP
Sbjct  160  SMAPGALVGSGLLDLVQKLVSGGCDNTVKVWKLYNGNWKMDCFPALQMHTDWVRDVAWAP  219

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIASAS+DG VVIWTVAKEGDQWEGKVL DF TPVWRVSWSLTGN LAV  G+
Sbjct  220  NLGLPKSTIASASQDGTVVIWTVAKEGDQWEGKVLKDFKTPVWRVSWSLTGNLLAVADGN  279

Query  283  NNVTLWNEAVDGEW  242
            NNVTLW EAVDGEW
Sbjct  280  NNVTLWKEAVDGEW  293



>ref|XP_010094976.1| Protein SEC13-like protein [Morus notabilis]
 gb|EXB57735.1| Protein SEC13-like protein [Morus notabilis]
Length=302

 Score =   238 bits (607),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 117/134 (87%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            SMAPGAL GSGL D VQKLAS GCDNTVKVWKLYNG WKMDCFPALQMH  WVRDVAWAP
Sbjct  161  SMAPGALVGSGLTDLVQKLASGGCDNTVKVWKLYNGTWKMDCFPALQMHADWVRDVAWAP  220

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIASAS+DG VVIWTVAKEGDQWEGKVL DF +PVWRVSWSLTGN LAV  G+
Sbjct  221  NLGLPKSTIASASQDGTVVIWTVAKEGDQWEGKVLKDFKSPVWRVSWSLTGNLLAVADGN  280

Query  283  NNVTLWNEAVDGEW  242
            NNVTLW EAVDGEW
Sbjct  281  NNVTLWKEAVDGEW  294



>ref|XP_007144311.1| hypothetical protein PHAVU_007G145400g [Phaseolus vulgaris]
 gb|ESW16305.1| hypothetical protein PHAVU_007G145400g [Phaseolus vulgaris]
Length=301

 Score =   238 bits (607),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 116/134 (87%), Positives = 121/134 (90%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            SMAPGAL G+GL DPVQKL S GCDNTVKVWKL NG+WKMDCFPAL MHT WVRDVAWAP
Sbjct  160  SMAPGALVGAGLLDPVQKLCSGGCDNTVKVWKLNNGLWKMDCFPALHMHTDWVRDVAWAP  219

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTI+SAS+DGKVVIWTVAKEGDQWEGKVL DF TPVWRVSWSLTGN LAV  G+
Sbjct  220  NLGLPKSTISSASQDGKVVIWTVAKEGDQWEGKVLNDFKTPVWRVSWSLTGNILAVAEGN  279

Query  283  NNVTLWNEAVDGEW  242
            NNVTLW EAVDGEW
Sbjct  280  NNVTLWKEAVDGEW  293



>gb|KHN12541.1| Protein SEC13 like [Glycine soja]
Length=301

 Score =   238 bits (606),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 116/134 (87%), Positives = 121/134 (90%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            SMAPGAL G GL DPVQKL S GCDNTVKVWKL NG+WKMDCFPALQMHT WVRDVAWAP
Sbjct  160  SMAPGALVGGGLLDPVQKLCSGGCDNTVKVWKLNNGLWKMDCFPALQMHTDWVRDVAWAP  219

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIASAS+DGKV+IWTVAK+GDQWEGKVL DF TPVWRVSWSLTGN LAV  G+
Sbjct  220  NLGLPKSTIASASQDGKVIIWTVAKDGDQWEGKVLNDFKTPVWRVSWSLTGNILAVADGN  279

Query  283  NNVTLWNEAVDGEW  242
            NNVTLW EAVDGEW
Sbjct  280  NNVTLWKEAVDGEW  293



>ref|XP_011085795.1| PREDICTED: protein transport protein SEC13 homolog B-like [Sesamum 
indicum]
Length=301

 Score =   238 bits (606),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 116/134 (87%), Positives = 122/134 (91%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            SMAPGAL GSG+ +PVQKLAS GCDNTVKVWKLYNG WKMDCFPALQMH+ WVRDVAWAP
Sbjct  160  SMAPGALVGSGVLEPVQKLASGGCDNTVKVWKLYNGNWKMDCFPALQMHSDWVRDVAWAP  219

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIASAS+DG VVIWTVAKEGDQWEGKVL DF TPVWRVSWSLTGN LAV SGD
Sbjct  220  NLGLPKSTIASASQDGTVVIWTVAKEGDQWEGKVLKDFKTPVWRVSWSLTGNLLAVASGD  279

Query  283  NNVTLWNEAVDGEW  242
            N++TLW EAVDG W
Sbjct  280  NSITLWKEAVDGVW  293



>ref|XP_011028666.1| PREDICTED: protein transport protein SEC13 homolog B [Populus 
euphratica]
 ref|XP_011028667.1| PREDICTED: protein transport protein SEC13 homolog B [Populus 
euphratica]
 ref|XP_011028668.1| PREDICTED: protein transport protein SEC13 homolog B [Populus 
euphratica]
 ref|XP_011028669.1| PREDICTED: protein transport protein SEC13 homolog B [Populus 
euphratica]
Length=301

 Score =   238 bits (606),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 115/134 (86%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            S APGAL GSGL DPVQKL S GCDNTVKVWKLYNG WK+DCFPAL MHT WVRDVAWAP
Sbjct  160  STAPGALVGSGLLDPVQKLCSGGCDNTVKVWKLYNGNWKLDCFPALNMHTDWVRDVAWAP  219

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIASAS+DGKV+IWTVAKEGDQWEGKVL+DF  PVWRVSWSLTGN LAV  G+
Sbjct  220  NLGLPKSTIASASQDGKVIIWTVAKEGDQWEGKVLHDFKAPVWRVSWSLTGNILAVADGN  279

Query  283  NNVTLWNEAVDGEW  242
            NNVTLW EAVDGEW
Sbjct  280  NNVTLWKEAVDGEW  293


 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 36/121 (30%), Positives = 59/121 (49%), Gaps = 8/121 (7%)
 Frame = -1

Query  595  QKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWA-PNLGLPKSTIASASED  419
            +++A+   D+++K+  + N   +      L  H   V  VAWA P  G   S +AS S D
Sbjct  24   KRIATASSDHSIKIIGVNNNTSQH--LANLTGHQGPVWQVAWAHPKFG---SLLASCSYD  78

Query  418  GKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWS--LTGNXLAVXSGDNNVTLWNEAVDGE  245
            G+V+IW    + D  +  V  D  + V  ++W+    G  LA  S D N++++    DG 
Sbjct  79   GRVIIWKEGNQNDWTQAHVFEDHKSSVNSIAWAPHELGLSLACGSSDGNISVFTARADGN  138

Query  244  W  242
            W
Sbjct  139  W  139



>gb|KCW52832.1| hypothetical protein EUGRSUZ_J02164 [Eucalyptus grandis]
Length=310

 Score =   238 bits (606),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 116/132 (88%), Positives = 121/132 (92%), Gaps = 0/132 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            SMAPGAL GSGL DPVQKLAS GCDNTVKVWKLYNG WKMDCFPALQMH+ WVRDVAWAP
Sbjct  161  SMAPGALVGSGLLDPVQKLASGGCDNTVKVWKLYNGTWKMDCFPALQMHSDWVRDVAWAP  220

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIASAS+DG VVIWTVAKEG+QW+GKVL DF TPVWRVSWSLTGN LAV  G+
Sbjct  221  NLGLPKSTIASASQDGTVVIWTVAKEGEQWQGKVLKDFKTPVWRVSWSLTGNLLAVADGN  280

Query  283  NNVTLWNEAVDG  248
            NNVTLWNEAVDG
Sbjct  281  NNVTLWNEAVDG  292



>gb|AGV54445.1| protein transport SEC13-like protein [Phaseolus vulgaris]
Length=301

 Score =   237 bits (605),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 117/134 (87%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            SMAPGAL GS L DPVQKL S GCDNTVKVWKL NG+WKMDCFPAL MHT WVRDVAWAP
Sbjct  160  SMAPGALVGSRLLDPVQKLCSGGCDNTVKVWKLNNGLWKMDCFPALHMHTDWVRDVAWAP  219

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIASAS+DGKVVIWTVAKEGDQWEGKVL DF TPVWRVSWSLTGN LAV  G+
Sbjct  220  NLGLPKSTIASASQDGKVVIWTVAKEGDQWEGKVLNDFKTPVWRVSWSLTGNILAVADGN  279

Query  283  NNVTLWNEAVDGEW  242
            NNVTLW EAVDGEW
Sbjct  280  NNVTLWKEAVDGEW  293



>gb|KCW84259.1| hypothetical protein EUGRSUZ_B01116 [Eucalyptus grandis]
Length=301

 Score =   237 bits (604),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 112/134 (84%), Positives = 122/134 (91%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            S APGAL GSG+ +PVQKL S GCDNTVKVWKLYN VWK+DCFP LQMHT WVRDVAWAP
Sbjct  160  STAPGALVGSGMMEPVQKLCSGGCDNTVKVWKLYNRVWKLDCFPVLQMHTDWVRDVAWAP  219

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIASAS+DG+V+IWT+AKEGDQW+GKVLYDF TPVWRVSWSLTGN LAV  G+
Sbjct  220  NLGLPKSTIASASQDGRVIIWTLAKEGDQWQGKVLYDFRTPVWRVSWSLTGNILAVADGN  279

Query  283  NNVTLWNEAVDGEW  242
            NNV+LWNEAVDGEW
Sbjct  280  NNVSLWNEAVDGEW  293



>ref|XP_008230683.1| PREDICTED: protein SEC13 homolog [Prunus mume]
Length=300

 Score =   237 bits (604),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 115/134 (86%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            SMAPGAL GSGL DPV KLAS GCDNTVKVWKLYNG WKMDCFPALQMH+ WVRDVAWAP
Sbjct  159  SMAPGALVGSGLLDPVHKLASGGCDNTVKVWKLYNGTWKMDCFPALQMHSDWVRDVAWAP  218

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIASAS+DG VVIWTVAKEG+QWEG VL DF TPVWRVSWSLTGN LAV  G+
Sbjct  219  NLGLPKSTIASASQDGTVVIWTVAKEGEQWEGNVLKDFKTPVWRVSWSLTGNLLAVADGN  278

Query  283  NNVTLWNEAVDGEW  242
            NNVTLW E+VDGEW
Sbjct  279  NNVTLWKESVDGEW  292



>ref|XP_010272104.1| PREDICTED: protein transport protein SEC13 homolog B [Nelumbo 
nucifera]
Length=301

 Score =   237 bits (604),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 115/134 (86%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            SMAPGAL GS + DPVQKL S GCDNTVKVWKL NG WKMDCFPALQMHT WVRDVAWAP
Sbjct  160  SMAPGALVGSAVLDPVQKLVSGGCDNTVKVWKLSNGNWKMDCFPALQMHTDWVRDVAWAP  219

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIASAS+DGKV+IWTVAKEGDQWEGK+L DF TPVWRVSWSLTGN LAV  G+
Sbjct  220  NLGLPKSTIASASQDGKVIIWTVAKEGDQWEGKILKDFKTPVWRVSWSLTGNILAVADGN  279

Query  283  NNVTLWNEAVDGEW  242
            NNVTLW EAVDGEW
Sbjct  280  NNVTLWKEAVDGEW  293



>ref|XP_008790006.1| PREDICTED: protein SEC13 homolog [Phoenix dactylifera]
Length=302

 Score =   237 bits (604),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 114/134 (85%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            +MAPG+L  SG  DPVQKLAS GCDNTVKVWKLYNG WKMDCFPALQMHT WVRDVAWAP
Sbjct  161  AMAPGSLVSSGQFDPVQKLASGGCDNTVKVWKLYNGSWKMDCFPALQMHTDWVRDVAWAP  220

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPK+TIASAS+DG VVIWTVAKEGDQWEGKVL+DF  PVWRVSWSLTGN LAV  G+
Sbjct  221  NLGLPKTTIASASQDGTVVIWTVAKEGDQWEGKVLHDFKAPVWRVSWSLTGNILAVADGN  280

Query  283  NNVTLWNEAVDGEW  242
            NNVTLW EAVDGEW
Sbjct  281  NNVTLWKEAVDGEW  294



>emb|CAN81348.1| hypothetical protein VITISV_021485 [Vitis vinifera]
Length=301

 Score =   236 bits (602),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = -1

Query  640  MAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAPN  461
            MAPGAL GSGL D VQKL S GCDNTVKVWKLYNG WKMDCFPALQMHT WVRDVAWAPN
Sbjct  161  MAPGALVGSGLLDLVQKLVSGGCDNTVKVWKLYNGNWKMDCFPALQMHTDWVRDVAWAPN  220

Query  460  LGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGDN  281
            LGLPKSTIASAS+DG VVIWTVAKEGDQWEGKVL DF TPVWRVSWSLTGN LAV  G+N
Sbjct  221  LGLPKSTIASASQDGTVVIWTVAKEGDQWEGKVLKDFKTPVWRVSWSLTGNLLAVADGNN  280

Query  280  NVTLWNEAVDGEW  242
            NVTLW EAVDGEW
Sbjct  281  NVTLWKEAVDGEW  293



>ref|XP_007215747.1| hypothetical protein PRUPE_ppa009252mg [Prunus persica]
 gb|EMJ16946.1| hypothetical protein PRUPE_ppa009252mg [Prunus persica]
Length=300

 Score =   236 bits (602),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/134 (86%), Positives = 119/134 (89%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            SMAPGAL GSGL DPV KLAS GCDNTVKVWKLYNG WKMDCFPALQMH  WVRDVAWAP
Sbjct  159  SMAPGALVGSGLLDPVHKLASGGCDNTVKVWKLYNGTWKMDCFPALQMHRDWVRDVAWAP  218

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIASAS+DG VVIWTVAKEG+QWEG VL DF TPVWRVSWSLTGN LAV  G+
Sbjct  219  NLGLPKSTIASASQDGTVVIWTVAKEGEQWEGNVLKDFKTPVWRVSWSLTGNLLAVADGN  278

Query  283  NNVTLWNEAVDGEW  242
            NNVTLW E+VDGEW
Sbjct  279  NNVTLWKESVDGEW  292



>gb|EYU44682.1| hypothetical protein MIMGU_mgv1a010776mg [Erythranthe guttata]
Length=302

 Score =   236 bits (602),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 114/134 (85%), Positives = 119/134 (89%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            SMAPGAL GSG  +PVQKLAS GCDNTVKVWKLYNG WKMDCFPALQMH+ WVRDVAWAP
Sbjct  161  SMAPGALVGSGAFEPVQKLASGGCDNTVKVWKLYNGSWKMDCFPALQMHSDWVRDVAWAP  220

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIASAS+DG VV+WT  KEGDQWEGKVL DF  PVWRVSWSLTGN LAV SGD
Sbjct  221  NLGLPKSTIASASQDGTVVVWTAVKEGDQWEGKVLKDFKNPVWRVSWSLTGNLLAVASGD  280

Query  283  NNVTLWNEAVDGEW  242
            NNVTLW E+VDGEW
Sbjct  281  NNVTLWKESVDGEW  294



>ref|XP_009759579.1| PREDICTED: protein transport protein SEC13-like [Nicotiana sylvestris]
 ref|XP_009759644.1| PREDICTED: protein transport protein SEC13-like [Nicotiana sylvestris]
 ref|XP_009759712.1| PREDICTED: protein transport protein SEC13-like [Nicotiana sylvestris]
 ref|XP_009759764.1| PREDICTED: protein transport protein SEC13-like [Nicotiana sylvestris]
 ref|XP_009759824.1| PREDICTED: protein transport protein SEC13-like [Nicotiana sylvestris]
 ref|XP_009759881.1| PREDICTED: protein transport protein SEC13-like [Nicotiana sylvestris]
 ref|XP_009759950.1| PREDICTED: protein transport protein SEC13-like [Nicotiana sylvestris]
Length=302

 Score =   236 bits (602),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/134 (83%), Positives = 123/134 (92%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            SM+PGA+ GSG+ +PVQKLAS GCDNTVKVWKLYNG+WKMDCFPALQMH+ WVRDVAWAP
Sbjct  161  SMSPGAIVGSGVLEPVQKLASGGCDNTVKVWKLYNGIWKMDCFPALQMHSNWVRDVAWAP  220

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKST+ASASEDG VVIWT+AKEG+QW+GKVL DF  PVWRVSWSLTGN LAV +GD
Sbjct  221  NLGLPKSTMASASEDGTVVIWTMAKEGNQWDGKVLKDFQNPVWRVSWSLTGNLLAVAAGD  280

Query  283  NNVTLWNEAVDGEW  242
            NNVTLW EA+DGEW
Sbjct  281  NNVTLWKEAIDGEW  294


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 63/124 (51%), Gaps = 13/124 (10%)
 Frame = -1

Query  595  QKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWA-PNLGLPKSTIASASED  419
            +++A+   DNT+K+  + +         +L  H+  V  VAWA P  G   S +AS S D
Sbjct  24   KRMATASSDNTIKIVGVGDNSASQH-LASLSGHSGPVWQVAWAHPKFG---SILASCSYD  79

Query  418  GKVVIWTVAKEGDQWE---GKVLYDFNTPVWRVSWS--LTGNXLAVXSGDNNVTLWNEAV  254
            GKV+IW   KEG+Q E     V  D  + V  +SW+    G  LA  S D N+++ N   
Sbjct  80   GKVIIW---KEGNQNEWTQAHVFSDHKSSVNSISWAPHELGLCLACASSDGNISVHNARS  136

Query  253  DGEW  242
            DG W
Sbjct  137  DGGW  140



>ref|XP_002321555.1| hypothetical protein POPTR_0015s080101g [Populus trichocarpa]
 ref|XP_006374503.1| hypothetical protein POPTR_0015s080101g [Populus trichocarpa]
 ref|XP_006374504.1| transport protein SEC13 [Populus trichocarpa]
 gb|EEF05682.1| hypothetical protein POPTR_0015s080101g [Populus trichocarpa]
 gb|ERP52300.1| hypothetical protein POPTR_0015s080101g [Populus trichocarpa]
 gb|ERP52301.1| transport protein SEC13 [Populus trichocarpa]
Length=301

 Score =   236 bits (602),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 114/134 (85%), Positives = 119/134 (89%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            S APGAL GSGL DPVQKL S GCDNTVKVWKLYNG WK+DCFPAL MHT WVRDVAWAP
Sbjct  160  STAPGALVGSGLLDPVQKLCSGGCDNTVKVWKLYNGNWKLDCFPALNMHTDWVRDVAWAP  219

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIAS S+DGKV+IWTVAKEGDQWEGKVL+DF  PVWRVSWSLTGN LAV  G+
Sbjct  220  NLGLPKSTIASVSQDGKVIIWTVAKEGDQWEGKVLHDFKAPVWRVSWSLTGNILAVADGN  279

Query  283  NNVTLWNEAVDGEW  242
            NNVTLW EAVDGEW
Sbjct  280  NNVTLWKEAVDGEW  293


 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 36/121 (30%), Positives = 59/121 (49%), Gaps = 8/121 (7%)
 Frame = -1

Query  595  QKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWA-PNLGLPKSTIASASED  419
            +++A+   D+++K+  + N   +      L  H   V  VAWA P  G   S +AS S D
Sbjct  24   KRIATASSDHSIKIIGVNNNTSQH--LANLTGHQGPVWQVAWAHPKFG---SLLASCSYD  78

Query  418  GKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWS--LTGNXLAVXSGDNNVTLWNEAVDGE  245
            G+V+IW    + D  +  V  D  + V  ++W+    G  LA  S D N++++    DG 
Sbjct  79   GRVIIWKEGNQNDWTQAHVFEDHKSSVNSIAWAPHELGLSLACGSSDGNISVFTARADGN  138

Query  244  W  242
            W
Sbjct  139  W  139



>gb|ACU18089.1| unknown [Glycine max]
Length=301

 Score =   236 bits (602),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/134 (86%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            SMAPGAL G GL DPVQKL S GCDNTVKVWKL NG+WKMDCFPALQMH  WVRDVAWAP
Sbjct  160  SMAPGALVGGGLLDPVQKLCSGGCDNTVKVWKLNNGLWKMDCFPALQMHMDWVRDVAWAP  219

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIASAS+DGKV+IWTVAK+GDQWEGKVL DF TPVWRVSWSLTGN LAV  G+
Sbjct  220  NLGLPKSTIASASQDGKVIIWTVAKDGDQWEGKVLNDFKTPVWRVSWSLTGNILAVADGN  279

Query  283  NNVTLWNEAVDGEW  242
            NNVTLW EAVDGEW
Sbjct  280  NNVTLWKEAVDGEW  293



>ref|XP_003551800.1| PREDICTED: protein SEC13 homolog isoform X1 [Glycine max]
 ref|XP_006602184.1| PREDICTED: protein SEC13 homolog isoform X2 [Glycine max]
Length=301

 Score =   236 bits (601),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 115/134 (86%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            SMAPGAL G GL DPVQKL S GCDNTVKVWKL NG+WKMDCFPALQMH  WVRDVAWAP
Sbjct  160  SMAPGALVGGGLLDPVQKLCSGGCDNTVKVWKLNNGLWKMDCFPALQMHMDWVRDVAWAP  219

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIASAS+DGKV+IWTVAK+GDQWEGKVL DF TPVWRVSWSLTGN LAV  G+
Sbjct  220  NLGLPKSTIASASQDGKVIIWTVAKDGDQWEGKVLNDFKTPVWRVSWSLTGNILAVADGN  279

Query  283  NNVTLWNEAVDGEW  242
            NNVTLW EAVDGEW
Sbjct  280  NNVTLWKEAVDGEW  293



>gb|AFK43784.1| unknown [Lotus japonicus]
Length=166

 Score =   231 bits (588),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 113/134 (84%), Positives = 118/134 (88%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            SMAPGAL G+GL DPVQKL S GCDNTVKVWKL NG WKMDCFPAL MHT WVRDVAWAP
Sbjct  25   SMAPGALVGAGLLDPVQKLCSGGCDNTVKVWKLTNGNWKMDCFPALHMHTDWVRDVAWAP  84

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIASAS+DGK +IWTV KEGDQWEGK+L DF TPVWRVSWSLTGN LAV  G+
Sbjct  85   NLGLPKSTIASASQDGKAIIWTVGKEGDQWEGKILNDFKTPVWRVSWSLTGNILAVADGN  144

Query  283  NNVTLWNEAVDGEW  242
            NNVTLW EAVDGEW
Sbjct  145  NNVTLWKEAVDGEW  158



>ref|XP_004512728.1| PREDICTED: protein SEC13 homolog isoform X1 [Cicer arietinum]
 ref|XP_004512729.1| PREDICTED: protein SEC13 homolog isoform X2 [Cicer arietinum]
Length=301

 Score =   235 bits (599),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 115/134 (86%), Positives = 119/134 (89%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            SMAPGAL GSGL DPVQKL S GCDNTVKVWKL NG WKMDCFPALQMHT WVRDVAWAP
Sbjct  160  SMAPGALVGSGLLDPVQKLCSGGCDNTVKVWKLNNGHWKMDCFPALQMHTDWVRDVAWAP  219

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIASAS+DGKV+IWTV KEGD W+GKVL DF TPVWRVSWSLTGN LAV  G+
Sbjct  220  NLGLPKSTIASASQDGKVIIWTVGKEGDHWDGKVLNDFKTPVWRVSWSLTGNILAVADGN  279

Query  283  NNVTLWNEAVDGEW  242
            NNVTLW EAVDGEW
Sbjct  280  NNVTLWKEAVDGEW  293


 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 42/124 (34%), Positives = 63/124 (51%), Gaps = 14/124 (11%)
 Frame = -1

Query  595  QKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWA-PNLGLPKSTIASASED  419
            ++LA+   D+T+K+  + N   +      L  H   V +VAWA P  G   S +AS S D
Sbjct  24   KRLATASSDHTIKIIGVSNSASQP--LATLTGHEGPVWEVAWAHPKFG---SLLASCSYD  78

Query  418  GKVVIWTVAKEGDQWE---GKVLYDFNTPVWRVSWSLT--GNXLAVXSGDNNVTLWNEAV  254
            G+V++W   KEG+Q E     V  D  + V  V+W+    G  LA  S D N++++    
Sbjct  79   GRVILW---KEGNQNEWVQAHVFDDHKSSVNSVAWAPHELGLCLACASSDGNISIFTARA  135

Query  253  DGEW  242
            DG W
Sbjct  136  DGGW  139



>dbj|BAJ10727.1| SEC13 family protein [Lotus japonicus]
 gb|AFK45896.1| unknown [Lotus japonicus]
Length=301

 Score =   235 bits (599),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 114/134 (85%), Positives = 119/134 (89%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            SMAPGAL G+GL DPVQKL S GCDNTVKVWKL NG WKMDCFPAL MHT WVRDVAWAP
Sbjct  160  SMAPGALVGAGLLDPVQKLCSGGCDNTVKVWKLTNGNWKMDCFPALHMHTDWVRDVAWAP  219

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIASAS+DGKV+IWTV KEGDQWEGK+L DF TPVWRVSWSLTGN LAV  G+
Sbjct  220  NLGLPKSTIASASQDGKVIIWTVGKEGDQWEGKILNDFKTPVWRVSWSLTGNILAVADGN  279

Query  283  NNVTLWNEAVDGEW  242
            NNVTLW EAVDGEW
Sbjct  280  NNVTLWKEAVDGEW  293


 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 58/121 (48%), Gaps = 8/121 (7%)
 Frame = -1

Query  595  QKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWA-PNLGLPKSTIASASED  419
            ++LA+   D+T+K+  + N   +      L  H   V  VAWA P  G   S IAS S D
Sbjct  24   KRLATASSDHTIKIIGVSNTASQH--LATLAGHQGPVWQVAWAHPKFG---SMIASCSYD  78

Query  418  GKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWS--LTGNXLAVXSGDNNVTLWNEAVDGE  245
            G+V+IW    + +  +  V  D  + V  V W+    G  LA  S D N++++    DG 
Sbjct  79   GRVIIWKEGNQNEWIQAHVFDDHKSSVNSVVWAPHELGLCLACGSSDGNISVFTARADGG  138

Query  244  W  242
            W
Sbjct  139  W  139



>ref|XP_006379798.1| hypothetical protein POPTR_0008s14080g [Populus trichocarpa]
 gb|ERP57595.1| hypothetical protein POPTR_0008s14080g [Populus trichocarpa]
Length=285

 Score =   234 bits (598),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 114/134 (85%), Positives = 119/134 (89%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            S APGAL GSGL DPVQKL S GCDNTVKVWKLYNG WK+DCFPAL MHT WVRDV WAP
Sbjct  144  STAPGALVGSGLLDPVQKLCSGGCDNTVKVWKLYNGNWKLDCFPALNMHTDWVRDVTWAP  203

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIASAS+DGKV+IWTVAKEGDQWEGKVL+DF  PVWRVSWSLTGN LAV  G+
Sbjct  204  NLGLPKSTIASASQDGKVIIWTVAKEGDQWEGKVLHDFKAPVWRVSWSLTGNILAVADGN  263

Query  283  NNVTLWNEAVDGEW  242
            NNVTLW EAVDGEW
Sbjct  264  NNVTLWKEAVDGEW  277



>ref|XP_011098538.1| PREDICTED: protein transport protein SEC13 homolog B-like [Sesamum 
indicum]
Length=302

 Score =   234 bits (597),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 116/134 (87%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            SMAPGAL GSG+ +PVQKLAS GCDNTVKVWKL N  WKMDCFPALQMH+ WVRDVAWAP
Sbjct  161  SMAPGALVGSGVLEPVQKLASGGCDNTVKVWKLCNDNWKMDCFPALQMHSDWVRDVAWAP  220

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIASAS+DG VVIWTVAKEGDQW GKVL DF TPVWRVSWSLTGN LAV SGD
Sbjct  221  NLGLPKSTIASASQDGTVVIWTVAKEGDQWAGKVLKDFKTPVWRVSWSLTGNLLAVASGD  280

Query  283  NNVTLWNEAVDGEW  242
            NNVTLW EAVDGEW
Sbjct  281  NNVTLWKEAVDGEW  294



>ref|XP_004150601.1| PREDICTED: protein SEC13 homolog [Cucumis sativus]
 ref|XP_004171462.1| PREDICTED: protein SEC13 homolog [Cucumis sativus]
 gb|KGN58046.1| hypothetical protein Csa_3G462670 [Cucumis sativus]
Length=301

 Score =   233 bits (595),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/134 (84%), Positives = 119/134 (89%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            S  PGAL GS L DPVQKL S GCDNTVKVWKLYNGVWKMDCFPALQMH+ WVRDV+WAP
Sbjct  160  STTPGALVGSALLDPVQKLCSGGCDNTVKVWKLYNGVWKMDCFPALQMHSDWVRDVSWAP  219

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIASAS+DGKVVIWTV KEGDQWEGKVL DF TPVWRVSWSLTGN LAV  G+
Sbjct  220  NLGLPKSTIASASQDGKVVIWTVVKEGDQWEGKVLKDFKTPVWRVSWSLTGNILAVADGN  279

Query  283  NNVTLWNEAVDGEW  242
            NNV+LW EAVDG+W
Sbjct  280  NNVSLWKEAVDGDW  293



>emb|CAN80755.1| hypothetical protein VITISV_027966 [Vitis vinifera]
Length=301

 Score =   233 bits (595),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 114/134 (85%), Positives = 119/134 (89%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            SM  GAL GSGL DPVQKL S GCDNTVKVWKLYNG WKMDCFPALQMHT WVRDVAWAP
Sbjct  160  SMPSGALVGSGLLDPVQKLVSGGCDNTVKVWKLYNGNWKMDCFPALQMHTDWVRDVAWAP  219

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIASAS+DG VVIWTVAKEGDQWEG+VL DF TPVWRVSWSLTGN LAV  G+
Sbjct  220  NLGLPKSTIASASQDGTVVIWTVAKEGDQWEGRVLKDFKTPVWRVSWSLTGNLLAVADGN  279

Query  283  NNVTLWNEAVDGEW  242
            NNVTLW ++VDGEW
Sbjct  280  NNVTLWKDSVDGEW  293



>ref|XP_010524317.1| PREDICTED: protein transport protein SEC13 homolog B-like [Tarenaya 
hassleriana]
Length=302

 Score =   233 bits (595),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 114/134 (85%), Positives = 119/134 (89%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            S APGAL GSGL +PV KLAS GCDNTVKVWKLYNG WKMDCFPALQMH+ WVRDVAWAP
Sbjct  161  STAPGALVGSGLLEPVYKLASGGCDNTVKVWKLYNGSWKMDCFPALQMHSDWVRDVAWAP  220

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIASAS+DG VVIWTV KEG+QWEGKVL DF TPVWRVSWSLTGN LAV  G+
Sbjct  221  NLGLPKSTIASASQDGTVVIWTVGKEGEQWEGKVLKDFKTPVWRVSWSLTGNLLAVSDGN  280

