BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF026P13

Length=764
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009601820.1|  PREDICTED: alanine--tRNA ligase {ECO:0000255...    215   4e-60   Nicotiana tomentosiformis
ref|XP_004235270.1|  PREDICTED: alanine--tRNA ligase                    214   5e-60   Solanum lycopersicum
ref|XP_006347609.1|  PREDICTED: alanine--tRNA ligase-like               214   7e-60   Solanum tuberosum [potatoes]
ref|XP_009802310.1|  PREDICTED: alanine--tRNA ligase                    194   1e-52   Nicotiana sylvestris
emb|CDP16860.1|  unnamed protein product                                170   3e-45   Coffea canephora [robusta coffee]
ref|XP_004505726.1|  PREDICTED: alanine--tRNA ligase-like               168   1e-43   Cicer arietinum [garbanzo]
ref|XP_003607217.1|  Alanyl-tRNA synthetase                             168   2e-43   
emb|CDP04915.1|  unnamed protein product                                166   1e-42   Coffea canephora [robusta coffee]
ref|XP_010031895.1|  PREDICTED: alanine--tRNA ligase                    165   2e-42   Eucalyptus grandis [rose gum]
ref|XP_007131657.1|  hypothetical protein PHAVU_011G031100g             160   7e-41   Phaseolus vulgaris [French bean]
ref|XP_008465597.1|  PREDICTED: alanine--tRNA ligase-like               150   7e-40   
gb|KDP43289.1|  hypothetical protein JCGZ_24210                         158   8e-40   Jatropha curcas
ref|XP_002307181.2|  alanyl-tRNA synthetase family protein              157   9e-40   
gb|KDO52980.1|  hypothetical protein CISIN_1g001826mg                   157   1e-39   Citrus sinensis [apfelsine]
ref|XP_002277341.1|  PREDICTED: alanine--tRNA ligase                    157   1e-39   Vitis vinifera
gb|KDO52988.1|  hypothetical protein CISIN_1g001826mg                   157   1e-39   Citrus sinensis [apfelsine]
gb|KDO52982.1|  hypothetical protein CISIN_1g001826mg                   157   1e-39   Citrus sinensis [apfelsine]
emb|CBI27126.3|  unnamed protein product                                157   2e-39   Vitis vinifera
ref|XP_011022066.1|  PREDICTED: alanine--tRNA ligase                    157   2e-39   Populus euphratica
ref|XP_011084638.1|  PREDICTED: LOW QUALITY PROTEIN: alanine--tRN...    156   2e-39   
ref|XP_006484669.1|  PREDICTED: alanine--tRNA ligase-like isoform X2    156   3e-39   Citrus sinensis [apfelsine]
emb|CDY64799.1|  BnaUnng00940D                                          151   4e-39   Brassica napus [oilseed rape]
ref|XP_010500574.1|  PREDICTED: alanine--tRNA ligase-like               155   9e-39   Camelina sativa [gold-of-pleasure]
ref|XP_010662077.1|  PREDICTED: alanine--tRNA ligase-like               152   4e-38   Vitis vinifera
gb|EYU19755.1|  hypothetical protein MIMGU_mgv1a000969mg                152   4e-38   Erythranthe guttata [common monkey flower]
ref|XP_009124544.1|  PREDICTED: alanine--tRNA ligase-like               150   4e-38   
ref|XP_010463338.1|  PREDICTED: alanine--tRNA ligase-like               153   4e-38   Camelina sativa [gold-of-pleasure]
emb|CBI26461.3|  unnamed protein product                                152   5e-38   Vitis vinifera
ref|XP_007043323.1|  Alanyl-tRNA synthetase, putative                   152   1e-37   
ref|XP_009147848.1|  PREDICTED: alanine--tRNA ligase-like               151   2e-37   Brassica rapa
emb|CDY22784.1|  BnaA06g02930D                                          151   2e-37   Brassica napus [oilseed rape]
ref|XP_006437524.1|  hypothetical protein CICLE_v10030624mg             151   2e-37   Citrus clementina [clementine]
ref|XP_009107233.1|  PREDICTED: alanine--tRNA ligase                    151   2e-37   Brassica rapa
ref|XP_006590811.1|  PREDICTED: alanine--tRNA ligase-like isoform X2    150   2e-37   
ref|XP_010541854.1|  PREDICTED: alanine--tRNA ligase-like               150   3e-37   Tarenaya hassleriana [spider flower]
ref|XP_002531134.1|  alanyl-tRNA synthetase, putative                   150   3e-37   
gb|KHN32273.1|  Alanine--tRNA ligase                                    150   4e-37   Glycine soja [wild soybean]
ref|XP_003537781.2|  PREDICTED: alanine--tRNA ligase-like isoform X1    150   5e-37   Glycine max [soybeans]
ref|XP_004148575.1|  PREDICTED: alanine--tRNA ligase-like               149   8e-37   
gb|KGN58521.1|  hypothetical protein Csa_3G656490                       149   8e-37   Cucumis sativus [cucumbers]
ref|XP_004163302.1|  PREDICTED: LOW QUALITY PROTEIN: alanine--tRN...    149   8e-37   
ref|XP_007225354.1|  hypothetical protein PRUPE_ppa000923mg             147   2e-36   
gb|KJB31826.1|  hypothetical protein B456_005G210000                    146   7e-36   Gossypium raimondii
gb|KJB31825.1|  hypothetical protein B456_005G210000                    146   7e-36   Gossypium raimondii
emb|CAA73145.1|  alanyl t-RNA synthetase                                139   9e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006305941.1|  hypothetical protein CARUB_v10011180mg             145   3e-35   Capsella rubella
ref|XP_010112290.1|  Alanine--tRNA ligase                               144   3e-35   
ref|XP_008340455.1|  PREDICTED: alanine--tRNA ligase                    144   6e-35   Malus domestica [apple tree]
ref|XP_009351710.1|  PREDICTED: alanine--tRNA ligase                    143   6e-35   
ref|XP_008221037.1|  PREDICTED: alanine--tRNA ligase                    142   2e-34   Prunus mume [ume]
gb|KDO52983.1|  hypothetical protein CISIN_1g001826mg                   142   2e-34   Citrus sinensis [apfelsine]
ref|XP_010479473.1|  PREDICTED: alanine--tRNA ligase                    141   4e-34   Camelina sativa [gold-of-pleasure]
ref|XP_006484668.1|  PREDICTED: alanine--tRNA ligase-like isoform X1    140   7e-34   
ref|XP_008366973.1|  PREDICTED: alanine--tRNA ligase-like               140   7e-34   
ref|XP_010265724.1|  PREDICTED: alanine--tRNA ligase-like               137   8e-34   Nelumbo nucifera [Indian lotus]
gb|KJB50036.1|  hypothetical protein B456_008G149700                    140   1e-33   Gossypium raimondii
ref|XP_006393172.1|  hypothetical protein EUTSA_v10011205mg             139   2e-33   Eutrema salsugineum [saltwater cress]
ref|XP_006393171.1|  hypothetical protein EUTSA_v10011205mg             139   2e-33   
ref|XP_006393173.1|  hypothetical protein EUTSA_v10011205mg             139   2e-33   
ref|XP_002894237.1|  cytosolic tRNA-Ala synthetase                      139   3e-33   
ref|XP_010273668.1|  PREDICTED: alanine--tRNA ligase                    139   4e-33   Nelumbo nucifera [Indian lotus]
gb|AAD50044.1|AC007980_9  cytosolic tRNA-Ala synthetase                 138   5e-33   Arabidopsis thaliana [mouse-ear cress]
ref|NP_175439.2|  Alanyl-tRNA synthetase                                138   5e-33   Arabidopsis thaliana [mouse-ear cress]
emb|CDY45055.1|  BnaA08g02200D                                          137   9e-33   Brassica napus [oilseed rape]
emb|CAA80381.1|  cytosolic tRNA-Ala synthetase                          136   2e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004297751.1|  PREDICTED: alanine--tRNA ligase                    136   2e-32   Fragaria vesca subsp. vesca
emb|CAA80380.1|  mitochondrial tRNA-Ala synthetase                      136   2e-32   Arabidopsis thaliana [mouse-ear cress]
pir||S32671  alanine-tRNA ligase (EC 6.1.1.7) - Arabidopsis thali...    136   3e-32
ref|XP_010523577.1|  PREDICTED: alanine--tRNA ligase-like isoform X1    135   4e-32   Tarenaya hassleriana [spider flower]
ref|XP_003607221.1|  Alanyl-tRNA synthetase                             132   4e-32   
ref|XP_010683781.1|  PREDICTED: alanine--tRNA ligase                    135   4e-32   Beta vulgaris subsp. vulgaris [field beet]
gb|AES89418.2|  alanyl-tRNA synthetase                                  131   1e-31   Medicago truncatula
ref|XP_003607220.1|  Alanyl-tRNA synthetase                             130   6e-31   
gb|AES89417.2|  alanyl-tRNA synthetase                                  130   6e-31   Medicago truncatula
ref|NP_001185186.1|  Alanyl-tRNA synthetase                             131   2e-30   
ref|XP_003619277.1|  Alanyl-tRNA synthetase                             126   4e-30   
ref|XP_010904628.1|  PREDICTED: LOW QUALITY PROTEIN: alanine--tRN...    129   9e-30   Elaeis guineensis
ref|XP_010927937.1|  PREDICTED: alanine--tRNA ligase-like               126   7e-29   Elaeis guineensis
ref|XP_003619276.1|  Alanyl-tRNA synthetase                             125   1e-28   
ref|XP_009386816.1|  PREDICTED: alanine--tRNA ligase {ECO:0000255...    125   1e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008810673.1|  PREDICTED: alanine--tRNA ligase-like isoform X2    125   2e-28   
ref|XP_008810668.1|  PREDICTED: alanine--tRNA ligase-like isoform X1    125   2e-28   Phoenix dactylifera
emb|CDY29328.1|  BnaA05g15950D                                          124   3e-28   Brassica napus [oilseed rape]
gb|KDO52981.1|  hypothetical protein CISIN_1g001826mg                   123   7e-28   Citrus sinensis [apfelsine]
gb|KJB50041.1|  hypothetical protein B456_008G149700                    122   2e-27   Gossypium raimondii
gb|KJB50037.1|  hypothetical protein B456_008G149700                    122   2e-27   Gossypium raimondii
gb|KJB50039.1|  hypothetical protein B456_008G149700                    122   2e-27   Gossypium raimondii
gb|EPS72880.1|  hypothetical protein M569_01869                         120   7e-27   Genlisea aurea
ref|XP_008778009.1|  PREDICTED: alanine--tRNA ligase-like               120   1e-26   
emb|CDY42520.1|  BnaC06g03380D                                          118   4e-26   Brassica napus [oilseed rape]
ref|XP_006662230.1|  PREDICTED: alanine--tRNA ligase-like               116   2e-25   Oryza brachyantha
gb|KFK23692.1|  hypothetical protein AALP_AAs48168U000100               116   2e-25   Arabis alpina [alpine rockcress]
gb|AAK70636.1|AC091238_14  Putative cytosolic tRNA-Ala synthetase       112   2e-24   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003571715.1|  PREDICTED: LOW QUALITY PROTEIN: alanine--tRN...    113   2e-24   
gb|EEE50661.1|  hypothetical protein OsJ_30891                          112   3e-24   Oryza sativa Japonica Group [Japonica rice]
gb|EEC66648.1|  hypothetical protein OsI_32912                          112   3e-24   Oryza sativa Indica Group [Indian rice]
ref|NP_001064254.1|  Os10g0182000                                       112   4e-24   
ref|XP_002443089.1|  hypothetical protein SORBIDRAFT_08g008230          111   9e-24   Sorghum bicolor [broomcorn]
ref|XP_008662576.1|  PREDICTED: alanine--tRNA ligase                    110   2e-23   Zea mays [maize]
ref|XP_008350821.1|  PREDICTED: alanine--tRNA ligase-like               100   2e-22   
gb|EMT00983.1|  Alanyl-tRNA synthetase, mitochondrial                   105   4e-22   
ref|XP_006826671.1|  hypothetical protein AMTR_s00137p00047050          106   4e-22   Amborella trichopoda
gb|EMT18589.1|  Alanyl-tRNA synthetase, mitochondrial                   106   5e-22   
dbj|BAJ98134.1|  predicted protein                                      106   5e-22   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ92565.1|  predicted protein                                      102   6e-22   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_001773539.1|  predicted protein                                  103   3e-21   
dbj|BAJ96541.1|  predicted protein                                      102   1e-20   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004983349.1|  PREDICTED: alanine--tRNA ligase-like isoform X2    101   2e-20   Setaria italica
ref|XP_004983350.1|  PREDICTED: alanine--tRNA ligase-like isoform X3    101   2e-20   
gb|EMT07345.1|  Alanyl-tRNA synthetase, mitochondrial                 99.0    1e-19   
gb|EMS67609.1|  Alanyl-tRNA synthetase                                95.5    2e-18   Triticum urartu
ref|XP_004983348.1|  PREDICTED: alanine--tRNA ligase-like isoform X1  92.4    2e-17   
emb|CDY46263.1|  BnaC05g50520D                                        85.1    4e-15   Brassica napus [oilseed rape]
emb|CDY69088.1|  BnaCnng61840D                                        78.2    9e-15   Brassica napus [oilseed rape]
ref|XP_001769326.1|  predicted protein                                79.3    2e-14   
gb|KDO52985.1|  hypothetical protein CISIN_1g001826mg                 80.5    1e-13   Citrus sinensis [apfelsine]
gb|KDO52984.1|  hypothetical protein CISIN_1g001826mg                 80.5    1e-13   Citrus sinensis [apfelsine]
gb|KJB50034.1|  hypothetical protein B456_008G149700                  77.0    1e-12   Gossypium raimondii
gb|KJB50035.1|  hypothetical protein B456_008G149700                  77.0    1e-12   Gossypium raimondii
gb|KJB50038.1|  hypothetical protein B456_008G149700                  77.0    1e-12   Gossypium raimondii
ref|XP_002462563.1|  hypothetical protein SORBIDRAFT_02g028270        60.8    1e-08   
ref|XP_005849315.1|  hypothetical protein CHLNCDRAFT_143654           60.8    2e-07   Chlorella variabilis
emb|CCI40732.1|  unnamed protein product                              60.1    6e-07   Albugo candida
emb|CCA14233.1|  unnamed protein product                              58.5    2e-06   Albugo laibachii Nc14
ref|XP_002950616.1|  hypothetical protein VOLCADRAFT_120886           57.0    7e-06   Volvox carteri f. nagariensis
gb|EMS64427.1|  Alanyl-tRNA synthetase                                54.7    3e-05   Triticum urartu