Query  283  NNVTLWNEAVDGEW  242
            NNVTLW EAVDGEW
Sbjct  281  NNVTLWKEAVDGEW  294



>ref|XP_009408052.1| PREDICTED: protein SEC13 homolog [Musa acuminata subsp. malaccensis]
Length=302

 Score =   233 bits (594),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 113/134 (84%), Positives = 119/134 (89%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            ++APG L GSG  DPVQKLAS GCDNTVKVWK YNG WKMDCFPALQMH+ WVRDVAWAP
Sbjct  161  ALAPGVLVGSGQLDPVQKLASGGCDNTVKVWKFYNGNWKMDCFPALQMHSDWVRDVAWAP  220

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIASAS+DG VVIWTVAKEGDQWEGKVL +FN PVWRVSWSLTGN LAV  G+
Sbjct  221  NLGLPKSTIASASQDGTVVIWTVAKEGDQWEGKVLNNFNAPVWRVSWSLTGNILAVADGN  280

Query  283  NNVTLWNEAVDGEW  242
            NNVTLW EAVDGEW
Sbjct  281  NNVTLWKEAVDGEW  294



>emb|CDP21792.1| unnamed protein product [Coffea canephora]
Length=299

 Score =   233 bits (593),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 111/134 (83%), Positives = 117/134 (87%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            S  PGAL GSG+ DPVQKLAS GCDN VKVWKLYNG+WKMDCFPALQMHT WVRDVAWAP
Sbjct  160  STGPGALVGSGVLDPVQKLASGGCDNAVKVWKLYNGIWKMDCFPALQMHTDWVRDVAWAP  219

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIASAS+DG+V+ WTV +EGDQWEGKVL DF TPVWRVSWSLTGN LAV  G 
Sbjct  220  NLGLPKSTIASASQDGRVITWTVMREGDQWEGKVLKDFKTPVWRVSWSLTGNILAVADGS  279

Query  283  NNVTLWNEAVDGEW  242
            NNVTLW E VDGEW
Sbjct  280  NNVTLWKEEVDGEW  293


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 57/121 (47%), Gaps = 8/121 (7%)
 Frame = -1

Query  595  QKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWA-PNLGLPKSTIASASED  419
            ++LA+   DNT+K+  + N          L  H   V  VAWA P  G   S +AS S D
Sbjct  24   KRLATASSDNTIKIIGVSNS--NSQPLATLSGHQGPVWQVAWAHPKFG---SLVASCSYD  78

Query  418  GKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWS--LTGNXLAVXSGDNNVTLWNEAVDGE  245
            GKV+IW    + +  +  +  D    V  ++W+    G  LA  S D N++++    DG 
Sbjct  79   GKVIIWREGNQNEWSQAHLFGDHKASVNSIAWAPHELGLCLACGSSDGNISIFTARSDGS  138

Query  244  W  242
            W
Sbjct  139  W  139



>gb|KDO51761.1| hypothetical protein CISIN_1g036510mg, partial [Citrus sinensis]
Length=288

 Score =   232 bits (591),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 111/129 (86%), Positives = 117/129 (91%), Gaps = 0/129 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            S APGAL GSG  DPVQKL S GCDNTVKVWKLYNG+WKMDCFPALQMHT WVRDVAWAP
Sbjct  160  STAPGALVGSGFLDPVQKLCSGGCDNTVKVWKLYNGIWKMDCFPALQMHTDWVRDVAWAP  219

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIASASEDGKV+IWTVA+EGDQWEGKVL+DF TPV+RVSWSLTGN LAV  G+
Sbjct  220  NLGLPKSTIASASEDGKVIIWTVAREGDQWEGKVLHDFKTPVYRVSWSLTGNILAVADGN  279

Query  283  NNVTLWNEA  257
            NNVTLW EA
Sbjct  280  NNVTLWEEA  288



>ref|NP_001275312.1| protein transport SEC13-like protein [Solanum tuberosum]
 gb|ABC01897.1| protein transport SEC13-like protein [Solanum tuberosum]
Length=303

 Score =   232 bits (592),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 115/135 (85%), Positives = 120/135 (89%), Gaps = 1/135 (1%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            SMAPGAL G+G+ +PVQKLAS GCDNTVKVWKLYNGVWKMDCFPALQMHT WVRDVAWAP
Sbjct  161  SMAPGALVGAGVLEPVQKLASGGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAP  220

Query  463  NLGLPKST-IASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSG  287
            NLGLPKST    ASEDG VVIWTV KEGDQWEGKVL DF +PVWRVSWSLTGN LAV +G
Sbjct  221  NLGLPKSTNCLVASEDGTVVIWTVGKEGDQWEGKVLKDFKSPVWRVSWSLTGNLLAVAAG  280

Query  286  DNNVTLWNEAVDGEW  242
            DNNVTLW EAVDGEW
Sbjct  281  DNNVTLWKEAVDGEW  295



>dbj|BAO49716.1| nuclear pore complex protein Sec13b [Nicotiana benthamiana]
Length=301

 Score =   232 bits (591),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 112/134 (84%), Positives = 121/134 (90%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            SMAPG+L  S   +PVQKLAS GCDNTVKVWKL+NG WKMDCFPALQMHT WVRDVAWAP
Sbjct  160  SMAPGSLVVSDNLNPVQKLASGGCDNTVKVWKLFNGTWKMDCFPALQMHTDWVRDVAWAP  219

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPK+TIASASEDG+V+IWTVAKEGDQW+GKVL DF +PVWRVSWSLTGN LAV  G+
Sbjct  220  NLGLPKTTIASASEDGRVIIWTVAKEGDQWDGKVLKDFGSPVWRVSWSLTGNILAVADGN  279

Query  283  NNVTLWNEAVDGEW  242
            NNVTLWNEAVDGEW
Sbjct  280  NNVTLWNEAVDGEW  293



>ref|XP_002315836.1| transport protein SEC13 [Populus trichocarpa]
 gb|ABK92752.1| unknown [Populus trichocarpa]
 gb|ABK93029.1| unknown [Populus trichocarpa]
 gb|EEF02007.1| transport protein SEC13 [Populus trichocarpa]
Length=301

 Score =   232 bits (591),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 112/134 (84%), Positives = 118/134 (88%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            S APGAL GSGL DP QKL S GCDNTVKVWKLYNG WK+DCFPAL MH  WVRDVAWAP
Sbjct  160  STAPGALVGSGLLDPAQKLCSGGCDNTVKVWKLYNGNWKLDCFPALNMHADWVRDVAWAP  219

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIASAS+DGKV+IWTVAKEGDQWEGKVL+DF  PVWRVSWSLTGN LAV  G+
Sbjct  220  NLGLPKSTIASASQDGKVIIWTVAKEGDQWEGKVLHDFKAPVWRVSWSLTGNILAVADGN  279

Query  283  NNVTLWNEAVDGEW  242
            +NVTLW EAVDGEW
Sbjct  280  SNVTLWKEAVDGEW  293



>ref|XP_011466267.1| PREDICTED: protein transport protein SEC13 homolog B-like [Fragaria 
vesca subsp. vesca]
Length=302

 Score =   231 bits (590),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 110/134 (82%), Positives = 119/134 (89%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            SMAPG+L G+G+ +PVQKL S GCDNTVKVWKLYNG WKMDCFPALQMHT WVRDVAWAP
Sbjct  161  SMAPGSLVGTGMLEPVQKLVSGGCDNTVKVWKLYNGTWKMDCFPALQMHTDWVRDVAWAP  220

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIAS S+DG V+IWTVAKEGDQW+GKVL DF TPVWRVSWSLTGN LAV  G+
Sbjct  221  NLGLPKSTIASCSQDGTVIIWTVAKEGDQWQGKVLNDFKTPVWRVSWSLTGNLLAVADGN  280

Query  283  NNVTLWNEAVDGEW  242
            N VTLW E+VDGEW
Sbjct  281  NEVTLWKESVDGEW  294



>dbj|BAJ10728.1| SEC13 family protein [Lotus japonicus]
Length=301

 Score =   231 bits (589),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/134 (84%), Positives = 118/134 (88%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            S APGAL   GL DPVQKL S GCDNTVKVWKL NG+WKMDCFPALQMHT WVRDVAWAP
Sbjct  160  STAPGALVSGGLLDPVQKLCSGGCDNTVKVWKLNNGLWKMDCFPALQMHTDWVRDVAWAP  219

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIASAS+DGKV+IWTVAKEGDQWEG+VL DF TPVWR SWSLTGN LAV  G+
Sbjct  220  NLGLPKSTIASASQDGKVIIWTVAKEGDQWEGRVLNDFKTPVWRASWSLTGNILAVADGN  279

Query  283  NNVTLWNEAVDGEW  242
            NNVTLW EAVDG+W
Sbjct  280  NNVTLWKEAVDGDW  293



>ref|XP_010550097.1| PREDICTED: protein transport protein SEC13 homolog B [Tarenaya 
hassleriana]
 ref|XP_010550098.1| PREDICTED: protein transport protein SEC13 homolog B [Tarenaya 
hassleriana]
 ref|XP_010550099.1| PREDICTED: protein transport protein SEC13 homolog B [Tarenaya 
hassleriana]
Length=302

 Score =   231 bits (588),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/134 (84%), Positives = 119/134 (89%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            + APGAL GSGL DPV KLAS GCDNTVKVWKLYNG WKMDCFPALQMH+ WVRDVAWAP
Sbjct  161  ATAPGALVGSGLLDPVYKLASGGCDNTVKVWKLYNGSWKMDCFPALQMHSDWVRDVAWAP  220

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIASAS+DG VVIWTV KEG++WEGKVL DF TPVWR+SWSLTGN LAV  G+
Sbjct  221  NLGLPKSTIASASQDGTVVIWTVGKEGEKWEGKVLKDFKTPVWRLSWSLTGNLLAVSDGN  280

Query  283  NNVTLWNEAVDGEW  242
            NNVTLW EAVDGEW
Sbjct  281  NNVTLWKEAVDGEW  294



>gb|AFK43487.1| unknown [Lotus japonicus]
Length=255

 Score =   229 bits (583),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 112/134 (84%), Positives = 118/134 (88%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            S APGAL   GL DPVQKL S GCDNTVKVWKL NG+WKMDCFPALQMHT WVRDVAWAP
Sbjct  114  STAPGALVSGGLLDPVQKLCSGGCDNTVKVWKLNNGLWKMDCFPALQMHTDWVRDVAWAP  173

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIASAS+DGKV+IWTVAKEGDQWEG+VL DF TPVWR SWSLTGN LAV  G+
Sbjct  174  NLGLPKSTIASASQDGKVIIWTVAKEGDQWEGRVLNDFKTPVWRASWSLTGNILAVADGN  233

Query  283  NNVTLWNEAVDGEW  242
            NNVTLW EAVDG+W
Sbjct  234  NNVTLWKEAVDGDW  247



>gb|AFK33508.1| unknown [Medicago truncatula]
Length=210

 Score =   227 bits (579),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 112/134 (84%), Positives = 115/134 (86%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            SMAPGAL GSGL DPVQKL S GCDNTVKVWKL NG WKMDCFPALQ H  WVRDVAWAP
Sbjct  69   SMAPGALVGSGLLDPVQKLCSGGCDNTVKVWKLSNGQWKMDCFPALQKHNDWVRDVAWAP  128

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIASAS+DGKV+IWT  KEGD WEGK L DF TPVWRVSWSLTGN LAV  G+
Sbjct  129  NLGLPKSTIASASQDGKVIIWTAGKEGDHWEGKDLNDFKTPVWRVSWSLTGNILAVADGN  188

Query  283  NNVTLWNEAVDGEW  242
            NNVTLW EAVDGEW
Sbjct  189  NNVTLWKEAVDGEW  202



>ref|XP_008380946.1| PREDICTED: protein transport protein SEC13-like [Malus domestica]
Length=335

 Score =   231 bits (590),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 111/134 (83%), Positives = 119/134 (89%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            S APGAL GSGL DPVQKL S GCDNTVKVWKL NG+WK+DCFPAL MH  WVRDVAWAP
Sbjct  194  STAPGALVGSGLLDPVQKLCSGGCDNTVKVWKLGNGIWKLDCFPALHMHVDWVRDVAWAP  253

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIASAS+DGKV+IWTV K+GDQWEGKVL+DFN PVWRVSWSLTGN LAV  G+
Sbjct  254  NLGLPKSTIASASQDGKVIIWTVGKDGDQWEGKVLHDFNAPVWRVSWSLTGNILAVADGN  313

Query  283  NNVTLWNEAVDGEW  242
            N+VTLW EAVDGEW
Sbjct  314  NSVTLWKEAVDGEW  327


 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 58/121 (48%), Gaps = 8/121 (7%)
 Frame = -1

Query  595  QKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWA-PNLGLPKSTIASASED  419
            ++LA+   DNT+K+  + N          L  H   V  VAWA P  G   S +AS S D
Sbjct  58   KRLATASSDNTIKIIGVSNS--SSQHLATLTGHQGPVWQVAWAHPKFG---SLLASCSYD  112

Query  418  GKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLT--GNXLAVXSGDNNVTLWNEAVDGE  245
            G+V++W    + +  +  V  D  + V  ++W+    G  LA  S D N++++    DG 
Sbjct  113  GRVILWKEGNQNEWTQAHVFDDHKSSVNSIAWAPHELGLCLACGSSDGNISVFTARSDGG  172

Query  244  W  242
            W
Sbjct  173  W  173



>ref|XP_010665916.1| PREDICTED: protein transport protein SEC13 homolog B-like [Beta 
vulgaris subsp. vulgaris]
Length=301

 Score =   230 bits (587),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 110/134 (82%), Positives = 119/134 (89%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            + APGAL  +GL DPVQKL S GCDNTVK+WKL  G+WKMDCFPALQMHT WVRDVAWAP
Sbjct  160  ATAPGALVAAGLHDPVQKLCSGGCDNTVKIWKLNGGIWKMDCFPALQMHTDWVRDVAWAP  219

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIASAS+DGKV++WTVA+EGDQWEGKVL DF TPVWRVSWSLTGN LAV  G+
Sbjct  220  NLGLPKSTIASASQDGKVIMWTVAREGDQWEGKVLNDFKTPVWRVSWSLTGNILAVADGN  279

Query  283  NNVTLWNEAVDGEW  242
            NNVTLWNEAVDG W
Sbjct  280  NNVTLWNEAVDGVW  293


 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 43/124 (35%), Positives = 61/124 (49%), Gaps = 14/124 (11%)
 Frame = -1

Query  595  QKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWA-PNLGLPKSTIASASED  419
            +++A+   D+T+K+  + N   +      L  H   V  VAWA P  G   S +AS S D
Sbjct  24   KRIATASSDHTIKIIGVSNNSHQQ--LATLSAHQGPVWQVAWAHPKFG---SILASCSYD  78

Query  418  GKVVIWTVAKEGDQWE---GKVLYDFNTPVWRVSWS--LTGNXLAVXSGDNNVTLWNEAV  254
            GKV+IW   KEG+Q E     V  D  + V  +SW+    G  LA  S D N+ ++    
Sbjct  79   GKVIIW---KEGNQNEWSQANVFDDHKSSVNSISWAPHELGLCLASGSSDGNIMVYTMRS  135

Query  253  DGEW  242
            DG W
Sbjct  136  DGGW  139



>ref|XP_007215469.1| hypothetical protein PRUPE_ppa006517mg [Prunus persica]
 gb|EMJ16668.1| hypothetical protein PRUPE_ppa006517mg [Prunus persica]
Length=408

 Score =   233 bits (594),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 110/134 (82%), Positives = 121/134 (90%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            S APGAL GSGL DPVQKL S GCDNTVKVWKL NGVWK+DCFPALQMH  WVRDVAWAP
Sbjct  267  STAPGALVGSGLLDPVQKLCSGGCDNTVKVWKLGNGVWKLDCFPALQMHVDWVRDVAWAP  326

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIASAS+DGKV+IWTVAK+GDQW+GKVL+DFN+PV++VSWSLTGN +AV  G+
Sbjct  327  NLGLPKSTIASASQDGKVIIWTVAKDGDQWDGKVLHDFNSPVYKVSWSLTGNIIAVADGN  386

Query  283  NNVTLWNEAVDGEW  242
            NNVTLW E VDGEW
Sbjct  387  NNVTLWKEVVDGEW  400


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 42/124 (34%), Positives = 62/124 (50%), Gaps = 14/124 (11%)
 Frame = -1

Query  595  QKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWA-PNLGLPKSTIASASED  419
            ++LA+   DNTVK+  + N   +      L  H   V  VAWA P  G   S +AS S D
Sbjct  131  KRLATGSADNTVKIIGVSNSASQH--LATLTGHQGPVWQVAWAHPKFG---SLLASCSYD  185

Query  418  GKVVIWTVAKEGDQWE---GKVLYDFNTPVWRVSWS--LTGNXLAVXSGDNNVTLWNEAV  254
            G+V++W   KEG+Q E     +  D  + V  ++W+    G  LA  S D N++++    
Sbjct  186  GRVILW---KEGNQNEWIQAHIFDDHKSSVNSIAWAPHELGLCLACGSSDGNISVFTARA  242

Query  253  DGEW  242
            DG W
Sbjct  243  DGGW  246



>ref|XP_007032314.1| Transducin family protein / WD-40 repeat family protein [Theobroma 
cacao]
 gb|EOY03240.1| Transducin family protein / WD-40 repeat family protein [Theobroma 
cacao]
Length=301

 Score =   229 bits (583),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 112/134 (84%), Positives = 118/134 (88%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            S APGAL GSGL DPVQKLAS G DNT+KVWKLYNG WKMDCFPALQMHT WVRDVAWAP
Sbjct  160  STAPGALVGSGLLDPVQKLASGGYDNTMKVWKLYNGTWKMDCFPALQMHTDWVRDVAWAP  219

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIASAS+DG VVIW  AKEG+QW+GKVL DF TPVWRVSWSLTGN L+V  G+
Sbjct  220  NLGLPKSTIASASQDGTVVIWACAKEGEQWKGKVLKDFKTPVWRVSWSLTGNLLSVADGN  279

Query  283  NNVTLWNEAVDGEW  242
            NNVTLW EAVDGEW
Sbjct  280  NNVTLWKEAVDGEW  293



>ref|XP_010687899.1| PREDICTED: protein transport protein SEC13 homolog B [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010687900.1| PREDICTED: protein transport protein SEC13 homolog B [Beta vulgaris 
subsp. vulgaris]
Length=302

 Score =   229 bits (583),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 110/134 (82%), Positives = 118/134 (88%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            + APGAL GSGL +PV KLAS GCDNTVKVWKL NG WKMDCFPALQMH+ WVRDV+WAP
Sbjct  161  ATAPGALVGSGLLEPVHKLASGGCDNTVKVWKLVNGSWKMDCFPALQMHSDWVRDVSWAP  220

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIASAS+DG VVIWTV KEG+QWEGK+L DF TPVWRVSWSLTGN LAV  GD
Sbjct  221  NLGLPKSTIASASQDGSVVIWTVGKEGEQWEGKILNDFKTPVWRVSWSLTGNLLAVADGD  280

Query  283  NNVTLWNEAVDGEW  242
            NNV+LW EAVDGEW
Sbjct  281  NNVSLWKEAVDGEW  294



>ref|XP_004141658.1| PREDICTED: protein SEC13 homolog [Cucumis sativus]
 ref|XP_004155955.1| PREDICTED: protein SEC13 homolog [Cucumis sativus]
 gb|KGN45591.1| hypothetical protein Csa_7G452950 [Cucumis sativus]
Length=301

 Score =   229 bits (583),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 110/134 (82%), Positives = 119/134 (89%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            S APGAL GSGL DPV KL S GCDNTVKVWK YNG+WKMDCFPALQMHT WVRDVAWAP
Sbjct  160  SSAPGALVGSGLVDPVLKLCSGGCDNTVKVWKPYNGIWKMDCFPALQMHTDWVRDVAWAP  219

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIASAS+DGKV+IWTVA+EGDQWEGK+L DF T VWRVSWSLTGN LAV  G+
Sbjct  220  NLGLPKSTIASASQDGKVIIWTVAREGDQWEGKILSDFKTAVWRVSWSLTGNILAVADGN  279

Query  283  NNVTLWNEAVDGEW  242
            N+VTLW E+VDG+W
Sbjct  280  NSVTLWKESVDGDW  293



>ref|XP_008462440.1| PREDICTED: protein SEC13 homolog [Cucumis melo]
Length=301

 Score =   228 bits (582),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 110/134 (82%), Positives = 119/134 (89%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            S APGAL GSGL DPV KL S GCDNTVKVWK YNG+WKMDCFPALQMHT WVRDVAWAP
Sbjct  160  SSAPGALVGSGLVDPVLKLCSGGCDNTVKVWKPYNGIWKMDCFPALQMHTDWVRDVAWAP  219

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIASAS+DGKV+IWTVA+EGDQWEGK+L DF T VWRVSWSLTGN LAV  G+
Sbjct  220  NLGLPKSTIASASQDGKVIIWTVAREGDQWEGKILNDFKTAVWRVSWSLTGNILAVADGN  279

Query  283  NNVTLWNEAVDGEW  242
            N+VTLW E+VDG+W
Sbjct  280  NSVTLWKESVDGDW  293



>gb|KEH33918.1| transducin/WD-like repeat-protein [Medicago truncatula]
Length=301

 Score =   228 bits (582),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 112/134 (84%), Positives = 115/134 (86%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            SMAPGAL GSGL DPVQKL S GCDNTVKVWKL NG WKMDCFPALQ H  WVRDVAWAP
Sbjct  160  SMAPGALVGSGLLDPVQKLCSGGCDNTVKVWKLSNGQWKMDCFPALQKHNDWVRDVAWAP  219

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIASAS+DGKV+IWT  KEGD WEGK L DF TPVWRVSWSLTGN LAV  G+
Sbjct  220  NLGLPKSTIASASQDGKVIIWTAGKEGDHWEGKDLNDFKTPVWRVSWSLTGNILAVADGN  279

Query  283  NNVTLWNEAVDGEW  242
            NNVTLW EAVDGEW
Sbjct  280  NNVTLWKEAVDGEW  293



>ref|XP_011021702.1| PREDICTED: protein transport protein SEC13 homolog B-like [Populus 
euphratica]
Length=301

 Score =   228 bits (580),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 109/134 (81%), Positives = 116/134 (87%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            SMAPGAL GSGL D  QKL S GCDNTVKVW+LYNG WK DCFPAL MH  WVRDVAWAP
Sbjct  160  SMAPGALVGSGLLDSAQKLCSGGCDNTVKVWRLYNGNWKQDCFPALNMHADWVRDVAWAP  219

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIASAS+DGKV++WT AKEGDQWEGKVL+DF  PVWRVSWSLTGN LAV  G+
Sbjct  220  NLGLPKSTIASASQDGKVILWTAAKEGDQWEGKVLHDFKAPVWRVSWSLTGNILAVADGN  279

Query  283  NNVTLWNEAVDGEW  242
            +NVTLW EAVDGEW
Sbjct  280  SNVTLWKEAVDGEW  293



>ref|XP_010267185.1| PREDICTED: protein transport protein SEC13 homolog B-like [Nelumbo 
nucifera]
 ref|XP_010267187.1| PREDICTED: protein transport protein SEC13 homolog B-like [Nelumbo 
nucifera]
Length=301

 Score =   227 bits (579),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 109/134 (81%), Positives = 117/134 (87%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            S APG L G G+ +PVQKL S GCDNTVK+WKL NG WKMDCFPALQMHT WVRDVAWAP
Sbjct  160  STAPGGLVGPGILEPVQKLVSGGCDNTVKIWKLQNGSWKMDCFPALQMHTDWVRDVAWAP  219

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIASAS+DG VVIWTVA+EG++WEGKVL DF TPVWRVSWSLTGN LAV  G+
Sbjct  220  NLGLPKSTIASASQDGTVVIWTVAREGEKWEGKVLKDFKTPVWRVSWSLTGNILAVSDGN  279

Query  283  NNVTLWNEAVDGEW  242
            NNVTLW EAVDGEW
Sbjct  280  NNVTLWKEAVDGEW  293



>ref|XP_011072420.1| PREDICTED: protein transport protein SEC13 homolog B [Sesamum 
indicum]
 ref|XP_011072421.1| PREDICTED: protein transport protein SEC13 homolog B [Sesamum 
indicum]
Length=301

 Score =   227 bits (578),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 110/134 (82%), Positives = 115/134 (86%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            S APGAL GSGL DPVQKLAS GCDNTVKVWK  NG W++DCFPAL MHT WVRDVAWAP
Sbjct  160  STAPGALVGSGLLDPVQKLASGGCDNTVKVWKFDNGTWRLDCFPALSMHTDWVRDVAWAP  219

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIASAS+DGKV+IWT  KEGDQW+GKVL DF  PVWRVSWSLTGN LAV  G 
Sbjct  220  NLGLPKSTIASASQDGKVIIWTAVKEGDQWDGKVLKDFGAPVWRVSWSLTGNILAVADGK  279

Query  283  NNVTLWNEAVDGEW  242
            NNVTLW EAVDGEW
Sbjct  280  NNVTLWKEAVDGEW  293


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 46/124 (37%), Positives = 60/124 (48%), Gaps = 14/124 (11%)
 Frame = -1

Query  595  QKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWA-PNLGLPKSTIASASED  419
            ++LA+   DNT+K+  + N          L  H   V  VAWA P  G   S +AS S D
Sbjct  24   KRLATASSDNTIKIIGVSNS--GSQHLATLTGHQGPVWQVAWAHPKFG---SLLASCSYD  78

Query  418  GKVVIWTVAKEGDQWE---GKVLYDFNTPVWRVSWS--LTGNXLAVXSGDNNVTLWNEAV  254
            GKVVIW   KEG+Q E     V  D    V  +SW+    G  LA  S D N++++    
Sbjct  79   GKVVIW---KEGNQNEWTQAHVFDDHKASVNSISWAPHELGLCLACGSSDGNISVFMARA  135

Query  253  DGEW  242
            DG W
Sbjct  136  DGGW  139



>gb|AFX66988.1| protein transport SEC13-like protein [Solanum tuberosum]
Length=326

 Score =   226 bits (577),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/134 (81%), Positives = 117/134 (87%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            S APG+L GS L +PV KLAS GCDNTVKVWKL++G WK+DCFP LQMHT WVRDVAWAP
Sbjct  160  STAPGSLVGSDLLNPVPKLASGGCDNTVKVWKLFDGTWKLDCFPVLQMHTDWVRDVAWAP  219

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIASASEDG+V+IWTV KEGDQW GKVL DF  PVWRVSWSLTGN LAV  G+
Sbjct  220  NLGLPKSTIASASEDGRVIIWTVGKEGDQWVGKVLKDFGAPVWRVSWSLTGNILAVADGN  279

Query  283  NNVTLWNEAVDGEW  242
            NNVTLWNEAVDGEW
Sbjct  280  NNVTLWNEAVDGEW  293



>ref|XP_006470402.1| PREDICTED: protein SEC13 homolog [Citrus sinensis]
Length=302

 Score =   225 bits (573),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 110/134 (82%), Positives = 117/134 (87%), Gaps = 1/134 (1%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            +MAPGAL G GL DPVQKLAS GCDNTVKVWK+YNG+WKMDCFPALQMH+ WVR VAWAP
Sbjct  160  AMAPGALVGLGLLDPVQKLASCGCDNTVKVWKMYNGIWKMDCFPALQMHSDWVRSVAWAP  219

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIASAS+DG VVIWT AKEG+QWEG+VL DF TPVW VSWSLTGN LAV    
Sbjct  220  NLGLPKSTIASASQDGTVVIWTCAKEGEQWEGRVLKDFKTPVWSVSWSLTGNLLAVADA-  278

Query  283  NNVTLWNEAVDGEW  242
            NNVTLW EAVDGEW
Sbjct  279  NNVTLWKEAVDGEW  292


 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 59/121 (49%), Gaps = 8/121 (7%)
 Frame = -1

Query  595  QKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWA-PNLGLPKSTIASASED  419
            ++LA+   D+++K+  L N   +      L+ H   V  VAWA P  G   S +AS S D
Sbjct  24   KRLATASSDSSIKIIGLSNSASQH--LATLKGHRGPVWQVAWAHPKFG---SILASCSYD  78

Query  418  GKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWS--LTGNXLAVXSGDNNVTLWNEAVDGE  245
            G+V+IW    + D  +     D  + V  ++W+    G  LA  S D N++++    DG 
Sbjct  79   GQVIIWKEGNQNDWTQAHTFNDHKSSVNSIAWAPHELGLSLACGSSDGNISVFTARADGG  138

Query  244  W  242
            W
Sbjct  139  W  139



>gb|KDP40875.1| hypothetical protein JCGZ_24874 [Jatropha curcas]
Length=301

 Score =   225 bits (573),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 109/134 (81%), Positives = 116/134 (87%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            S  PGAL GS L DPVQKL S GCDNTVKVWKL NG+WK+DCFPALQMHT  VRDVAWAP
Sbjct  160  STTPGALVGSSLLDPVQKLCSGGCDNTVKVWKLCNGIWKLDCFPALQMHTDLVRDVAWAP  219

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIASAS+DGKV+IWT AKEG++WEGKVL+DF  PVWRVSWSLTGN LAV  G 
Sbjct  220  NLGLPKSTIASASQDGKVIIWTAAKEGEKWEGKVLHDFKAPVWRVSWSLTGNILAVADGV  279

Query  283  NNVTLWNEAVDGEW  242
            NNVTLW EAVDGEW
Sbjct  280  NNVTLWKEAVDGEW  293



>ref|XP_006446433.1| hypothetical protein CICLE_v10016079mg [Citrus clementina]
 gb|ESR59673.1| hypothetical protein CICLE_v10016079mg [Citrus clementina]
 gb|KDO66291.1| hypothetical protein CISIN_1g022111mg [Citrus sinensis]
Length=302

 Score =   225 bits (573),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 110/134 (82%), Positives = 117/134 (87%), Gaps = 1/134 (1%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            +MAPGAL G GL DPVQKLAS GCDNTVKVWK+YNG+WKMDCFPALQMH+ WVR VAWAP
Sbjct  160  AMAPGALVGLGLLDPVQKLASCGCDNTVKVWKMYNGIWKMDCFPALQMHSDWVRSVAWAP  219

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIASAS+DG VVIWT AKEG+QWEG+VL DF TPVW VSWSLTGN LAV    
Sbjct  220  NLGLPKSTIASASQDGTVVIWTCAKEGEQWEGRVLKDFKTPVWSVSWSLTGNLLAVADA-  278

Query  283  NNVTLWNEAVDGEW  242
            NNVTLW EAVDGEW
Sbjct  279  NNVTLWKEAVDGEW  292


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 59/121 (49%), Gaps = 8/121 (7%)
 Frame = -1

Query  595  QKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWA-PNLGLPKSTIASASED  419
            ++LA+   D+++K+  L N   +      L+ H   V  VAWA P  G   S +AS S D
Sbjct  24   KRLATASSDSSIKIIGLSNSASQH--LATLKGHRGPVWQVAWAHPKFG---SILASCSYD  78

Query  418  GKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWS--LTGNXLAVXSGDNNVTLWNEAVDGE  245
            G+V+IW    + D  +     D  + V  ++W+    G  LA  S D N++++    DG 
Sbjct  79   GQVIIWKEGNQNDWTQAHTFNDHKSSVNSIAWAPHELGLSLACGSSDGNISVFTATADGG  138

Query  244  W  242
            W
Sbjct  139  W  139



>ref|XP_002879246.1| transducin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55505.1| transducin family protein [Arabidopsis lyrata subsp. lyrata]
Length=302

 Score =   224 bits (571),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 110/134 (82%), Positives = 116/134 (87%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            + APGAL  SGL DPV KLAS GCDNTVKVWKL NG WKMDCFPALQ HT WVRDVAWAP
Sbjct  161  ATAPGALVSSGLLDPVYKLASGGCDNTVKVWKLSNGSWKMDCFPALQKHTDWVRDVAWAP  220

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIAS S+DGKV+IWTV KEG+QWEGKVL DF TPVWRVSWSLTGN LAV  G+
Sbjct  221  NLGLPKSTIASGSQDGKVIIWTVGKEGEQWEGKVLKDFMTPVWRVSWSLTGNLLAVSDGN  280

Query  283  NNVTLWNEAVDGEW  242
            NNVT+W EAVDGEW
Sbjct  281  NNVTVWKEAVDGEW  294



>ref|NP_180566.1| transport protein SEC13A [Arabidopsis thaliana]
 sp|O64740.1|SC13B_ARATH RecName: Full=Protein transport protein SEC13 homolog B; AltName: 
Full=SEC13-like protein B [Arabidopsis thaliana]
 gb|AAL06565.1|AF412112_1 At2g30050/F23F1.3 [Arabidopsis thaliana]
 gb|AAC16967.1| putative protein transport protein SEC13 [Arabidopsis thaliana]
 gb|AAM14986.1| putative protein transport protein SEC13 [Arabidopsis thaliana]
 gb|AAM70557.1| At2g30050/F23F1.3 [Arabidopsis thaliana]
 gb|AEC08339.1| transport protein SEC13A [Arabidopsis thaliana]
Length=302

 Score =   224 bits (571),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 110/134 (82%), Positives = 116/134 (87%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            + APGAL  SGL DPV KLAS GCDNTVKVWKL NG WKMDCFPALQ HT WVRDVAWAP
Sbjct  161  ATAPGALVSSGLLDPVYKLASGGCDNTVKVWKLANGSWKMDCFPALQKHTDWVRDVAWAP  220

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIAS S+DGKV+IWTV KEG+QWEGKVL DF TPVWRVSWSLTGN LAV  G+
Sbjct  221  NLGLPKSTIASGSQDGKVIIWTVGKEGEQWEGKVLKDFMTPVWRVSWSLTGNLLAVSDGN  280

Query  283  NNVTLWNEAVDGEW  242
            NNVT+W EAVDGEW
Sbjct  281  NNVTVWKEAVDGEW  294



>emb|CDY10705.1| BnaA05g12310D [Brassica napus]
Length=365

 Score =   226 bits (576),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 110/134 (82%), Positives = 115/134 (86%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            S APGAL  SGL DPV KLAS GCDNTVKVWKL NG WKMDCFPALQ H+ WVRDVAWAP
Sbjct  161  STAPGALVSSGLLDPVYKLASGGCDNTVKVWKLSNGSWKMDCFPALQKHSDWVRDVAWAP  220

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIAS S+DGKVVIWTV KEG+QWEGKVL DF  PVWRVSWSLTGN LAV  G+
Sbjct  221  NLGLPKSTIASGSQDGKVVIWTVGKEGEQWEGKVLNDFKAPVWRVSWSLTGNLLAVSDGN  280

Query  283  NNVTLWNEAVDGEW  242
            NNVT+W EAVDGEW
Sbjct  281  NNVTVWKEAVDGEW  294



>ref|XP_004235651.1| PREDICTED: protein transport protein SEC13 homolog B-like [Solanum 
lycopersicum]
 ref|XP_010318533.1| PREDICTED: protein transport protein SEC13 homolog B-like [Solanum 
lycopersicum]
Length=301

 Score =   224 bits (570),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 107/134 (80%), Positives = 117/134 (87%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            S APG+L GS L + + KLAS GCDNTVKVWK+++G WK+DCFPALQMHT WVRDVAWAP
Sbjct  160  STAPGSLVGSDLLNSIPKLASAGCDNTVKVWKMFDGTWKLDCFPALQMHTDWVRDVAWAP  219

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIASASEDG+V+IWTV KEGDQW GKVL DF  PVWRVSWSLTGN LAV  G+
Sbjct  220  NLGLPKSTIASASEDGRVIIWTVGKEGDQWIGKVLKDFGAPVWRVSWSLTGNILAVADGN  279

Query  283  NNVTLWNEAVDGEW  242
            NNVTLWNEAVDGEW
Sbjct  280  NNVTLWNEAVDGEW  293



>emb|CDY24035.1| BnaC03g16560D [Brassica napus]
Length=301

 Score =   224 bits (570),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 109/134 (81%), Positives = 116/134 (87%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            + APGAL  SGL DPV KLAS GCDNTVKVWKL NG WKMDCFPALQ HT WVRDVAWAP
Sbjct  161  ATAPGALVSSGLLDPVYKLASGGCDNTVKVWKLSNGSWKMDCFPALQKHTDWVRDVAWAP  220

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIAS S+DGKV+IWTV KEG+QWEGKVL DF TPVWRVSWSLTGN LAV  G+
Sbjct  221  NLGLPKSTIASGSQDGKVIIWTVGKEGEQWEGKVLKDFMTPVWRVSWSLTGNMLAVSDGN  280

Query  283  NNVTLWNEAVDGEW  242
            NN+T+W EAVDGEW
Sbjct  281  NNMTVWKEAVDGEW  294



>emb|CDX84863.1| BnaA03g13670D [Brassica napus]
Length=301

 Score =   223 bits (569),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/134 (81%), Positives = 116/134 (87%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            + +PGAL  SGL DPV KLAS GCDNTVKVWKL NG WKMDCFPALQ HT WVRDVAWAP
Sbjct  161  ATSPGALVSSGLLDPVYKLASGGCDNTVKVWKLSNGSWKMDCFPALQKHTDWVRDVAWAP  220

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIAS S+DGKV+IWTV KEG+QWEGK+L DF TPVWRVSWSLTGN LAV  G+
Sbjct  221  NLGLPKSTIASGSQDGKVIIWTVGKEGEQWEGKILKDFMTPVWRVSWSLTGNMLAVSDGN  280

Query  283  NNVTLWNEAVDGEW  242
            NNVT+W EAVDGEW
Sbjct  281  NNVTVWKEAVDGEW  294



>gb|EPS72747.1| hypothetical protein M569_02010 [Genlisea aurea]
Length=301

 Score =   222 bits (565),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 106/134 (79%), Positives = 115/134 (86%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            S APGAL GSG+ +PVQK+AS GCDNTVKVWKLYNG WKMDCFPALQ H+ WVRDVAWAP
Sbjct  160  STAPGALVGSGVSEPVQKIASGGCDNTVKVWKLYNGGWKMDCFPALQKHSDWVRDVAWAP  219

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPK+TIAS SEDG VV+WTVA EGDQWEGKV+ DF   VWRVSWSLTGN LAV SGD
Sbjct  220  NLGLPKTTIASGSEDGTVVVWTVANEGDQWEGKVMKDFKAAVWRVSWSLTGNLLAVASGD  279

Query  283  NNVTLWNEAVDGEW  242
            NNV+LW E  DG+W
Sbjct  280  NNVSLWKEEADGDW  293



>emb|CDY02025.1| BnaC04g14760D [Brassica napus]
Length=303

 Score =   222 bits (565),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 110/134 (82%), Positives = 114/134 (85%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            S APGAL  SGL DPV KLAS GCDNTVKVWKL NG WKMDCFPALQ HT WVR VAWAP
Sbjct  162  STAPGALVSSGLLDPVYKLASGGCDNTVKVWKLSNGSWKMDCFPALQKHTDWVRGVAWAP  221

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIAS S+DGKVVIWTV KEG+QWEGKVL DF  PVWRVSWSLTGN LAV  G+
Sbjct  222  NLGLPKSTIASGSQDGKVVIWTVGKEGEQWEGKVLNDFKAPVWRVSWSLTGNLLAVSDGN  281

Query  283  NNVTLWNEAVDGEW  242
            NNVT+W EAVDGEW
Sbjct  282  NNVTVWKEAVDGEW  295



>ref|XP_009141033.1| PREDICTED: protein SEC13 homolog [Brassica rapa]
Length=301

 Score =   222 bits (565),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 107/134 (80%), Positives = 117/134 (87%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            S APGA+  SGL DPV K+AS GCDNTVKVWKL +G+WKMDCFPALQ H+ WVRDVAWAP
Sbjct  160  STAPGAIVSSGLLDPVYKIASGGCDNTVKVWKLSDGLWKMDCFPALQKHSDWVRDVAWAP  219

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIAS S+DGKV+IWTV KEG+QWEGKVL DF TPVWRVSWSLTGN LAV  G+
Sbjct  220  NLGLPKSTIASGSQDGKVIIWTVGKEGEQWEGKVLKDFMTPVWRVSWSLTGNMLAVSDGN  279

Query  283  NNVTLWNEAVDGEW  242
            NNVT+W EAVDGEW
Sbjct  280  NNVTVWKEAVDGEW  293



>ref|XP_004968630.1| PREDICTED: protein SEC13 homolog [Setaria italica]
Length=305

 Score =   221 bits (563),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 117/137 (85%), Gaps = 3/137 (2%)
 Frame = -1

Query  643  SMAPGALXG---SGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVA  473
            SMAPGAL     SG  + VQKLAS GCDNTVKVWKL NG W+MDCFPALQMH  WVRDVA
Sbjct  161  SMAPGALISAGPSGQYEYVQKLASGGCDNTVKVWKLTNGSWRMDCFPALQMHKDWVRDVA  220

Query  472  WAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVX  293
            WAPNLGLPKST+ASAS+DG VVIWT AKEG+QWEG+VLYDF TPVWR+SWSLTGN LAV 
Sbjct  221  WAPNLGLPKSTMASASQDGTVVIWTAAKEGEQWEGRVLYDFRTPVWRLSWSLTGNILAVS  280

Query  292  SGDNNVTLWNEAVDGEW  242
             G+NNVTLW EAVDGEW
Sbjct  281  DGNNNVTLWKEAVDGEW  297


 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 59/122 (48%), Gaps = 9/122 (7%)
 Frame = -1

Query  595  QKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWA-PNLGLPKSTIASASED  419
            ++LA+   DNT+K+  +     +      L  H   V  VAWA P  G   S +AS S D
Sbjct  24   KRLATASSDNTIKIIGVSGASHQQ--LATLSGHQGPVWQVAWAHPKFG---SMLASCSYD  78

Query  418  GKVVIWTVAKEGDQW-EGKVLYDFNTPVWRVSWSLT--GNXLAVXSGDNNVTLWNEAVDG  248
            G+V+IW    + D+W +     +  + V  ++W+    G  LA  S D N++++    DG
Sbjct  79   GRVIIWKEGSKPDEWAQAHTFVEHKSSVNSIAWAPHELGLSLACGSSDGNISVFTARSDG  138

Query  247  EW  242
             W
Sbjct  139  GW  140



>gb|AAM65095.1| putative protein transport protein SEC13 [Arabidopsis thaliana]
Length=302

 Score =   221 bits (562),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 109/134 (81%), Positives = 115/134 (86%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            + APGAL  SGL DPV KLAS GCDNTVKVWKL NG WKMDCFPALQ HT WVRDVAWAP
Sbjct  161  ATAPGALVSSGLLDPVYKLASGGCDNTVKVWKLANGSWKMDCFPALQKHTDWVRDVAWAP  220

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIAS S+DGKV+IWTV KEG+QWEGKVL DF TPVWRVS SLTGN LAV  G+
Sbjct  221  NLGLPKSTIASGSQDGKVIIWTVGKEGEQWEGKVLKDFMTPVWRVSSSLTGNLLAVSDGN  280

Query  283  NNVTLWNEAVDGEW  242
            NNVT+W EAVDGEW
Sbjct  281  NNVTVWKEAVDGEW  294



>ref|XP_004302867.1| PREDICTED: protein transport protein SEC13 homolog A-like isoform 
X3 [Fragaria vesca subsp. vesca]
Length=300

 Score =   220 bits (561),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 106/134 (79%), Positives = 114/134 (85%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            S APGAL GSGL D VQKL S GCDNTVK+WKL NG WKMDCFPALQ H  WVRDVAWAP
Sbjct  159  STAPGALVGSGLLDTVQKLCSGGCDNTVKIWKLTNGAWKMDCFPALQKHDDWVRDVAWAP  218

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKST+ASAS+DGKV+IWTVAK+GD+WE KVL+DF  PVWRVSWSLTGN LAV  G+
Sbjct  219  NLGLPKSTVASASQDGKVIIWTVAKDGDKWEHKVLHDFKAPVWRVSWSLTGNILAVSDGN  278

Query  283  NNVTLWNEAVDGEW  242
            N VTLW E VDGEW
Sbjct  279  NKVTLWKEEVDGEW  292



>ref|NP_001045820.1| Os02g0135800 [Oryza sativa Japonica Group]
 dbj|BAB83081.1| Sec13p [Oryza sativa]
 dbj|BAD10362.1| Sec13p [Oryza sativa Japonica Group]
 dbj|BAF07734.1| Os02g0135800 [Oryza sativa Japonica Group]
 gb|EAY84386.1| hypothetical protein OsI_05762 [Oryza sativa Indica Group]
 gb|EAZ21659.1| hypothetical protein OsJ_05292 [Oryza sativa Japonica Group]
 dbj|BAG99387.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99519.1| unnamed protein product [Oryza sativa Japonica Group]
Length=305

 Score =   220 bits (561),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 108/137 (79%), Positives = 117/137 (85%), Gaps = 3/137 (2%)
 Frame = -1

Query  643  SMAPGALXG---SGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVA  473
            +MAPGAL     SG  + VQKLAS GCDNTVKVWKLYNG W+MDCFPALQMH  WVRDVA
Sbjct  161  AMAPGALINTGPSGQFEYVQKLASGGCDNTVKVWKLYNGSWRMDCFPALQMHRDWVRDVA  220

Query  472  WAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVX  293
            WAPNLGLPKSTIASAS+DG VVIWT  KEG+QWEG+VLYDF TPVWR+SWSLTGN LAV 
Sbjct  221  WAPNLGLPKSTIASASQDGTVVIWTAPKEGEQWEGRVLYDFQTPVWRLSWSLTGNILAVS  280

Query  292  SGDNNVTLWNEAVDGEW  242
             G++NVTLW EAVDGEW
Sbjct  281  DGNDNVTLWKEAVDGEW  297



>ref|XP_010469902.1| PREDICTED: protein transport protein SEC13 homolog B [Camelina 
sativa]
Length=302

 Score =   220 bits (561),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 108/134 (81%), Positives = 115/134 (86%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            + APGAL  SGL DPV KLAS GCDNTVKVWKL NG WKMDCFPALQ HT WVRDVAWAP
Sbjct  161  ATAPGALVSSGLLDPVYKLASGGCDNTVKVWKLSNGSWKMDCFPALQKHTDWVRDVAWAP  220

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIAS S+DGKV+IWTV KE +QWEGKVL DF TPVWRVSWSLTGN LAV  G+
Sbjct  221  NLGLPKSTIASGSQDGKVIIWTVGKEDEQWEGKVLKDFMTPVWRVSWSLTGNLLAVSDGN  280

Query  283  NNVTLWNEAVDGEW  242
            NNVT+W E+VDGEW
Sbjct  281  NNVTVWKESVDGEW  294



>ref|XP_006646853.1| PREDICTED: protein SEC13 homolog [Oryza brachyantha]
Length=305

 Score =   220 bits (561),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 108/137 (79%), Positives = 117/137 (85%), Gaps = 3/137 (2%)
 Frame = -1

Query  643  SMAPGALXGSG---LXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVA  473
            +MAPGAL  SG     + VQKLAS GCDNTVKVWKLYNG W++DCFPALQMH  WVRDVA
Sbjct  161  AMAPGALINSGPSGQFEYVQKLASGGCDNTVKVWKLYNGSWRLDCFPALQMHKDWVRDVA  220

Query  472  WAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVX  293
            WAPNLGLPKSTIASAS+DG VVIWT  KEG+QWEG+VLYDF TPVWR+SWSLTGN LAV 
Sbjct  221  WAPNLGLPKSTIASASQDGTVVIWTAPKEGEQWEGRVLYDFQTPVWRLSWSLTGNILAVS  280

Query  292  SGDNNVTLWNEAVDGEW  242
             G+NNVTLW EAVDGEW
Sbjct  281  DGNNNVTLWKEAVDGEW  297



>gb|AGT16309.1| SEC13-related protein [Saccharum hybrid cultivar R570]
 gb|AGT16328.1| SEC13-related protein [Saccharum hybrid cultivar R570]
Length=305

 Score =   220 bits (561),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 117/137 (85%), Gaps = 3/137 (2%)
 Frame = -1

Query  643  SMAPGALXG---SGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVA  473
            +MAPGAL     SG  + VQKLAS GCDNTVKVWKL NG W+MDCFPALQMH  WVRDVA
Sbjct  161  AMAPGALISAGSSGQFEYVQKLASGGCDNTVKVWKLNNGSWRMDCFPALQMHKDWVRDVA  220

Query  472  WAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVX  293
            WAPNLGLPKSTIASAS+DG VVIWT AKEG+QWEG+VLYDF TPVWR+SWSLTGN LAV 
Sbjct  221  WAPNLGLPKSTIASASQDGTVVIWTAAKEGEQWEGRVLYDFRTPVWRLSWSLTGNILAVS  280

Query  292  SGDNNVTLWNEAVDGEW  242
             G+NNVTLW EAVDGEW
Sbjct  281  DGNNNVTLWKEAVDGEW  297



>ref|XP_010510416.1| PREDICTED: protein transport protein SEC13 homolog B-like [Camelina 
sativa]
Length=302

 Score =   220 bits (560),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 108/134 (81%), Positives = 115/134 (86%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            + APGAL  SGL DPV KLAS GCDNTVKVWKL NG WKMDCFPALQ HT WVRDVAWAP
Sbjct  161  ATAPGALVSSGLFDPVYKLASGGCDNTVKVWKLSNGSWKMDCFPALQKHTDWVRDVAWAP  220

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIAS S+DGKV+IWTV KE +QWEGKVL DF TPVWRVSWSLTGN LAV  G+
Sbjct  221  NLGLPKSTIASGSQDGKVIIWTVGKEDEQWEGKVLKDFMTPVWRVSWSLTGNLLAVSDGN  280

Query  283  NNVTLWNEAVDGEW  242
            NNVT+W E+VDGEW
Sbjct  281  NNVTVWKESVDGEW  294



>ref|XP_006294683.1| hypothetical protein CARUB_v10023720mg [Capsella rubella]
 gb|EOA27581.1| hypothetical protein CARUB_v10023720mg [Capsella rubella]
Length=302

 Score =   220 bits (560),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 107/134 (80%), Positives = 115/134 (86%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            + APGAL  SGL DPV KLAS GCDNTVKVWKL NG WKMDCFPALQ HT WVRDVAWAP
Sbjct  161  ATAPGALVSSGLQDPVYKLASGGCDNTVKVWKLSNGSWKMDCFPALQKHTDWVRDVAWAP  220

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIAS S+DGKV+IWT+ KEG+QWEG VL DF TPVWRVSWSLTGN LAV  G+
Sbjct  221  NLGLPKSTIASGSQDGKVIIWTMGKEGEQWEGTVLKDFMTPVWRVSWSLTGNLLAVSDGN  280

Query  283  NNVTLWNEAVDGEW  242
            NNVT+W E+VDGEW
Sbjct  281  NNVTVWKESVDGEW  294



>ref|XP_006646846.1| PREDICTED: protein SEC13 homolog [Oryza brachyantha]
Length=305

 Score =   220 bits (560),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 108/137 (79%), Positives = 117/137 (85%), Gaps = 3/137 (2%)
 Frame = -1

Query  643  SMAPGALXGSG---LXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVA  473
            +MAPGAL  SG     + VQKLAS GCDNTVKVWKLYNG W++DCFPALQMH  WVRDVA
Sbjct  161  AMAPGALINSGPSGQFEYVQKLASGGCDNTVKVWKLYNGSWRLDCFPALQMHKDWVRDVA  220

Query  472  WAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVX  293
            WAPNLGLPKSTIASAS+DG VVIWT  KEG+QWEG+VLYDF TPVWR+SWSLTGN LAV 
Sbjct  221  WAPNLGLPKSTIASASQDGTVVIWTAPKEGEQWEGQVLYDFQTPVWRLSWSLTGNILAVS  280

Query  292  SGDNNVTLWNEAVDGEW  242
             G+NNVTLW EAVDGEW
Sbjct  281  DGNNNVTLWKEAVDGEW  297



>ref|XP_010414320.1| PREDICTED: protein transport protein SEC13 homolog B-like [Camelina 
sativa]
Length=354

 Score =   221 bits (564),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 108/134 (81%), Positives = 115/134 (86%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            + APGAL  SGL DPV KLAS GCDNTVKVWKL NG WKMDCFPALQ HT WVRDVAWAP
Sbjct  213  ATAPGALVSSGLLDPVYKLASGGCDNTVKVWKLSNGSWKMDCFPALQKHTDWVRDVAWAP  272

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIAS S+DGKV+IWTV KE +QWEGKVL DF TPVWRVSWSLTGN LAV  G+
Sbjct  273  NLGLPKSTIASGSQDGKVIIWTVGKEDEQWEGKVLKDFMTPVWRVSWSLTGNLLAVSDGN  332

Query  283  NNVTLWNEAVDGEW  242
            NNVT+W E+VDGEW
Sbjct  333  NNVTVWKESVDGEW  346



>emb|CDX97854.1| BnaC04g40850D [Brassica napus]
Length=301

 Score =   220 bits (560),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 107/134 (80%), Positives = 115/134 (86%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            S  PGAL  SGL DPV KLAS GCDNTVKVWKL +G+WKMDCFPALQ H+ WVRDVAWAP
Sbjct  160  STVPGALVSSGLLDPVYKLASGGCDNTVKVWKLSDGLWKMDCFPALQKHSDWVRDVAWAP  219

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIAS S+DGKV+IWTV KEG+QWEGKVL DF  PVWRVSWSLTGN LAV  G+
Sbjct  220  NLGLPKSTIASGSQDGKVIIWTVGKEGEQWEGKVLKDFLAPVWRVSWSLTGNMLAVSDGN  279

Query  283  NNVTLWNEAVDGEW  242
            NNVT+W EAVDGEW
Sbjct  280  NNVTVWKEAVDGEW  293



>ref|XP_011466664.1| PREDICTED: protein transport protein SEC13 homolog A-like isoform 
X2 [Fragaria vesca subsp. vesca]
Length=312

 Score =   220 bits (560),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 106/134 (79%), Positives = 114/134 (85%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            S APGAL GSGL D VQKL S GCDNTVK+WKL NG WKMDCFPALQ H  WVRDVAWAP
Sbjct  159  STAPGALVGSGLLDTVQKLCSGGCDNTVKIWKLTNGAWKMDCFPALQKHDDWVRDVAWAP  218

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKST+ASAS+DGKV+IWTVAK+GD+WE KVL+DF  PVWRVSWSLTGN LAV  G+
Sbjct  219  NLGLPKSTVASASQDGKVIIWTVAKDGDKWEHKVLHDFKAPVWRVSWSLTGNILAVSDGN  278

Query  283  NNVTLWNEAVDGEW  242
            N VTLW E VDGEW
Sbjct  279  NKVTLWKEEVDGEW  292



>ref|XP_002454939.1| hypothetical protein SORBIDRAFT_03g001760 [Sorghum bicolor]
 gb|EES00059.1| hypothetical protein SORBIDRAFT_03g001760 [Sorghum bicolor]
Length=305

 Score =   220 bits (560),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 117/137 (85%), Gaps = 3/137 (2%)
 Frame = -1

Query  643  SMAPGALXG---SGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVA  473
            +MAPGAL     SG  + VQKLAS GCDNTVKVWKL NG W+MDCFPALQMH  WVRDVA
Sbjct  161  AMAPGALISAGSSGQFEYVQKLASGGCDNTVKVWKLNNGSWRMDCFPALQMHKDWVRDVA  220

Query  472  WAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVX  293
            WAPNLGLPKSTIASAS+DG VVIWT AKEG+QWEG+VLYDF TPVWR+SWSLTGN LAV 
Sbjct  221  WAPNLGLPKSTIASASQDGTVVIWTAAKEGEQWEGQVLYDFRTPVWRLSWSLTGNILAVS  280

Query  292  SGDNNVTLWNEAVDGEW  242
             G+NNVTLW EAVDGEW
Sbjct  281  DGNNNVTLWKEAVDGEW  297



>ref|NP_001150249.1| SEC13-related protein [Zea mays]
 gb|ACG38366.1| SEC13-related protein [Zea mays]
 gb|AFW80398.1| SEC13 protein isoform 1 [Zea mays]
 gb|AFW80399.1| SEC13 protein isoform 2 [Zea mays]
Length=305

 Score =   219 bits (559),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 108/137 (79%), Positives = 117/137 (85%), Gaps = 3/137 (2%)
 Frame = -1

Query  643  SMAPGALXG---SGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVA  473
            +MAPGAL     SG  + VQKLAS GCDNTVKVWKL NG W+MDCFPALQMH  WVRDVA
Sbjct  161  AMAPGALISAGSSGQFEYVQKLASGGCDNTVKVWKLNNGSWRMDCFPALQMHKDWVRDVA  220

Query  472  WAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVX  293
            WAPNLGLPKSTIASAS+DG VVIWT AKEG+QWEG++LYDF TPVWR+SWSLTGN LAV 
Sbjct  221  WAPNLGLPKSTIASASQDGTVVIWTAAKEGEQWEGRLLYDFRTPVWRLSWSLTGNILAVS  280

Query  292  SGDNNVTLWNEAVDGEW  242
             G+NNVTLW EAVDGEW
Sbjct  281  DGNNNVTLWKEAVDGEW  297



>ref|XP_011466663.1| PREDICTED: protein transport protein SEC13 homolog A-like isoform 
X1 [Fragaria vesca subsp. vesca]
Length=313

 Score =   219 bits (559),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 106/134 (79%), Positives = 114/134 (85%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            S APGAL GSGL D VQKL S GCDNTVK+WKL NG WKMDCFPALQ H  WVRDVAWAP
Sbjct  159  STAPGALVGSGLLDTVQKLCSGGCDNTVKIWKLTNGAWKMDCFPALQKHDDWVRDVAWAP  218

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKST+ASAS+DGKV+IWTVAK+GD+WE KVL+DF  PVWRVSWSLTGN LAV  G+
Sbjct  219  NLGLPKSTVASASQDGKVIIWTVAKDGDKWEHKVLHDFKAPVWRVSWSLTGNILAVSDGN  278

Query  283  NNVTLWNEAVDGEW  242
            N VTLW E VDGEW
Sbjct  279  NKVTLWKEEVDGEW  292



>gb|AGT17401.1| SEC13-related protein [Saccharum hybrid cultivar R570]
Length=305

 Score =   219 bits (558),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 108/137 (79%), Positives = 117/137 (85%), Gaps = 3/137 (2%)
 Frame = -1

Query  643  SMAPGALXGSG---LXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVA  473
            +MAPGAL  +G     + VQKLAS GCDNTVKVWKL NG W+MDCFPALQMH  WVRDVA
Sbjct  161  AMAPGALISAGSSSQFEYVQKLASGGCDNTVKVWKLNNGSWRMDCFPALQMHKDWVRDVA  220

Query  472  WAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVX  293
            WAPNLGLPKSTIASAS+DG VVIWT AKEG+QWEG+VLYDF TPVWR+SWSLTGN LAV 
Sbjct  221  WAPNLGLPKSTIASASQDGTVVIWTAAKEGEQWEGRVLYDFRTPVWRLSWSLTGNILAVS  280

Query  292  SGDNNVTLWNEAVDGEW  242
             G+NNVTLW EAVDGEW
Sbjct  281  DGNNNVTLWKEAVDGEW  297



>gb|ACG46695.1| SEC13-related protein [Zea mays]
 gb|ACL54360.1| unknown [Zea mays]
 gb|AFW61900.1| SEC13 protein [Zea mays]
 gb|AFW69101.1| SEC13 protein [Zea mays]
 tpg|DAA52845.1| TPA: SEC13 protein [Zea mays]
Length=305

 Score =   219 bits (557),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 108/137 (79%), Positives = 117/137 (85%), Gaps = 3/137 (2%)
 Frame = -1

Query  643  SMAPGALXG---SGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVA  473
            +MAPGAL     SG  + VQKLAS GCDNTVKVWKL NG W+MDCFPALQMH  WVRDVA
Sbjct  161  AMAPGALISAGSSGQFEYVQKLASGGCDNTVKVWKLNNGSWRMDCFPALQMHKDWVRDVA  220

Query  472  WAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVX  293
            WAPNLGLPKSTIASAS+DG VVIWT AKEG+QW+G+VLYDF TPVWR+SWSLTGN LAV 
Sbjct  221  WAPNLGLPKSTIASASQDGTVVIWTAAKEGEQWDGRVLYDFRTPVWRLSWSLTGNILAVS  280

Query  292  SGDNNVTLWNEAVDGEW  242
             G+NNVTLW EAVDGEW
Sbjct  281  DGNNNVTLWKEAVDGEW  297



>ref|NP_001149004.1| SEC13-related protein [Zea mays]
 gb|ACG33776.1| SEC13-related protein [Zea mays]
Length=305

 Score =   219 bits (557),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 108/137 (79%), Positives = 117/137 (85%), Gaps = 3/137 (2%)
 Frame = -1

Query  643  SMAPGALXG---SGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVA  473
            +MAPGAL     SG  + VQKLAS GCDNTVKVWKL NG W+MDCFPALQMH  WVRDVA
Sbjct  161  AMAPGALISAGSSGQFEYVQKLASGGCDNTVKVWKLNNGSWRMDCFPALQMHKDWVRDVA  220