>ref|XP_009601820.1| PREDICTED: alanine--tRNA ligase {ECO:0000255|HAMAP-Rule:MF_03133} 
[Nicotiana tomentosiformis]
Length=1027

 Score =   215 bits (547),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 172/191 (90%), Gaps = 0/191 (0%)
 Frame = -3

Query  762   EKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAE  583
             E+K+ EA   ++SLLEEKVT+LNA+VERAQIP  +K +LK +LS LQ +VI+AKK+IAAE
Sbjct  837   EQKVNEAFQTDESLLEEKVTSLNAAVERAQIPTVRKADLKAKLSALQNQVIKAKKKIAAE  896

Query  582   NSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEA  403
             N   AVKAASEMAEAA SGGKAYCIL++ +GLDTAAVR+AVVKVMEQKG+AV +FSTDEA
Sbjct  897   NVQKAVKAASEMAEAAASGGKAYCILQISVGLDTAAVREAVVKVMEQKGMAVLVFSTDEA  956

Query  402   ANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMD  223
             ANKVLVCAGVPEKGD C+QL+VK+WLNAALKPLGGKGGGGKGGLAQGQA+++ HV EAMD
Sbjct  957   ANKVLVCAGVPEKGDKCQQLNVKDWLNAALKPLGGKGGGGKGGLAQGQATNISHVGEAMD  1016

Query  222   LAASFASIKLS  190
             +AASFA++KL+
Sbjct  1017  VAASFAAMKLN  1027



>ref|XP_004235270.1| PREDICTED: alanine--tRNA ligase [Solanum lycopersicum]
Length=1010

 Score =   214 bits (546),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 146/191 (76%), Positives = 171/191 (90%), Gaps = 0/191 (0%)
 Frame = -3

Query  762   EKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAE  583
             E+K+ EA+  ++SLLEEKVT+LNA+VERAQIP   K +LK +LS LQ RVI+AKK+IAAE
Sbjct  820   EQKVNEASQTDESLLEEKVTSLNATVERAQIPTVVKTDLKAKLSVLQDRVIKAKKKIAAE  879

Query  582   NSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEA  403
             N   AVKAASEMAEAA SGGKAYCIL++G+GLDTAAVR+AVVKVMEQKG+AV +FS DEA
Sbjct  880   NIQKAVKAASEMAEAAASGGKAYCILQIGVGLDTAAVREAVVKVMEQKGMAVLVFSKDEA  939

Query  402   ANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMD  223
             A KVLVCAGVPEKGD CKQL+VK+WLNAALKPLGGKGGGGKGGLAQGQA+D+  VDEAMD
Sbjct  940   AKKVLVCAGVPEKGDKCKQLNVKDWLNAALKPLGGKGGGGKGGLAQGQATDISKVDEAMD  999

Query  222   LAASFASIKLS  190
             +AASFA++KL+
Sbjct  1000  VAASFAALKLN  1010



>ref|XP_006347609.1| PREDICTED: alanine--tRNA ligase-like [Solanum tuberosum]
Length=1009

 Score =   214 bits (545),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 145/191 (76%), Positives = 171/191 (90%), Gaps = 0/191 (0%)
 Frame = -3

Query  762   EKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAE  583
             E+K+ EA   ++SLLEEKVT+LNA+VERAQIP   K +LK +LS LQ +VI+AKK+IAAE
Sbjct  819   EQKVNEAFQTDESLLEEKVTSLNATVERAQIPTVMKTDLKAKLSVLQNQVIKAKKKIAAE  878

Query  582   NSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEA  403
             N   AVKAASEMAEAA SGGKAYCIL++G+GLDTAAVR+AVVKVMEQKG+AV +FS DEA
Sbjct  879   NIQKAVKAASEMAEAAASGGKAYCILQIGVGLDTAAVREAVVKVMEQKGMAVLVFSKDEA  938

Query  402   ANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMD  223
             ANKVLVCAGVPEKGD C+QL+VK+WLNAALKPLGGKGGGGKGGLAQGQA+D+  VDEAMD
Sbjct  939   ANKVLVCAGVPEKGDKCQQLNVKDWLNAALKPLGGKGGGGKGGLAQGQATDISKVDEAMD  998

Query  222   LAASFASIKLS  190
             +AASFA++KL+
Sbjct  999   VAASFAAMKLN  1009



>ref|XP_009802310.1| PREDICTED: alanine--tRNA ligase [Nicotiana sylvestris]
Length=1014

 Score =   194 bits (493),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 111/149 (74%), Positives = 132/149 (89%), Gaps = 0/149 (0%)
 Frame = -3

Query  762  EKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAE  583
            E+K+ EA   ++SLLEEKVT+LNA+VERAQIP  +K +LK +LS LQ +VI+AKK+IAAE
Sbjct  837  EQKVNEAFQTDESLLEEKVTSLNAAVERAQIPTVRKADLKAKLSALQNQVIKAKKKIAAE  896

Query  582  NSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEA  403
            N   AVKAASEMAEAA SGGKAYCIL++ +GLDTAAVR+AVVKVMEQKG+AV +FSTDEA
Sbjct  897  NVQKAVKAASEMAEAAASGGKAYCILQISVGLDTAAVREAVVKVMEQKGMAVLVFSTDEA  956

Query  402  ANKVLVCAGVPEKGDVCKQLSVKEWLNAA  316
            ANKVLVCAGVPEKGD C+QL+VK+WLNAA
Sbjct  957  ANKVLVCAGVPEKGDKCQQLNVKDWLNAA  985



>emb|CDP16860.1| unnamed protein product [Coffea canephora]
Length=560

 Score =   170 bits (430),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 109/191 (57%), Positives = 139/191 (73%), Gaps = 1/191 (1%)
 Frame = -3

Query  762  EKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAE  583
            E ++ E    E +LLE++VT LN  VE A IP  KK ++K +LS LQ  +I+AKK+IA E
Sbjct  370  EHEVNETFKSEGALLEQRVTKLNGRVEGAVIPTVKKADIKAKLSLLQNHIIKAKKKIAEE  429

Query  582  NSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEA  403
            N+ NAVK A E A  + S GKAYC+  + +G DTAA+R+AV+KV EQKG+AV + S D+A
Sbjct  430  NTQNAVKVALEEAAVSSSDGKAYCLTHVNVGGDTAAIREAVLKVTEQKGMAVMVISKDDA  489

Query  402  ANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMD  223
            ANKV+VCAGVPEK D  KQL+ KEWL  AL+P     GGGKG LAQGQ S + HV EAMD
Sbjct  490  ANKVVVCAGVPEKNDQYKQLNAKEWLRVALEP-LSGKGGGKGCLAQGQGSGISHVSEAMD  548

Query  222  LAASFASIKLS  190
            +AASFA++KL+
Sbjct  549  IAASFATLKLN  559



>ref|XP_004505726.1| PREDICTED: alanine--tRNA ligase-like [Cicer arietinum]
Length=990

 Score =   168 bits (426),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 110/191 (58%), Positives = 144/191 (75%), Gaps = 1/191 (1%)
 Frame = -3

Query  762  EKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAE  583
            E+++ EAA +E SLLEEKV++L ++VE   IPAAKK ++K +++ LQ +V +A+KR+A E
Sbjct  801  ERQVDEAAKLEGSLLEEKVSSLKSNVETLSIPAAKKADIKTKIALLQDQVRKAQKRVAEE  860

Query  582  NSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEA  403
            N   AV    E AE AVS GK++CI  + +GLD AAVR+AV KV++QKG++V +FSTDE+
Sbjct  861  NKRKAVMLTVEKAELAVSDGKSFCISHVDVGLDVAAVREAVTKVIDQKGLSVMVFSTDES  920

Query  402  ANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMD  223
             NK +VCAGVPEKGD  K L V EWL+ AL PL G+ G GKGGLA GQ +D  HV+EAMD
Sbjct  921  TNKAVVCAGVPEKGDKVK-LDVSEWLSNALGPLKGRCGKGKGGLATGQGTDASHVNEAMD  979

Query  222  LAASFASIKLS  190
            LA  FASIKL+
Sbjct  980  LAVKFASIKLT  990



>ref|XP_003607217.1| Alanyl-tRNA synthetase [Medicago truncatula]
 gb|AES89414.1| alanine-tRNA ligase [Medicago truncatula]
Length=950

 Score =   168 bits (425),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 109/191 (57%), Positives = 144/191 (75%), Gaps = 1/191 (1%)
 Frame = -3

Query  762  EKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAE  583
            EK++ E A +E SLLEEKV++L ++VE   IPAAKK E+K +++ LQ +V +A+KR+A E
Sbjct  761  EKQVDEVAKLEGSLLEEKVSSLKSNVETLSIPAAKKAEIKTKIALLQDQVRKAQKRVAEE  820

Query  582  NSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEA  403
            N   AV   +E A+ AVS GK++CI  + +GLD AAVR+AV KV++QKG++V +FSTDE+
Sbjct  821  NKRKAVTITAEKADLAVSDGKSFCISHVNVGLDVAAVREAVTKVIDQKGLSVMVFSTDES  880

Query  402  ANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMD  223
             NK +VCAGVPEKGD  K L V EWL+ AL PL G+ G GKGGLA GQ +D  HV+EAMD
Sbjct  881  TNKAVVCAGVPEKGDKGK-LDVSEWLSNALGPLKGRCGKGKGGLATGQGTDASHVNEAMD  939

Query  222  LAASFASIKLS  190
            LA  FAS+KL+
Sbjct  940  LAVKFASVKLN  950



>emb|CDP04915.1| unnamed protein product [Coffea canephora]
Length=1128

 Score =   166 bits (421),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 110/190 (58%), Positives = 137/190 (72%), Gaps = 1/190 (1%)
 Frame = -3

Query  762   EKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAE  583
             E+++ E   +E SLLE++VT LN  VE A IP  KK +LK ++S LQ ++I+AKK+IA E
Sbjct  939   EQEVNETFKMEGSLLEQRVTKLNGRVEGAAIPTVKKTDLKAKISVLQNQIIKAKKKIAEE  998

Query  582   NSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEA  403
             N  NAVK A E AE + S GK YCI  + +G DTAA+R+AV+KV EQKG+A+ + S D  
Sbjct  999   NIQNAVKVALEEAEVSSSHGKTYCITHVNVGADTAAIREAVLKVTEQKGMAIMVISKDGT  1058

Query  402   ANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMD  223
             ANKV+ CAGVPEK D  KQL  KEWL AAL P     GGGKG LAQGQ S+L HV EAMD
Sbjct  1059  ANKVVACAGVPEKIDQFKQLDAKEWLTAALAP-LNGKGGGKGRLAQGQGSELSHVTEAMD  1117

Query  222   LAASFASIKL  193
             +AASFA++KL
Sbjct  1118  IAASFAALKL  1127



>ref|XP_010031895.1| PREDICTED: alanine--tRNA ligase [Eucalyptus grandis]
 gb|KCW51291.1| hypothetical protein EUGRSUZ_J00856 [Eucalyptus grandis]
Length=1046

 Score =   165 bits (418),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 106/190 (56%), Positives = 143/190 (75%), Gaps = 0/190 (0%)
 Frame = -3

Query  762   EKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAE  583
             E+++ +A   E SLLE+KV +L + V+ A IPAA+K +++ +++ LQ+ V +A+K+IA  
Sbjct  856   EQEVTDACRTEGSLLEKKVASLKSRVDSAAIPAARKADIRTKIAALQSEVKKAQKKIAEA  915

Query  582   NSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEA  403
             N+  AV+ + E AEAA+SGGK +CI R+ +GLD AAVR+AVVKV+EQKGI+  +FS DE 
Sbjct  916   NTKKAVEVSLETAEAAISGGKGFCISRVDVGLDAAAVREAVVKVLEQKGISAMVFSRDET  975

Query  402   ANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMD  223
              NKV+VCAGVPEKG   KQL V +WL  AL PL G+ G GKGGLA GQ +D  H+DEAM+
Sbjct  976   TNKVVVCAGVPEKGGNAKQLEVSQWLEEALGPLKGRCGKGKGGLATGQGTDASHLDEAMN  1035

Query  222   LAASFASIKL  193
             LA SFAS+KL
Sbjct  1036  LAVSFASMKL  1045



>ref|XP_007131657.1| hypothetical protein PHAVU_011G031100g [Phaseolus vulgaris]
 gb|ESW03651.1| hypothetical protein PHAVU_011G031100g [Phaseolus vulgaris]
Length=996

 Score =   160 bits (406),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 104/191 (54%), Positives = 142/191 (74%), Gaps = 1/191 (1%)
 Frame = -3