Query  472  WAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVX  293
            WAPNLGLPKSTIASAS+DG VVIWT AKEG+QW+G+VLYDF TPVWR+SWSLTGN LAV 
Sbjct  221  WAPNLGLPKSTIASASQDGTVVIWTAAKEGEQWDGRVLYDFRTPVWRLSWSLTGNILAVS  280

Query  292  SGDNNVTLWNEAVDGEW  242
             G+NNVTLW EAVDGEW
Sbjct  281  DGNNNVTLWKEAVDGEW  297



>gb|ACN59487.1| SEC13 [Triticum aestivum]
Length=306

 Score =   216 bits (550),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 108/137 (79%), Positives = 115/137 (84%), Gaps = 3/137 (2%)
 Frame = -1

Query  643  SMAPGALXG---SGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVA  473
            +MAPGAL     SG  + VQKLAS GCDNTVKVWKL NG W+MDCFPALQMH  WVRDVA
Sbjct  162  AMAPGALISPGPSGQFEYVQKLASGGCDNTVKVWKLTNGSWRMDCFPALQMHRDWVRDVA  221

Query  472  WAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVX  293
            WAPNLGLPKSTIASAS+DG VVIWT  KEG+QWEG+VL DF TPVWRVSWSLTGN LAV 
Sbjct  222  WAPNLGLPKSTIASASQDGTVVIWTAPKEGEQWEGRVLNDFRTPVWRVSWSLTGNILAVS  281

Query  292  SGDNNVTLWNEAVDGEW  242
             G+NNVTLW EAVDGEW
Sbjct  282  DGNNNVTLWKEAVDGEW  298



>gb|EMT07862.1| hypothetical protein F775_17938 [Aegilops tauschii]
Length=305

 Score =   216 bits (550),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 108/137 (79%), Positives = 115/137 (84%), Gaps = 3/137 (2%)
 Frame = -1

Query  643  SMAPGALXG---SGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVA  473
            SMAPGAL     SG  + VQKLAS GCDNTVKVWKL NG W+MDCFPALQMH  WVRDVA
Sbjct  161  SMAPGALISPGPSGQFEYVQKLASGGCDNTVKVWKLTNGSWRMDCFPALQMHRDWVRDVA  220

Query  472  WAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVX  293
            WAPNLGLPKSTIASAS+DG VVIWT  KEG+QWEG+VL DF TPVWR+SWSLTGN LAV 
Sbjct  221  WAPNLGLPKSTIASASQDGTVVIWTAPKEGEQWEGRVLNDFRTPVWRLSWSLTGNILAVS  280

Query  292  SGDNNVTLWNEAVDGEW  242
             G+NNVTLW EAVDGEW
Sbjct  281  DGNNNVTLWKEAVDGEW  297



>dbj|BAJ89756.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ98585.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=305

 Score =   216 bits (550),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 108/137 (79%), Positives = 115/137 (84%), Gaps = 3/137 (2%)
 Frame = -1

Query  643  SMAPGALXG---SGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVA  473
            +MAPGAL     SG  + VQKLAS GCDNTVKVWKL NG W+MDCFPALQMH  WVRDVA
Sbjct  161  AMAPGALISPGPSGQFEYVQKLASGGCDNTVKVWKLTNGSWRMDCFPALQMHRDWVRDVA  220

Query  472  WAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVX  293
            WAPNLGLPKSTIASAS+DG VVIWT  KEG+QWEG+VL DF TPVWRVSWSLTGN LAV 
Sbjct  221  WAPNLGLPKSTIASASQDGTVVIWTAPKEGEQWEGRVLNDFRTPVWRVSWSLTGNILAVS  280

Query  292  SGDNNVTLWNEAVDGEW  242
             G+NNVTLW EAVDGEW
Sbjct  281  DGNNNVTLWKEAVDGEW  297



>ref|NP_186783.1| transport protein SEC13B [Arabidopsis thaliana]
 ref|NP_001030616.1| transport protein SEC13B [Arabidopsis thaliana]
 sp|Q9SRI1.1|SC13A_ARATH RecName: Full=Protein transport protein SEC13 homolog A; AltName: 
Full=SEC13-like protein A [Arabidopsis thaliana]
 gb|AAF03492.1|AC010676_2 putative protein transport protein SEC13 [Arabidopsis thaliana]
 gb|AAK44077.1|AF370262_1 putative transport protein SEC13 [Arabidopsis thaliana]
 gb|AAL34253.1| putative transport protein SEC13 [Arabidopsis thaliana]
 gb|AEE73651.1| transport protein SEC13B [Arabidopsis thaliana]
 gb|AEE73652.1| transport protein SEC13B [Arabidopsis thaliana]
Length=302

 Score =   216 bits (549),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 111/131 (85%), Gaps = 0/131 (0%)
 Frame = -1

Query  634  PGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAPNLG  455
            PGAL  SG+ DPV KLAS GCD+TVKVWK  NG WKMDCFPAL  HT WVRDVAWAPNLG
Sbjct  164  PGALVSSGMIDPVYKLASGGCDSTVKVWKFSNGSWKMDCFPALNKHTDWVRDVAWAPNLG  223

Query  454  LPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGDNNV  275
            LPKSTIAS SEDGKV+IWT+ KEG+QWEG VL DF TPVWRVSWSLTGN LAV  G+NNV
Sbjct  224  LPKSTIASGSEDGKVIIWTIGKEGEQWEGTVLKDFKTPVWRVSWSLTGNLLAVSDGNNNV  283

Query  274  TLWNEAVDGEW  242
            T+W E+VDGEW
Sbjct  284  TVWKESVDGEW  294



>ref|XP_006410057.1| hypothetical protein EUTSA_v10016789mg [Eutrema salsugineum]
 gb|ESQ51510.1| hypothetical protein EUTSA_v10016789mg [Eutrema salsugineum]
Length=384

 Score =   218 bits (554),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 105/134 (78%), Positives = 114/134 (85%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            + APGAL  SG  DPV KLAS GCD+TVKVWKL NG WKMDC+P L+ HT WVRDVAWAP
Sbjct  243  ATAPGALVSSGSLDPVYKLASGGCDDTVKVWKLTNGSWKMDCYPGLKKHTDWVRDVAWAP  302

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIAS S+DGKV+IWTV KEG+QWEGKVL DF TPVWRVSWSLTGN LAV  G+
Sbjct  303  NLGLPKSTIASGSQDGKVIIWTVGKEGEQWEGKVLKDFMTPVWRVSWSLTGNLLAVSDGN  362

Query  283  NNVTLWNEAVDGEW  242
            NNVT+W EAVDGEW
Sbjct  363  NNVTVWKEAVDGEW  376



>gb|EMS54340.1| Protein SEC13-like protein [Triticum urartu]
Length=305

 Score =   215 bits (547),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 107/137 (78%), Positives = 115/137 (84%), Gaps = 3/137 (2%)
 Frame = -1

Query  643  SMAPGALXG---SGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVA  473
            +MAPGAL     SG  + VQKLAS GCDNTVKVWKL NG W+MDCFPALQMH  WVRDVA
Sbjct  161  AMAPGALISPGPSGQFEYVQKLASGGCDNTVKVWKLTNGSWRMDCFPALQMHRDWVRDVA  220

Query  472  WAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVX  293
            WAPNLGLPKSTIASAS+DG VVIWT  KEG+QWEG+VL DF TPVWR+SWSLTGN LAV 
Sbjct  221  WAPNLGLPKSTIASASQDGTVVIWTAPKEGEQWEGRVLNDFRTPVWRLSWSLTGNILAVS  280

Query  292  SGDNNVTLWNEAVDGEW  242
             G+NNVTLW EAVDGEW
Sbjct  281  DGNNNVTLWKEAVDGEW  297



>emb|CDY29706.1| BnaA04g17210D [Brassica napus]
Length=690

 Score =   224 bits (571),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 107/134 (80%), Positives = 117/134 (87%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            S APGA+  SGL DPV K+AS GCDNTVKVWKL +G+WKMDCFPALQ H+ WVRDVAWAP
Sbjct  549  STAPGAIVSSGLLDPVYKIASGGCDNTVKVWKLSDGLWKMDCFPALQKHSDWVRDVAWAP  608

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIAS S+DGKV+IWTV KEG+QWEGKVL DF TPVWRVSWSLTGN LAV  G+
Sbjct  609  NLGLPKSTIASGSQDGKVIIWTVGKEGEQWEGKVLKDFMTPVWRVSWSLTGNMLAVSDGN  668

Query  283  NNVTLWNEAVDGEW  242
            NNVT+W EAVDGEW
Sbjct  669  NNVTVWKEAVDGEW  682



>gb|EYU21504.1| hypothetical protein MIMGU_mgv1a010808mg [Erythranthe guttata]
Length=301

 Score =   215 bits (547),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 104/132 (79%), Positives = 110/132 (83%), Gaps = 0/132 (0%)
 Frame = -1

Query  637  APGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAPNL  458
            APG+L      +PVQKL S GCDNTVKVWK  NG W+MDCFPAL+MHT WVRDVAWAPNL
Sbjct  162  APGSLVDFSQLEPVQKLVSGGCDNTVKVWKFENGAWRMDCFPALKMHTDWVRDVAWAPNL  221

Query  457  GLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGDNN  278
            GLPKSTIAS S+DGKV+IWT AKEGDQWEGKVL DF  PVWRVSWSLTGN LAV  G NN
Sbjct  222  GLPKSTIASCSQDGKVLIWTAAKEGDQWEGKVLKDFGGPVWRVSWSLTGNILAVADGKNN  281

Query  277  VTLWNEAVDGEW  242
            VTLW EAVDGEW
Sbjct  282  VTLWKEAVDGEW  293



>ref|XP_006410056.1| hypothetical protein EUTSA_v10016789mg [Eutrema salsugineum]
 gb|ESQ51509.1| hypothetical protein EUTSA_v10016789mg [Eutrema salsugineum]
Length=383

 Score =   217 bits (553),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 105/134 (78%), Positives = 114/134 (85%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            + APGAL  SG  DPV KLAS GCD+TVKVWKL NG WKMDC+P L+ HT WVRDVAWAP
Sbjct  242  ATAPGALVSSGSLDPVYKLASGGCDDTVKVWKLTNGSWKMDCYPGLKKHTDWVRDVAWAP  301

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIAS S+DGKV+IWTV KEG+QWEGKVL DF TPVWRVSWSLTGN LAV  G+
Sbjct  302  NLGLPKSTIASGSQDGKVIIWTVGKEGEQWEGKVLKDFMTPVWRVSWSLTGNLLAVSDGN  361

Query  283  NNVTLWNEAVDGEW  242
            NNVT+W EAVDGEW
Sbjct  362  NNVTVWKEAVDGEW  375



>ref|XP_006854548.1| hypothetical protein AMTR_s00030p00063600 [Amborella trichopoda]
 gb|ERN16015.1| hypothetical protein AMTR_s00030p00063600 [Amborella trichopoda]
Length=306

 Score =   214 bits (546),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 105/135 (78%), Positives = 116/135 (86%), Gaps = 1/135 (1%)
 Frame = -1

Query  643  SMAPGALXG-SGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWA  467
            ++ PG+L G +   + VQKLAS GCDNTVK+WKLYNG W+MDCFPALQMH  WVRDVAWA
Sbjct  164  AILPGSLVGPNSGGEIVQKLASCGCDNTVKIWKLYNGTWRMDCFPALQMHVDWVRDVAWA  223

Query  466  PNLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSG  287
            PNLGLPKSTIASAS+DG VVIWTV KEG++WEGKVL DF TPVWRVSWSLTGN LAV  G
Sbjct  224  PNLGLPKSTIASASQDGTVVIWTVGKEGEKWEGKVLKDFKTPVWRVSWSLTGNLLAVADG  283

Query  286  DNNVTLWNEAVDGEW  242
            +NNVTLW EAVDGEW
Sbjct  284  NNNVTLWKEAVDGEW  298



>gb|ABK26393.1| unknown [Picea sitchensis]
Length=283

 Score =   213 bits (543),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 103/132 (78%), Positives = 110/132 (83%), Gaps = 1/132 (1%)
 Frame = -1

Query  637  APGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAPNL  458
            APG+L G    DP+QKL S GCDNT KVWK YNG WK+DCFP LQMHT WVRDVAWAPNL
Sbjct  146  APGSLVGQP-SDPIQKLVSGGCDNTAKVWKFYNGSWKLDCFPPLQMHTDWVRDVAWAPNL  204

Query  457  GLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGDNN  278
            GLPKSTIAS S+DGKV IWT  KEGD+WEGK+L DF TPVWRVSWSLTGN LAV  G+NN
Sbjct  205  GLPKSTIASCSQDGKVAIWTQGKEGDKWEGKILNDFKTPVWRVSWSLTGNILAVADGNNN  264

Query  277  VTLWNEAVDGEW  242
            VTLW EAVDGEW
Sbjct  265  VTLWKEAVDGEW  276



>ref|XP_006408491.1| hypothetical protein EUTSA_v10021223mg [Eutrema salsugineum]
 gb|ESQ49944.1| hypothetical protein EUTSA_v10021223mg [Eutrema salsugineum]
Length=302

 Score =   214 bits (545),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 102/131 (78%), Positives = 111/131 (85%), Gaps = 0/131 (0%)
 Frame = -1

Query  634  PGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAPNLG  455
            PGAL  SG+ +PV KLAS GCD+ VKVW+  NG WKMDCFPAL  HT WVRDVAWAPNLG
Sbjct  164  PGALVSSGMQEPVYKLASGGCDSKVKVWRFANGSWKMDCFPALDKHTDWVRDVAWAPNLG  223

Query  454  LPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGDNNV  275
            LPKSTIAS SEDGKV+IWT+ KEG+QWEGKVL DF TPVWRVSWSLTGN LAV  G+NNV
Sbjct  224  LPKSTIASGSEDGKVIIWTIGKEGEQWEGKVLKDFKTPVWRVSWSLTGNLLAVSDGNNNV  283

Query  274  TLWNEAVDGEW  242
            T+W EAVDGEW
Sbjct  284  TVWKEAVDGEW  294



>gb|ABK22893.1| unknown [Picea sitchensis]
Length=322

 Score =   214 bits (546),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 103/132 (78%), Positives = 110/132 (83%), Gaps = 1/132 (1%)
 Frame = -1

Query  637  APGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAPNL  458
            APG+L G    DP+QKL S GCDNT KVWK YNG WK+DCFP LQMHT WVRDVAWAPNL
Sbjct  171  APGSLVGQP-SDPIQKLVSGGCDNTAKVWKFYNGSWKLDCFPPLQMHTDWVRDVAWAPNL  229

Query  457  GLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGDNN  278
            GLPKSTIAS S+DGKV IWT  KEGD+WEGK+L DF TPVWRVSWSLTGN LAV  G+NN
Sbjct  230  GLPKSTIASCSQDGKVAIWTQGKEGDKWEGKILNDFKTPVWRVSWSLTGNILAVADGNNN  289

Query  277  VTLWNEAVDGEW  242
            VTLW EAVDGEW
Sbjct  290  VTLWKEAVDGEW  301



>emb|CDY49046.1| BnaC05g48740D [Brassica napus]
Length=302

 Score =   214 bits (544),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 102/131 (78%), Positives = 110/131 (84%), Gaps = 0/131 (0%)
 Frame = -1

Query  634  PGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAPNLG  455
            PGAL  SG+ +PV KLAS GCD+TVKVWK  NG WKMDCFPAL  H  WVRDVAWAPNLG
Sbjct  164  PGALVSSGMHEPVYKLASGGCDSTVKVWKFANGSWKMDCFPALHKHKDWVRDVAWAPNLG  223

Query  454  LPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGDNNV  275
            LPKSTIAS SEDG V+IWTV KEG+QWEGKVL DF TPVWRV+WSLTGN LAV  G+NNV
Sbjct  224  LPKSTIASGSEDGSVIIWTVGKEGEQWEGKVLKDFKTPVWRVTWSLTGNLLAVSDGNNNV  283

Query  274  TLWNEAVDGEW  242
            T+W EAVDGEW
Sbjct  284  TVWKEAVDGEW  294



>ref|XP_003565584.1| PREDICTED: protein transport protein SEC13 homolog B-like [Brachypodium 
distachyon]
 ref|XP_010230618.1| PREDICTED: protein transport protein SEC13 homolog B-like [Brachypodium 
distachyon]
Length=305

 Score =   213 bits (543),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 106/137 (77%), Positives = 115/137 (84%), Gaps = 3/137 (2%)
 Frame = -1

Query  643  SMAPGALXG---SGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVA  473
            +MAPGAL     SG  + VQKL+S GCDNTVKVWKL NG W+MDCFPALQMH  WVRDVA
Sbjct  161  AMAPGALISPGPSGQFEYVQKLSSGGCDNTVKVWKLTNGNWRMDCFPALQMHRDWVRDVA  220

Query  472  WAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVX  293
            WAPNLGLPKSTIASAS+DG VVIWT  KEG+QWEG+VL DF TPVWR+SWSLTGN LAV 
Sbjct  221  WAPNLGLPKSTIASASQDGTVVIWTAPKEGEQWEGRVLNDFRTPVWRLSWSLTGNILAVS  280

Query  292  SGDNNVTLWNEAVDGEW  242
             G+NNVTLW EAVDGEW
Sbjct  281  DGNNNVTLWKEAVDGEW  297



>ref|XP_004956945.1| PREDICTED: protein SEC13 homolog [Setaria italica]
Length=305

 Score =   213 bits (542),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 105/137 (77%), Positives = 115/137 (84%), Gaps = 3/137 (2%)
 Frame = -1

Query  643  SMAPGALXG---SGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVA  473
            +MAPGAL     SG  + VQKLAS GCDNTVKVWKL NG W+MDCFPALQMH  WVRDVA
Sbjct  161  AMAPGALITAGPSGQFEYVQKLASGGCDNTVKVWKLQNGSWRMDCFPALQMHKDWVRDVA  220

Query  472  WAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVX  293
            WAPNLGLPKSTIASAS+DG VVIWT AKEG+QW G++L+DF TPVWR+SWSLTGN LA  
Sbjct  221  WAPNLGLPKSTIASASQDGTVVIWTEAKEGEQWVGRILHDFKTPVWRLSWSLTGNILAAS  280

Query  292  SGDNNVTLWNEAVDGEW  242
             G+NNVTLW EAVDGEW
Sbjct  281  DGNNNVTLWKEAVDGEW  297



>emb|CDY37530.1| BnaA05g33950D [Brassica napus]
Length=302

 Score =   213 bits (541),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 110/131 (84%), Gaps = 0/131 (0%)
 Frame = -1

Query  634  PGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAPNLG  455
            PGAL  SG+ +PV KLAS GCD+TVKVWK  NG WKMDCFPAL  H  WVRDVAWAPNLG
Sbjct  164  PGALVSSGMHEPVYKLASGGCDSTVKVWKFANGSWKMDCFPALHKHKDWVRDVAWAPNLG  223

Query  454  LPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGDNNV  275
            LPKSTIAS SEDG V+IWTV KEG+QWEGKVL DF TPVWRV+WS+TGN LAV  G+NNV
Sbjct  224  LPKSTIASGSEDGSVIIWTVGKEGEQWEGKVLKDFKTPVWRVTWSMTGNLLAVSDGNNNV  283

Query  274  TLWNEAVDGEW  242
            T+W EAVDGEW
Sbjct  284  TVWKEAVDGEW  294



>ref|XP_009147418.1| PREDICTED: protein SEC13 homolog [Brassica rapa]
 ref|XP_009147419.1| PREDICTED: protein SEC13 homolog [Brassica rapa]
 ref|XP_009147420.1| PREDICTED: protein SEC13 homolog [Brassica rapa]
 ref|XP_009147421.1| PREDICTED: protein SEC13 homolog [Brassica rapa]
Length=302

 Score =   213 bits (541),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 110/131 (84%), Gaps = 0/131 (0%)
 Frame = -1

Query  634  PGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAPNLG  455
            PGAL  SG+ +PV KLAS GCD+TVKVWK  NG WKMDCFPAL  H  WVRDVAWAPNLG
Sbjct  164  PGALVSSGMHEPVYKLASGGCDSTVKVWKFANGSWKMDCFPALHKHKDWVRDVAWAPNLG  223

Query  454  LPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGDNNV  275
            LPKSTIAS SEDG V+IWTV KEG+QWEGKVL DF TPVWRV+WS+TGN LAV  G+NNV
Sbjct  224  LPKSTIASGSEDGSVIIWTVGKEGEQWEGKVLKDFKTPVWRVTWSMTGNLLAVSDGNNNV  283

Query  274  TLWNEAVDGEW  242
            T+W EAVDGEW
Sbjct  284  TVWKEAVDGEW  294



>ref|XP_010463534.1| PREDICTED: protein transport protein SEC13 homolog A-like [Camelina 
sativa]
Length=302

 Score =   213 bits (541),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 110/131 (84%), Gaps = 0/131 (0%)
 Frame = -1

Query  634  PGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAPNLG  455
            PGAL  SG+ +PV KLAS GCD+TVKVWK  NG WKMDCFPAL  HT WVRDVAWAPNLG
Sbjct  164  PGALVSSGMLEPVYKLASGGCDSTVKVWKFSNGSWKMDCFPALSKHTDWVRDVAWAPNLG  223

Query  454  LPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGDNNV  275
            LPKSTIAS SEDGKV+IWT  KEG+QWEGKVL DF T VWRVSWSLTGN LAV  G+NNV
Sbjct  224  LPKSTIASGSEDGKVIIWTTGKEGEQWEGKVLKDFETTVWRVSWSLTGNLLAVSYGNNNV  283

Query  274  TLWNEAVDGEW  242
            T+W EAVDGEW
Sbjct  284  TVWKEAVDGEW  294



>ref|XP_011080528.1| PREDICTED: protein transport protein SEC13 homolog B-like [Sesamum 
indicum]
 ref|XP_011080536.1| PREDICTED: protein transport protein SEC13 homolog B-like [Sesamum 
indicum]
 ref|XP_011080543.1| PREDICTED: protein transport protein SEC13 homolog B-like [Sesamum 
indicum]
 ref|XP_011080551.1| PREDICTED: protein transport protein SEC13 homolog B-like [Sesamum 
indicum]
 ref|XP_011080561.1| PREDICTED: protein transport protein SEC13 homolog B-like [Sesamum 
indicum]
 ref|XP_011080569.1| PREDICTED: protein transport protein SEC13 homolog B-like [Sesamum 
indicum]
 ref|XP_011080578.1| PREDICTED: protein transport protein SEC13 homolog B-like [Sesamum 
indicum]
 ref|XP_011080587.1| PREDICTED: protein transport protein SEC13 homolog B-like [Sesamum 
indicum]
 ref|XP_011080595.1| PREDICTED: protein transport protein SEC13 homolog B-like [Sesamum 
indicum]
Length=301

 Score =   212 bits (539),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 100/134 (75%), Positives = 113/134 (84%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            S A GAL GSGL +PV++LAS GCDNTVKVWK  NG W+MDCFPAL+MHT WVRDV+WAP
Sbjct  160  STALGALIGSGLLNPVRRLASGGCDNTVKVWKFDNGTWRMDCFPALKMHTDWVRDVSWAP  219

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKS IASASEDGKV+IWT  KEGDQW GK+L DF + VWRVSWSLTGN LAV  G 
Sbjct  220  NLGLPKSVIASASEDGKVIIWTALKEGDQWNGKILKDFGSAVWRVSWSLTGNTLAVADGK  279

Query  283  NNVTLWNEAVDGEW  242
            +N+T+W EA+DGEW
Sbjct  280  SNITVWKEAIDGEW  293


 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 57/121 (47%), Gaps = 8/121 (7%)
 Frame = -1

Query  595  QKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWA-PNLGLPKSTIASASED  419
            ++LA+   DN +K+  + N   +      L  H   V  VAWA P  G   S +AS S D
Sbjct  24   KRLATASSDNAIKIIGVSNS--RSQHLATLTGHRGPVWQVAWAHPKFG---SLLASCSYD  78

Query  418  GKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWS--LTGNXLAVXSGDNNVTLWNEAVDGE  245
            GKVVIW    + +  +  V  D    V  +SW+    G  LA  S D N++++    DG 
Sbjct  79   GKVVIWKEGNQNEWIQAHVFDDHKASVNCISWAPHELGLCLACGSTDGNISVFTARSDGG  138

Query  244  W  242
            W
Sbjct  139  W  139



>gb|KHG02181.1| Protein SEC13 [Gossypium arboreum]
Length=301

 Score =   212 bits (539),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 103/134 (77%), Positives = 111/134 (83%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            S A GA  GSGL DPVQKLAS GCDN VKVW+LYNG WKMD  PALQMHT WVRDVAWAP
Sbjct  160  STALGAFIGSGLLDPVQKLASGGCDNMVKVWRLYNGSWKMDYSPALQMHTDWVRDVAWAP  219

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIASAS+DGKV+IWT  KEG+QW+G +L DF TPVWRVSWSLTGN L+V   +
Sbjct  220  NLGLPKSTIASASQDGKVIIWTCGKEGEQWKGAILKDFKTPVWRVSWSLTGNLLSVADAN  279

Query  283  NNVTLWNEAVDGEW  242
            NNVTLW E VD EW
Sbjct  280  NNVTLWKETVDDEW  293



>ref|XP_006836221.1| hypothetical protein AMTR_s00101p00099400 [Amborella trichopoda]
 gb|ERM99074.1| hypothetical protein AMTR_s00101p00099400 [Amborella trichopoda]
Length=302

 Score =   211 bits (538),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 105/132 (80%), Positives = 112/132 (85%), Gaps = 1/132 (1%)
 Frame = -1

Query  634  PGALXGSG-LXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAPNL  458
            PG+L G     + V KLAS GCDNTVK+WKL NG WKMDCFPALQMH  WVRDVAWAPNL
Sbjct  163  PGSLVGPNWGSEIVHKLASGGCDNTVKIWKLDNGTWKMDCFPALQMHADWVRDVAWAPNL  222

Query  457  GLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGDNN  278
            GLPKSTIASAS+DG VVIWTV KEG+QWEGK+L DFNTPVWRVSWSLTGN LAV  G+NN
Sbjct  223  GLPKSTIASASQDGTVVIWTVGKEGEQWEGKLLKDFNTPVWRVSWSLTGNILAVADGNNN  282

Query  277  VTLWNEAVDGEW  242
            VTLW EAVDGEW
Sbjct  283  VTLWKEAVDGEW  294



>ref|XP_006298213.1| hypothetical protein CARUB_v10014264mg [Capsella rubella]
 gb|EOA31111.1| hypothetical protein CARUB_v10014264mg [Capsella rubella]
Length=302

 Score =   211 bits (538),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 110/131 (84%), Gaps = 0/131 (0%)
 Frame = -1

Query  634  PGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAPNLG  455
            PG+L  SG+ +PV KLAS GCD+TVKVWK  NG WKMDCFPAL  HT WVRDVAWAPNLG
Sbjct  164  PGSLVSSGMLEPVYKLASGGCDSTVKVWKFSNGSWKMDCFPALHKHTDWVRDVAWAPNLG  223

Query  454  LPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGDNNV  275
            LPKSTIAS SEDGKV+IWT+ KEG+QWEGKVL DF T VWRVSWSLTGN LAV  G+NNV
Sbjct  224  LPKSTIASGSEDGKVIIWTIGKEGEQWEGKVLKDFKTTVWRVSWSLTGNLLAVSYGNNNV  283

Query  274  TLWNEAVDGEW  242
            T+W E VDGEW
Sbjct  284  TVWKETVDGEW  294



>ref|XP_010485502.1| PREDICTED: protein transport protein SEC13 homolog A [Camelina 
sativa]
Length=302

 Score =   211 bits (537),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 102/131 (78%), Positives = 109/131 (83%), Gaps = 0/131 (0%)
 Frame = -1

Query  634  PGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAPNLG  455
            PGAL  SG+ +PV KLAS GCD+TVKVWK  NG WKMDCFPAL  HT WVRDVAWAPNLG
Sbjct  164  PGALVSSGMLEPVYKLASGGCDSTVKVWKFSNGSWKMDCFPALSKHTDWVRDVAWAPNLG  223

Query  454  LPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGDNNV  275
            LPKSTIAS SEDGKV+IWT  KEG+QWEGKVL DF T VWRVSWSLTGN LAV  G+NNV
Sbjct  224  LPKSTIASGSEDGKVIIWTTGKEGEQWEGKVLKDFETTVWRVSWSLTGNLLAVSYGNNNV  283

Query  274  TLWNEAVDGEW  242
            T+W E VDGEW
Sbjct  284  TVWKEIVDGEW  294



>gb|KJB40797.1| hypothetical protein B456_007G077700 [Gossypium raimondii]
 gb|KJB40798.1| hypothetical protein B456_007G077700 [Gossypium raimondii]
Length=301

 Score =   209 bits (533),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 101/134 (75%), Positives = 110/134 (82%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            S A GA  GSGL DPVQKLAS GCDN VKVW+LYNG WKMD  PALQMHT WVRDVAWAP
Sbjct  160  STALGAFIGSGLLDPVQKLASGGCDNMVKVWRLYNGSWKMDYSPALQMHTDWVRDVAWAP  219

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPK TIASAS+DGKV+IWT  KEG+QW+G +L DF TPVWR+SWSLTGN L+V   +
Sbjct  220  NLGLPKCTIASASQDGKVIIWTCGKEGEQWKGTILKDFKTPVWRISWSLTGNLLSVADAN  279

Query  283  NNVTLWNEAVDGEW  242
            NNVTLW E VD EW
Sbjct  280  NNVTLWKETVDDEW  293



>ref|XP_010914535.1| PREDICTED: protein transport protein SEC13 homolog B-like [Elaeis 
guineensis]
Length=302

 Score =   208 bits (530),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 112/131 (85%), Gaps = 2/131 (2%)
 Frame = -1

Query  634  PGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAPNLG  455
            PG+L G  L +   KLAS GCDNTVKVW+LYNG WK+DC PALQMHT WVRDVAWAPNLG
Sbjct  166  PGSLIG--LGELTYKLASGGCDNTVKVWRLYNGSWKLDCSPALQMHTDWVRDVAWAPNLG  223

Query  454  LPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGDNNV  275
            LPKST+ASAS+DG VVIWT+AKEG+QWEGKVL DF  PVWRVSWSLTGN LAV  G+NNV
Sbjct  224  LPKSTMASASQDGTVVIWTLAKEGEQWEGKVLNDFKNPVWRVSWSLTGNILAVADGNNNV  283

Query  274  TLWNEAVDGEW  242
            TLW EAVDGEW
Sbjct  284  TLWKEAVDGEW  294



>ref|XP_010500953.1| PREDICTED: protein transport protein SEC13 homolog A-like [Camelina 
sativa]
Length=302

 Score =   207 bits (527),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 108/131 (82%), Gaps = 0/131 (0%)
 Frame = -1

Query  634  PGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAPNLG  455
            PGAL  SG+ +PV KLAS GCD+TVKVWK  NG WKMDCFPAL  HT  VRDVAWAPNLG
Sbjct  164  PGALVSSGMLEPVYKLASGGCDSTVKVWKFSNGSWKMDCFPALSKHTDRVRDVAWAPNLG  223

Query  454  LPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGDNNV  275
            LPKSTIAS SEDGKV+IWT  KEG+QWEGKVL DF T VWRVSWSLTGN LAV  G+NNV
Sbjct  224  LPKSTIASGSEDGKVIIWTTGKEGEQWEGKVLKDFETTVWRVSWSLTGNLLAVSYGNNNV  283

Query  274  TLWNEAVDGEW  242
            T+W E VDGEW
Sbjct  284  TVWKEVVDGEW  294



>gb|AAM65185.1| transport protein SEC13, putative [Arabidopsis thaliana]
Length=301

 Score =   207 bits (526),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 109/131 (83%), Gaps = 1/131 (1%)
 Frame = -1

Query  634  PGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAPNLG  455
            PGAL  SG+ DPV KLAS GCD+TVKVWK  NG WKMDCFPAL  HT WVRDVAWAPNLG
Sbjct  164  PGALVSSGMIDPVYKLASGGCDSTVKVWKFSNGSWKMDCFPALNKHTDWVRDVAWAPNLG  223

Query  454  LPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGDNNV  275
            LPKSTIAS SEDGKV+IWT+ K G+QWEG VL DF TPVWRVSWSLT N LAV  G+NNV
Sbjct  224  LPKSTIASGSEDGKVIIWTIGK-GEQWEGTVLKDFKTPVWRVSWSLTANLLAVSDGNNNV  282

Query  274  TLWNEAVDGEW  242
            T+W E+VDGEW
Sbjct  283  TVWKESVDGEW  293



>ref|XP_002460282.1| hypothetical protein SORBIDRAFT_02g025945 [Sorghum bicolor]
 gb|EER96803.1| hypothetical protein SORBIDRAFT_02g025945 [Sorghum bicolor]
Length=276

 Score =   206 bits (523),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 103/134 (77%), Positives = 112/134 (84%), Gaps = 3/134 (2%)
 Frame = -1

Query  643  SMAPGALXG---SGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVA  473
            +MAPGAL     SG  + VQKLAS GCDNTVKVWKL NG W+MDCFPALQMH  WVRDVA
Sbjct  143  AMAPGALITAGPSGQFEYVQKLASGGCDNTVKVWKLQNGSWRMDCFPALQMHKDWVRDVA  202

Query  472  WAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVX  293
            WAPNLGLPKSTIASAS+DG VVIWT AKEG+QW G+VL+DF TPVWR+SWSLTGN LA  
Sbjct  203  WAPNLGLPKSTIASASQDGTVVIWTEAKEGEQWVGRVLHDFKTPVWRLSWSLTGNILAAS  262

Query  292  SGDNNVTLWNEAVD  251
             G+NNVTLW EAVD
Sbjct  263  DGNNNVTLWKEAVD  276



>gb|ADC80686.1| Sec13-like protein [Populus tremula x Populus alba]
 gb|ADC80688.1| Sec13-like protein [Populus tremula x Populus alba]
Length=155

 Score =   198 bits (504),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 96/110 (87%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            S APGAL GSGL DPVQKL S GCDNTVKVWKLYNG WK+DCFPAL MHT WVRDVAWAP
Sbjct  46   STAPGALVGSGLLDPVQKLCSGGCDNTVKVWKLYNGNWKLDCFPALNMHTDWVRDVAWAP  105

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLT  314
            NLGLPKSTIASAS+DGKV+IWTVAKEGDQWEGKVL+DF  PVWRVSWSLT
Sbjct  106  NLGLPKSTIASASQDGKVIIWTVAKEGDQWEGKVLHDFKAPVWRVSWSLT  155



>gb|ADC80685.1| Sec13-like protein [Populus tremula x Populus alba]
 gb|ADC80689.1| Sec13-like protein, partial [Populus tremula x Populus alba]
Length=155

 Score =   198 bits (504),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 96/110 (87%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            S APGAL GSGL DPVQKL S GCDNTVKVWKLYNG WK+DCFPAL MHT WVRDVAWAP
Sbjct  46   STAPGALVGSGLLDPVQKLCSGGCDNTVKVWKLYNGNWKLDCFPALNMHTDWVRDVAWAP  105

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLT  314
            NLGLPKSTIASAS+DGKV+IWTVAKEGDQWEGKVL+DF  PVWRVSWSLT
Sbjct  106  NLGLPKSTIASASQDGKVIIWTVAKEGDQWEGKVLHDFKAPVWRVSWSLT  155



>gb|ADC80678.1| Sec13-like protein [Eperua grandiflora]
Length=155

 Score =   198 bits (503),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 96/110 (87%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            S APGAL G+GL DPV KL S GCDNTVKVWKL NG+WKMDCFPALQMHT WVRDVAWAP
Sbjct  46   STAPGALVGAGLLDPVHKLCSGGCDNTVKVWKLNNGIWKMDCFPALQMHTDWVRDVAWAP  105

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLT  314
            NLGLPKSTIASAS+DGKV+IWTVAKEGDQWEGKVL DF TPVWRVSWSLT
Sbjct  106  NLGLPKSTIASASQDGKVIIWTVAKEGDQWEGKVLNDFKTPVWRVSWSLT  155



>gb|ADC80672.1| Sec13-like protein [Eperua falcata]
 gb|ADC80674.1| Sec13-like protein [Eperua falcata]
 gb|ADC80675.1| Sec13-like protein, partial [Eperua falcata]
 gb|ADC80679.1| Sec13-like protein [Eperua grandiflora]
 gb|ADC80680.1| Sec13-like protein [Eperua grandiflora]
 gb|ADC80681.1| Sec13-like protein, partial [Eperua grandiflora]
 gb|ADC80682.1| Sec13-like protein, partial [Eperua grandiflora]
 gb|ADD10999.1| Sec 13 transport-like protein [Eperua falcata]
 gb|ADD11000.1| Sec 13 transport-like protein, partial [Eperua grandiflora]
Length=155

 Score =   198 bits (503),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 96/110 (87%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            S APGAL G+GL DPV KL S GCDNTVKVWKL NG+WKMDCFPALQMHT WVRDVAWAP
Sbjct  46   STAPGALVGAGLLDPVHKLCSGGCDNTVKVWKLNNGIWKMDCFPALQMHTDWVRDVAWAP  105

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLT  314
            NLGLPKSTIASAS+DGKV+IWTVAKEGDQWEGKVL DF TPVWRVSWSLT
Sbjct  106  NLGLPKSTIASASQDGKVIIWTVAKEGDQWEGKVLNDFKTPVWRVSWSLT  155



>gb|ADC80677.1| Sec13-like protein [Eperua falcata]
Length=155

 Score =   197 bits (502),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 96/110 (87%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            S APGAL G+GL DPV KL S GCDNTVKVWKL NG+WKMDCFPALQMHT WVRDVAWAP
Sbjct  46   STAPGALVGAGLLDPVHKLCSGGCDNTVKVWKLNNGIWKMDCFPALQMHTDWVRDVAWAP  105

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLT  314
            NLGLPKSTIASAS+DGKV+IWTVAKEGDQWEGKVL DF TPVWRVSWSLT
Sbjct  106  NLGLPKSTIASASQDGKVIIWTVAKEGDQWEGKVLNDFKTPVWRVSWSLT  155



>gb|ADC80666.1| Sec13-like protein [Bauhinia guianensis]
Length=155

 Score =   197 bits (501),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 95/110 (86%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            S APGAL G+GL DPVQKL S GCDNTVKVWKL NG+WKMDCFPALQMHT WVRDVAWAP
Sbjct  46   STAPGALVGAGLLDPVQKLCSGGCDNTVKVWKLNNGLWKMDCFPALQMHTDWVRDVAWAP  105

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLT  314
            NLGLPKSTIAS S+DGKV+IWTVAKEGDQWEGK+L DF TPVWRVSWSLT
Sbjct  106  NLGLPKSTIASCSQDGKVIIWTVAKEGDQWEGKILNDFKTPVWRVSWSLT  155



>gb|ADC80670.1| Sec13-like protein [Bauhinia purpurea]
 gb|ADD10998.1| Sec 13 transport-like protein, partial [Bauhinia purpurea]
Length=155

 Score =   197 bits (501),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 95/110 (86%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            S APGAL G+GL DPVQKL S GCDNTVKVWKL NG+WKMDCFPALQMHT WVRDVAWAP
Sbjct  46   STAPGALVGAGLLDPVQKLCSGGCDNTVKVWKLNNGLWKMDCFPALQMHTDWVRDVAWAP  105

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLT  314
            NLGLPKSTIAS S+DGKV+IWTVAKEGDQWEGK+L DF TPVWRVSWSLT
Sbjct  106  NLGLPKSTIASCSQDGKVIIWTVAKEGDQWEGKILNDFKTPVWRVSWSLT  155



>gb|ADC80667.1| Sec13-like protein [Bauhinia purpurea]
Length=155

 Score =   197 bits (501),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 95/110 (86%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            S APGAL G+GL DPVQKL S GCDNTVKVWKL NG+WKMDCFPALQMHT WVRDVAWAP
Sbjct  46   STAPGALVGAGLLDPVQKLCSGGCDNTVKVWKLNNGLWKMDCFPALQMHTDWVRDVAWAP  105

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLT  314
            NLGLPKSTIAS S+DGKV+IWTVAKEGDQWEGK+L DF TPVWRVSWSLT
Sbjct  106  NLGLPKSTIASCSQDGKVIIWTVAKEGDQWEGKILNDFKTPVWRVSWSLT  155



>gb|ADC80661.1| Sec13-like protein [Bauhinia guianensis]
 gb|ADC80664.1| Sec13-like protein, partial [Bauhinia guianensis]
 gb|ADC80665.1| Sec13-like protein [Bauhinia guianensis]
 gb|ADD10997.1| Sec 13 transport-like protein, partial [Bauhinia guianensis]
Length=155

 Score =   197 bits (501),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 95/110 (86%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            S APGAL G+GL DPVQKL S GCDNTVKVWKL NG+WKMDCFPALQMHT WVRDVAWAP
Sbjct  46   STAPGALVGAGLLDPVQKLCSGGCDNTVKVWKLNNGLWKMDCFPALQMHTDWVRDVAWAP  105

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLT  314
            NLGLPKSTIAS S+DGKV+IWTVAKEGDQWEGK+L DF TPVWRVSWSLT
Sbjct  106  NLGLPKSTIASCSQDGKVIIWTVAKEGDQWEGKILNDFKTPVWRVSWSLT  155



>gb|ADC80692.1| Sec13-like protein [Tachigali melinonii]
 gb|ADC80694.1| Sec13-like protein, partial [Tachigali melinonii]
 gb|ADD11001.1| Sec 13 transport-like protein, partial [Tachigali melinonii]
Length=155

 Score =   197 bits (500),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 95/110 (86%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            S APGAL G+GL DPVQKL S GCDNTVKVWKLYNG+WK+DCFPAL MHT WVRDVAWAP
Sbjct  46   STAPGALVGTGLLDPVQKLCSGGCDNTVKVWKLYNGIWKLDCFPALLMHTDWVRDVAWAP  105

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLT  314
            NLGLPKSTIASAS+DGKV+IWTVAKEGDQWEG VL DF TPVWRVSWSLT
Sbjct  106  NLGLPKSTIASASQDGKVIIWTVAKEGDQWEGNVLNDFKTPVWRVSWSLT  155



>gb|ADC80659.1| Sec13-like protein [Bauhinia guianensis]
Length=155

 Score =   197 bits (500),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 95/110 (86%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            S APGAL G+GL DPVQKL S GCDNTVKVWKL NG+WKMDCFPALQMHT WVRDVAWAP
Sbjct  46   STAPGALVGAGLLDPVQKLCSGGCDNTVKVWKLNNGLWKMDCFPALQMHTDWVRDVAWAP  105

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLT  314
            NLGLPKSTIAS S+DGKV+IWTVAKEGDQWEGK+L DF TPVWRVSWSLT
Sbjct  106  NLGLPKSTIASCSQDGKVIIWTVAKEGDQWEGKILNDFKTPVWRVSWSLT  155



>gb|ADC80690.1| Sec13-like protein [Tachigali melinonii]
Length=155

 Score =   197 bits (500),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 95/110 (86%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            S APGAL G+GL DPVQKL S GCDNTVKVWKLYNG+WK+DCFPAL MHT WVRDVAWAP
Sbjct  46   STAPGALVGTGLLDPVQKLCSGGCDNTVKVWKLYNGIWKLDCFPALLMHTDWVRDVAWAP  105

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLT  314
            NLGLPKSTIASAS+DGKV+IWTVAKEGDQWEG VL DF TPVWRVSWSLT
Sbjct  106  NLGLPKSTIASASQDGKVIIWTVAKEGDQWEGNVLNDFKTPVWRVSWSLT  155



>ref|XP_010249546.1| PREDICTED: protein transport protein SEC13 homolog B-like [Nelumbo 
nucifera]
Length=300

 Score =   201 bits (512),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 94/135 (70%), Positives = 112/135 (83%), Gaps = 1/135 (1%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            S +PG   GSG+  PVQKL S GCDNT+KVWKL +G WK+DCFPALQMHT WVRDVAWAP
Sbjct  158  STSPGVFVGSGMLQPVQKLVSSGCDNTMKVWKLQSGSWKLDCFPALQMHTDWVRDVAWAP  217

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGD-QWEGKVLYDFNTPVWRVSWSLTGNXLAVXSG  287
            NLGLPKSTIA+AS+DG V+IWT+ ++G+ +WEGK++ DF  PVWRVSWSLTG+ LA   G
Sbjct  218  NLGLPKSTIANASQDGTVIIWTLTRDGEKKWEGKIMKDFKNPVWRVSWSLTGSILAAADG  277

Query  286  DNNVTLWNEAVDGEW  242
            +NNVTLW EA +GEW
Sbjct  278  NNNVTLWKEAENGEW  292



>gb|ADC80676.1| Sec13-like protein [Eperua falcata]
Length=155

 Score =   196 bits (499),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 96/110 (87%), Positives = 99/110 (90%), Gaps = 0/110 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            S APGAL G+GL DPV KL S GCDNTVKVWKL NG WKMDCFPALQMHT WVRDVAWAP
Sbjct  46   STAPGALVGAGLLDPVHKLCSGGCDNTVKVWKLNNGTWKMDCFPALQMHTDWVRDVAWAP  105

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLT  314
            NLGLPKSTIASAS+DGKV+IWTVAKEGDQWEGKVL DF TPVWRVSWSLT
Sbjct  106  NLGLPKSTIASASQDGKVIIWTVAKEGDQWEGKVLNDFKTPVWRVSWSLT  155



>gb|KHM99531.1| Protein SEC13 like, partial [Glycine soja]
Length=358

 Score =   203 bits (516),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 103/134 (77%), Positives = 108/134 (81%), Gaps = 18/134 (13%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            SMAPGAL G+G                  VWKL NG+WKMDCFPALQMHT WVRDVAWAP
Sbjct  235  SMAPGALVGAG------------------VWKLNNGLWKMDCFPALQMHTDWVRDVAWAP  276

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPKSTIASAS+DGKV+IWTVAKEGDQWEGKVL DFNTPVWRVSWSLTGN LAV  G+
Sbjct  277  NLGLPKSTIASASQDGKVIIWTVAKEGDQWEGKVLNDFNTPVWRVSWSLTGNILAVADGN  336

Query  283  NNVTLWNEAVDGEW  242
            NNVTLW EAVDGEW
Sbjct  337  NNVTLWKEAVDGEW  350



>gb|ADC80669.1| Sec13-like protein [Bauhinia purpurea]
 gb|ADC80671.1| Sec13-like protein, partial [Bauhinia purpurea]
Length=155

 Score =   196 bits (499),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 94/110 (85%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            S APGAL G+GL DPVQKL S GCDNTVKVWKL NG+WKMDCFPALQMHT WVRDVAWAP
Sbjct  46   STAPGALVGAGLLDPVQKLCSGGCDNTVKVWKLTNGLWKMDCFPALQMHTDWVRDVAWAP  105

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLT  314
            NLGLPKSTIAS S+DGKV++WTVAKEGDQWEGK+L DF TPVWRVSWSLT
Sbjct  106  NLGLPKSTIASCSQDGKVILWTVAKEGDQWEGKILNDFKTPVWRVSWSLT  155



>gb|ADC80660.1| Sec13-like protein [Bauhinia guianensis]
Length=155

 Score =   196 bits (498),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 95/110 (86%), Positives = 99/110 (90%), Gaps = 0/110 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            S APGAL G+GL DPVQKL S GCDNTVKVWKL NG WKMDCFPALQMHT WVRDVAWAP
Sbjct  46   STAPGALVGAGLLDPVQKLCSGGCDNTVKVWKLTNGQWKMDCFPALQMHTDWVRDVAWAP  105

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLT  314
            NLGLPKSTIAS S+DGKV+IWTVAKEGDQWEGK+L DF TPVWRVSWSLT
Sbjct  106  NLGLPKSTIASCSQDGKVIIWTVAKEGDQWEGKILNDFKTPVWRVSWSLT  155



>gb|ADC80693.1| Sec13-like protein [Tachigali melinonii]
Length=155

 Score =   196 bits (498),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 95/110 (86%), Positives = 99/110 (90%), Gaps = 0/110 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            S APGAL GSGL DPV KL S GCDNTVKVWKLYNG+WK+DCFPAL MHT WVRDVAWAP
Sbjct  46   STAPGALVGSGLLDPVHKLCSGGCDNTVKVWKLYNGIWKLDCFPALLMHTDWVRDVAWAP  105

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLT  314
            NLGLPKSTIASAS+DGKV+IWTVAKEGDQWEG VL DF TPVWRVSWSLT
Sbjct  106  NLGLPKSTIASASQDGKVIIWTVAKEGDQWEGNVLNDFKTPVWRVSWSLT  155



>gb|ADC80673.1| Sec13-like protein [Eperua falcata]
Length=155

 Score =   196 bits (498),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 95/110 (86%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            S APGAL G+GL DPV KL S GCDNTVKVWKL NG+WKMDCFPALQ+HT WVRDVAWAP
Sbjct  46   STAPGALVGAGLLDPVHKLCSGGCDNTVKVWKLNNGIWKMDCFPALQVHTDWVRDVAWAP  105

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLT  314
            NLGLPKSTIASAS+DGKV+IWTVAKEGDQWEGKVL DF TPVWRVSWSLT
Sbjct  106  NLGLPKSTIASASQDGKVIIWTVAKEGDQWEGKVLNDFKTPVWRVSWSLT  155



>gb|ADC80684.1| Sec13-like protein [Populus tremula x Populus alba]
Length=155

 Score =   195 bits (496),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 95/110 (86%), Positives = 99/110 (90%), Gaps = 0/110 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            S APGAL GSGL DPVQKL S GCDNTVKVWKLYNG WK+DCFPAL MHT WVRDVA AP
Sbjct  46   STAPGALVGSGLLDPVQKLCSGGCDNTVKVWKLYNGNWKLDCFPALNMHTDWVRDVARAP  105

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLT  314
            NLGLPKSTIASAS+DGKV+IWTVAKEGDQWEGKVL+DF  PVWRVSWSLT
Sbjct  106  NLGLPKSTIASASQDGKVIIWTVAKEGDQWEGKVLHDFKAPVWRVSWSLT  155



>gb|ADC80683.1| Sec13-like protein [Populus tremula x Populus alba]
 gb|ADC80687.1| Sec13-like protein, partial [Populus tremula x Populus alba]
Length=155

 Score =   195 bits (496),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 94/110 (85%), Positives = 98/110 (89%), Gaps = 0/110 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            S APGAL GSGL DP QKL S GCDNTVKVWKLYNG WK+DCFPAL MH  WVRDVAWAP
Sbjct  46   STAPGALVGSGLLDPAQKLCSGGCDNTVKVWKLYNGNWKLDCFPALNMHADWVRDVAWAP  105

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLT  314
            NLGLPKSTIASAS+DGKV+IWTVAKEGDQWEGKVL+DF  PVWRVSWSLT
Sbjct  106  NLGLPKSTIASASQDGKVIIWTVAKEGDQWEGKVLHDFKAPVWRVSWSLT  155



>ref|XP_002979018.1| hypothetical protein SELMODRAFT_109958 [Selaginella moellendorffii]
 gb|EFJ19975.1| hypothetical protein SELMODRAFT_109958 [Selaginella moellendorffii]
Length=317

 Score =   200 bits (509),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 94/134 (70%), Positives = 108/134 (81%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            S +PG+L G G    +QKL S GCDNTVKVWK  +G WKMDCFP L MH+ WVRDVAWAP
Sbjct  177  SASPGSLLGDGRAGLIQKLVSGGCDNTVKVWKFADGHWKMDCFPPLSMHSDWVRDVAWAP  236

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPK+TIASAS+DG VVIWT  +EGDQW+G++L+DF +PVWR SWSLTGN LAV    
Sbjct  237  NLGLPKNTIASASQDGTVVIWTQGREGDQWQGQLLHDFKSPVWRASWSLTGNILAVADAT  296

Query  283  NNVTLWNEAVDGEW  242
            N+VTLW EAVDGEW
Sbjct  297  NSVTLWKEAVDGEW  310



>ref|XP_002988399.1| hypothetical protein SELMODRAFT_128111 [Selaginella moellendorffii]
 gb|EFJ10489.1| hypothetical protein SELMODRAFT_128111 [Selaginella moellendorffii]
Length=317

 Score =   200 bits (509),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 94/134 (70%), Positives = 108/134 (81%), Gaps = 0/134 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            S +PG+L G G    +QKL S GCDNTVKVWK  +G WKMDCFP L MH+ WVRDVAWAP
Sbjct  177  SASPGSLLGDGRAGLIQKLVSGGCDNTVKVWKFADGHWKMDCFPPLSMHSDWVRDVAWAP  236

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGLPK+TIASAS+DG VVIWT  +EGDQW+G++L+DF +PVWR SWSLTGN LAV    
Sbjct  237  NLGLPKNTIASASQDGTVVIWTQGREGDQWQGQLLHDFKSPVWRASWSLTGNILAVADAT  296

Query  283  NNVTLWNEAVDGEW  242
            N+VTLW EAVDGEW
Sbjct  297  NSVTLWKEAVDGEW  310



>ref|XP_010551882.1| PREDICTED: protein transport protein SEC13 homolog B-like [Tarenaya 
hassleriana]
 ref|XP_010551884.1| PREDICTED: protein transport protein SEC13 homolog B-like [Tarenaya 
hassleriana]
 ref|XP_010551885.1| PREDICTED: protein transport protein SEC13 homolog B-like [Tarenaya 
hassleriana]
 ref|XP_010551886.1| PREDICTED: protein transport protein SEC13 homolog B-like [Tarenaya 
hassleriana]
Length=301

 Score =   199 bits (507),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 100/134 (75%), Positives = 112/134 (84%), Gaps = 1/134 (1%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            + +PGAL GSGL +P  KLAS G D+TVKVWKL+NG W+ DCFPALQMH+ WVRDVAWAP
Sbjct  161  ATSPGALVGSGLLEPAHKLASGGWDSTVKVWKLHNGSWEKDCFPALQMHSDWVRDVAWAP  220

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGL KSTIASAS+DG VVIWTV KEG++WE KV+ DF TPVW VSWSLTGN LAV  GD
Sbjct  221  NLGLSKSTIASASQDGTVVIWTVGKEGEKWEVKVMKDFKTPVWGVSWSLTGNLLAVSDGD  280

Query  283  NNVTLWNEAVDGEW  242
            +NVTLW EA DGEW
Sbjct  281  SNVTLWKEA-DGEW  293



>gb|ADC80658.1| Sec13-like protein [Bauhinia guianensis]
Length=155

 Score =   194 bits (494),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 94/110 (85%), Positives = 98/110 (89%), Gaps = 0/110 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            S APGAL G+GL DPVQKL S GCDNTVKVWKL NG WKMDCFPAL MHT WVRDVAWAP
Sbjct  46   STAPGALVGAGLLDPVQKLCSGGCDNTVKVWKLNNGFWKMDCFPALHMHTDWVRDVAWAP  105

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLT  314
            NLGLPKSTIAS S+DGKV+IWTVAKEGDQWEGK+L DF TPVWRVSWSLT
Sbjct  106  NLGLPKSTIASCSQDGKVIIWTVAKEGDQWEGKILNDFKTPVWRVSWSLT  155



>gb|ADC80668.1| Sec13-like protein [Bauhinia purpurea]
Length=155

 Score =   194 bits (494),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 94/110 (85%), Positives = 99/110 (90%), Gaps = 0/110 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            S APGAL G+GL DPVQKL S GCDNTVKVWKL NG+WKMDCFPALQMHT WVRDVAWAP
Sbjct  46   STAPGALVGAGLLDPVQKLCSGGCDNTVKVWKLNNGLWKMDCFPALQMHTDWVRDVAWAP  105

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLT  314
            NLGLPKSTIAS S+ GKV+IWTVAKEGDQWEGK+L DF TPVWRVSWSLT
Sbjct  106  NLGLPKSTIASCSQGGKVIIWTVAKEGDQWEGKILNDFKTPVWRVSWSLT  155



>gb|ADC80691.1| Sec13-like protein [Tachigali melinonii]
Length=155

 Score =   194 bits (492),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 94/110 (85%), Positives = 99/110 (90%), Gaps = 0/110 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            S APGAL G+GL DPVQKL S GCDNTVKVWKLYNG+WK+DCFPAL MHT  VRDVAWAP
Sbjct  46   STAPGALVGTGLLDPVQKLCSGGCDNTVKVWKLYNGIWKLDCFPALLMHTDRVRDVAWAP  105

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLT  314
            NLGLPKSTIASAS+DGKV+IWTVAKEGDQWEG VL DF TPVWRVSWSLT
Sbjct  106  NLGLPKSTIASASQDGKVIIWTVAKEGDQWEGNVLNDFKTPVWRVSWSLT  155



>gb|ADC80662.1| Sec13-like protein [Bauhinia guianensis]
 gb|ADC80663.1| Sec13-like protein, partial [Bauhinia guianensis]
Length=155

 Score =   193 bits (490),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 94/110 (85%), Positives = 98/110 (89%), Gaps = 0/110 (0%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            S APGAL G+GL DPVQKL S GCDNTVKVWKL NG WKMDCFPALQMHT WVRDVAWAP
Sbjct  46   STAPGALVGAGLLDPVQKLCSGGCDNTVKVWKLTNGQWKMDCFPALQMHTDWVRDVAWAP  105

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLT  314
            NLGLPKSTIAS S+DGKV+IWTVAKEGDQWEGK+L D  TPVWRVSWSLT
Sbjct  106  NLGLPKSTIASCSQDGKVIIWTVAKEGDQWEGKILNDSKTPVWRVSWSLT  155



>gb|EMT13956.1| hypothetical protein F775_31904 [Aegilops tauschii]
Length=320

 Score =   194 bits (494),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 97/125 (78%), Positives = 104/125 (83%), Gaps = 3/125 (2%)
 Frame = -1

Query  643  SMAPGALXG---SGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVA  473
            +MAPGAL     SG  + VQKLAS GCDNTVKVWKL NG W+MDCFPALQMH  WVRDVA
Sbjct  161  AMAPGALISPGPSGQFEYVQKLASGGCDNTVKVWKLTNGSWRMDCFPALQMHRDWVRDVA  220

Query  472  WAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVX  293
            WAPNLGLPKSTIASAS+DG VVIWT  KEG+QWEG+VL DF TPVWRVSWSLTGN LAV 
Sbjct  221  WAPNLGLPKSTIASASQDGTVVIWTAPKEGEQWEGRVLNDFRTPVWRVSWSLTGNILAVS  280

Query  292  SGDNN  278
             G+NN
Sbjct  281  DGNNN  285



>gb|EMT33754.1| hypothetical protein F775_27473 [Aegilops tauschii]
Length=280

 Score =   192 bits (489),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 92/117 (79%), Positives = 100/117 (85%), Gaps = 0/117 (0%)
 Frame = -1

Query  592  KLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAPNLGLPKSTIASASEDGK  413
            ++AS GCDNTVKVWKL N  W+MDCFPALQMH  WVRDVAWAPNLGLPKSTIASAS+DG 
Sbjct  156  EIASGGCDNTVKVWKLTNESWRMDCFPALQMHRDWVRDVAWAPNLGLPKSTIASASQDGT  215

Query  412  VVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGDNNVTLWNEAVDGEW  242
            VVIWT  KEG+QWEG+VL  F  PVWR+SWSLTGN LAV  G+NNVTLW EAVDGEW
Sbjct  216  VVIWTTPKEGEQWEGRVLNVFRNPVWRLSWSLTGNILAVSDGNNNVTLWKEAVDGEW  272



>ref|XP_001768123.1| predicted protein [Physcomitrella patens]
 gb|EDQ66996.1| predicted protein [Physcomitrella patens]
Length=298

 Score =   190 bits (483),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 97/136 (71%), Positives = 104/136 (76%), Gaps = 5/136 (4%)
 Frame = -1

Query  643  SMAPGALXGSGLXDP--VQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAW  470
            + APG+L G    DP  VQKLAS GCDNTVKVWK  NG WK+DCFP L  H  WVRDVAW
Sbjct  160  ATAPGSLIG---VDPGAVQKLASGGCDNTVKVWKFMNGSWKLDCFPPLSKHVDWVRDVAW  216

Query  469  APNLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXS  290
            APNLGLP+STIASAS+DG VVIWT AK+GDQW+   L DF TPVWRVSWSLTGN LAV  
Sbjct  217  APNLGLPRSTIASASQDGTVVIWTQAKDGDQWQPLTLNDFKTPVWRVSWSLTGNILAVSD  276

Query  289  GDNNVTLWNEAVDGEW  242
              N VTLW E VDGEW
Sbjct  277  SSNKVTLWKEEVDGEW  292



>ref|XP_001781370.1| predicted protein [Physcomitrella patens]
 gb|EDQ53817.1| predicted protein [Physcomitrella patens]
Length=307

 Score =   190 bits (483),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 95/132 (72%), Positives = 102/132 (77%), Gaps = 1/132 (1%)
 Frame = -1

Query  637  APGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAPNL  458
            APG+L G    +PVQKLAS GCDNTVKVWK  NG WK+DCFP L  H  WVRDVAWAPNL
Sbjct  170  APGSLIGIN-SEPVQKLASGGCDNTVKVWKFLNGSWKLDCFPPLSKHVDWVRDVAWAPNL  228