Query  762  EKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAE  583
            E+++ +A+ ++ SLLEEKV++  ++VE   IPAAKK ++K ++++LQ +V +A+K++A E
Sbjct  807  EQQVDDASKLDGSLLEEKVSSFKSNVETLSIPAAKKADIKNKIARLQDQVRKAQKQVAEE  866

Query  582  NSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEA  403
            N   AV   +E AE A S GKA+CI R+ +GLD AAVR+AV K M+QKG++V +FSTDE+
Sbjct  867  NKRKAVIITAEKAELAASNGKAFCISRVDVGLDVAAVREAVTKAMDQKGLSVMVFSTDES  926

Query  402  ANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMD  223
             NK ++CAGVPEKGD  K L V EWL+ AL PL G+ G GKGGLA GQ +D   V EAMD
Sbjct  927  TNKAVICAGVPEKGDKGK-LDVSEWLSNALGPLKGRCGKGKGGLATGQGTDAARVKEAMD  985

Query  222  LAASFASIKLS  190
            LA  FAS+KLS
Sbjct  986  LAEKFASVKLS  996



>ref|XP_008465597.1| PREDICTED: alanine--tRNA ligase-like [Cucumis melo]
Length=291

 Score =   150 bits (379),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 100/190 (53%), Positives = 134/190 (71%), Gaps = 0/190 (0%)
 Frame = -3

Query  762  EKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAE  583
            E+++  A +++ +LLE+ V +    V+ A IPAA+K +++ ++  LQ  V +A+K++A E
Sbjct  100  EQEVDAAFNIDGNLLEKVVASFKNRVDSAPIPAARKAQIRAKIVLLQNEVRKAQKKLAEE  159

Query  582  NSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEA  403
            N   AVK A E AE A S GKA+CI  + +GLD AAVR+AVV+VMEQKGI+  +FSTDE 
Sbjct  160  NMQKAVKIAVETAEMASSEGKAFCISHVDVGLDAAAVREAVVRVMEQKGISAMVFSTDET  219

Query  402  ANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMD  223
              K +VCAGVP KG+  KQL V EWL  AL+PL G+ G GKGGLA GQ +D   + EAMD
Sbjct  220  TKKAVVCAGVPPKGNQGKQLEVSEWLTTALQPLKGRCGKGKGGLATGQGTDASQIKEAMD  279

Query  222  LAASFASIKL  193
            LA SFAS+KL
Sbjct  280  LATSFASLKL  289



>gb|KDP43289.1| hypothetical protein JCGZ_24210 [Jatropha curcas]
Length=1019

 Score =   158 bits (399),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 107/190 (56%), Positives = 143/190 (75%), Gaps = 0/190 (0%)
 Frame = -3

Query  762   EKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAE  583
             E+++ E +  E SLLE+KV +L + V+ A IPAAKK +++ ++S LQ +V +A+K+IA E
Sbjct  829   EQEVHETSKAEGSLLEKKVASLKSRVDSAPIPAAKKADIRAKISVLQNQVRKAQKKIAEE  888

Query  582   NSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEA  403
             N   AVK A+EMAE A S GK +CI R+ +GLD AAVR+AV+KV+E+KGI+  +FS DE 
Sbjct  889   NMQKAVKVATEMAEIAASEGKGFCISRVDVGLDAAAVREAVLKVLEKKGISAMVFSMDET  948

Query  402   ANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMD  223
              NKV+VCAGVPEK D  K+L V EWL  AL+PL G+ G GKGGLA GQ +D  HVD+A+D
Sbjct  949   TNKVVVCAGVPEKKDQGKKLEVSEWLTKALEPLNGRCGKGKGGLATGQGTDGVHVDKAID  1008

Query  222   LAASFASIKL  193
             LAA+FA +KL
Sbjct  1009  LAATFAEMKL  1018



>ref|XP_002307181.2| alanyl-tRNA synthetase family protein [Populus trichocarpa]
 gb|EEE94177.2| alanyl-tRNA synthetase family protein [Populus trichocarpa]
Length=967

 Score =   157 bits (398),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 105/190 (55%), Positives = 140/190 (74%), Gaps = 0/190 (0%)
 Frame = -3

Query  762  EKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAE  583
            E+++ EA+  + SLLE+KV +L   V+ A IPAAKK +++ ++S LQ +V +A+K+IA E
Sbjct  777  EQEVDEASQADGSLLEKKVASLKTRVDSALIPAAKKADIRAKISVLQNKVRKAQKKIAEE  836

Query  582  NSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEA  403
            N   AV+ A+EMAE A S GKA+CI  + +GLD AAVR+AV+KV+E+KGI+  +FSTDE+
Sbjct  837  NMQKAVEVAAEMAEVASSDGKAFCISHVDVGLDAAAVREAVLKVLERKGISAMVFSTDES  896

Query  402  ANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMD  223
             NKV+VCAGVPEK D  K L V EWL  AL PL G+ G GK GLA GQ +D  H+DEAM 
Sbjct  897  TNKVVVCAGVPEKLDKGKGLEVSEWLTTALGPLKGRCGKGKAGLATGQGTDASHLDEAMG  956

Query  222  LAASFASIKL  193
            LA +FA +KL
Sbjct  957  LATTFAQMKL  966



>gb|KDO52980.1| hypothetical protein CISIN_1g001826mg [Citrus sinensis]
Length=1002

 Score =   157 bits (397),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 106/190 (56%), Positives = 141/190 (74%), Gaps = 0/190 (0%)
 Frame = -3

Query  762   EKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAE  583
             EK++ +A+ +E SLLE+ V +L + V+ A IPA KK +++ +++ LQ +V +A+K++A E
Sbjct  812   EKEVDDASKIEGSLLEKTVASLKSKVDGAAIPAPKKADIRAKIALLQNQVRKAQKKVAEE  871

Query  582   NSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEA  403
             N   AVK A+E AEAA S GK +CI R+ +GLD AAVR+AV+KV+EQKG+ V +FSTDE 
Sbjct  872   NLQKAVKVATETAEAAASNGKPFCISRVEVGLDAAAVREAVLKVIEQKGMPVMVFSTDET  931

Query  402   ANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMD  223
              NK +VCAGVPEK D  KQL V EWL AAL+PL G+ G GKGGLA GQ +D   V  AMD
Sbjct  932   TNKAVVCAGVPEKSDQSKQLEVSEWLTAALQPLKGRCGKGKGGLASGQGTDAAQVTPAMD  991

Query  222   LAASFASIKL  193
             LAA FA++KL
Sbjct  992   LAAEFAAMKL  1001



>ref|XP_002277341.1| PREDICTED: alanine--tRNA ligase [Vitis vinifera]
Length=1002

 Score =   157 bits (397),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 107/190 (56%), Positives = 142/190 (75%), Gaps = 0/190 (0%)
 Frame = -3

Query  762   EKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAE  583
             E+++ +A+  E   LE+KV +L + V+ A IPAA+K +L+ ++S LQ +V +A+K+ A E
Sbjct  812   EQEVDDASKTEGISLEKKVASLRSRVDSAPIPAARKADLRAKISLLQDQVRKAQKKFAEE  871

Query  582   NSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEA  403
             N   AVKAA++MA+ A S GK +CI  + +GLDT AVR+AV+KV+EQKGI+V IFSTDE 
Sbjct  872   NIQKAVKAATDMAQLAASDGKTFCISHVDVGLDTTAVREAVLKVIEQKGISVMIFSTDET  931

Query  402   ANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMD  223
              NK +V AGVP+KGD  KQL V EWL AAL PL G+ G GKGGLAQGQ +D  HV EAMD
Sbjct  932   TNKAVVYAGVPQKGDKAKQLEVSEWLTAALGPLKGRCGKGKGGLAQGQGTDASHVKEAMD  991

Query  222   LAASFASIKL  193
             +A +FAS+KL
Sbjct  992   VAENFASMKL  1001



>gb|KDO52988.1| hypothetical protein CISIN_1g001826mg [Citrus sinensis]
Length=904

 Score =   157 bits (396),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 106/190 (56%), Positives = 141/190 (74%), Gaps = 0/190 (0%)
 Frame = -3

Query  762  EKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAE  583
            EK++ +A+ +E SLLE+ V +L + V+ A IPA KK +++ +++ LQ +V +A+K++A E
Sbjct  714  EKEVDDASKIEGSLLEKTVASLKSKVDGAAIPAPKKADIRAKIALLQNQVRKAQKKVAEE  773

Query  582  NSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEA  403
            N   AVK A+E AEAA S GK +CI R+ +GLD AAVR+AV+KV+EQKG+ V +FSTDE 
Sbjct  774  NLQKAVKVATETAEAAASNGKPFCISRVEVGLDAAAVREAVLKVIEQKGMPVMVFSTDET  833

Query  402  ANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMD  223
             NK +VCAGVPEK D  KQL V EWL AAL+PL G+ G GKGGLA GQ +D   V  AMD
Sbjct  834  TNKAVVCAGVPEKSDQSKQLEVSEWLTAALQPLKGRCGKGKGGLASGQGTDAAQVTPAMD  893

Query  222  LAASFASIKL  193
            LAA FA++KL
Sbjct  894  LAAEFAAMKL  903



>gb|KDO52982.1| hypothetical protein CISIN_1g001826mg [Citrus sinensis]
Length=995

 Score =   157 bits (397),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 106/190 (56%), Positives = 141/190 (74%), Gaps = 0/190 (0%)
 Frame = -3

Query  762  EKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAE  583
            EK++ +A+ +E SLLE+ V +L + V+ A IPA KK +++ +++ LQ +V +A+K++A E
Sbjct  805  EKEVDDASKIEGSLLEKTVASLKSKVDGAAIPAPKKADIRAKIALLQNQVRKAQKKVAEE  864

Query  582  NSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEA  403
            N   AVK A+E AEAA S GK +CI R+ +GLD AAVR+AV+KV+EQKG+ V +FSTDE 
Sbjct  865  NLQKAVKVATETAEAAASNGKPFCISRVEVGLDAAAVREAVLKVIEQKGMPVMVFSTDET  924

Query  402  ANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMD  223
             NK +VCAGVPEK D  KQL V EWL AAL+PL G+ G GKGGLA GQ +D   V  AMD
Sbjct  925  TNKAVVCAGVPEKSDQSKQLEVSEWLTAALQPLKGRCGKGKGGLASGQGTDAAQVTPAMD  984

Query  222  LAASFASIKL  193
            LAA FA++KL
Sbjct  985  LAAEFAAMKL  994



>emb|CBI27126.3| unnamed protein product [Vitis vinifera]
Length=1026

 Score =   157 bits (396),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 107/190 (56%), Positives = 142/190 (75%), Gaps = 0/190 (0%)
 Frame = -3

Query  762   EKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAE  583
             E+++ +A+  E   LE+KV +L + V+ A IPAA+K +L+ ++S LQ +V +A+K+ A E
Sbjct  836   EQEVDDASKTEGISLEKKVASLRSRVDSAPIPAARKADLRAKISLLQDQVRKAQKKFAEE  895

Query  582   NSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEA  403
             N   AVKAA++MA+ A S GK +CI  + +GLDT AVR+AV+KV+EQKGI+V IFSTDE 
Sbjct  896   NIQKAVKAATDMAQLAASDGKTFCISHVDVGLDTTAVREAVLKVIEQKGISVMIFSTDET  955

Query  402   ANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMD  223
              NK +V AGVP+KGD  KQL V EWL AAL PL G+ G GKGGLAQGQ +D  HV EAMD
Sbjct  956   TNKAVVYAGVPQKGDKAKQLEVSEWLTAALGPLKGRCGKGKGGLAQGQGTDASHVKEAMD  1015

Query  222   LAASFASIKL  193
             +A +FAS+KL
Sbjct  1016  VAENFASMKL  1025



>ref|XP_011022066.1| PREDICTED: alanine--tRNA ligase [Populus euphratica]
Length=1008

 Score =   157 bits (396),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 104/190 (55%), Positives = 140/190 (74%), Gaps = 0/190 (0%)
 Frame = -3

Query  762   EKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAE  583
             E+++ EA+  + SLLE+KV +L   V+ A IPAAKK +++ ++S LQ +V +A+K+IA E
Sbjct  818   EQEVDEASKADGSLLEKKVASLKTRVDSALIPAAKKADIRAKISVLQNKVRKAQKKIAEE  877

Query  582   NSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEA  403
             N   AV+ A+EMAE A S GKA+CI  + +GLD AAVR+AV+KV+++KGI+  +FSTDE+
Sbjct  878   NMQKAVEVATEMAEVASSDGKAFCISHVDVGLDVAAVREAVLKVLDRKGISAMVFSTDES  937

Query  402   ANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMD  223
              NKV+VCAGVPEK D  K L V EWL  AL PL G+ G GK GLA GQ +D  H+DEAM 
Sbjct  938   TNKVVVCAGVPEKLDKGKGLEVSEWLTTALGPLKGRCGKGKAGLATGQGTDASHLDEAMG  997

Query  222   LAASFASIKL  193
             LA +FA +KL
Sbjct  998   LATTFAQMKL  1007



>ref|XP_011084638.1| PREDICTED: LOW QUALITY PROTEIN: alanine--tRNA ligase [Sesamum 
indicum]
Length=1012

 Score =   156 bits (395),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 107/191 (56%), Positives = 146/191 (76%), Gaps = 0/191 (0%)
 Frame = -3

Query  762   EKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAE  583
             E+++ EA++ E S+LE+KVT+LN+ +E A IP+AKK +LK ++S LQ++VI+AKK+IA E
Sbjct  822   EQEVNEASNAEGSVLEQKVTSLNSRIEGAAIPSAKKADLKAKISVLQSQVIKAKKKIAEE  881