Query  457  GLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGDNN  278
            GL KSTIASAS+DG VVIWT AK+GDQW+   L DF TPVWR+SWSLTGN LAV    N 
Sbjct  229  GLVKSTIASASQDGTVVIWTQAKDGDQWQPLTLNDFKTPVWRISWSLTGNLLAVSDSSNK  288

Query  277  VTLWNEAVDGEW  242
            VTLW E VDGEW
Sbjct  289  VTLWKEEVDGEW  300



>ref|XP_001774339.1| predicted protein [Physcomitrella patens]
 gb|EDQ60841.1| predicted protein [Physcomitrella patens]
Length=311

 Score =   183 bits (465),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 94/132 (71%), Positives = 100/132 (76%), Gaps = 1/132 (1%)
 Frame = -1

Query  637  APGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAPNL  458
            APG+L G     PVQKLAS GCDNTVKVWK  N  WK+DCFP L  H  WVRDVAWAPNL
Sbjct  175  APGSLIGPD-PGPVQKLASGGCDNTVKVWKFVNNNWKLDCFPPLSKHVDWVRDVAWAPNL  233

Query  457  GLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGDNN  278
            GL +STIASAS+DG VVIWT AK+GDQW+   L DF TPVWRVSWSLTGN LAV    N 
Sbjct  234  GLVRSTIASASQDGTVVIWTQAKDGDQWQPLTLNDFKTPVWRVSWSLTGNILAVSDSCNK  293

Query  277  VTLWNEAVDGEW  242
            VTLW E VDGEW
Sbjct  294  VTLWKEEVDGEW  305



>ref|XP_001767345.1| predicted protein [Physcomitrella patens]
 gb|EDQ67836.1| predicted protein [Physcomitrella patens]
Length=296

 Score =   169 bits (429),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 89/119 (75%), Gaps = 0/119 (0%)
 Frame = -1

Query  598  VQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAPNLGLPKSTIASASED  419
            +Q+LAS GCDNTVKVWK  N  WK+DCFP L  H  WVRDV WAPN GL +STIASAS+D
Sbjct  171  LQRLASGGCDNTVKVWKFENNSWKLDCFPPLSKHVDWVRDVGWAPNFGLGRSTIASASQD  230

Query  418  GKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGDNNVTLWNEAVDGEW  242
            G VVIWT   +GDQW+   L DF TPVWRVSWSLTGN LAV    + VTLW E VDG+W
Sbjct  231  GTVVIWTQKNDGDQWQSLTLNDFKTPVWRVSWSLTGNILAVSDSSSKVTLWKEEVDGDW  289



>ref|XP_008443459.1| PREDICTED: protein SEC13 homolog [Cucumis melo]
Length=301

 Score =   166 bits (419),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 81/134 (60%), Positives = 102/134 (76%), Gaps = 1/134 (1%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            + APG+L GS   DPV KLAS G D+TVKVW L +G W+ D   +LQMHT WVRDVAW+P
Sbjct  161  TTAPGSLVGSSSEDPVWKLASGGFDSTVKVWTLKDGSWRRDSSLSLQMHTDWVRDVAWSP  220

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGL KSTIAS S+DG V+IW+  KEG +W+  ++ DF TP+W+VSWSLTG+ LAV  G+
Sbjct  221  NLGLQKSTIASGSQDGTVIIWST-KEGGKWDATLMNDFKTPIWKVSWSLTGDLLAVSDGN  279

Query  283  NNVTLWNEAVDGEW  242
            N++TLW EA  G+W
Sbjct  280  NHITLWKEAASGKW  293



>ref|XP_002971002.1| hypothetical protein SELMODRAFT_94917 [Selaginella moellendorffii]
 gb|EFJ27600.1| hypothetical protein SELMODRAFT_94917 [Selaginella moellendorffii]
Length=303

 Score =   165 bits (418),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 82/140 (59%), Positives = 98/140 (70%), Gaps = 6/140 (4%)
 Frame = -1

Query  643  SMAPGALXGSGLXDP---VQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVA  473
            ++APGAL  S        V KL S GCDNTVKVW+  +G WKMDCFP L  H+ WVRDVA
Sbjct  158  ALAPGALVSSQPASHNTYVFKLVSCGCDNTVKVWRFSDGSWKMDCFPPLSKHSDWVRDVA  217

Query  472  WAPNLGLPKSTIASASEDGKVVIWTVAKE---GDQWEGKVLYDFNTPVWRVSWSLTGNXL  302
            WAPN+GLP++T+ASAS+DG V+IWT        DQW+G++L DF  PVWRV WS  GN L
Sbjct  218  WAPNIGLPRTTMASASQDGTVIIWTQDHSEAGSDQWQGRLLNDFKVPVWRVRWSSAGNVL  277

Query  301  AVXSGDNNVTLWNEAVDGEW  242
            AV  G N V+LW E VDG+W
Sbjct  278  AVTDGSNAVSLWKEVVDGKW  297



>ref|XP_002962084.1| hypothetical protein SELMODRAFT_76631 [Selaginella moellendorffii]
 gb|EFJ37344.1| hypothetical protein SELMODRAFT_76631 [Selaginella moellendorffii]
Length=303

 Score =   165 bits (418),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 82/140 (59%), Positives = 98/140 (70%), Gaps = 6/140 (4%)
 Frame = -1

Query  643  SMAPGALXGSGLXDP---VQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVA  473
            ++APGAL  S        V KL S GCDNTVKVW+  +G WKMDCFP L  H+ WVRDVA
Sbjct  158  ALAPGALVSSQPASHNTYVFKLVSCGCDNTVKVWRFSDGSWKMDCFPPLSKHSDWVRDVA  217

Query  472  WAPNLGLPKSTIASASEDGKVVIWTVAKE---GDQWEGKVLYDFNTPVWRVSWSLTGNXL  302
            WAPN+GLP++T+ASAS+DG V+IWT        DQW+G++L DF  PVWRV WS  GN L
Sbjct  218  WAPNIGLPRTTMASASQDGTVIIWTQDHSEAGSDQWQGRLLNDFKVPVWRVRWSSAGNVL  277

Query  301  AVXSGDNNVTLWNEAVDGEW  242
            AV  G N V+LW E VDG+W
Sbjct  278  AVTDGSNAVSLWKEVVDGKW  297



>ref|XP_006650845.1| PREDICTED: protein SEC13 homolog [Oryza brachyantha]
Length=301

 Score =   164 bits (414),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 82/132 (62%), Positives = 100/132 (76%), Gaps = 2/132 (2%)
 Frame = -1

Query  637  APGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAPNL  458
            A G++ GSG  + VQKL S G D+ V+VW   +G WK++     +MHT  VRDV+WAP L
Sbjct  164  ALGSIVGSG--ELVQKLVSGGIDSVVRVWAFVSGSWKLEYALPSEMHTNCVRDVSWAPVL  221

Query  457  GLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGDNN  278
            GL KSTIASASEDGKVVIWT  KEGD+WEGKV++DF  P WRVSWSLTGN L+V +G +N
Sbjct  222  GLAKSTIASASEDGKVVIWTKGKEGDKWEGKVMHDFEAPAWRVSWSLTGNILSVAAGSDN  281

Query  277  VTLWNEAVDGEW  242
            +TLW EA DG+W
Sbjct  282  ITLWKEASDGQW  293



>ref|NP_001051797.1| Os03g0831800 [Oryza sativa Japonica Group]
 gb|AAO39855.1| putative coat protein complex II (COPII) component [Oryza sativa 
Japonica Group]
 gb|AAP46251.1| putative protein-transport protein [Oryza sativa Japonica Group]
 gb|ABF99713.1| SEC13-related protein, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABF99714.1| SEC13-related protein, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF13711.1| Os03g0831800 [Oryza sativa Japonica Group]
 gb|EAY92452.1| hypothetical protein OsI_14185 [Oryza sativa Indica Group]
 gb|EAZ29179.1| hypothetical protein OsJ_13238 [Oryza sativa Japonica Group]
 dbj|BAG96146.1| unnamed protein product [Oryza sativa Japonica Group]
Length=301

 Score =   161 bits (408),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 83/134 (62%), Positives = 97/134 (72%), Gaps = 2/134 (1%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            + A G++ GSG  + VQKL S G D  VKVW   NG WK+D      MHT  VRDV+WAP
Sbjct  162  ATALGSIVGSG--ELVQKLVSGGFDCVVKVWAFVNGSWKLDSVLPSDMHTDCVRDVSWAP  219

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
             LGL K TIASASEDGKVVIWT  KEGD+WEGKV++DF  P WRVSWSLTGN L+V +G 
Sbjct  220  VLGLAKFTIASASEDGKVVIWTKGKEGDKWEGKVMHDFEAPAWRVSWSLTGNILSVAAGS  279

Query  283  NNVTLWNEAVDGEW  242
             ++TLW EA DG+W
Sbjct  280  GDITLWKEASDGQW  293



>ref|XP_004169158.1| PREDICTED: protein SEC13 homolog [Cucumis sativus]
Length=301

 Score =   160 bits (405),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 78/134 (58%), Positives = 101/134 (75%), Gaps = 1/134 (1%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            + APG+L GS   DPV KLAS G D++VKVW L +G W+ D   +LQ+HT WVRDVAW+P
Sbjct  161  TTAPGSLVGSSSEDPVWKLASGGFDSSVKVWTLKDGSWRRDSSLSLQIHTDWVRDVAWSP  220

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
            NLGL KSTIAS S+DG V+IW+  KEG +W+  ++ DF TP+W+VSWSLTG+ LAV  G+
Sbjct  221  NLGLQKSTIASGSQDGTVIIWST-KEGGKWDATLVNDFKTPIWKVSWSLTGDLLAVSDGN  279

Query  283  NNVTLWNEAVDGEW  242
            N++TLW E   G+W
Sbjct  280  NHITLWKEGTGGKW  293



>gb|AAF64424.1|AF206628_1 sec13-like protein [Cucumis melo]
Length=143

 Score =   155 bits (392),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 77/128 (60%), Positives = 96/128 (75%), Gaps = 1/128 (1%)
 Frame = -1

Query  625  LXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAPNLGLPK  446
            L GS   DPV KLAS G D+TVKVW L +G W+ D   +LQMHT WVRDVAW+PNLGL K
Sbjct  17   LVGSSSEDPVWKLASGGFDSTVKVWTLKDGSWRRDSSLSLQMHTDWVRDVAWSPNLGLQK  76

Query  445  STIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGDNNVTLW  266
            STIAS  +DG V+IW+  KEG +W+  ++ DF TP+W+VSWSLTG+ LAV  G+N++TLW
Sbjct  77   STIASGXQDGTVIIWST-KEGGKWDATLMNDFKTPIWKVSWSLTGDLLAVSDGNNHITLW  135

Query  265  NEAVDGEW  242
             EA  G+W
Sbjct  136  KEAASGKW  143



>ref|XP_004147452.1| PREDICTED: protein SEC13 homolog [Cucumis sativus]
 gb|KGN59617.1| hypothetical protein Csa_3G829070 [Cucumis sativus]
Length=301

 Score =   160 bits (405),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 100/132 (76%), Gaps = 1/132 (1%)
 Frame = -1

Query  637  APGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAPNL  458
            APG+L GS   DPV KLAS G D++VKVW L +G W+ D   +LQ+HT WVRDVAW+PNL
Sbjct  163  APGSLVGSSSEDPVWKLASGGFDSSVKVWTLKDGSWRRDSSLSLQIHTDWVRDVAWSPNL  222

Query  457  GLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGDNN  278
            GL KSTIAS S+DG V+IW+  KEG +W+  ++ DF TP+W+VSWSLTG+ LAV  G+N+
Sbjct  223  GLQKSTIASGSQDGTVIIWST-KEGGKWDATLVNDFKTPIWKVSWSLTGDLLAVSDGNNH  281

Query  277  VTLWNEAVDGEW  242
            +TLW E   G+W
Sbjct  282  ITLWKEGTGGKW  293



>gb|EPS72324.1| hypothetical protein M569_02435, partial [Genlisea aurea]
Length=284

 Score =   159 bits (403),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 82/119 (69%), Positives = 91/119 (76%), Gaps = 3/119 (3%)
 Frame = -1

Query  598  VQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAPNLGLPKSTIASASED  419
            +QKL S GCD T KVW+  NG W+M+   AL +H  WVRDVAWAPN+GLPKSTIASAS+D
Sbjct  166  LQKLVSGGCDGTAKVWRRDNGTWRME--DAL-LHGDWVRDVAWAPNMGLPKSTIASASQD  222

Query  418  GKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGDNNVTLWNEAVDGEW  242
            GKV IW   KEGD+W+ KVL DF  PVWRVSWSLTGN LAV     NVTLW EAVDGEW
Sbjct  223  GKVTIWIKPKEGDEWDSKVLDDFEGPVWRVSWSLTGNILAVADSKQNVTLWKEAVDGEW  281



>ref|NP_001059284.1| Os07g0246300 [Oryza sativa Japonica Group]
 dbj|BAC82934.1| putative Sec13p [Oryza sativa Japonica Group]
 dbj|BAD31963.1| putative Sec13p [Oryza sativa Japonica Group]
 dbj|BAF21198.1| Os07g0246300 [Oryza sativa Japonica Group]
 gb|EAZ03370.1| hypothetical protein OsI_25509 [Oryza sativa Indica Group]
 gb|EAZ39271.1| hypothetical protein OsJ_23698 [Oryza sativa Japonica Group]
 dbj|BAG99420.1| unnamed protein product [Oryza sativa Japonica Group]
Length=315

 Score =   159 bits (402),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 81/134 (60%), Positives = 101/134 (75%), Gaps = 2/134 (1%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            + A G+L GSG  + V KL S G D+ VKVW   NG WK++      +HT  VRDVAWAP
Sbjct  162  ATALGSLAGSG--ELVYKLVSGGFDSVVKVWGFVNGGWKLESALPSDVHTDCVRDVAWAP  219

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
             LGL K+TIASAS+DGKVVIW+  K GD+WEGKV++DF +PVWRVSWSLTGN L+V +G+
Sbjct  220  VLGLAKATIASASQDGKVVIWSRGKVGDKWEGKVMHDFGSPVWRVSWSLTGNILSVAAGE  279

Query  283  NNVTLWNEAVDGEW  242
            NN+TLW +A DG+W
Sbjct  280  NNITLWKQASDGQW  293



>ref|NP_001149986.1| SEC13-related protein [Zea mays]
 ref|XP_008651487.1| PREDICTED: SEC13-related protein isoform X1 [Zea mays]
 gb|ACF84405.1| unknown [Zea mays]
 gb|ACG37410.1| SEC13-related protein [Zea mays]
Length=299

 Score =   158 bits (399),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 94/132 (71%), Gaps = 0/132 (0%)
 Frame = -1

Query  637  APGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAPNL  458
            AP     +G  + V KL S G D+ VKVW   NG WK++      MHT  VRDVAWAP L
Sbjct  160  APATASLAGAGELVYKLVSGGFDSVVKVWGFNNGSWKLESALISDMHTDCVRDVAWAPVL  219

Query  457  GLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGDNN  278
            GL KSTIAS S+DGKVVIWT  K+GD+WEGK++ DF +PVWRVSWSLTGN L + +G+NN
Sbjct  220  GLSKSTIASGSQDGKVVIWTKGKDGDKWEGKLMRDFGSPVWRVSWSLTGNILCIAAGENN  279

Query  277  VTLWNEAVDGEW  242
            +TLW E  DG+W
Sbjct  280  ITLWKEGSDGQW  291



>gb|ACN31668.1| unknown [Zea mays]
Length=299

 Score =   158 bits (399),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 94/132 (71%), Gaps = 0/132 (0%)
 Frame = -1

Query  637  APGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAPNL  458
            AP     +G  + V KL S G D+ VKVW   NG WK++      MHT  VRDVAWAP L
Sbjct  160  APATASLAGAGELVYKLVSGGFDSVVKVWGFNNGSWKLESALISDMHTDCVRDVAWAPVL  219

Query  457  GLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGDNN  278
            GL KSTIAS S+DGKVVIWT  K+GD+WEGK++ DF +PVWRVSWSLTGN L + +G+NN
Sbjct  220  GLSKSTIASGSQDGKVVIWTKGKDGDKWEGKLMRDFGSPVWRVSWSLTGNILCIAAGENN  279

Query  277  VTLWNEAVDGEW  242
            +TLW E  DG+W
Sbjct  280  ITLWKEGSDGQW  291



>ref|XP_010098129.1| Protein SEC13-like protein [Morus notabilis]
 gb|EXB74566.1| Protein SEC13-like protein [Morus notabilis]
Length=355

 Score =   159 bits (401),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 87/132 (66%), Positives = 95/132 (72%), Gaps = 3/132 (2%)
 Frame = -1

Query  634  PGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAPNLG  455
            P AL  S   D V +L S G DN VKVWKL NGVWKMD   ALQMH  W+RDVAWAPNLG
Sbjct  218  PSAL--SDAKDTVWRLCSGGFDNNVKVWKLDNGVWKMDSLKALQMHNGWIRDVAWAPNLG  275

Query  454  LPKSTIASASEDGKVVIWTVAKEGD-QWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGDNN  278
              KS IASASEDGKVV+W++ K G  QWEGKVL DF T VW+VSWSLTG+ LAV  G+  
Sbjct  276  SLKSMIASASEDGKVVVWSLPKGGSGQWEGKVLGDFKTSVWKVSWSLTGDVLAVADGNKK  335

Query  277  VTLWNEAVDGEW  242
            VTL  EA  GEW
Sbjct  336  VTLLKEAASGEW  347



>ref|XP_006657588.1| PREDICTED: protein SEC13 homolog [Oryza brachyantha]
Length=315

 Score =   157 bits (396),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 80/134 (60%), Positives = 99/134 (74%), Gaps = 2/134 (1%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            + A G+L G G  + V KL S G D+ VKVW   +G WK+D      +HT  VRDVAWAP
Sbjct  162  ATALGSLAGPG--ELVYKLVSGGFDSVVKVWGFVDGGWKLDSALPSDVHTDCVRDVAWAP  219

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
             LG  KSTIASAS+DGKVVIWT  K GD+WEGK+++DF +PVWRVSWSLTGN L+V +G+
Sbjct  220  VLGSAKSTIASASQDGKVVIWTRGKAGDKWEGKIMHDFGSPVWRVSWSLTGNILSVAAGE  279

Query  283  NNVTLWNEAVDGEW  242
            NN+TLW +A DG+W
Sbjct  280  NNITLWKQASDGQW  293



>ref|XP_004955890.1| PREDICTED: protein SEC13 homolog [Setaria italica]
Length=301

 Score =   156 bits (394),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 78/134 (58%), Positives = 98/134 (73%), Gaps = 2/134 (1%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            + A G+L GSG  + V KL S G D+ VKVW   +G WK++      MHT  VRDV+WAP
Sbjct  162  ATALGSLAGSG--ELVYKLVSGGFDSVVKVWGFVDGSWKLEGALISDMHTDCVRDVSWAP  219

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
             LG+ KSTIAS S+DGKVVIWT  K+GD+WEGK++ DF  PVWRVSWSLTGN L++ +G+
Sbjct  220  VLGMAKSTIASGSQDGKVVIWTKGKDGDKWEGKLMRDFGAPVWRVSWSLTGNILSIAAGE  279

Query  283  NNVTLWNEAVDGEW  242
            NN+TLW E  DG+W
Sbjct  280  NNITLWKEGSDGQW  293



>ref|XP_008651486.1| PREDICTED: SEC13-related protein isoform X2 [Zea mays]
Length=421

 Score =   158 bits (400),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 94/132 (71%), Gaps = 0/132 (0%)
 Frame = -1

Query  637  APGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAPNL  458
            AP     +G  + V KL S G D+ VKVW   NG WK++      MHT  VRDVAWAP L
Sbjct  282  APATASLAGAGELVYKLVSGGFDSVVKVWGFNNGSWKLESALISDMHTDCVRDVAWAPVL  341

Query  457  GLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGDNN  278
            GL KSTIAS S+DGKVVIWT  K+GD+WEGK++ DF +PVWRVSWSLTGN L + +G+NN
Sbjct  342  GLSKSTIASGSQDGKVVIWTKGKDGDKWEGKLMRDFGSPVWRVSWSLTGNILCIAAGENN  401

Query  277  VTLWNEAVDGEW  242
            +TLW E  DG+W
Sbjct  402  ITLWKEGSDGQW  413



>ref|NP_001146460.1| SEC13 protein [Zea mays]
 gb|ACL54052.1| unknown [Zea mays]
 tpg|DAA39762.1| TPA: SEC13 protein [Zea mays]
Length=305

 Score =   155 bits (392),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 94/132 (71%), Gaps = 0/132 (0%)
 Frame = -1

Query  637  APGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAPNL  458
            AP     +G  + V KL S G D+ VKVW   NG WK++      MHT  VRDVAWAP L
Sbjct  166  APATDSIAGTGEFVYKLVSGGFDSVVKVWGFNNGSWKLESALISDMHTDCVRDVAWAPVL  225

Query  457  GLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGDNN  278
            GL KSTIASAS+DGKVVIWT  K+GD+WE K++ DF +PVWRVSWSLTGN L++ +G NN
Sbjct  226  GLAKSTIASASQDGKVVIWTRGKDGDKWERKLMRDFGSPVWRVSWSLTGNILSIAAGGNN  285

Query  277  VTLWNEAVDGEW  242
            +TLW E  DG+W
Sbjct  286  ITLWKEGSDGQW  297



>gb|ABK26766.1| unknown [Picea sitchensis]
Length=94

 Score =   147 bits (372),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 72/87 (83%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = -1

Query  502  MHTXWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSW  323
            MHT WVRDVAWAPNLGLPKSTIAS S+DGKV IWT  KEGD+WEGK+L DF TPVWRVSW
Sbjct  1    MHTDWVRDVAWAPNLGLPKSTIASCSQDGKVAIWTQGKEGDKWEGKILNDFKTPVWRVSW  60

Query  322  SLTGNXLAVXSGDNNVTLWNEAVDGEW  242
            SLTGN LAV  G+NNVTLW EAVDGEW
Sbjct  61   SLTGNILAVADGNNNVTLWKEAVDGEW  87



>ref|XP_010228200.1| PREDICTED: protein transport protein SEC13 homolog B-like [Brachypodium 
distachyon]
Length=301

 Score =   152 bits (385),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 96/134 (72%), Gaps = 2/134 (1%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            + A G L  SG  + V KL S G D+ VKVW+  NG W +D      MHT  VRDVAW P
Sbjct  162  ATALGLLASSG--EVVCKLVSGGFDSVVKVWEFTNGSWNLDSALPSDMHTDCVRDVAWPP  219

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
             LGL KSTIASA +DGKVVIWT  K+GD+W+G V++DF TPVWRVSWSLTGN L+V +G+
Sbjct  220  VLGLAKSTIASACQDGKVVIWTRVKDGDKWQGMVMHDFKTPVWRVSWSLTGNILSVAAGE  279

Query  283  NNVTLWNEAVDGEW  242
            +N+TLW EA  G+W
Sbjct  280  SNITLWKEASGGQW  293



>dbj|BAJ95085.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=317

 Score =   151 bits (381),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 93/130 (72%), Gaps = 2/130 (2%)
 Frame = -1

Query  631  GALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAPNLGL  452
            G++ GSG    V KL S G D  VKVW+  NG WK++      MH   VRDV+WAP LGL
Sbjct  167  GSMVGSG--QLVHKLVSGGFDCVVKVWEFVNGGWKLESAMVSDMHKECVRDVSWAPVLGL  224

Query  451  PKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGDNNVT  272
             KSTIASAS+DGKVVIWT  K G +WEGK++ DF  PVWRVSWSLTGN L+V +G+ ++T
Sbjct  225  AKSTIASASQDGKVVIWTSGKAGGKWEGKLMRDFEAPVWRVSWSLTGNILSVAAGEGDIT  284

Query  271  LWNEAVDGEW  242
            LW E+ DG+W
Sbjct  285  LWKESSDGQW  294



>ref|XP_003563373.1| PREDICTED: protein transport protein SEC13 homolog B-like [Brachypodium 
distachyon]
 ref|XP_010240532.1| PREDICTED: protein transport protein SEC13 homolog B-like [Brachypodium 
distachyon]
Length=316

 Score =   147 bits (371),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 77/134 (57%), Positives = 90/134 (67%), Gaps = 2/134 (1%)
 Frame = -1

Query  637  APGALXGS--GLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            AP    GS  G    V KL S G D  VKVW+  NG WK++      MH   VRDV+WAP
Sbjct  160  APATALGSMVGSDQLVHKLVSGGFDCVVKVWEFVNGGWKVESALVSDMHAECVRDVSWAP  219

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
             LGL KSTIASAS+DGKVVIWT  K GD+WEGK++ D   PVWRVSWSLTGN L+V +G+
Sbjct  220  VLGLAKSTIASASQDGKVVIWTKGKGGDKWEGKMMRDLEAPVWRVSWSLTGNILSVAAGE  279

Query  283  NNVTLWNEAVDGEW  242
              +TLW E  DG+W
Sbjct  280  GAITLWKETSDGQW  293



>gb|EEE60233.1| hypothetical protein OsJ_13231 [Oryza sativa Japonica Group]
Length=151

 Score =   142 bits (359),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 75/122 (61%), Positives = 87/122 (71%), Gaps = 2/122 (2%)
 Frame = -1

Query  643  SMAPGALXGSGLXDPVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAP  464
            + A G++ GSG  + VQKL S G D  VKVW   NG WK+D      MHT  VRDV+WAP
Sbjct  30   ATALGSIVGSG--ELVQKLVSGGFDCVVKVWAFVNGSWKLDSVLPSDMHTDCVRDVSWAP  87

Query  463  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGD  284
             LGL K TIASASEDGKVVIWT  KEGD+WEGKV++DF  P WRVSWSLTGN L+V +G 
Sbjct  88   VLGLAKFTIASASEDGKVVIWTKGKEGDKWEGKVMHDFEAPAWRVSWSLTGNILSVAAGS  147

Query  283  NN  278
             +
Sbjct  148  GD  149



>gb|KIY93193.1| SEC13-related protein [Monoraphidium neglectum]
Length=140

 Score =   138 bits (348),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 85/120 (71%), Gaps = 2/120 (2%)
 Frame = -1

Query  601  PVQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRDVAWAPNLGLPKSTIASASE  422
            PV++L S GCDNT KVW   +G W  +    LQ HT WVRD AWAPNLGLP +TIA+A +
Sbjct  18   PVKRLVSAGCDNTAKVWGCSSGGWAQEAL--LQGHTDWVRDAAWAPNLGLPINTIATAGQ  75

Query  421  DGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNXLAVXSGDNNVTLWNEAVDGEW  242
            DG+V+ W+   +G  W+  V++DF TPVWRVSWS+TG  LA   G+N V+LW E++DG W
Sbjct  76   DGQVISWSERADGSGWDRAVVHDFRTPVWRVSWSVTGGILAASDGNNAVSLWKESLDGTW  135



>ref|XP_008303630.1| PREDICTED: protein SEC13 homolog, partial [Stegastes partitus]
Length=227

 Score =   139 bits (350),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 93/142 (65%), Gaps = 10/142 (7%)
 Frame = -1

Query  643  SMAPGALXGSGLXDP-------VQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWV  485
            S AP  + GS +  P       V++  S GCDN VK+WK  +G WK D    L+ H+ WV
Sbjct  64   SWAPAVVPGSLIDQPSGQKPNYVKRFVSGGCDNLVKLWKEEDGQWKED--QKLEAHSDWV  121

Query  484  RDVAWAPNLGLPKSTIASASEDGKVVIWTVAK-EGDQWEGKVLYDFNTPVWRVSWSLTGN  308
            RDV WAP++GLP STIAS S+DG+V IWT     G+ W  K+L+ FN  VW VSWS+TGN
Sbjct  122  RDVGWAPSIGLPTSTIASCSQDGRVFIWTCDDPAGNTWTAKLLHKFNDVVWHVSWSITGN  181

Query  307  XLAVXSGDNNVTLWNEAVDGEW  242
             LAV  GDN VTLW E++DG+W
Sbjct  182  ILAVSGGDNKVTLWKESMDGQW  203



>ref|XP_010001682.1| PREDICTED: protein SEC13 homolog [Chaetura pelagica]
Length=308

 Score =   140 bits (353),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 94/142 (66%), Gaps = 10/142 (7%)
 Frame = -1

Query  643  SMAPGALXGSGLXDP-------VQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWV  485
            S AP  + GS +  P       +++ AS GCDN VK+WK  +G WK +    L+ H+ WV
Sbjct  145  SWAPAVVPGSLIEQPSGQKPNYIKRFASGGCDNLVKIWKEEDGQWKEE--QKLEAHSDWV  202

Query  484  RDVAWAPNLGLPKSTIASASEDGKVVIWTVAK-EGDQWEGKVLYDFNTPVWRVSWSLTGN  308
            RDVAWAP++GLP STIAS S+DG+V IWT     G+ W  K+L+ FN  VW VSWS+T N
Sbjct  203  RDVAWAPSIGLPTSTIASCSQDGRVFIWTCDDASGNSWSPKLLHKFNDVVWHVSWSITAN  262

Query  307  XLAVXSGDNNVTLWNEAVDGEW  242
             LAV  GDN VTLW E+VDG+W
Sbjct  263  ILAVSGGDNKVTLWKESVDGQW  284



>gb|KFU93946.1| Protein SEC13, partial [Chaetura pelagica]
Length=304

 Score =   140 bits (353),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 94/142 (66%), Gaps = 10/142 (7%)
 Frame = -1

Query  643  SMAPGALXGSGLXDP-------VQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWV  485
            S AP  + GS +  P       +++ AS GCDN VK+WK  +G WK +    L+ H+ WV
Sbjct  141  SWAPAVVPGSLIEQPSGQKPNYIKRFASGGCDNLVKIWKEEDGQWKEE--QKLEAHSDWV  198

Query  484  RDVAWAPNLGLPKSTIASASEDGKVVIWTVAK-EGDQWEGKVLYDFNTPVWRVSWSLTGN  308
            RDVAWAP++GLP STIAS S+DG+V IWT     G+ W  K+L+ FN  VW VSWS+T N
Sbjct  199  RDVAWAPSIGLPTSTIASCSQDGRVFIWTCDDASGNSWSPKLLHKFNDVVWHVSWSITAN  258

Query  307  XLAVXSGDNNVTLWNEAVDGEW  242
             LAV  GDN VTLW E+VDG+W
Sbjct  259  ILAVSGGDNKVTLWKESVDGQW  280



>gb|KFV05646.1| Protein SEC13, partial [Tauraco erythrolophus]
Length=216

 Score =   138 bits (347),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 93/142 (65%), Gaps = 10/142 (7%)
 Frame = -1