Query  582   NSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEA  403
             +   A + A +MAE A S GKAYCI  + +G DTAA+R+AVVKVMEQKG+AV + S D+ 
Sbjct  882   HMKKATEVALQMAEGASSNGKAYCISLVDVGGDTAAIREAVVKVMEQKGMAVMVISKDDQ  941

Query  402   ANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMD  223
              NK  +CAGVPEK    KQL+V EWL   L+ + GKGGGGKGGLAQGQ SD+  V+ AM+
Sbjct  942   VNKAFICAGVPEKDGKYKQLNVTEWLKKVLELISGKGGGGKGGLAQGQGSDVSRVEAAME  1001

Query  222   LAASFASIKLS  190
             +A SFA++KL+
Sbjct  1002  VAESFAAMKLT  1012



>ref|XP_006484669.1| PREDICTED: alanine--tRNA ligase-like isoform X2 [Citrus sinensis]
Length=1002

 Score =   156 bits (394),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 105/190 (55%), Positives = 141/190 (74%), Gaps = 0/190 (0%)
 Frame = -3

Query  762   EKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAE  583
             EK++ +A+ +E SL+E+ V +L + V+ A IPA KK +++ +++ LQ +V +A+K++A E
Sbjct  812   EKEVDDASKIEGSLVEKTVASLKSKVDGAAIPAPKKADIRAKIALLQNQVRKAQKKVAEE  871

Query  582   NSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEA  403
             N   AVK A+E AEAA S GK +CI R+ +GLD AAVR+AV+KV+EQKG+ V +FSTDE 
Sbjct  872   NLQKAVKVATETAEAAASNGKPFCISRVEVGLDAAAVREAVLKVIEQKGMPVMVFSTDET  931

Query  402   ANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMD  223
              NK +VCAGVPEK D  KQL V EWL AAL+PL G+ G GKGGLA GQ +D   V  AMD
Sbjct  932   TNKAVVCAGVPEKSDQSKQLEVSEWLTAALQPLKGRCGKGKGGLASGQGTDAAQVTPAMD  991

Query  222   LAASFASIKL  193
             LAA FA++KL
Sbjct  992   LAAEFAAMKL  1001



>emb|CDY64799.1| BnaUnng00940D, partial [Brassica napus]
Length=414

 Score =   151 bits (382),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 101/191 (53%), Positives = 141/191 (74%), Gaps = 0/191 (0%)
 Frame = -3

Query  762  EKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAE  583
            EK++++A+  E S LE+KV  L + V+ A +PAAKK +++ +++ LQ  V +A+K+IA +
Sbjct  224  EKEVEDASKAEGSALEKKVAALKSRVDSAIMPAAKKADIRAKIALLQNEVRKAQKKIAEQ  283

Query  582  NSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEA  403
            N   +VK A+E AE+A S GK +CI++L +GLD AAVR+AV KVME+KG+++ +FSTDE 
Sbjct  284  NLKISVKVATEAAESAASDGKTFCIIQLDVGLDAAAVREAVSKVMEKKGMSIMVFSTDET  343

Query  402  ANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMD  223
             NK +VCAGVP+K D  KQL V EWL  AL PL G+ G GK GLA GQ +D   V+ A+D
Sbjct  344  TNKAVVCAGVPDKSDKFKQLDVTEWLTTALGPLKGRCGKGKSGLASGQGTDASQVNAALD  403

Query  222  LAASFASIKLS  190
            LAASFAS+KL+
Sbjct  404  LAASFASLKLN  414



>ref|XP_010500574.1| PREDICTED: alanine--tRNA ligase-like [Camelina sativa]
Length=1006

 Score =   155 bits (391),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 103/191 (54%), Positives = 142/191 (74%), Gaps = 0/191 (0%)
 Frame = -3

Query  762   EKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAE  583
             EK++++A+  E S LE+KV+ L + V+ A IPAAKK +++ +++ LQ  V +A+KRIA +
Sbjct  816   EKEVEDASVAEGSALEKKVSALKSQVDTAVIPAAKKADIRAKIASLQNEVKKAQKRIAEQ  875

Query  582   NSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEA  403
             N   +VK A+E AE+A S GK +CI++L +GLD AAVR+AV KVME+KG+++ +FSTDE 
Sbjct  876   NLKKSVKVATEAAESAASIGKTFCIIQLDVGLDAAAVREAVSKVMEKKGMSIMVFSTDEG  935

Query  402   ANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMD  223
              NK +VCAGVP+K D  KQL V EWL  AL PL G+ G GKGGLA GQ +D   V  A+D
Sbjct  936   TNKAVVCAGVPDKSDQFKQLDVAEWLTTALGPLKGRCGKGKGGLASGQGTDASQVHAALD  995

Query  222   LAASFASIKLS  190
             +AASFAS+KL+
Sbjct  996   MAASFASMKLN  1006



>ref|XP_010662077.1| PREDICTED: alanine--tRNA ligase-like [Vitis vinifera]
Length=955

 Score =   152 bits (385),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 108/191 (57%), Positives = 140/191 (73%), Gaps = 0/191 (0%)
 Frame = -3

Query  762  EKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAE  583
            E+++  A+  E SLLE+KV +L + V+ A IPA KK +L+ ++S LQ +V + +K+IA E
Sbjct  765  EQEVDAASDAEGSLLEKKVASLRSRVDAAPIPAPKKADLRTKISLLQDQVRKEQKKIAEE  824

Query  582  NSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEA  403
            N   AVK A+EMA+ A S GKA+CI  + +GLDT AVR+AV+KV+EQKGI+V +FSTDE 
Sbjct  825  NIQKAVKVATEMADGAASDGKAFCISLVDVGLDTTAVREAVLKVIEQKGISVMVFSTDET  884

Query  402  ANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMD  223
             NK +V AGVPE G+  KQL V EWL AAL PL G+ G GKGGLAQGQ +D   V EAMD
Sbjct  885  TNKAVVYAGVPENGEKFKQLEVSEWLTAALGPLKGRCGKGKGGLAQGQGTDASLVKEAMD  944

Query  222  LAASFASIKLS  190
            +A  FAS+KLS
Sbjct  945  VATKFASMKLS  955



>gb|EYU19755.1| hypothetical protein MIMGU_mgv1a000969mg [Erythranthe guttata]
Length=927

 Score =   152 bits (385),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 108/191 (57%), Positives = 144/191 (75%), Gaps = 1/191 (1%)
 Frame = -3

Query  762  EKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAE  583
            E+++KEA+  E S+LE+KVT+LN+ VE A IP+AKK +LK ++S LQ++VI+AKK+IA E
Sbjct  738  EQEVKEASIAEGSVLEQKVTSLNSRVEGASIPSAKKADLKAKISVLQSQVIKAKKKIAEE  797

Query  582  NSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEA  403
            +   AV+ A++ AE A+S GK +CI  + +G DT A+R+AVVKVME+KG+AV +FS DE 
Sbjct  798  HMQKAVEVATQTAEGALSNGKTFCISLVDVGADTTAIREAVVKVMEKKGMAVMVFSIDEK  857

Query  402  ANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMD  223
             NK  VCAGVPE G    QL+V EWL   L  + GKGGGGKGGLAQGQ SD   V+ AMD
Sbjct  858  VNKAFVCAGVPEDGKY-GQLNVTEWLKKVLDLINGKGGGGKGGLAQGQGSDSSRVEAAMD  916

Query  222  LAASFASIKLS  190
            +A SFA++KL+
Sbjct  917  VAESFAAMKLT  927



>ref|XP_009124544.1| PREDICTED: alanine--tRNA ligase-like [Brassica rapa]
Length=684

 Score =   150 bits (380),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 99/190 (52%), Positives = 137/190 (72%), Gaps = 0/190 (0%)
 Frame = -3

Query  759  KKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAEN  580
            K++ EA+    + LE+KV  L   V+   IPAAK+ ++K ++++LQ  V +A+K+IA EN
Sbjct  495  KEVDEASKAVGNALEKKVNALKRRVDEVDIPAAKRADIKAKIAQLQNEVRKAQKKIAKEN  554

Query  579  SLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEAA  400
               +V+ A+E AE+A S GK +CI++L +GLD AAVR+AV KVM++KG++V +FSTDE+ 
Sbjct  555  LKKSVEIATEGAESAASDGKNFCIVQLDVGLDAAAVREAVSKVMQKKGMSVMVFSTDEST  614

Query  399  NKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMDL  220
            NK +VCAGVP+K D  KQL V EWL  AL P+ GK G GK GLA GQ +D   V  A+DL
Sbjct  615  NKAVVCAGVPDKSDQFKQLDVTEWLTTALSPIKGKCGKGKSGLASGQGTDASQVSSALDL  674

Query  219  AASFASIKLS  190
            AASFAS+KL+
Sbjct  675  AASFASMKLN  684



>ref|XP_010463338.1| PREDICTED: alanine--tRNA ligase-like [Camelina sativa]
Length=1050

 Score =   153 bits (386),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 102/191 (53%), Positives = 141/191 (74%), Gaps = 0/191 (0%)
 Frame = -3

Query  762   EKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAE  583
             EK++++A+  E S LE+KV+ L + V+ A IPAAKK +++ +++ LQ  V +A+KRIA +
Sbjct  860   EKEVEDASVAEGSALEKKVSALKSQVDTAVIPAAKKADIRAKIASLQNEVKKAQKRIAEQ  919

Query  582   NSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEA  403
             N   +VK A+E AE+A S GK +CI++L +GLD AAVR+AV KVME+KG+++ +FSTDE 
Sbjct  920   NLKKSVKVATEAAESAASIGKTFCIIQLDVGLDAAAVREAVSKVMEKKGMSIMVFSTDEG  979

Query  402   ANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMD  223
              NK +VCAGVP+K D  KQL V EWL  AL PL G+ G GKGGLA GQ +D   V  A+D
Sbjct  980   TNKAVVCAGVPDKSDQFKQLDVAEWLTTALGPLKGRCGKGKGGLASGQGTDASQVQAALD  1039

Query  222   LAASFASIKLS  190
             +A SFAS+KL+
Sbjct  1040  MAESFASMKLN  1050



>emb|CBI26461.3| unnamed protein product [Vitis vinifera]
Length=960

 Score =   152 bits (385),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 108/191 (57%), Positives = 140/191 (73%), Gaps = 0/191 (0%)
 Frame = -3

Query  762  EKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAE  583
            E+++  A+  E SLLE+KV +L + V+ A IPA KK +L+ ++S LQ +V + +K+IA E
Sbjct  770  EQEVDAASDAEGSLLEKKVASLRSRVDAAPIPAPKKADLRTKISLLQDQVRKEQKKIAEE  829

Query  582  NSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEA  403
            N   AVK A+EMA+ A S GKA+CI  + +GLDT AVR+AV+KV+EQKGI+V +FSTDE 
Sbjct  830  NIQKAVKVATEMADGAASDGKAFCISLVDVGLDTTAVREAVLKVIEQKGISVMVFSTDET  889

Query  402  ANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMD  223
             NK +V AGVPE G+  KQL V EWL AAL PL G+ G GKGGLAQGQ +D   V EAMD
Sbjct  890  TNKAVVYAGVPENGEKFKQLEVSEWLTAALGPLKGRCGKGKGGLAQGQGTDASLVKEAMD  949

Query  222  LAASFASIKLS  190
            +A  FAS+KLS
Sbjct  950  VATKFASMKLS  960



>ref|XP_007043323.1| Alanyl-tRNA synthetase, putative [Theobroma cacao]
 gb|EOX99154.1| Alanyl-tRNA synthetase, putative [Theobroma cacao]
Length=1015

 Score =   152 bits (383),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 102/189 (54%), Positives = 139/189 (74%), Gaps = 0/189 (0%)
 Frame = -3

Query  759   KKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAEN  580
             K++ +A+ +E SLLE+KV +L   V+ A IPAAKK +++ ++++LQ ++ +A+K+IA EN
Sbjct  826   KEVDDASKIEVSLLEKKVASLKTRVDSASIPAAKKADIRGKIAQLQNQLKKAQKKIAEEN  885

Query  579   SLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEAA  400
                AVK A+E+AE A S GK +C+ R+ +GLD AA+R+AV KV+EQKG+ V +FSTDE  
Sbjct  886   MQKAVKIATELAEVAASEGKTFCVSRIDVGLDAAALREAVSKVIEQKGMPVMVFSTDETT  945

Query  399   NKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMDL  220
             NK +V AGVPEK    K L V EWL  AL PL G+ G GKGGLA GQ +D  H++EAMDL
Sbjct  946   NKAVVYAGVPEKSAQSKLLEVSEWLTNALGPLKGRCGRGKGGLATGQGTDASHINEAMDL  1005

Query  219   AASFASIKL  193
             A SFAS+KL
Sbjct  1006  ATSFASMKL  1014



>ref|XP_009147848.1| PREDICTED: alanine--tRNA ligase-like [Brassica rapa]
Length=999

 Score =   151 bits (381),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 101/191 (53%), Positives = 141/191 (74%), Gaps = 0/191 (0%)
 Frame = -3

Query  762  EKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAE  583
            EK++++A+  E S LE+KV  L + V+ A +PAAKK +++ +++ LQ  V +A+K+IA +
Sbjct  809  EKEVEDASKAEGSALEKKVAALKSRVDSAIMPAAKKADIRAKIALLQNEVRKAQKKIAEQ  868

Query  582  NSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEA  403
            N   +VK A+E AE+A S GK +CI++L +GLD AAVR+AV KVME+KG+++ +FSTDE 
Sbjct  869  NLKISVKVATEAAESAASDGKTFCIIQLDVGLDAAAVREAVSKVMEKKGMSIMVFSTDET  928

Query  402  ANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMD  223
             NK +VCAGVP+K D  KQL V EWL  AL PL G+ G GK GLA GQ +D   V+ A+D
Sbjct  929  TNKAVVCAGVPDKSDKFKQLDVTEWLTTALGPLKGRCGKGKSGLASGQGTDASQVNAALD  988

Query  222  LAASFASIKLS  190
            LAASFAS+KL+
Sbjct  989  LAASFASLKLN  999



>emb|CDY22784.1| BnaA06g02930D [Brassica napus]
Length=999

 Score =   151 bits (381),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 101/191 (53%), Positives = 141/191 (74%), Gaps = 0/191 (0%)
 Frame = -3

Query  762  EKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAE  583
            EK++++A+  E S LE+KV  L + V+ A +PAAKK +++ +++ LQ  V +A+K+IA +
Sbjct  809  EKEVEDASKAEGSALEKKVAALKSRVDSAIMPAAKKADIRAKIALLQNEVRKAQKKIAEQ  868

Query  582  NSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEA  403
            N   +VK A+E AE+A S GK +CI++L +GLD AAVR+AV KVME+KG+++ +FSTDE 
Sbjct  869  NLKISVKVATEAAESAASDGKTFCIIQLDVGLDAAAVREAVSKVMEKKGMSIMVFSTDET  928

Query  402  ANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMD  223
             NK +VCAGVP+K D  KQL V EWL  AL PL G+ G GK GLA GQ +D   V+ A+D
Sbjct  929  TNKAVVCAGVPDKSDKFKQLDVTEWLTTALGPLKGRCGKGKSGLASGQGTDASQVNAALD  988

Query  222  LAASFASIKLS  190
            LAASFAS+KL+
Sbjct  989  LAASFASLKLN  999



>ref|XP_006437524.1| hypothetical protein CICLE_v10030624mg [Citrus clementina]
 gb|ESR50764.1| hypothetical protein CICLE_v10030624mg [Citrus clementina]
Length=1001

 Score =   151 bits (381),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 105/190 (55%), Positives = 140/190 (74%), Gaps = 1/190 (1%)
 Frame = -3

Query  762  EKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAE  583
            EK++ +A+ +E SLLE+ V +L + V+ A IPA KK +++ +++ LQ +V +A+K++A E
Sbjct  812  EKEVDDASKIEGSLLEKTVASLKSKVDGAAIPAPKKADIRAKIALLQNQVRKAQKKVAEE  871

Query  582  NSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEA  403
            N   AVK A+E AEAA S GK +CI R+ +GLD AAVR+AV+KV+EQ G+ V +FSTDE 
Sbjct  872  NLQKAVKVATETAEAAASNGKPFCISRVEVGLDAAAVREAVLKVIEQ-GMPVMVFSTDET  930

Query  402  ANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMD  223
             NK +VCAGVPEK D  KQL V EWL AAL+PL G+ G GKGGLA GQ +D   V  AMD
Sbjct  931  TNKAVVCAGVPEKSDQSKQLEVSEWLTAALQPLKGRCGKGKGGLASGQGTDAAQVTPAMD  990

Query  222  LAASFASIKL  193
            LAA FA++KL
Sbjct  991  LAAEFAAMKL  1000



>ref|XP_009107233.1| PREDICTED: alanine--tRNA ligase [Brassica rapa]
Length=997

 Score =   151 bits (381),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 101/191 (53%), Positives = 140/191 (73%), Gaps = 0/191 (0%)
 Frame = -3

Query  762  EKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAE  583
            EK++++A+  E + LE+KV  L + V+ A IPAAKK +++ +++ LQ  V +A+K+IA +
Sbjct  807  EKEVEDASKAEGNALEKKVAALKSRVDSAIIPAAKKADIRAKIALLQNEVRKAQKKIAEQ  866

Query  582  NSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEA  403
            N   +VK A+E AE+A S GK +CI++L +GLD AAVR+AV KVME+KG+++ +FSTDE 
Sbjct  867  NLKKSVKVATEAAESAASDGKTFCIIQLDVGLDAAAVREAVSKVMEKKGMSIMVFSTDET  926

Query  402  ANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMD  223
             NK +VCAGVP+K D  KQL V EWL  AL PL G+ G GK GLA GQ +D   V  A+D
Sbjct  927  TNKAVVCAGVPDKSDKFKQLDVTEWLTTALGPLKGRCGKGKSGLASGQGTDASQVKAALD  986

Query  222  LAASFASIKLS  190
            LAASFAS+KL+
Sbjct  987  LAASFASMKLN  997



>ref|XP_006590811.1| PREDICTED: alanine--tRNA ligase-like isoform X2 [Glycine max]
Length=824

 Score =   150 bits (378),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 100/191 (52%), Positives = 140/191 (73%), Gaps = 1/191 (1%)
 Frame = -3

Query  762  EKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAE  583
            E+++ +AA +  +LLEEKV++L +++E   IPAAKK ++K ++ +LQ +V +A+K++A E
Sbjct  635  EQQVDDAAKLVGTLLEEKVSSLKSNIETLSIPAAKKADIKIKIVRLQDQVRKAQKQVAEE  694

Query  582  NSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEA  403
            N   AV   +E AE A S GK +CI  + +GLD AAVR+AV KVM+QKG++V +FSTDE+
Sbjct  695  NKRKAVMITAEKAELAASNGKTFCISLVDVGLDVAAVREAVTKVMDQKGLSVMVFSTDES  754

Query  402  ANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMD  223
             NK +VCAGVPEKG     L V +WL+ AL PL G+ G GKGGLA GQ ++  HV+EA+D
Sbjct  755  TNKAVVCAGVPEKGG-KGNLDVADWLSNALGPLKGRCGKGKGGLATGQGTEASHVNEAID  813

Query  222  LAASFASIKLS  190
            LA  FAS+KLS
Sbjct  814  LAEKFASMKLS  824



>ref|XP_010541854.1| PREDICTED: alanine--tRNA ligase-like [Tarenaya hassleriana]
Length=1003

 Score =   150 bits (380),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 104/191 (54%), Positives = 143/191 (75%), Gaps = 3/191 (2%)
 Frame = -3

Query  762   EKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAE  583
             EK +++A+  E S LE+KV  LN+ V++A IPAAKK +++ +++ LQ+ V +A+K+IA E
Sbjct  816   EKDVEDASKEEGSTLEKKVAALNSRVDKAVIPAAKKADIRAKITLLQSEVRKAQKKIAEE  875

Query  582   NSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEA  403
             N   AVK A++ AEAA S GK++C+  + +GLD AAVR+AV KVM+QKG++V +FSTD  
Sbjct  876   NIQKAVKVATDAAEAAASNGKSFCVSHVDVGLDAAAVREAVSKVMKQKGMSVMVFSTDGT  935

Query  402   ANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMD  223
              NK +VCAGVP+K    KQL V EWL+ AL PL G+ G GKGGLA GQ +D   V+EA+D
Sbjct  936   TNKAIVCAGVPDK---YKQLDVTEWLSNALGPLNGRCGKGKGGLATGQGTDASQVNEALD  992

Query  222   LAASFASIKLS  190
             LAASFAS+KL+
Sbjct  993   LAASFASMKLN  1003



>ref|XP_002531134.1| alanyl-tRNA synthetase, putative [Ricinus communis]
 gb|EEF31254.1| alanyl-tRNA synthetase, putative [Ricinus communis]
Length=1025

 Score =   150 bits (380),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 105/190 (55%), Positives = 139/190 (73%), Gaps = 0/190 (0%)
 Frame = -3

Query  762   EKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAE  583
             E++  E +  E SLLE+KV +L + V+ A IPAAKK +++ ++S LQ  V +A+K+I+ E
Sbjct  835   EQEADEISKTEGSLLEKKVASLKSRVDSAPIPAAKKFDIRTKISALQDEVRKAQKKISEE  894

Query  582   NSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEA  403
             N   AVK A+EMAE A S GK +CI R+ +GLD AAVR+AV KV+++KG++  +FS DE 
Sbjct  895   NMQKAVKIATEMAEVAASEGKQFCISRVDVGLDAAAVREAVSKVLQKKGLSAMVFSIDET  954

Query  402   ANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMD  223
              NKV+VCAGV EKGD  KQL V EWL AALKPL G+ G GKGGLA GQ ++  H+D AM+
Sbjct  955   TNKVVVCAGVAEKGDKSKQLEVSEWLTAALKPLNGRCGKGKGGLATGQGTEGVHLDAAMN  1014

Query  222   LAASFASIKL  193
             LAA FA +KL
Sbjct  1015  LAAEFAQMKL  1024



>gb|KHN32273.1| Alanine--tRNA ligase, partial [Glycine soja]
Length=919

 Score =   150 bits (378),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 100/191 (52%), Positives = 140/191 (73%), Gaps = 1/191 (1%)
 Frame = -3

Query  762  EKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAE  583
            E+++ +AA +  +LLEEKV++L +++E   IPAAKK ++K ++ +LQ +V +A+K++A E
Sbjct  730  EQQVDDAAKLVGTLLEEKVSSLKSNIETLSIPAAKKADIKIKIVRLQDQVRKAQKQVAEE  789

Query  582  NSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEA  403
            N   AV   +E AE A S GK +CI  + +GLD AAVR+AV KVM+QKG++V +FSTDE+
Sbjct  790  NKRKAVMITAEKAELAASNGKTFCISLVDVGLDVAAVREAVTKVMDQKGLSVMVFSTDES  849

Query  402  ANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMD  223
             NK +VCAGVPEKG     L V +WL+ AL PL G+ G GKGGLA GQ ++  HV+EA+D
Sbjct  850  TNKAVVCAGVPEKGGK-GNLDVADWLSNALGPLKGRCGKGKGGLATGQGTEASHVNEAID  908

Query  222  LAASFASIKLS  190
            LA  FAS+KLS
Sbjct  909  LAEKFASMKLS  919



>ref|XP_003537781.2| PREDICTED: alanine--tRNA ligase-like isoform X1 [Glycine max]
Length=999

 Score =   150 bits (378),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 100/191 (52%), Positives = 140/191 (73%), Gaps = 1/191 (1%)
 Frame = -3

Query  762  EKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAE  583
            E+++ +AA +  +LLEEKV++L +++E   IPAAKK ++K ++ +LQ +V +A+K++A E
Sbjct  810  EQQVDDAAKLVGTLLEEKVSSLKSNIETLSIPAAKKADIKIKIVRLQDQVRKAQKQVAEE  869

Query  582  NSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEA  403
            N   AV   +E AE A S GK +CI  + +GLD AAVR+AV KVM+QKG++V +FSTDE+
Sbjct  870  NKRKAVMITAEKAELAASNGKTFCISLVDVGLDVAAVREAVTKVMDQKGLSVMVFSTDES  929

Query  402  ANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMD  223
             NK +VCAGVPEKG     L V +WL+ AL PL G+ G GKGGLA GQ ++  HV+EA+D
Sbjct  930  TNKAVVCAGVPEKGG-KGNLDVADWLSNALGPLKGRCGKGKGGLATGQGTEASHVNEAID  988

Query  222  LAASFASIKLS  190
            LA  FAS+KLS
Sbjct  989  LAEKFASMKLS  999



>ref|XP_004148575.1| PREDICTED: alanine--tRNA ligase-like [Cucumis sativus]
Length=956

 Score =   149 bits (376),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 99/191 (52%), Positives = 134/191 (70%), Gaps = 0/191 (0%)
 Frame = -3

Query  762  EKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAE  583
            E+++  A +++ +LLE+ V +    V+ A IPAA+K +++ ++  LQ  V +A+K++A E
Sbjct  765  EQEVDAAFNIDGNLLEKMVASFKNRVDSAPIPAARKAQIRTKIVLLQNEVRKAQKKLAEE  824

Query  582  NSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEA  403
            N   AVK A E AE A S GK +CI  + +GLD AAVR+AVV+VMEQKGI+  +FSTDE 
Sbjct  825  NMQKAVKIAVETAEMASSEGKPFCISHVDVGLDAAAVREAVVRVMEQKGISTMVFSTDET  884

Query  402  ANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMD  223
              K +VCAGVP KG+  KQL V EWL  AL+PL G+ G GKGGLA GQ +D   + EAMD
Sbjct  885  TKKAVVCAGVPPKGNQGKQLEVSEWLTTALQPLKGRCGKGKGGLATGQGTDASQIKEAMD  944

Query  222  LAASFASIKLS  190
            LA SFAS+KL+
Sbjct  945  LATSFASLKLN  955



>gb|KGN58521.1| hypothetical protein Csa_3G656490 [Cucumis sativus]
Length=1030

 Score =   149 bits (376),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 99/191 (52%), Positives = 134/191 (70%), Gaps = 0/191 (0%)
 Frame = -3

Query  762   EKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAE  583
             E+++  A +++ +LLE+ V +    V+ A IPAA+K +++ ++  LQ  V +A+K++A E
Sbjct  839   EQEVDAAFNIDGNLLEKMVASFKNRVDSAPIPAARKAQIRTKIVLLQNEVRKAQKKLAEE  898

Query  582   NSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEA  403
             N   AVK A E AE A S GK +CI  + +GLD AAVR+AVV+VMEQKGI+  +FSTDE 
Sbjct  899   NMQKAVKIAVETAEMASSEGKPFCISHVDVGLDAAAVREAVVRVMEQKGISTMVFSTDET  958

Query  402   ANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMD  223
               K +VCAGVP KG+  KQL V EWL  AL+PL G+ G GKGGLA GQ +D   + EAMD
Sbjct  959   TKKAVVCAGVPPKGNQGKQLEVSEWLTTALQPLKGRCGKGKGGLATGQGTDASQIKEAMD  1018

Query  222   LAASFASIKLS  190
             LA SFAS+KL+
Sbjct  1019  LATSFASLKLN  1029