Query  643  SMAPGALXGSGLXDP-------VQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWV  485
            S AP  + GS +  P       +++ AS GCDN VK+WK  +G WK +    L+ H+ WV
Sbjct  53   SWAPAVVPGSLIEQPSGQKPNYIKRFASGGCDNLVKIWKEEDGQWKEE--QKLEAHSDWV  110

Query  484  RDVAWAPNLGLPKSTIASASEDGKVVIWTVAK-EGDQWEGKVLYDFNTPVWRVSWSLTGN  308
            RDVAWAP++GLP STIAS S+DG+V IWT     G+ W  K+L+ FN  VW VSWS+T N
Sbjct  111  RDVAWAPSIGLPTSTIASCSQDGRVFIWTCDDASGNSWSPKLLHKFNDVVWHVSWSITAN  170

Query  307  XLAVXSGDNNVTLWNEAVDGEW  242
             LAV  GDN VTLW E+VDG W
Sbjct  171  ILAVSGGDNKVTLWKESVDGLW  192



>ref|NP_998500.1| protein SEC13 homolog [Danio rerio]
 gb|AAH54585.1| SEC13 homolog (S. cerevisiae) [Danio rerio]
 emb|CAK11154.1| SEC13-like 1 (S. cerevisiae) [Danio rerio]
 gb|AAI53484.1| SEC13 homolog (S. cerevisiae) [Danio rerio]
Length=320

 Score =   140 bits (354),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/140 (52%), Positives = 92/140 (66%), Gaps = 10/140 (7%)
 Frame = -1

Query  637  APGALXGSGLXDP-------VQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRD  479
            AP  + GS +  P       +++  S GCDN VK+WK  +G WK D    L+ H+ WVRD
Sbjct  159  APAVVPGSLIEQPTGQKPNYIKRFVSGGCDNLVKLWKEEDGQWKED--QKLEAHSDWVRD  216

Query  478  VAWAPNLGLPKSTIASASEDGKVVIWTVAK-EGDQWEGKVLYDFNTPVWRVSWSLTGNXL  302
            V WAP++GLP STIAS S+DG+V IWT     G+ W  K+L+ FN  VW VSWS+TGN L
Sbjct  217  VGWAPSIGLPTSTIASCSQDGRVFIWTCDDPAGNTWTAKLLHKFNDVVWHVSWSITGNIL  276

Query  301  AVXSGDNNVTLWNEAVDGEW  242
            AV  GDN VTLW E+VDG+W
Sbjct  277  AVSGGDNKVTLWKESVDGQW  296



>ref|XP_009988542.1| PREDICTED: protein SEC13 homolog, partial [Tauraco erythrolophus]
Length=219

 Score =   138 bits (347),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 93/142 (65%), Gaps = 10/142 (7%)
 Frame = -1

Query  643  SMAPGALXGSGLXDP-------VQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWV  485
            S AP  + GS +  P       +++ AS GCDN VK+WK  +G WK +    L+ H+ WV
Sbjct  56   SWAPAVVPGSLIEQPSGQKPNYIKRFASGGCDNLVKIWKEEDGQWKEE--QKLEAHSDWV  113

Query  484  RDVAWAPNLGLPKSTIASASEDGKVVIWTVAK-EGDQWEGKVLYDFNTPVWRVSWSLTGN  308
            RDVAWAP++GLP STIAS S+DG+V IWT     G+ W  K+L+ FN  VW VSWS+T N
Sbjct  114  RDVAWAPSIGLPTSTIASCSQDGRVFIWTCDDASGNSWSPKLLHKFNDVVWHVSWSITAN  173

Query  307  XLAVXSGDNNVTLWNEAVDGEW  242
             LAV  GDN VTLW E+VDG W
Sbjct  174  ILAVSGGDNKVTLWKESVDGLW  195



>ref|XP_006631140.1| PREDICTED: protein SEC13 homolog [Lepisosteus oculatus]
Length=325

 Score =   140 bits (353),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/140 (52%), Positives = 92/140 (66%), Gaps = 10/140 (7%)
 Frame = -1

Query  637  APGALXGSGLXDP-------VQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRD  479
            AP  + GS +  P       +++  S GCDN VK+WK  +G WK D    L+ H+ WVRD
Sbjct  164  APAVVPGSLIDQPLGQKPNLIKRFVSGGCDNLVKLWKEEDGQWKED--QKLEAHSDWVRD  221

Query  478  VAWAPNLGLPKSTIASASEDGKVVIWTVAK-EGDQWEGKVLYDFNTPVWRVSWSLTGNXL  302
            V WAP++GLP STIAS S+DG+V IWT     G+ W  K+L+ FN  VW VSWS+TGN L
Sbjct  222  VGWAPSIGLPTSTIASCSQDGRVFIWTCDDPSGNAWTAKLLHKFNDVVWHVSWSITGNIL  281

Query  301  AVXSGDNNVTLWNEAVDGEW  242
            AV  GDN VTLW E+VDG+W
Sbjct  282  AVSGGDNKVTLWKESVDGQW  301



>ref|XP_008319422.1| PREDICTED: protein SEC13 homolog [Cynoglossus semilaevis]
Length=320

 Score =   140 bits (353),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 74/140 (53%), Positives = 92/140 (66%), Gaps = 10/140 (7%)
 Frame = -1

Query  637  APGALXGSGLXDP-------VQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRD  479
            AP  L GS +  P       V++  S GCDN VK+WK  +G WK D    L+ H+ WVRD
Sbjct  159  APAVLPGSLIDQPTSQKPNYVKRFVSGGCDNLVKLWKEEDGQWKED--QKLEAHSDWVRD  216

Query  478  VAWAPNLGLPKSTIASASEDGKVVIWTVAK-EGDQWEGKVLYDFNTPVWRVSWSLTGNXL  302
            V WAP++GLP STIAS S+DG+V IWT     G+ W  K+L+ FN  VW VSWS+TGN L
Sbjct  217  VGWAPSIGLPTSTIASCSQDGRVFIWTCDDPSGNTWTTKLLHKFNDVVWHVSWSITGNIL  276

Query  301  AVXSGDNNVTLWNEAVDGEW  242
            AV  GDN VTLW E++DG+W
Sbjct  277  AVSGGDNKVTLWKESMDGQW  296



>ref|XP_010745417.1| PREDICTED: protein SEC13 homolog [Larimichthys crocea]
Length=320

 Score =   139 bits (351),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 73/140 (52%), Positives = 92/140 (66%), Gaps = 10/140 (7%)
 Frame = -1

Query  637  APGALXGSGLXDP-------VQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRD  479
            AP  + GS +  P       V++  S GCDN VK+WK  +G WK D    L+ H+ WVRD
Sbjct  159  APAVVPGSLIDQPSGQKPNYVKRFVSGGCDNLVKLWKEEDGQWKED--QKLEAHSDWVRD  216

Query  478  VAWAPNLGLPKSTIASASEDGKVVIWTVAK-EGDQWEGKVLYDFNTPVWRVSWSLTGNXL  302
            V WAP++GLP STIAS S+DG+V IWT     G+ W  K+L+ FN  VW VSWS+TGN L
Sbjct  217  VGWAPSIGLPTSTIASCSQDGRVFIWTCDDPAGNTWTAKLLHKFNDVVWHVSWSITGNIL  276

Query  301  AVXSGDNNVTLWNEAVDGEW  242
            AV  GDN VTLW E++DG+W
Sbjct  277  AVSGGDNKVTLWKESMDGQW  296



>ref|XP_008303874.1| PREDICTED: protein SEC13 homolog [Stegastes partitus]
Length=320

 Score =   139 bits (351),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 73/140 (52%), Positives = 92/140 (66%), Gaps = 10/140 (7%)
 Frame = -1

Query  637  APGALXGSGLXDP-------VQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRD  479
            AP  + GS +  P       V++  S GCDN VK+WK  +G WK D    L+ H+ WVRD
Sbjct  159  APAVVPGSLIDQPSGQKPNYVKRFVSGGCDNLVKLWKEEDGQWKED--QKLEAHSDWVRD  216

Query  478  VAWAPNLGLPKSTIASASEDGKVVIWTVAK-EGDQWEGKVLYDFNTPVWRVSWSLTGNXL  302
            V WAP++GLP STIAS S+DG+V IWT     G+ W  K+L+ FN  VW VSWS+TGN L
Sbjct  217  VGWAPSIGLPTSTIASCSQDGRVFIWTCDDPAGNTWTAKLLHKFNDVVWHVSWSITGNIL  276

Query  301  AVXSGDNNVTLWNEAVDGEW  242
            AV  GDN VTLW E++DG+W
Sbjct  277  AVSGGDNKVTLWKESMDGQW  296



>ref|XP_005754890.1| PREDICTED: protein SEC13 homolog [Pundamilia nyererei]
Length=308

 Score =   139 bits (350),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 93/142 (65%), Gaps = 10/142 (7%)
 Frame = -1

Query  643  SMAPGALXGSGLXDP-------VQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWV  485
            S AP  + GS +  P       V++  S GCDN VK+WK  +G WK D    L+ H+ WV
Sbjct  145  SWAPAIVPGSLIDQPSGQKPNYVKRFVSGGCDNLVKLWKEEDGQWKED--QKLEAHSDWV  202

Query  484  RDVAWAPNLGLPKSTIASASEDGKVVIWTVAK-EGDQWEGKVLYDFNTPVWRVSWSLTGN  308
            RDV WAP++GLP STIAS S+DG+V IWT     G+ W  K+L+ FN  VW VSWS+TGN
Sbjct  203  RDVGWAPSIGLPTSTIASCSQDGRVFIWTCDDPAGNTWTAKLLHKFNDVVWHVSWSITGN  262

Query  307  XLAVXSGDNNVTLWNEAVDGEW  242
             LAV  GDN VTLW E++DG+W
Sbjct  263  ILAVSGGDNKVTLWKESMDGQW  284



>ref|XP_007569682.1| PREDICTED: protein SEC13 homolog [Poecilia formosa]
 ref|XP_008407412.1| PREDICTED: protein SEC13 homolog [Poecilia reticulata]
Length=320

 Score =   139 bits (350),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 74/140 (53%), Positives = 92/140 (66%), Gaps = 10/140 (7%)
 Frame = -1

Query  637  APGALXGSGLXDP-------VQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRD  479
            AP  + GS +  P       V++  S GCDN VK+WK  +G WK D    L+ H+ WVRD
Sbjct  159  APAVVPGSLIDQPSGQKPNYVKRFVSGGCDNLVKLWKEEDGQWKED--QKLEAHSDWVRD  216

Query  478  VAWAPNLGLPKSTIASASEDGKVVIWTVAK-EGDQWEGKVLYDFNTPVWRVSWSLTGNXL  302
            V WAP++GLP STIAS S+DG+V IWT     G+ W  K+L+ FN  VW VSWS+TGN L
Sbjct  217  VGWAPSIGLPTSTIASCSQDGRVFIWTCDDPAGNTWTVKLLHKFNDVVWHVSWSITGNIL  276

Query  301  AVXSGDNNVTLWNEAVDGEW  242
            AV  GDN VTLW E+VDG+W
Sbjct  277  AVSGGDNKVTLWKESVDGQW  296



>ref|XP_004559093.1| PREDICTED: protein SEC13 homolog [Maylandia zebra]
 ref|XP_005456487.1| PREDICTED: protein SEC13 homolog [Oreochromis niloticus]
 ref|XP_005946628.1| PREDICTED: protein SEC13 homolog [Haplochromis burtoni]
Length=320

 Score =   139 bits (350),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 73/140 (52%), Positives = 92/140 (66%), Gaps = 10/140 (7%)
 Frame = -1

Query  637  APGALXGSGLXDP-------VQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRD  479
            AP  + GS +  P       V++  S GCDN VK+WK  +G WK D    L+ H+ WVRD
Sbjct  159  APAIVPGSLIDQPSGQKPNYVKRFVSGGCDNLVKLWKEEDGQWKED--QKLEAHSDWVRD  216

Query  478  VAWAPNLGLPKSTIASASEDGKVVIWTVAK-EGDQWEGKVLYDFNTPVWRVSWSLTGNXL  302
            V WAP++GLP STIAS S+DG+V IWT     G+ W  K+L+ FN  VW VSWS+TGN L
Sbjct  217  VGWAPSIGLPTSTIASCSQDGRVFIWTCDDPAGNTWTAKLLHKFNDVVWHVSWSITGNIL  276

Query  301  AVXSGDNNVTLWNEAVDGEW  242
            AV  GDN VTLW E++DG+W
Sbjct  277  AVSGGDNKVTLWKESMDGQW  296



>ref|XP_005997883.1| PREDICTED: protein SEC13 homolog [Latimeria chalumnae]
Length=320

 Score =   139 bits (349),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 74/140 (53%), Positives = 92/140 (66%), Gaps = 10/140 (7%)
 Frame = -1

Query  637  APGALXGSGLXDP-------VQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRD  479
            AP  + GS +  P       V++  S GCDN VK+WK  +G WK D    L+ H+ WVRD
Sbjct  159  APAVVPGSLVDQPSGQKPNYVKRFVSGGCDNLVKLWKEEDGQWKDD--QKLEAHSDWVRD  216

Query  478  VAWAPNLGLPKSTIASASEDGKVVIWTVAK-EGDQWEGKVLYDFNTPVWRVSWSLTGNXL  302
            VAWAP++GLP S+IAS S+DG+V IWT     G+ W  K L+ FN  VW VSWS+TGN L
Sbjct  217  VAWAPSIGLPTSSIASCSQDGRVFIWTCDDPSGNAWTAKELHKFNDVVWHVSWSITGNIL  276

Query  301  AVXSGDNNVTLWNEAVDGEW  242
            AV  GDN VTLW E+VDG+W
Sbjct  277  AVSGGDNKVTLWKESVDGQW  296



>ref|XP_010388584.1| PREDICTED: protein SEC13 homolog [Corvus cornix cornix]
Length=300

 Score =   138 bits (348),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 93/142 (65%), Gaps = 10/142 (7%)
 Frame = -1

Query  643  SMAPGALXGSGLXDP-------VQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWV  485
            S AP  + GS +  P       +++ AS GCDN VK+WK  +G WK +    L+ H+ WV
Sbjct  137  SWAPAVVPGSLIEQPSGQKPNYIKRFASGGCDNLVKIWKEEDGQWKEE--QKLEAHSDWV  194

Query  484  RDVAWAPNLGLPKSTIASASEDGKVVIWTVAK-EGDQWEGKVLYDFNTPVWRVSWSLTGN  308
            RDVAWAP++GLP STIAS S+DG+V IWT     G+ W  K+L+ FN  VW VSWS+T N
Sbjct  195  RDVAWAPSIGLPTSTIASCSQDGRVFIWTCDDASGNSWSPKLLHKFNDVVWHVSWSITAN  254

Query  307  XLAVXSGDNNVTLWNEAVDGEW  242
             LAV  GDN VTLW E+VDG W
Sbjct  255  ILAVSGGDNKVTLWKESVDGLW  276



>ref|XP_009512940.1| PREDICTED: protein SEC13 homolog, partial [Phalacrocorax carbo]
Length=319

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 93/142 (65%), Gaps = 10/142 (7%)
 Frame = -1

Query  643  SMAPGALXGSGLXDP-------VQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWV  485
            S AP  + GS +  P       +++ AS GCDN VK+WK  +G WK +    L+ H+ WV
Sbjct  156  SWAPAVVPGSLIEQPSGQKPNYIKRFASGGCDNLVKIWKEEDGQWKEE--QKLEAHSDWV  213

Query  484  RDVAWAPNLGLPKSTIASASEDGKVVIWTVAK-EGDQWEGKVLYDFNTPVWRVSWSLTGN  308
            RDVAWAP++GLP STIAS S+DG+V IWT     G+ W  K+L+ FN  VW VSWS+T N
Sbjct  214  RDVAWAPSIGLPTSTIASCSQDGRVFIWTCDDASGNSWSPKLLHKFNDVVWHVSWSITAN  273

Query  307  XLAVXSGDNNVTLWNEAVDGEW  242
             LAV  GDN VTLW E+VDG W
Sbjct  274  ILAVSGGDNKVTLWKESVDGLW  295



>ref|XP_009564163.1| PREDICTED: protein SEC13 homolog [Cuculus canorus]
 ref|XP_010568568.1| PREDICTED: protein SEC13 homolog [Haliaeetus leucocephalus]
 ref|XP_010717077.1| PREDICTED: protein SEC13 homolog [Meleagris gallopavo]
Length=306

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 93/142 (65%), Gaps = 10/142 (7%)
 Frame = -1

Query  643  SMAPGALXGSGLXDP-------VQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWV  485
            S AP  + GS +  P       +++ AS GCDN VK+WK  +G WK +    L+ H+ WV
Sbjct  143  SWAPAVVPGSLIEQPSGQKPNYIKRFASGGCDNLVKIWKEEDGQWKEE--QKLEAHSDWV  200

Query  484  RDVAWAPNLGLPKSTIASASEDGKVVIWTVAK-EGDQWEGKVLYDFNTPVWRVSWSLTGN  308
            RDVAWAP++GLP STIAS S+DG+V IWT     G+ W  K+L+ FN  VW VSWS+T N
Sbjct  201  RDVAWAPSIGLPTSTIASCSQDGRVFIWTCDDASGNSWSPKLLHKFNDVVWHVSWSITAN  260

Query  307  XLAVXSGDNNVTLWNEAVDGEW  242
             LAV  GDN VTLW E+VDG W
Sbjct  261  ILAVSGGDNKVTLWKESVDGLW  282



>ref|XP_005240252.1| PREDICTED: protein SEC13 homolog [Falco peregrinus]
 ref|XP_005443627.1| PREDICTED: protein SEC13 homolog [Falco cherrug]
Length=306

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 93/142 (65%), Gaps = 10/142 (7%)
 Frame = -1

Query  643  SMAPGALXGSGLXDP-------VQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWV  485
            S AP  + GS +  P       +++ AS GCDN VK+WK  +G WK +    L+ H+ WV
Sbjct  143  SWAPAVVPGSLIEQPSGQKPNYIKRFASGGCDNLVKIWKEEDGQWKEE--QKLEAHSDWV  200

Query  484  RDVAWAPNLGLPKSTIASASEDGKVVIWTVAK-EGDQWEGKVLYDFNTPVWRVSWSLTGN  308
            RDVAWAP++GLP STIAS S+DG+V IWT     G+ W  K+L+ FN  VW VSWS+T N
Sbjct  201  RDVAWAPSIGLPTSTIASCSQDGRVFIWTCDDASGNSWSPKLLHKFNDVVWHVSWSITAN  260

Query  307  XLAVXSGDNNVTLWNEAVDGEW  242
             LAV  GDN VTLW E+VDG W
Sbjct  261  ILAVSGGDNKVTLWKESVDGLW  282



>ref|XP_010123453.1| PREDICTED: protein SEC13 homolog, partial [Chlamydotis macqueenii]
 gb|EOB06837.1| Protein SEC13-like protein, partial [Anas platyrhynchos]
 gb|KFP44236.1| Protein SEC13, partial [Chlamydotis macqueenii]
 gb|KFQ75978.1| Protein SEC13, partial [Phoenicopterus ruber ruber]
 gb|KFZ67354.1| Protein SEC13, partial [Podiceps cristatus]
Length=304

 Score =   138 bits (348),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 93/142 (65%), Gaps = 10/142 (7%)
 Frame = -1

Query  643  SMAPGALXGSGLXDP-------VQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWV  485
            S AP  + GS +  P       +++ AS GCDN VK+WK  +G WK +    L+ H+ WV
Sbjct  141  SWAPAVVPGSLIEQPSGQKPNYIKRFASGGCDNLVKIWKEEDGQWKEE--QKLEAHSDWV  198

Query  484  RDVAWAPNLGLPKSTIASASEDGKVVIWTVAK-EGDQWEGKVLYDFNTPVWRVSWSLTGN  308
            RDVAWAP++GLP STIAS S+DG+V IWT     G+ W  K+L+ FN  VW VSWS+T N
Sbjct  199  RDVAWAPSIGLPTSTIASCSQDGRVFIWTCDDASGNSWSPKLLHKFNDVVWHVSWSITAN  258

Query  307  XLAVXSGDNNVTLWNEAVDGEW  242
             LAV  GDN VTLW E+VDG W
Sbjct  259  ILAVSGGDNKVTLWKESVDGLW  280



>ref|XP_008939207.1| PREDICTED: protein SEC13 homolog [Merops nubicus]
Length=300

 Score =   138 bits (348),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 93/142 (65%), Gaps = 10/142 (7%)
 Frame = -1

Query  643  SMAPGALXGSGLXDP-------VQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWV  485
            S AP  + GS +  P       +++ AS GCDN VK+WK  +G WK +    L+ H+ WV
Sbjct  137  SWAPAVVPGSLIEQPSGQKPNYIKRFASGGCDNLVKIWKEEDGQWKEE--QKLEAHSDWV  194

Query  484  RDVAWAPNLGLPKSTIASASEDGKVVIWTVAK-EGDQWEGKVLYDFNTPVWRVSWSLTGN  308
            RDVAWAP++GLP STIAS S+DG+V IWT     G+ W  K+L+ FN  VW VSWS+T N
Sbjct  195  RDVAWAPSIGLPTSTIASCSQDGRVFIWTCDDASGNSWSPKLLHKFNDVVWHVSWSITAN  254

Query  307  XLAVXSGDNNVTLWNEAVDGEW  242
             LAV  GDN VTLW E+VDG W
Sbjct  255  ILAVSGGDNKVTLWKESVDGLW  276



>ref|XP_010022441.1| PREDICTED: protein SEC13 homolog, partial [Nestor notabilis]
 gb|KFQ45343.1| Protein SEC13, partial [Nestor notabilis]
Length=304

 Score =   138 bits (348),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 93/142 (65%), Gaps = 10/142 (7%)
 Frame = -1

Query  643  SMAPGALXGSGLXDP-------VQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWV  485
            S AP  + GS +  P       +++ AS GCDN VK+WK  +G WK +    L+ H+ WV
Sbjct  141  SWAPAVVPGSLIEQPSGQKPNYIKRFASGGCDNLVKIWKEEDGQWKEE--QKLEAHSDWV  198

Query  484  RDVAWAPNLGLPKSTIASASEDGKVVIWTVAK-EGDQWEGKVLYDFNTPVWRVSWSLTGN  308
            RDVAWAP++GLP STIAS S+DG+V IWT     G+ W  K+L+ FN  VW VSWS+T N
Sbjct  199  RDVAWAPSIGLPTSTIASCSQDGRVFIWTCDDASGNSWSPKLLHKFNDVVWHVSWSITAN  258

Query  307  XLAVXSGDNNVTLWNEAVDGEW  242
             LAV  GDN VTLW E+VDG W
Sbjct  259  ILAVSGGDNKVTLWKESVDGLW  280



>gb|KFR14993.1| Protein SEC13, partial [Opisthocomus hoazin]
Length=304

 Score =   138 bits (348),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 93/142 (65%), Gaps = 10/142 (7%)
 Frame = -1

Query  643  SMAPGALXGSGLXDP-------VQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWV  485
            S AP  + GS +  P       +++ AS GCDN VK+WK  +G WK +    L+ H+ WV
Sbjct  141  SWAPAVVPGSLIEQPSGQKPNYIKRFASGGCDNLVKIWKEEDGQWKEE--QKLEAHSDWV  198

Query  484  RDVAWAPNLGLPKSTIASASEDGKVVIWTVAK-EGDQWEGKVLYDFNTPVWRVSWSLTGN  308
            RDVAWAP++GLP STIAS S+DG+V IWT     G+ W  K+L+ FN  VW VSWS+T N
Sbjct  199  RDVAWAPSIGLPTSTIASCSQDGRVFIWTCDDASGNSWSPKLLHKFNDVVWHVSWSITAN  258

Query  307  XLAVXSGDNNVTLWNEAVDGEW  242
             LAV  GDN VTLW E+VDG W
Sbjct  259  ILAVSGGDNKVTLWKESVDGLW  280



>gb|KFV45554.1| Protein SEC13, partial [Gavia stellata]
 gb|KFV93035.1| Protein SEC13, partial [Fulmarus glacialis]
 gb|KGL91525.1| Protein SEC13, partial [Charadrius vociferus]
Length=320

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 93/142 (65%), Gaps = 10/142 (7%)
 Frame = -1

Query  643  SMAPGALXGSGLXDP-------VQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWV  485
            S AP  + GS +  P       +++ AS GCDN VK+WK  +G WK +    L+ H+ WV
Sbjct  157  SWAPAVVPGSLIEQPSGQKPNYIKRFASGGCDNLVKIWKEEDGQWKEE--QKLEAHSDWV  214

Query  484  RDVAWAPNLGLPKSTIASASEDGKVVIWTVAK-EGDQWEGKVLYDFNTPVWRVSWSLTGN  308
            RDVAWAP++GLP STIAS S+DG+V IWT     G+ W  K+L+ FN  VW VSWS+T N
Sbjct  215  RDVAWAPSIGLPTSTIASCSQDGRVFIWTCDDASGNSWSPKLLHKFNDVVWHVSWSITAN  274

Query  307  XLAVXSGDNNVTLWNEAVDGEW  242
             LAV  GDN VTLW E+VDG W
Sbjct  275  ILAVSGGDNKVTLWKESVDGLW  296



>gb|KFP91989.1| Protein SEC13, partial [Apaloderma vittatum]
Length=320

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 93/142 (65%), Gaps = 10/142 (7%)
 Frame = -1

Query  643  SMAPGALXGSGLXDP-------VQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWV  485
            S AP  + GS +  P       +++ AS GCDN VK+WK  +G WK +    L+ H+ WV
Sbjct  157  SWAPAVVPGSLIEQPSGQKPNYIKRFASGGCDNLVKIWKEEDGQWKEE--QKLEAHSDWV  214

Query  484  RDVAWAPNLGLPKSTIASASEDGKVVIWTVAK-EGDQWEGKVLYDFNTPVWRVSWSLTGN  308
            RDVAWAP++GLP STIAS S+DG+V IWT     G+ W  K+L+ FN  VW VSWS+T N
Sbjct  215  RDVAWAPSIGLPTSTIASCSQDGRVFIWTCDDASGNSWSPKLLHKFNDVVWHVSWSITAN  274

Query  307  XLAVXSGDNNVTLWNEAVDGEW  242
             LAV  GDN VTLW E+VDG W
Sbjct  275  ILAVSGGDNKVTLWKESVDGLW  296



>gb|KFQ30001.1| Protein SEC13, partial [Mesitornis unicolor]
 gb|KFU97303.1| Protein SEC13, partial [Pterocles gutturalis]
Length=320

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 93/142 (65%), Gaps = 10/142 (7%)
 Frame = -1

Query  643  SMAPGALXGSGLXDP-------VQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWV  485
            S AP  + GS +  P       +++ AS GCDN VK+WK  +G WK +    L+ H+ WV
Sbjct  157  SWAPAVVPGSLIEQPSGQKPNYIKRFASGGCDNLVKIWKEEDGQWKEE--QKLEAHSDWV  214

Query  484  RDVAWAPNLGLPKSTIASASEDGKVVIWTVAK-EGDQWEGKVLYDFNTPVWRVSWSLTGN  308
            RDVAWAP++GLP STIAS S+DG+V IWT     G+ W  K+L+ FN  VW VSWS+T N
Sbjct  215  RDVAWAPSIGLPTSTIASCSQDGRVFIWTCDDASGNSWSPKLLHKFNDVVWHVSWSITAN  274

Query  307  XLAVXSGDNNVTLWNEAVDGEW  242
             LAV  GDN VTLW E+VDG W
Sbjct  275  ILAVSGGDNKVTLWKESVDGLW  296



>gb|KFM01351.1| Protein SEC13, partial [Aptenodytes forsteri]
 gb|KFO04787.1| Protein SEC13, partial [Balearica regulorum gibbericeps]
 gb|KFO79809.1| Protein SEC13, partial [Cuculus canorus]
 gb|KFP11868.1| Protein SEC13, partial [Egretta garzetta]
 gb|KFP51582.1| Protein SEC13, partial [Cathartes aura]
 gb|KFP68011.1| Protein SEC13, partial [Cariama cristata]
 gb|KFP95247.1| Protein SEC13, partial [Haliaeetus albicilla]
 gb|KFP97480.1| Protein SEC13, partial [Leptosomus discolor]
 gb|KFQ48236.1| Protein SEC13, partial [Pelecanus crispus]
 gb|KFQ66263.1| Protein SEC13, partial [Phaethon lepturus]
 gb|KFR02377.1| Protein SEC13, partial [Nipponia nippon]
 gb|KFV38797.1| Protein SEC13, partial [Tyto alba]
 gb|KFV99230.1| Protein SEC13, partial [Eurypyga helias]
 gb|KFW64389.1| Protein SEC13, partial [Pygoscelis adeliae]
 gb|KFW95973.1| Protein SEC13, partial [Phalacrocorax carbo]
Length=320

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 93/142 (65%), Gaps = 10/142 (7%)
 Frame = -1

Query  643  SMAPGALXGSGLXDP-------VQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWV  485
            S AP  + GS +  P       +++ AS GCDN VK+WK  +G WK +    L+ H+ WV
Sbjct  157  SWAPAVVPGSLIEQPSGQKPNYIKRFASGGCDNLVKIWKEEDGQWKEE--QKLEAHSDWV  214

Query  484  RDVAWAPNLGLPKSTIASASEDGKVVIWTVAK-EGDQWEGKVLYDFNTPVWRVSWSLTGN  308
            RDVAWAP++GLP STIAS S+DG+V IWT     G+ W  K+L+ FN  VW VSWS+T N
Sbjct  215  RDVAWAPSIGLPTSTIASCSQDGRVFIWTCDDASGNSWSPKLLHKFNDVVWHVSWSITAN  274

Query  307  XLAVXSGDNNVTLWNEAVDGEW  242
             LAV  GDN VTLW E+VDG W
Sbjct  275  ILAVSGGDNKVTLWKESVDGLW  296



>gb|EMC83360.1| Protein SEC13 like protein, partial [Columba livia]
Length=320

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 73/140 (52%), Positives = 92/140 (66%), Gaps = 10/140 (7%)
 Frame = -1

Query  637  APGALXGSGLXDP-------VQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRD  479
            AP  + GS +  P       +++ AS GCDN VK+WK  +G WK +    L+ H+ WVRD
Sbjct  159  APAVVPGSLIEQPSGQKPNYIKRFASGGCDNLVKIWKEEDGQWKEE--QKLEAHSDWVRD  216