>ref|XP_004163302.1| PREDICTED: LOW QUALITY PROTEIN: alanine--tRNA ligase-like [Cucumis 
sativus]
Length=956

 Score =   149 bits (376),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 99/191 (52%), Positives = 134/191 (70%), Gaps = 0/191 (0%)
 Frame = -3

Query  762  EKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAE  583
            E+++  A +++ +LLE+ V +    V+ A IPAA+K +++ ++  LQ  V +A+K++A E
Sbjct  765  EQEVDAAFNIDGNLLEKMVASFKNRVDSAPIPAARKAQIRTKIVLLQNEVRKAQKKLAEE  824

Query  582  NSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEA  403
            N   AVK A E AE A S GK +CI  + +GLD AAVR+AVV+VMEQKGI+  +FSTDE 
Sbjct  825  NMQKAVKIAVETAEMASSEGKPFCISHVDVGLDAAAVREAVVRVMEQKGISTMVFSTDET  884

Query  402  ANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMD  223
              K +VCAGVP KG+  KQL V EWL  AL+PL G+ G GKGGLA GQ +D   + EAMD
Sbjct  885  TKKAVVCAGVPPKGNQGKQLEVSEWLTTALQPLKGRCGKGKGGLATGQGTDASQIKEAMD  944

Query  222  LAASFASIKLS  190
            LA SFAS+KL+
Sbjct  945  LATSFASLKLN  955



>ref|XP_007225354.1| hypothetical protein PRUPE_ppa000923mg [Prunus persica]
 gb|EMJ26553.1| hypothetical protein PRUPE_ppa000923mg [Prunus persica]
Length=960

 Score =   147 bits (372),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 103/190 (54%), Positives = 137/190 (72%), Gaps = 2/190 (1%)
 Frame = -3

Query  762  EKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAE  583
            E+++ EA+  E SLLE+KV +L + V+ A IP A K E++ +++ LQ +V +A+K IA +
Sbjct  772  EQEVDEASKAEGSLLEKKVASLKSRVDSAPIPVANKAEIRAKIAVLQNQVRKAQKIIAEQ  831

Query  582  NSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEA  403
            N  NAVK A+EMAE A S GKAYC+  + +GLD AAVR+AVVKV+E+KG+   +FSTDE 
Sbjct  832  NMQNAVKVATEMAEVAASDGKAYCVSHVDVGLDAAAVREAVVKVIEKKGMPAMVFSTDET  891

Query  402  ANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMD  223
             NK +VCAGVP  GD   QL V EWL A+L PL G+ G GKGGLA GQ +D   ++EA+D
Sbjct  892  TNKAVVCAGVP--GDKGNQLEVSEWLTASLGPLKGRCGKGKGGLATGQGTDASRLNEAVD  949

Query  222  LAASFASIKL  193
            LA SFA +KL
Sbjct  950  LATSFAQMKL  959



>gb|KJB31826.1| hypothetical protein B456_005G210000 [Gossypium raimondii]
Length=974

 Score =   146 bits (369),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 96/189 (51%), Positives = 137/189 (72%), Gaps = 0/189 (0%)
 Frame = -3

Query  759  KKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAEN  580
            K++ +A+++E  LLE+KV +L  +V+ A IPAA+K +++ ++++LQ ++ +A+K+IA +N
Sbjct  785  KEVDDASNMEVRLLEKKVASLKTTVDSASIPAAQKADIRSKIAQLQNQLKKAQKKIAEQN  844

Query  579  SLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEAA  400
               AV  A+E+AE A   GK +C+ R+ +GLD AA+R+AV KV++QKG+ V +FS DE  
Sbjct  845  MQRAVTTATELAEVAAKEGKTFCVTRIDVGLDAAALREAVSKVIQQKGMPVMVFSIDETT  904

Query  399  NKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMDL  220
            NK +V AGVPEK +  K L V EWL  AL PL G+ G GKGGLA GQ +D  HV EAMDL
Sbjct  905  NKAVVYAGVPEKSEQSKLLEVSEWLTNALGPLKGRCGKGKGGLATGQGTDGSHVKEAMDL  964

Query  219  AASFASIKL  193
            A SFAS+KL
Sbjct  965  ATSFASMKL  973



>gb|KJB31825.1| hypothetical protein B456_005G210000 [Gossypium raimondii]
Length=1015

 Score =   146 bits (369),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 96/189 (51%), Positives = 137/189 (72%), Gaps = 0/189 (0%)
 Frame = -3

Query  759   KKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAEN  580
             K++ +A+++E  LLE+KV +L  +V+ A IPAA+K +++ ++++LQ ++ +A+K+IA +N
Sbjct  826   KEVDDASNMEVRLLEKKVASLKTTVDSASIPAAQKADIRSKIAQLQNQLKKAQKKIAEQN  885

Query  579   SLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEAA  400
                AV  A+E+AE A   GK +C+ R+ +GLD AA+R+AV KV++QKG+ V +FS DE  
Sbjct  886   MQRAVTTATELAEVAAKEGKTFCVTRIDVGLDAAALREAVSKVIQQKGMPVMVFSIDETT  945

Query  399   NKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMDL  220
             NK +V AGVPEK +  K L V EWL  AL PL G+ G GKGGLA GQ +D  HV EAMDL
Sbjct  946   NKAVVYAGVPEKSEQSKLLEVSEWLTNALGPLKGRCGKGKGGLATGQGTDGSHVKEAMDL  1005

Query  219   AASFASIKL  193
             A SFAS+KL
Sbjct  1006  ATSFASMKL  1014



>emb|CAA73145.1| alanyl t-RNA synthetase [Arabidopsis thaliana]
Length=251

 Score =   139 bits (349),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 100/191 (52%), Positives = 142/191 (74%), Gaps = 0/191 (0%)
 Frame = -3

Query  762  EKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAE  583
            E+++++A+  E S LE+KV+ L + V+ A IPAAKK +++ +++ LQ  V +A+K+IA +
Sbjct  61   EREVEDASRAEGSALEKKVSALKSRVDAAIIPAAKKADIRTKIASLQNEVRKAQKKIAEQ  120

Query  582  NSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEA  403
            N   +VK A+E AE+A S GK +CI++L +GLD AAVR+AV KVME+KG+++ +FSTDE+
Sbjct  121  NLKKSVKLATEAAESAASDGKTFCIIQLDVGLDAAAVREAVSKVMEKKGMSIMVFSTDES  180

Query  402  ANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMD  223
             NK +VCAGVPEK D  K L V EWL  AL PL G+ G GKGGLA GQ +D   V  A+D
Sbjct  181  TNKAVVCAGVPEKSDQFKPLDVTEWLTTALGPLKGRCGKGKGGLASGQGTDAFQVQAALD  240

Query  222  LAASFASIKLS  190
            +A+SFAS+KL+
Sbjct  241  MASSFASMKLN  251



>ref|XP_006305941.1| hypothetical protein CARUB_v10011180mg [Capsella rubella]
 gb|EOA38839.1| hypothetical protein CARUB_v10011180mg [Capsella rubella]
Length=1003

 Score =   145 bits (365),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 104/191 (54%), Positives = 142/191 (74%), Gaps = 0/191 (0%)
 Frame = -3

Query  762   EKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAE  583
             EK++++A+  E S LE+KV+ L + V+ A IPAAKK +++ +++ LQ  V +A+KRIA +
Sbjct  813   EKEVEDASKAEGSALEKKVSALKSRVDAAIIPAAKKADIRAKIASLQNEVRKAQKRIAEQ  872

Query  582   NSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEA  403
             N   +VK A E AE+A S GK +CI++L +GLD AAVR+AV KVME+KG+++ +FSTDE+
Sbjct  873   NLKKSVKVAIETAESAASDGKTFCIIQLDVGLDAAAVREAVSKVMEKKGMSIMVFSTDES  932

Query  402   ANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMD  223
              NK +VCAGVPEK D  KQL V EWL  AL PL G+ G GKGGLA GQ +D   V  A+D
Sbjct  933   TNKAVVCAGVPEKSDQFKQLDVTEWLTTALGPLKGRCGKGKGGLASGQGTDASQVQAALD  992

Query  222   LAASFASIKLS  190
             +AASFAS+KL+
Sbjct  993   MAASFASMKLN  1003



>ref|XP_010112290.1| Alanine--tRNA ligase [Morus notabilis]
 gb|EXC33093.1| Alanine--tRNA ligase [Morus notabilis]
Length=906

 Score =   144 bits (363),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 97/190 (51%), Positives = 134/190 (71%), Gaps = 0/190 (0%)
 Frame = -3

Query  762  EKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAE  583
            E+++ +A+  E   LE+KV +L   V+ A IPAAKK +++ +++ LQ +V +A+K+IA E
Sbjct  716  EQEVDDASKDEGISLEKKVASLKNRVDSALIPAAKKADIRSKIALLQNQVKKAQKKIAEE  775

Query  582  NSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEA  403
            N   A++  + +A+ A S GKA+CI  + +GLD  AVR+AV KVM+ KG++  +FSTD  
Sbjct  776  NLQKAIQVTTMIADNATSEGKAFCICSVDVGLDVNAVREAVSKVMKDKGMSAMVFSTDVT  835

Query  402  ANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMD  223
             NK +VCAGVPEKGD  K L V  WL AAL+PL G+ G GKGGLA GQ +D  HV EAM 
Sbjct  836  TNKAVVCAGVPEKGDKSKLLDVTAWLTAALEPLKGRCGKGKGGLATGQGTDASHVQEAMS  895

Query  222  LAASFASIKL  193
            LA+SFAS+KL
Sbjct  896  LASSFASMKL  905



>ref|XP_008340455.1| PREDICTED: alanine--tRNA ligase [Malus domestica]
Length=1015

 Score =   144 bits (362),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 103/190 (54%), Positives = 137/190 (72%), Gaps = 3/190 (2%)
 Frame = -3

Query  762   EKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAE  583
             E+ + EA+  E SLLE+KV +L + V+ A IPAAKK E++ +++ LQT++ +A+K IA +
Sbjct  828   EQDVHEASKAEGSLLEKKVASLKSRVDSAPIPAAKKAEIRTKMAVLQTQLKKAQKMIAEQ  887

Query  582   NSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEA  403
             N  NAVK A+EMAE A S GKAYC+ ++ +GLDTAAVR+AV+K+    G+   +FSTDE 
Sbjct  888   NIKNAVKVATEMAEVAASDGKAYCVSQVDVGLDTAAVREAVLKITGM-GMPAMVFSTDET  946

Query  402   ANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMD  223
              NK LVCAGVP  GD   QL V EWL AA+ PL G+ G GKGGLA GQ +D   ++EA+D
Sbjct  947   TNKALVCAGVP--GDKGTQLEVSEWLTAAMGPLNGRCGKGKGGLATGQGTDASRLNEAID  1004

Query  222   LAASFASIKL  193
             LA SFA +KL
Sbjct  1005  LATSFAQMKL  1014



>ref|XP_009351710.1| PREDICTED: alanine--tRNA ligase [Pyrus x bretschneideri]
Length=952

 Score =   143 bits (361),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 103/190 (54%), Positives = 137/190 (72%), Gaps = 3/190 (2%)
 Frame = -3

Query  762  EKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAE  583
            E+ + EA+  E SLLE+KV +L + V+ A IPAAKK E++ +++ LQT++ +A+K IA +
Sbjct  765  EQDVHEASKAEGSLLEKKVASLKSRVDSAPIPAAKKAEIRAKMAVLQTQLRKAQKMIAEQ  824

Query  582  NSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEA  403
            N  NAVK A+EMAE A S GKAYC+ ++ +GLDTAAVR+AV+K+    G+   +FSTDE 
Sbjct  825  NIKNAVKVATEMAEVAASDGKAYCVSQVDVGLDTAAVREAVLKITGM-GMPAMVFSTDET  883

Query  402  ANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMD  223
             NK LVCAGVP  GD   QL V EWL AA+ PL G+ G GKGGLA GQ +D   ++EA+D
Sbjct  884  TNKALVCAGVP--GDKGTQLEVSEWLTAAMGPLNGRCGKGKGGLATGQGTDASRLNEAID  941

Query  222  LAASFASIKL  193
            LA SFA +KL
Sbjct  942  LATSFAQMKL  951



>ref|XP_008221037.1| PREDICTED: alanine--tRNA ligase [Prunus mume]
Length=1025

 Score =   142 bits (359),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 102/190 (54%), Positives = 135/190 (71%), Gaps = 3/190 (2%)
 Frame = -3

Query  762   EKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAE  583
             E+++ EA+  E SLLE+KV +L + V+ A IP A K E++ +++ LQ +V +A+K IA +
Sbjct  838   EQEVDEASKAEGSLLEKKVASLKSRVDSAPIPVANKAEIRAKIAVLQNQVRKAQKIIAEQ  897

Query  582   NSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEA  403
             N  NAVK A+EMAE A S GKAYC+  + +GLD AAVR+AVVKV+E KG+   +FSTDE 
Sbjct  898   NMQNAVKVATEMAEVAASDGKAYCVSHVDVGLDVAAVREAVVKVIE-KGMPAMVFSTDET  956

Query  402   ANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMD  223
              NK +VCAGVP  GD   QL V EWL A+L PL G+ G GKGGL  GQ +D   ++EA+D
Sbjct  957   TNKAVVCAGVP--GDKGNQLEVSEWLTASLGPLKGRCGKGKGGLVTGQGTDASRLNEAVD  1014

Query  222   LAASFASIKL  193
             LA SFA +KL
Sbjct  1015  LATSFAQMKL  1024



>gb|KDO52983.1| hypothetical protein CISIN_1g001826mg [Citrus sinensis]
Length=1009