Query  478  VAWAPNLGLPKSTIASASEDGKVVIWTVAK-EGDQWEGKVLYDFNTPVWRVSWSLTGNXL  302
            VAWAP++GLP STIAS S+DG+V IWT     G+ W  K+L+ FN  VW VSWS+T N L
Sbjct  217  VAWAPSIGLPTSTIASCSQDGRVFIWTCDDASGNSWSPKLLHKFNDVVWHVSWSITANIL  276

Query  301  AVXSGDNNVTLWNEAVDGEW  242
            AV  GDN VTLW E+VDG W
Sbjct  277  AVSGGDNKVTLWKESVDGLW  296



>ref|XP_010085319.1| PREDICTED: protein SEC13 homolog, partial [Pterocles gutturalis]
 ref|XP_010176870.1| PREDICTED: protein SEC13 homolog, partial [Mesitornis unicolor]
Length=319

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 93/142 (65%), Gaps = 10/142 (7%)
 Frame = -1

Query  643  SMAPGALXGSGLXDP-------VQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWV  485
            S AP  + GS +  P       +++ AS GCDN VK+WK  +G WK +    L+ H+ WV
Sbjct  156  SWAPAVVPGSLIEQPSGQKPNYIKRFASGGCDNLVKIWKEEDGQWKEE--QKLEAHSDWV  213

Query  484  RDVAWAPNLGLPKSTIASASEDGKVVIWTVAK-EGDQWEGKVLYDFNTPVWRVSWSLTGN  308
            RDVAWAP++GLP STIAS S+DG+V IWT     G+ W  K+L+ FN  VW VSWS+T N
Sbjct  214  RDVAWAPSIGLPTSTIASCSQDGRVFIWTCDDASGNSWSPKLLHKFNDVVWHVSWSITAN  273

Query  307  XLAVXSGDNNVTLWNEAVDGEW  242
             LAV  GDN VTLW E+VDG W
Sbjct  274  ILAVSGGDNKVTLWKESVDGLW  295



>ref|XP_009080512.1| PREDICTED: protein SEC13 homolog, partial [Acanthisitta chloris]
Length=319

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 93/142 (65%), Gaps = 10/142 (7%)
 Frame = -1

Query  643  SMAPGALXGSGLXDP-------VQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWV  485
            S AP  + GS +  P       +++ AS GCDN VK+WK  +G WK +    L+ H+ WV
Sbjct  156  SWAPAVVPGSLIEQPSGQKPNYIKRFASGGCDNLVKIWKEEDGQWKEE--QKLEAHSDWV  213

Query  484  RDVAWAPNLGLPKSTIASASEDGKVVIWTVAK-EGDQWEGKVLYDFNTPVWRVSWSLTGN  308
            RDVAWAP++GLP STIAS S+DG+V IWT     G+ W  K+L+ FN  VW VSWS+T N
Sbjct  214  RDVAWAPSIGLPTSTIASCSQDGRVFIWTCDDASGNSWSPKLLHKFNDVVWHVSWSITAN  273

Query  307  XLAVXSGDNNVTLWNEAVDGEW  242
             LAV  GDN VTLW E+VDG W
Sbjct  274  ILAVSGGDNKVTLWKESVDGLW  295



>ref|XP_010134784.1| PREDICTED: protein SEC13 homolog, partial [Buceros rhinoceros 
silvestris]
 gb|KFO89938.1| Protein SEC13, partial [Buceros rhinoceros silvestris]
Length=304

 Score =   138 bits (348),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 93/142 (65%), Gaps = 10/142 (7%)
 Frame = -1

Query  643  SMAPGALXGSGLXDP-------VQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWV  485
            S AP  + GS +  P       +++ AS GCDN VK+WK  +G WK +    L+ H+ WV
Sbjct  141  SWAPAVVPGSLIEQPSGQKPNYIKRFASGGCDNLVKIWKEEDGQWKEE--QKLEAHSDWV  198

Query  484  RDVAWAPNLGLPKSTIASASEDGKVVIWTVAK-EGDQWEGKVLYDFNTPVWRVSWSLTGN  308
            RDVAWAP++GLP STIAS S+DG+V IWT     G+ W  K+L+ FN  VW VSWS+T N
Sbjct  199  RDVAWAPSIGLPTSTIASCSQDGRVFIWTCDDASGNSWSPKLLHKFNDVVWHVSWSITAN  258

Query  307  XLAVXSGDNNVTLWNEAVDGEW  242
             LAV  GDN VTLW E+VDG W
Sbjct  259  ILAVSGGDNKVTLWKESVDGLW  280



>gb|KFZ64786.1| Protein SEC13, partial [Caprimulgus carolinensis]
Length=320

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 93/142 (65%), Gaps = 10/142 (7%)
 Frame = -1

Query  643  SMAPGALXGSGLXDP-------VQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWV  485
            S AP  + GS +  P       +++ AS GCDN VK+WK  +G WK +    L+ H+ WV
Sbjct  157  SWAPAVVPGSLIEQPSGQKPNYIKRFASGGCDNLVKIWKEEDGQWKEE--QKLEAHSDWV  214

Query  484  RDVAWAPNLGLPKSTIASASEDGKVVIWTVAK-EGDQWEGKVLYDFNTPVWRVSWSLTGN  308
            RDVAWAP++GLP STIAS S+DG+V IWT     G+ W  K+L+ FN  VW VSWS+T N
Sbjct  215  RDVAWAPSIGLPTSTIASCSQDGRVFIWTCDDASGNSWSPKLLHKFNDVVWHVSWSITAN  274

Query  307  XLAVXSGDNNVTLWNEAVDGEW  242
             LAV  GDN VTLW E+VDG W
Sbjct  275  ILAVSGGDNKVTLWKESVDGLW  296



>gb|KFP72681.1| Protein SEC13, partial [Acanthisitta chloris]
Length=320

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 93/142 (65%), Gaps = 10/142 (7%)
 Frame = -1

Query  643  SMAPGALXGSGLXDP-------VQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWV  485
            S AP  + GS +  P       +++ AS GCDN VK+WK  +G WK +    L+ H+ WV
Sbjct  157  SWAPAVVPGSLIEQPSGQKPNYIKRFASGGCDNLVKIWKEEDGQWKEE--QKLEAHSDWV  214

Query  484  RDVAWAPNLGLPKSTIASASEDGKVVIWTVAK-EGDQWEGKVLYDFNTPVWRVSWSLTGN  308
            RDVAWAP++GLP STIAS S+DG+V IWT     G+ W  K+L+ FN  VW VSWS+T N
Sbjct  215  RDVAWAPSIGLPTSTIASCSQDGRVFIWTCDDASGNSWSPKLLHKFNDVVWHVSWSITAN  274

Query  307  XLAVXSGDNNVTLWNEAVDGEW  242
             LAV  GDN VTLW E+VDG W
Sbjct  275  ILAVSGGDNKVTLWKESVDGLW  296



>gb|KFQ30347.1| Protein SEC13, partial [Merops nubicus]
Length=304

 Score =   138 bits (348),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 93/142 (65%), Gaps = 10/142 (7%)
 Frame = -1

Query  643  SMAPGALXGSGLXDP-------VQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWV  485
            S AP  + GS +  P       +++ AS GCDN VK+WK  +G WK +    L+ H+ WV
Sbjct  141  SWAPAVVPGSLIEQPSGQKPNYIKRFASGGCDNLVKIWKEEDGQWKEE--QKLEAHSDWV  198

Query  484  RDVAWAPNLGLPKSTIASASEDGKVVIWTVAK-EGDQWEGKVLYDFNTPVWRVSWSLTGN  308
            RDVAWAP++GLP STIAS S+DG+V IWT     G+ W  K+L+ FN  VW VSWS+T N
Sbjct  199  RDVAWAPSIGLPTSTIASCSQDGRVFIWTCDDASGNSWSPKLLHKFNDVVWHVSWSITAN  258

Query  307  XLAVXSGDNNVTLWNEAVDGEW  242
             LAV  GDN VTLW E+VDG W
Sbjct  259  ILAVSGGDNKVTLWKESVDGLW  280



>ref|XP_009490110.1| PREDICTED: protein SEC13 homolog, partial [Pelecanus crispus]
Length=331

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 73/140 (52%), Positives = 92/140 (66%), Gaps = 10/140 (7%)
 Frame = -1

Query  637  APGALXGSGLXDP-------VQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRD  479
            AP  + GS +  P       +++ AS GCDN VK+WK  +G WK +    L+ H+ WVRD
Sbjct  170  APAVVPGSLIEQPSGQKPNYIKRFASGGCDNLVKIWKEEDGQWKEE--QKLEAHSDWVRD  227

Query  478  VAWAPNLGLPKSTIASASEDGKVVIWTVAK-EGDQWEGKVLYDFNTPVWRVSWSLTGNXL  302
            VAWAP++GLP STIAS S+DG+V IWT     G+ W  K+L+ FN  VW VSWS+T N L
Sbjct  228  VAWAPSIGLPTSTIASCSQDGRVFIWTCDDASGNSWSPKLLHKFNDVVWHVSWSITANIL  287

Query  301  AVXSGDNNVTLWNEAVDGEW  242
            AV  GDN VTLW E+VDG W
Sbjct  288  AVSGGDNKVTLWKESVDGLW  307



>ref|XP_009925138.1| PREDICTED: LOW QUALITY PROTEIN: protein SEC13 homolog [Haliaeetus 
albicilla]
Length=334

 Score =   139 bits (350),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 73/140 (52%), Positives = 92/140 (66%), Gaps = 10/140 (7%)
 Frame = -1

Query  637  APGALXGSGLXDP-------VQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRD  479
            AP  + GS +  P       +++ AS GCDN VK+WK  +G WK +    L+ H+ WVRD
Sbjct  173  APAVVPGSLIEQPSGQKPNYIKRFASGGCDNLVKIWKEEDGQWKEE--QKLEAHSDWVRD  230

Query  478  VAWAPNLGLPKSTIASASEDGKVVIWTVAK-EGDQWEGKVLYDFNTPVWRVSWSLTGNXL  302
            VAWAP++GLP STIAS S+DG+V IWT     G+ W  K+L+ FN  VW VSWS+T N L
Sbjct  231  VAWAPSIGLPTSTIASCSQDGRVFIWTCDDASGNSWSPKLLHKFNDVVWHVSWSITANIL  290

Query  301  AVXSGDNNVTLWNEAVDGEW  242
            AV  GDN VTLW E+VDG W
Sbjct  291  AVSGGDNKVTLWKESVDGLW  310



>ref|XP_002741141.1| PREDICTED: protein SEC13 homolog, partial [Saccoglossus kowalevskii]
Length=263

 Score =   137 bits (345),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 72/142 (51%), Positives = 93/142 (65%), Gaps = 10/142 (7%)
 Frame = -1

Query  643  SMAPGALXGSGLXDP-------VQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWV  485
            S AP  + GS +  P       V++  S GCDN VK+WK   G WK +    L+ H+ WV
Sbjct  102  SWAPAVVPGSLIEQPSAQKPITVKRFVSGGCDNLVKIWKEEEGQWKEE--QKLEAHSDWV  159

Query  484  RDVAWAPNLGLPKSTIASASEDGKVVIWTVAKE-GDQWEGKVLYDFNTPVWRVSWSLTGN  308
            RDVAWAP++GLP STIAS S+DG+V+IWT     G  W  K+L+ FN  VW VSWS+TGN
Sbjct  160  RDVAWAPSIGLPHSTIASCSQDGRVIIWTSDDSTGSMWTPKILHKFNDVVWHVSWSITGN  219

Query  307  XLAVXSGDNNVTLWNEAVDGEW  242
             LAV  GDN V+LW E+++G+W
Sbjct  220  ILAVSGGDNKVSLWKESLEGQW  241



>gb|KFO59722.1| Protein SEC13, partial [Corvus brachyrhynchos]
Length=320

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 93/142 (65%), Gaps = 10/142 (7%)
 Frame = -1

Query  643  SMAPGALXGSGLXDP-------VQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWV  485
            S AP  + GS +  P       +++ AS GCDN VK+WK  +G WK +    L+ H+ WV
Sbjct  157  SWAPAVVPGSLIEQPSGQKPNYIKRFASGGCDNLVKIWKEEDGQWKEE--QKLEAHSDWV  214

Query  484  RDVAWAPNLGLPKSTIASASEDGKVVIWTVAK-EGDQWEGKVLYDFNTPVWRVSWSLTGN  308
            RDVAWAP++GLP STIAS S+DG+V IWT     G+ W  K+L+ FN  VW VSWS+T N
Sbjct  215  RDVAWAPSIGLPTSTIASCSQDGRVFIWTCDDASGNSWSPKLLHKFNDVVWHVSWSITAN  274

Query  307  XLAVXSGDNNVTLWNEAVDGEW  242
             LAV  GDN VTLW E+VDG W
Sbjct  275  ILAVSGGDNKVTLWKESVDGLW  296



>ref|XP_005145852.1| PREDICTED: protein SEC13 homolog [Melopsittacus undulatus]
Length=320

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 73/140 (52%), Positives = 92/140 (66%), Gaps = 10/140 (7%)
 Frame = -1

Query  637  APGALXGSGLXDP-------VQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRD  479
            AP  + GS +  P       +++ AS GCDN VK+WK  +G WK +    L+ H+ WVRD
Sbjct  159  APAVVPGSLIEQPSGQKPNYIKRFASGGCDNLVKIWKEEDGQWKEE--QKLEAHSDWVRD  216

Query  478  VAWAPNLGLPKSTIASASEDGKVVIWTVAK-EGDQWEGKVLYDFNTPVWRVSWSLTGNXL  302
            VAWAP++GLP STIAS S+DG+V IWT     G+ W  K+L+ FN  VW VSWS+T N L
Sbjct  217  VAWAPSIGLPTSTIASCSQDGRVFIWTCDDASGNSWSPKLLHKFNDVVWHVSWSITANIL  276

Query  301  AVXSGDNNVTLWNEAVDGEW  242
            AV  GDN VTLW E+VDG W
Sbjct  277  AVSGGDNKVTLWKESVDGLW  296



>ref|XP_009704500.1| PREDICTED: protein SEC13 homolog [Cariama cristata]
Length=331

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 73/140 (52%), Positives = 92/140 (66%), Gaps = 10/140 (7%)
 Frame = -1

Query  637  APGALXGSGLXDP-------VQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRD  479
            AP  + GS +  P       +++ AS GCDN VK+WK  +G WK +    L+ H+ WVRD
Sbjct  170  APAVVPGSLIEQPSGQKPNYIKRFASGGCDNLVKIWKEEDGQWKEE--QKLEAHSDWVRD  227

Query  478  VAWAPNLGLPKSTIASASEDGKVVIWTVAK-EGDQWEGKVLYDFNTPVWRVSWSLTGNXL  302
            VAWAP++GLP STIAS S+DG+V IWT     G+ W  K+L+ FN  VW VSWS+T N L
Sbjct  228  VAWAPSIGLPTSTIASCSQDGRVFIWTCDDASGNSWSPKLLHKFNDVVWHVSWSITANIL  287

Query  301  AVXSGDNNVTLWNEAVDGEW  242
            AV  GDN VTLW E+VDG W
Sbjct  288  AVSGGDNKVTLWKESVDGLW  307



>ref|XP_010172929.1| PREDICTED: protein SEC13 homolog, partial [Caprimulgus carolinensis]
Length=330

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 73/140 (52%), Positives = 92/140 (66%), Gaps = 10/140 (7%)
 Frame = -1

Query  637  APGALXGSGLXDP-------VQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRD  479
            AP  + GS +  P       +++ AS GCDN VK+WK  +G WK +    L+ H+ WVRD
Sbjct  169  APAVVPGSLIEQPSGQKPNYIKRFASGGCDNLVKIWKEEDGQWKEE--QKLEAHSDWVRD  226

Query  478  VAWAPNLGLPKSTIASASEDGKVVIWTVAK-EGDQWEGKVLYDFNTPVWRVSWSLTGNXL  302
            VAWAP++GLP STIAS S+DG+V IWT     G+ W  K+L+ FN  VW VSWS+T N L
Sbjct  227  VAWAPSIGLPTSTIASCSQDGRVFIWTCDDASGNSWSPKLLHKFNDVVWHVSWSITANIL  286

Query  301  AVXSGDNNVTLWNEAVDGEW  242
            AV  GDN VTLW E+VDG W
Sbjct  287  AVSGGDNKVTLWKESVDGLW  306



>ref|XP_005509092.1| PREDICTED: protein SEC13 homolog, partial [Columba livia]
Length=324

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 73/140 (52%), Positives = 92/140 (66%), Gaps = 10/140 (7%)
 Frame = -1

Query  637  APGALXGSGLXDP-------VQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRD  479
            AP  + GS +  P       +++ AS GCDN VK+WK  +G WK +    L+ H+ WVRD
Sbjct  163  APAVVPGSLIEQPSGQKPNYIKRFASGGCDNLVKIWKEEDGQWKEE--QKLEAHSDWVRD  220

Query  478  VAWAPNLGLPKSTIASASEDGKVVIWTVAK-EGDQWEGKVLYDFNTPVWRVSWSLTGNXL  302
            VAWAP++GLP STIAS S+DG+V IWT     G+ W  K+L+ FN  VW VSWS+T N L
Sbjct  221  VAWAPSIGLPTSTIASCSQDGRVFIWTCDDASGNSWSPKLLHKFNDVVWHVSWSITANIL  280

Query  301  AVXSGDNNVTLWNEAVDGEW  242
            AV  GDN VTLW E+VDG W
Sbjct  281  AVSGGDNKVTLWKESVDGLW  300



>ref|XP_010159209.1| PREDICTED: protein SEC13 homolog, partial [Eurypyga helias]
Length=343

 Score =   139 bits (350),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 73/140 (52%), Positives = 92/140 (66%), Gaps = 10/140 (7%)
 Frame = -1

Query  637  APGALXGSGLXDP-------VQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRD  479
            AP  + GS +  P       +++ AS GCDN VK+WK  +G WK +    L+ H+ WVRD
Sbjct  182  APAVVPGSLIEQPSGQKPNYIKRFASGGCDNLVKIWKEEDGQWKEE--QKLEAHSDWVRD  239

Query  478  VAWAPNLGLPKSTIASASEDGKVVIWTVAK-EGDQWEGKVLYDFNTPVWRVSWSLTGNXL  302
            VAWAP++GLP STIAS S+DG+V IWT     G+ W  K+L+ FN  VW VSWS+T N L
Sbjct  240  VAWAPSIGLPTSTIASCSQDGRVFIWTCDDASGNSWSPKLLHKFNDVVWHVSWSITANIL  299

Query  301  AVXSGDNNVTLWNEAVDGEW  242
            AV  GDN VTLW E+VDG W
Sbjct  300  AVSGGDNKVTLWKESVDGLW  319



>ref|XP_009816902.1| PREDICTED: LOW QUALITY PROTEIN: protein SEC13 homolog, partial 
[Gavia stellata]
Length=339

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 73/140 (52%), Positives = 92/140 (66%), Gaps = 10/140 (7%)
 Frame = -1

Query  637  APGALXGSGLXDP-------VQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRD  479
            AP  + GS +  P       +++ AS GCDN VK+WK  +G WK +    L+ H+ WVRD
Sbjct  178  APAVVPGSLIEQPSGQKPNYIKRFASGGCDNLVKIWKEEDGQWKEE--QKLEAHSDWVRD  235

Query  478  VAWAPNLGLPKSTIASASEDGKVVIWTVAK-EGDQWEGKVLYDFNTPVWRVSWSLTGNXL  302
            VAWAP++GLP STIAS S+DG+V IWT     G+ W  K+L+ FN  VW VSWS+T N L
Sbjct  236  VAWAPSIGLPTSTIASCSQDGRVFIWTCDDASGNSWSPKLLHKFNDVVWHVSWSITANIL  295

Query  301  AVXSGDNNVTLWNEAVDGEW  242
            AV  GDN VTLW E+VDG W
Sbjct  296  AVSGGDNKVTLWKESVDGLW  315



>ref|XP_010281426.1| PREDICTED: protein SEC13 homolog, partial [Phaethon lepturus]
Length=341

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 73/140 (52%), Positives = 92/140 (66%), Gaps = 10/140 (7%)
 Frame = -1

Query  637  APGALXGSGLXDP-------VQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRD  479
            AP  + GS +  P       +++ AS GCDN VK+WK  +G WK +    L+ H+ WVRD
Sbjct  180  APAVVPGSLIEQPSGQKPNYIKRFASGGCDNLVKIWKEEDGQWKEE--QKLEAHSDWVRD  237

Query  478  VAWAPNLGLPKSTIASASEDGKVVIWTVAK-EGDQWEGKVLYDFNTPVWRVSWSLTGNXL  302
            VAWAP++GLP STIAS S+DG+V IWT     G+ W  K+L+ FN  VW VSWS+T N L
Sbjct  238  VAWAPSIGLPTSTIASCSQDGRVFIWTCDDASGNSWSPKLLHKFNDVVWHVSWSITANIL  297

Query  301  AVXSGDNNVTLWNEAVDGEW  242
            AV  GDN VTLW E+VDG W
Sbjct  298  AVSGGDNKVTLWKESVDGLW  317



>ref|XP_009946398.1| PREDICTED: protein SEC13 homolog, partial [Leptosomus discolor]
Length=324

 Score =   138 bits (348),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 93/142 (65%), Gaps = 10/142 (7%)
 Frame = -1

Query  643  SMAPGALXGSGLXDP-------VQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWV  485
            S AP  + GS +  P       +++ AS GCDN VK+WK  +G WK +    L+ H+ WV
Sbjct  161  SWAPAVVPGSLIEQPSGQKPNYIKRFASGGCDNLVKIWKEEDGQWKEE--QKLEAHSDWV  218

Query  484  RDVAWAPNLGLPKSTIASASEDGKVVIWTVAK-EGDQWEGKVLYDFNTPVWRVSWSLTGN  308
            RDVAWAP++GLP STIAS S+DG+V IWT     G+ W  K+L+ FN  VW VSWS+T N
Sbjct  219  RDVAWAPSIGLPTSTIASCSQDGRVFIWTCDDASGNSWSPKLLHKFNDVVWHVSWSITAN  278

Query  307  XLAVXSGDNNVTLWNEAVDGEW  242
             LAV  GDN VTLW E+VDG W
Sbjct  279  ILAVSGGDNKVTLWKESVDGLW  300



>ref|XP_009282024.1| PREDICTED: protein SEC13 homolog [Aptenodytes forsteri]
Length=333

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 93/142 (65%), Gaps = 10/142 (7%)
 Frame = -1

Query  643  SMAPGALXGSGLXDP-------VQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWV  485
            S AP  + GS +  P       +++ AS GCDN VK+WK  +G WK +    L+ H+ WV
Sbjct  170  SWAPAVVPGSLIEQPSGQKPNYIKRFASGGCDNLVKIWKEEDGQWKEE--QKLEAHSDWV  227

Query  484  RDVAWAPNLGLPKSTIASASEDGKVVIWTVAK-EGDQWEGKVLYDFNTPVWRVSWSLTGN  308
            RDVAWAP++GLP STIAS S+DG+V IWT     G+ W  K+L+ FN  VW VSWS+T N
Sbjct  228  RDVAWAPSIGLPTSTIASCSQDGRVFIWTCDDASGNSWSPKLLHKFNDVVWHVSWSITAN  287

Query  307  XLAVXSGDNNVTLWNEAVDGEW  242
             LAV  GDN VTLW E+VDG W
Sbjct  288  ILAVSGGDNKVTLWKESVDGLW  309



>ref|XP_007451615.1| PREDICTED: protein SEC13 homolog, partial [Lipotes vexillifer]
Length=172

 Score =   134 bits (338),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/143 (52%), Positives = 94/143 (66%), Gaps = 11/143 (8%)
 Frame = -1

Query  643  SMAPGALXGSGLXDP-------VQKLASXGCDNTVKVWKLY-NGVWKMDCFPALQMHTXW  488
            S AP  + GS +  P       ++K AS GCDN +K+WK   +G WK +    L+ H+ W
Sbjct  7    SWAPAVVPGSLIDQPSGQKPNYIKKFASGGCDNLIKLWKEEEDGQWKEE--QKLEAHSDW  64

Query  487  VRDVAWAPNLGLPKSTIASASEDGKVVIWTVAK-EGDQWEGKVLYDFNTPVWRVSWSLTG  311
            VRDVAWAP++GLP STIAS S+DG+V IWT     G+ W  K+L+ FN  VW VSWS+T 
Sbjct  65   VRDVAWAPSIGLPTSTIASCSQDGRVFIWTCDDASGNAWSPKLLHKFNDVVWHVSWSITA  124

Query  310  NXLAVXSGDNNVTLWNEAVDGEW  242
            N LAV  GDN VTLW E+VDG+W
Sbjct  125  NILAVSGGDNKVTLWKESVDGQW  147



>ref|XP_009938282.1| PREDICTED: protein SEC13 homolog [Opisthocomus hoazin]
Length=331

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 93/142 (65%), Gaps = 10/142 (7%)
 Frame = -1

Query  643  SMAPGALXGSGLXDP-------VQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWV  485
            S AP  + GS +  P       +++ AS GCDN VK+WK  +G WK +    L+ H+ WV
Sbjct  168  SWAPAVVPGSLIEQPSGQKPNYIKRFASGGCDNLVKIWKEEDGQWKEE--QKLEAHSDWV  225

Query  484  RDVAWAPNLGLPKSTIASASEDGKVVIWTVAK-EGDQWEGKVLYDFNTPVWRVSWSLTGN  308
            RDVAWAP++GLP STIAS S+DG+V IWT     G+ W  K+L+ FN  VW VSWS+T N
Sbjct  226  RDVAWAPSIGLPTSTIASCSQDGRVFIWTCDDASGNSWSPKLLHKFNDVVWHVSWSITAN  285

Query  307  XLAVXSGDNNVTLWNEAVDGEW  242
             LAV  GDN VTLW E+VDG W
Sbjct  286  ILAVSGGDNKVTLWKESVDGLW  307



>ref|XP_009874190.1| PREDICTED: protein SEC13 homolog, partial [Apaloderma vittatum]
Length=329

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 73/140 (52%), Positives = 92/140 (66%), Gaps = 10/140 (7%)
 Frame = -1

Query  637  APGALXGSGLXDP-------VQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRD  479
            AP  + GS +  P       +++ AS GCDN VK+WK  +G WK +    L+ H+ WVRD
Sbjct  168  APAVVPGSLIEQPSGQKPNYIKRFASGGCDNLVKIWKEEDGQWKEE--QKLEAHSDWVRD  225

Query  478  VAWAPNLGLPKSTIASASEDGKVVIWTVAK-EGDQWEGKVLYDFNTPVWRVSWSLTGNXL  302
            VAWAP++GLP STIAS S+DG+V IWT     G+ W  K+L+ FN  VW VSWS+T N L
Sbjct  226  VAWAPSIGLPTSTIASCSQDGRVFIWTCDDASGNSWSPKLLHKFNDVVWHVSWSITANIL  285

Query  301  AVXSGDNNVTLWNEAVDGEW  242
            AV  GDN VTLW E+VDG W
Sbjct  286  AVSGGDNKVTLWKESVDGLW  305



>emb|CDQ92083.1| unnamed protein product [Oncorhynchus mykiss]
Length=329

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 72/140 (51%), Positives = 91/140 (65%), Gaps = 10/140 (7%)
 Frame = -1

Query  637  APGALXGSGLXDP-------VQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWVRD  479
            AP  + GS +  P       +++  S GCDN VK+WK  +G WK D    L+ H+ WVRD
Sbjct  168  APSVVPGSLIDQPSGQKPNFIKRFVSGGCDNLVKLWKEEDGQWKED--QKLEAHSDWVRD  225

Query  478  VAWAPNLGLPKSTIASASEDGKVVIWTVAK-EGDQWEGKVLYDFNTPVWRVSWSLTGNXL  302
            V WAP++GLP STIAS S+DG+V IWT     G+ W  K+L+ FN  VW VSWS+TGN L
Sbjct  226  VGWAPSIGLPTSTIASCSQDGRVFIWTCDDPSGNTWTAKLLHKFNDVVWHVSWSVTGNIL  285

Query  301  AVXSGDNNVTLWNEAVDGEW  242
            AV  GDN VTLW E+ DG+W
Sbjct  286  AVSGGDNKVTLWKESADGQW  305



>ref|XP_008632704.1| PREDICTED: protein SEC13 homolog [Corvus brachyrhynchos]
Length=339

 Score =   139 bits (349),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 93/142 (65%), Gaps = 10/142 (7%)
 Frame = -1

Query  643  SMAPGALXGSGLXDP-------VQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWV  485
            S AP  + GS +  P       +++ AS GCDN VK+WK  +G WK +    L+ H+ WV
Sbjct  176  SWAPAVVPGSLIEQPSGQKPNYIKRFASGGCDNLVKIWKEEDGQWKEE--QKLEAHSDWV  233

Query  484  RDVAWAPNLGLPKSTIASASEDGKVVIWTVAK-EGDQWEGKVLYDFNTPVWRVSWSLTGN  308
            RDVAWAP++GLP STIAS S+DG+V IWT     G+ W  K+L+ FN  VW VSWS+T N
Sbjct  234  RDVAWAPSIGLPTSTIASCSQDGRVFIWTCDDASGNSWSPKLLHKFNDVVWHVSWSITAN  293

Query  307  XLAVXSGDNNVTLWNEAVDGEW  242
             LAV  GDN VTLW E+VDG W
Sbjct  294  ILAVSGGDNKVTLWKESVDGLW  315



>gb|KFV70045.1| Protein SEC13, partial [Picoides pubescens]
Length=264

 Score =   137 bits (345),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 73/142 (51%), Positives = 93/142 (65%), Gaps = 10/142 (7%)
 Frame = -1

Query  643  SMAPGALXGSGLXDP-------VQKLASXGCDNTVKVWKLYNGVWKMDCFPALQMHTXWV  485
            S AP  + GS +  P       +++ AS GCDN VK+WK  +G WK +    L+ H+ WV
Sbjct  102  SWAPAVVPGSLIEQPSGQKPNYIKRFASGGCDNLVKIWKEEDGQWKEE--QKLEAHSDWV  159

Query  484  RDVAWAPNLGLPKSTIASASEDGKVVIWTVAK-EGDQWEGKVLYDFNTPVWRVSWSLTGN  308
            RDVAWAP++GLP STIAS S+DG+V IW+     G+ W  K+L+ FN  VW VSWS+T N
Sbjct  160  RDVAWAPSIGLPTSTIASCSQDGRVFIWSCDDASGNSWSPKLLHKFNDVVWHVSWSITAN  219

Query  307  XLAVXSGDNNVTLWNEAVDGEW  242
             LAV  GDN VTLW E+VDG W
Sbjct  220  ILAVSGGDNKVTLWKESVDGLW  241



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 960833956375