 Score =   142 bits (357),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 83/152 (55%), Positives = 114/152 (75%), Gaps = 0/152 (0%)
 Frame = -3

Query  762  EKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAE  583
            EK++ +A+ +E SLLE+ V +L + V+ A IPA KK +++ +++ LQ +V +A+K++A E
Sbjct  812  EKEVDDASKIEGSLLEKTVASLKSKVDGAAIPAPKKADIRAKIALLQNQVRKAQKKVAEE  871

Query  582  NSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEA  403
            N   AVK A+E AEAA S GK +CI R+ +GLD AAVR+AV+KV+EQKG+ V +FSTDE 
Sbjct  872  NLQKAVKVATETAEAAASNGKPFCISRVEVGLDAAAVREAVLKVIEQKGMPVMVFSTDET  931

Query  402  ANKVLVCAGVPEKGDVCKQLSVKEWLNAALKP  307
             NK +VCAGVPEK D  KQL V EWL AAL+P
Sbjct  932  TNKAVVCAGVPEKSDQSKQLEVSEWLTAALQP  963



>ref|XP_010479473.1| PREDICTED: alanine--tRNA ligase [Camelina sativa]
Length=1006

 Score =   141 bits (356),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 102/191 (53%), Positives = 143/191 (75%), Gaps = 0/191 (0%)
 Frame = -3

Query  762   EKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAE  583
             EK++++A+  E S LE+KV+ L + V+ A IPAAKK +++ +++ LQ  V +A+KRIA +
Sbjct  816   EKEVEDASVAEGSALEKKVSALKSQVDAAIIPAAKKADIRAKIASLQNEVKKAQKRIAEQ  875

Query  582   NSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEA  403
             N   +VK A+E AE+A S GK +CI++L +GLD AAVR+AV KVME+KG+++ +FSTDE+
Sbjct  876   NLKKSVKVATEAAESAASNGKTFCIIQLDVGLDAAAVREAVSKVMEKKGMSIMVFSTDES  935

Query  402   ANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMD  223
              NK +VCAGVP+K D  KQL V EWL  AL PL G+ G GKGGLA GQ +D   V  A+D
Sbjct  936   TNKAVVCAGVPDKSDQFKQLDVTEWLTNALGPLKGRCGKGKGGLASGQGTDASQVQAALD  995

Query  222   LAASFASIKLS  190
             +A+SFAS+KL+
Sbjct  996   MASSFASMKLN  1006



>ref|XP_006484668.1| PREDICTED: alanine--tRNA ligase-like isoform X1 [Citrus sinensis]
Length=1009

 Score =   140 bits (354),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 82/152 (54%), Positives = 114/152 (75%), Gaps = 0/152 (0%)
 Frame = -3

Query  762  EKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAE  583
            EK++ +A+ +E SL+E+ V +L + V+ A IPA KK +++ +++ LQ +V +A+K++A E
Sbjct  812  EKEVDDASKIEGSLVEKTVASLKSKVDGAAIPAPKKADIRAKIALLQNQVRKAQKKVAEE  871

Query  582  NSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEA  403
            N   AVK A+E AEAA S GK +CI R+ +GLD AAVR+AV+KV+EQKG+ V +FSTDE 
Sbjct  872  NLQKAVKVATETAEAAASNGKPFCISRVEVGLDAAAVREAVLKVIEQKGMPVMVFSTDET  931

Query  402  ANKVLVCAGVPEKGDVCKQLSVKEWLNAALKP  307
             NK +VCAGVPEK D  KQL V EWL AAL+P
Sbjct  932  TNKAVVCAGVPEKSDQSKQLEVSEWLTAALQP  963



>ref|XP_008366973.1| PREDICTED: alanine--tRNA ligase-like [Malus domestica]
Length=901

 Score =   140 bits (353),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 102/190 (54%), Positives = 135/190 (71%), Gaps = 3/190 (2%)
 Frame = -3

Query  762  EKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAE  583
            E+ + EA+  E SLLE+KV +L + V+ A IPAAKK E++ +++ LQ ++ +A+K IA +
Sbjct  714  EQDVHEASKAEGSLLEKKVXSLKSRVDSAPIPAAKKAEIRAKMAVLQNQLKKAQKMIAEQ  773

Query  582  NSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEA  403
            N  NAVK A+EMAE A S GKAYC+ ++ +GLD AAVR+AV+K+    GI   +FSTDE 
Sbjct  774  NIKNAVKVATEMAEVAASDGKAYCVSQVDVGLDAAAVREAVLKITGM-GIPAMVFSTDET  832

Query  402  ANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMD  223
             NK LVCAGVP  GD   QL V EWL AA+ PL G+ G GKGGLA GQ +D   ++EA+D
Sbjct  833  TNKALVCAGVP--GDKGTQLEVSEWLTAAMGPLNGRCGKGKGGLASGQGTDASRLNEAID  890

Query  222  LAASFASIKL  193
            LA SFA +KL
Sbjct  891  LATSFAQMKL  900



>ref|XP_010265724.1| PREDICTED: alanine--tRNA ligase-like [Nelumbo nucifera]
Length=493

 Score =   137 bits (346),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 94/193 (49%), Positives = 132/193 (68%), Gaps = 3/193 (2%)
 Frame = -3

Query  762  EKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAE  583
            +++I  AA +E S LE+KV +L + V+ A IPAA K +L  ++S+LQ +V +  K+IA E
Sbjct  300  DQEISGAAKIEVSQLEKKVASLKSRVQSATIPAAMKTDLSAKISQLQDQVRKEMKKIAQE  359

Query  582  NSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEA  403
            N   A   A+EMA+AA S G+++C+  + +GLD AAVR+AV++ M+QKG++V IFSTDE 
Sbjct  360  NVQKAKTTAAEMADAAASNGESFCVCHVNVGLDAAAVREAVIRTMDQKGMSVMIFSTDET  419

Query  402  ANKVLVCAGVPEKGDVCKQLSVKEWLNAALKP---lggkggggkgglaqgqASDLKHVDE  232
             NK + CAGV E  D  K L V EW  AA++P    GGKG  GK   AQGQ +D  H+ E
Sbjct  420  TNKAVACAGVVENVDKSKDLDVLEWFTAAMEPLKGRGGKGNVGKRFYAQGQGTDASHLQE  479

Query  231  AMDLAASFASIKL  193
            AMD+A +FAS++L
Sbjct  480  AMDIATAFASMRL  492



>gb|KJB50036.1| hypothetical protein B456_008G149700 [Gossypium raimondii]
Length=1010

 Score =   140 bits (352),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 96/189 (51%), Positives = 136/189 (72%), Gaps = 0/189 (0%)
 Frame = -3

Query  759   KKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAEN  580
             +++ +A+ +E +LLE+KV +L  SV+ A IPAAKK +++ ++++LQ ++ +A+K+IA +N
Sbjct  821   QEVDDASKMEVNLLEKKVASLKTSVDSASIPAAKKADIRAKIAQLQNQLKKAQKKIAEQN  880

Query  579   SLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEAA  400
                AV  A E+AE A   GK +CI R+ +GLD AA+R+AV KV++QK + V +FS DE  
Sbjct  881   MQKAVTIAIELAELAAKEGKTFCISRIDVGLDAAALREAVSKVIQQKEMPVMVFSIDETT  940

Query  399   NKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMDL  220
             NK +V AGVPEK +  K+L V EWL  AL PL GK G GKGGLA GQ +D   V+EA+DL
Sbjct  941   NKAVVYAGVPEKSESIKRLEVSEWLTKALGPLKGKCGRGKGGLATGQGTDASRVNEAIDL  1000

Query  219   AASFASIKL  193
             A SFAS+KL
Sbjct  1001  ATSFASMKL  1009



>ref|XP_006393172.1| hypothetical protein EUTSA_v10011205mg [Eutrema salsugineum]
 gb|ESQ30458.1| hypothetical protein EUTSA_v10011205mg [Eutrema salsugineum]
Length=1001

 Score =   139 bits (350),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 102/191 (53%), Positives = 138/191 (72%), Gaps = 0/191 (0%)
 Frame = -3

Query  762   EKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAE  583
             EK+ ++A   E S LE+KV TL   V+   IPAAKK ++K ++  LQ  V +A+K+IA +
Sbjct  811   EKEAEDAFKAEGSALEKKVATLKRRVDEVDIPAAKKADIKAKIVLLQNEVRKAQKKIAEQ  870

Query  582   NSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEA  403
             N   +V+ A+E AE+A S GK +CI++L +GLD AAVR+AV KVM++KG++V +FSTDE+
Sbjct  871   NLKKSVEVATEAAESAASDGKMFCIVQLDVGLDAAAVREAVSKVMQKKGMSVMVFSTDES  930

Query  402   ANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMD  223
              NK +VCAGVPEK D  KQL V EWL  AL PL G+ G GK GLA GQ +D   V+ A+D
Sbjct  931   TNKAVVCAGVPEKSDQFKQLDVTEWLTTALGPLKGRCGKGKSGLATGQGTDASQVNAALD  990

Query  222   LAASFASIKLS  190
             +AASFAS+KL+
Sbjct  991   MAASFASMKLN  1001



>ref|XP_006393171.1| hypothetical protein EUTSA_v10011205mg [Eutrema salsugineum]
 gb|ESQ30457.1| hypothetical protein EUTSA_v10011205mg [Eutrema salsugineum]
Length=994

 Score =   139 bits (350),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 102/191 (53%), Positives = 138/191 (72%), Gaps = 0/191 (0%)
 Frame = -3

Query  762  EKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAE  583
            EK+ ++A   E S LE+KV TL   V+   IPAAKK ++K ++  LQ  V +A+K+IA +
Sbjct  804  EKEAEDAFKAEGSALEKKVATLKRRVDEVDIPAAKKADIKAKIVLLQNEVRKAQKKIAEQ  863

Query  582  NSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEA  403
            N   +V+ A+E AE+A S GK +CI++L +GLD AAVR+AV KVM++KG++V +FSTDE+
Sbjct  864  NLKKSVEVATEAAESAASDGKMFCIVQLDVGLDAAAVREAVSKVMQKKGMSVMVFSTDES  923

Query  402  ANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMD  223
             NK +VCAGVPEK D  KQL V EWL  AL PL G+ G GK GLA GQ +D   V+ A+D
Sbjct  924  TNKAVVCAGVPEKSDQFKQLDVTEWLTTALGPLKGRCGKGKSGLATGQGTDASQVNAALD  983

Query  222  LAASFASIKLS  190
            +AASFAS+KL+
Sbjct  984  MAASFASMKLN  994



>ref|XP_006393173.1| hypothetical protein EUTSA_v10011205mg [Eutrema salsugineum]
 gb|ESQ30459.1| hypothetical protein EUTSA_v10011205mg [Eutrema salsugineum]
Length=1005

 Score =   139 bits (350),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 102/191 (53%), Positives = 138/191 (72%), Gaps = 0/191 (0%)
 Frame = -3

Query  762   EKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAE  583
             EK+ ++A   E S LE+KV TL   V+   IPAAKK ++K ++  LQ  V +A+K+IA +
Sbjct  815   EKEAEDAFKAEGSALEKKVATLKRRVDEVDIPAAKKADIKAKIVLLQNEVRKAQKKIAEQ  874

Query  582   NSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEA  403
             N   +V+ A+E AE+A S GK +CI++L +GLD AAVR+AV KVM++KG++V +FSTDE+
Sbjct  875   NLKKSVEVATEAAESAASDGKMFCIVQLDVGLDAAAVREAVSKVMQKKGMSVMVFSTDES  934

Query  402   ANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMD  223
              NK +VCAGVPEK D  KQL V EWL  AL PL G+ G GK GLA GQ +D   V+ A+D
Sbjct  935   TNKAVVCAGVPEKSDQFKQLDVTEWLTTALGPLKGRCGKGKSGLATGQGTDASQVNAALD  994

Query  222   LAASFASIKLS  190
             +AASFAS+KL+
Sbjct  995   MAASFASMKLN  1005



>ref|XP_002894237.1| cytosolic tRNA-Ala synthetase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70496.1| cytosolic tRNA-Ala synthetase [Arabidopsis lyrata subsp. lyrata]
Length=955

 Score =   139 bits (349),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 101/191 (53%), Positives = 142/191 (74%), Gaps = 0/191 (0%)
 Frame = -3

Query  762  EKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAE  583
            E+++++A+  E S LE+KV+ L + V+ A IPAAKK +++ +++ LQ  V +A+K+IA +
Sbjct  765  EREVEDASRAEGSALEKKVSALKSRVDAAIIPAAKKADIRAKIASLQNEVRKAQKKIAEQ  824

Query  582  NSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEA  403
            N   +VK A+E AE+A S GK +CI++L +GLD AAVR+AV KVME+KG+++ +FSTDE+
Sbjct  825  NLKKSVKVATEAAESAASDGKTFCIIQLDVGLDAAAVREAVSKVMEKKGMSIMVFSTDES  884

Query  402  ANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMD  223
             NK +VCAGVPEK D  K L V EWL  AL PL G+ G GKGGLA GQ +D   V  A+D
Sbjct  885  TNKAVVCAGVPEKSDQFKPLDVTEWLTTALGPLKGRCGKGKGGLASGQGTDASQVQAALD  944

Query  222  LAASFASIKLS  190
            +AASFAS+KL+
Sbjct  945  MAASFASMKLN  955



>ref|XP_010273668.1| PREDICTED: alanine--tRNA ligase [Nelumbo nucifera]
Length=1038

 Score =   139 bits (349),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 94/193 (49%), Positives = 134/193 (69%), Gaps = 3/193 (2%)
 Frame = -3

Query  762   EKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAE  583
             E++I +AA ++ S +E+KV +L + V+ A IPA  K +L  ++S+LQ +V +A K+IA E
Sbjct  845   EQEISDAAKLDVSQMEKKVASLKSRVQSAAIPATMKADLGAKISQLQDQVRKATKKIAQE  904

Query  582   NSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEA  403
             N   A K A+EMA+ A + GKA+CI R+ +GLD AA+R+AV+K M+QKG++V IFSTDE 
Sbjct  905   NIQKATKTAAEMADIAATNGKAFCICRVNVGLDAAAIREAVIKTMDQKGMSVMIFSTDET  964

Query  402   ANKVLVCAGVPEKGDVCKQLSVKEWLNAALKP---lggkggggkgglaqgqASDLKHVDE  232
              NK +VCAGV E G   K L + EW  AA++P    GGKG  GK   AQGQ +D   V +
Sbjct  965   TNKAVVCAGVSENGSKSKDLDLLEWFTAAMEPLKGRGGKGSVGKRFYAQGQGTDASQVQQ  1024

Query  231   AMDLAASFASIKL  193
             A+++A +FAS+KL
Sbjct  1025  AIEIATAFASMKL  1037



>gb|AAD50044.1|AC007980_9 cytosolic tRNA-Ala synthetase [Arabidopsis thaliana]
 gb|AAO00886.1| Unknown protein [Arabidopsis thaliana]
 gb|AAP68246.1| At1g50200 [Arabidopsis thaliana]
Length=955

 Score =   138 bits (347),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 100/191 (52%), Positives = 142/191 (74%), Gaps = 0/191 (0%)
 Frame = -3

Query  762  EKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAE  583
            E+++++A+  E S LE+KV+ L + V+ A IPAAKK +++ +++ LQ  V +A+K+IA +
Sbjct  765  EREVEDASRAEGSALEKKVSALKSRVDAAIIPAAKKADIRTKIASLQNEVRKAQKKIAEQ  824

Query  582  NSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEA  403
            N   +VK A+E AE+A S GK +CI++L +GLD AAVR+AV KVME+KG+++ +FSTDE+
Sbjct  825  NLKKSVKLATEAAESAASDGKTFCIIQLDVGLDAAAVREAVSKVMEKKGMSIMVFSTDES  884

Query  402  ANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMD  223
             NK +VCAGVPEK D  K L V EWL  AL PL G+ G GKGGLA GQ +D   V  A+D
Sbjct  885  TNKAVVCAGVPEKSDQFKPLDVTEWLTTALGPLKGRCGKGKGGLASGQGTDASQVQAALD  944

Query  222  LAASFASIKLS  190
            +A+SFAS+KL+
Sbjct  945  MASSFASMKLN  955



>ref|NP_175439.2| Alanyl-tRNA synthetase [Arabidopsis thaliana]
 sp|P36428.3|SYA_ARATH RecName: Full=Alanine--tRNA ligase; AltName: Full=Alanyl-tRNA 
synthetase; Short=AlaRS; Flags: Precursor [Arabidopsis thaliana]
 gb|AEE32524.1| Alanyl-tRNA synthetase [Arabidopsis thaliana]
Length=1003

 Score =   138 bits (348),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 100/191 (52%), Positives = 142/191 (74%), Gaps = 0/191 (0%)
 Frame = -3

Query  762   EKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAE  583
             E+++++A+  E S LE+KV+ L + V+ A IPAAKK +++ +++ LQ  V +A+K+IA +
Sbjct  813   EREVEDASRAEGSALEKKVSALKSRVDAAIIPAAKKADIRTKIASLQNEVRKAQKKIAEQ  872

Query  582   NSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEA  403
             N   +VK A+E AE+A S GK +CI++L +GLD AAVR+AV KVME+KG+++ +FSTDE+
Sbjct  873   NLKKSVKLATEAAESAASDGKTFCIIQLDVGLDAAAVREAVSKVMEKKGMSIMVFSTDES  932

Query  402   ANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMD  223
              NK +VCAGVPEK D  K L V EWL  AL PL G+ G GKGGLA GQ +D   V  A+D
Sbjct  933   TNKAVVCAGVPEKSDQFKPLDVTEWLTTALGPLKGRCGKGKGGLASGQGTDASQVQAALD  992

Query  222   LAASFASIKLS  190
             +A+SFAS+KL+
Sbjct  993   MASSFASMKLN  1003



>emb|CDY45055.1| BnaA08g02200D [Brassica napus]
Length=993

 Score =   137 bits (346),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 97/191 (51%), Positives = 135/191 (71%), Gaps = 5/191 (3%)
 Frame = -3

Query  762  EKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAE  583
            EK++++A+  E + LE+KV  L + V+ A IPAAKK +++ +++ LQ  V +A+K+IA +
Sbjct  808  EKEVEDASKAEGNALEKKVAALKSRVDSAIIPAAKKADIRAKIALLQNEVRKAQKKIAEQ  867

Query  582  NSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEA  403
            N   +VK A+E AE+A S GK +CI++L +GLD AAVR+AV      KG+++ +FSTDE 
Sbjct  868  NLKKSVKVATEAAESAASDGKTFCIIQLDVGLDAAAVREAV-----SKGMSIMVFSTDET  922

Query  402  ANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMD  223
             NK +VCAGVP+K D  KQL V EWL  AL PL G+ G GK GLA GQ +D   V  A+D
Sbjct  923  TNKAVVCAGVPDKSDKFKQLDVTEWLTTALGPLKGRCGKGKSGLASGQGTDASQVKAALD  982

Query  222  LAASFASIKLS  190
            LAASFAS+KL+
Sbjct  983  LAASFASMKLN  993



>emb|CAA80381.1| cytosolic tRNA-Ala synthetase [Arabidopsis thaliana]
Length=955

 Score =   136 bits (342),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 99/191 (52%), Positives = 142/191 (74%), Gaps = 0/191 (0%)
 Frame = -3

Query  762  EKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAE  583
            E+++++A+  E S LE+KV+ L + V+ A IPAAKK +++ +++ LQ  V +A+K+IA +
Sbjct  765  EREVEDASRAEGSALEKKVSALKSRVDAAIIPAAKKADIRTKIASLQNEVRKAQKKIAEQ  824

Query  582  NSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEA  403
            N   +VK A+E AE+A S GK +CI++L +GLD AAV++AV KVME+KG+++ +FSTDE+
Sbjct  825  NLKKSVKLATEAAESAASDGKTFCIIQLDVGLDAAAVQEAVSKVMEKKGMSIMVFSTDES  884

Query  402  ANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMD  223
             NK +VCAGVPEK D  K L V EWL  AL PL G+ G GKGGLA GQ +D   V  A+D
Sbjct  885  TNKAVVCAGVPEKSDQFKPLDVTEWLTTALGPLKGRCGKGKGGLASGQGTDASQVQAALD  944

Query  222  LAASFASIKLS  190
            +A+SFAS+KL+
Sbjct  945  MASSFASMKLN  955



>ref|XP_004297751.1| PREDICTED: alanine--tRNA ligase [Fragaria vesca subsp. vesca]
Length=1002

 Score =   136 bits (343),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 97/191 (51%), Positives = 137/191 (72%), Gaps = 3/191 (2%)
 Frame = -3

Query  762   EKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAE  583
             E+++ EA+  E+SLLE+K+ +  + ++ AQIPAAKK +++ ++ +LQ +V +A+K+IA +
Sbjct  815   EQEVTEASKAEESLLEKKIASFKSRIDAAQIPAAKKADIRDKIVQLQNKVRKAQKKIAEQ  874

Query  582   NSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEA  403
             N   AVK A EMAE A S GKA+C+  + +GLD AAVR+AV KV+E KG+   +FSTDE 
Sbjct  875   NLQKAVKVAREMAELAASDGKAFCVSHVDVGLDIAAVREAVCKVIE-KGMPAIVFSTDET  933

Query  402   ANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMD  223
              NK + CAGVP  GD  KQL V +WL AAL PL G+ G GKGGLA GQ +D   + E++D
Sbjct  934   TNKAVACAGVP--GDKGKQLEVSQWLIAALGPLKGRCGKGKGGLATGQGTDASRLKESID  991

Query  222   LAASFASIKLS  190
             +A +FA +KLS
Sbjct  992   VATTFAQMKLS  1002



>emb|CAA80380.1| mitochondrial tRNA-Ala synthetase [Arabidopsis thaliana]
Length=1003

 Score =   136 bits (342),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 99/191 (52%), Positives = 142/191 (74%), Gaps = 0/191 (0%)
 Frame = -3

Query  762   EKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAE  583
             E+++++A+  E S LE+KV+ L + V+ A IPAAKK +++ +++ LQ  V +A+K+IA +
Sbjct  813   EREVEDASRAEGSALEKKVSALKSRVDAAIIPAAKKADIRTKIASLQNEVRKAQKKIAEQ  872

Query  582   NSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEA  403
             N   +VK A+E AE+A S GK +CI++L +GLD AAV++AV KVME+KG+++ +FSTDE+
Sbjct  873   NLKKSVKLATEAAESAASDGKTFCIIQLDVGLDAAAVQEAVSKVMEKKGMSIMVFSTDES  932

Query  402   ANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMD  223
              NK +VCAGVPEK D  K L V EWL  AL PL G+ G GKGGLA GQ +D   V  A+D
Sbjct  933   TNKAVVCAGVPEKSDQFKPLDVTEWLTTALGPLKGRCGKGKGGLASGQGTDASQVQAALD  992

Query  222   LAASFASIKLS  190
             +A+SFAS+KL+
Sbjct  993   MASSFASMKLN  1003



>pir||S32671 alanine-tRNA ligase (EC 6.1.1.7) - Arabidopsis thaliana  (fragment)
Length=989

 Score =   136 bits (342),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 99/191 (52%), Positives = 142/191 (74%), Gaps = 0/191 (0%)
 Frame = -3

Query  762  EKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAE  583
            E+++++A+  E S LE+KV+ L + V+ A IPAAKK +++ +++ LQ  V +A+K+IA +
Sbjct  799  EREVEDASRAEGSALEKKVSALKSRVDAAIIPAAKKADIRTKIASLQNEVRKAQKKIAEQ  858

Query  582  NSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEA  403
            N   +VK A+E AE+A S GK +CI++L +GLD AAV++AV KVME+KG+++ +FSTDE+
Sbjct  859  NLKKSVKLATEAAESAASDGKTFCIIQLDVGLDAAAVQEAVSKVMEKKGMSIMVFSTDES  918

Query  402  ANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMD  223
             NK +VCAGVPEK D  K L V EWL  AL PL G+ G GKGGLA GQ +D   V  A+D
Sbjct  919  TNKAVVCAGVPEKSDQFKPLDVTEWLTTALGPLKGRCGKGKGGLASGQGTDASQVQAALD  978

Query  222  LAASFASIKLS  190
            +A+SFAS+KL+
Sbjct  979  MASSFASMKLN  989



>ref|XP_010523577.1| PREDICTED: alanine--tRNA ligase-like isoform X1 [Tarenaya hassleriana]
 ref|XP_010523578.1| PREDICTED: alanine--tRNA ligase-like isoform X1 [Tarenaya hassleriana]
 ref|XP_010523579.1| PREDICTED: alanine--tRNA ligase-like isoform X2 [Tarenaya hassleriana]
Length=1003

 Score =   135 bits (341),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 101/191 (53%), Positives = 137/191 (72%), Gaps = 3/191 (2%)
 Frame = -3

Query  762   EKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAE  583
             EK++++A+    S LE+KV  L + V+ A IPA KK +++ ++  LQ+ V +A+K+IA E
Sbjct  816   EKEVEDASKELGSALEKKVAALKSRVDAAVIPAPKKADIRAKIVLLQSEVRKAQKKIAEE  875

Query  582   NSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEA  403
             N   AVK A+E AEAA S GK +C+  + +GLD AAVR+AV KVMEQKG+++ +FSTDEA
Sbjct  876   NIRKAVKVATETAEAAASDGKPFCVSNVDVGLDAAAVREAVSKVMEQKGMSIMVFSTDEA  935

Query  402   ANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMD  223
               K +VCAGVP K    KQL V EWL+ AL PL G+ G GKGGLA GQ +D   V+ A+D
Sbjct  936   TKKAVVCAGVPGK---YKQLDVTEWLSNALGPLNGRCGKGKGGLATGQGTDASQVNAALD  992

Query  222   LAASFASIKLS  190
             LAA+FAS+KL+
Sbjct  993   LAATFASMKLN  1003



>ref|XP_003607221.1| Alanyl-tRNA synthetase [Medicago truncatula]
Length=389

 Score =   132 bits (331),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 94/174 (54%), Positives = 124/174 (71%), Gaps = 1/174 (1%)
 Frame = -3

Query  711  KVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAENSLNavkaasemaeaav  532
            KV +L ++VE   IPAAKK E K E+   Q ++ +A+K +A E+   AVK  +E A+ AV
Sbjct  217  KVLSLKSNVETLSIPAAKKAENKIEIVLPQDQMRKAQKHVAEEDKRKAVKITTEKADLAV  276

Query  531  SGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEAANKVLVCAGVPEKGDVC  352
            S GK +CI  + +GLD AAVR+AV KV++QKG++V +FSTDE+ NK +VCAGVPEKGD  
Sbjct  277  SDGKYFCISHVDVGLDVAAVREAVKKVIDQKGLSVMVFSTDESTNKAVVCAGVPEKGDKG  336

Query  351  KQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMDLAASFASIKLS  190
            K L   EWL+ AL PL G+ G GKGGLA GQ +D  H++EAM LA  FAS+KL+
Sbjct  337  K-LDASEWLSNALGPLKGRCGKGKGGLATGQGTDASHLNEAMGLAVKFASVKLT  389



>ref|XP_010683781.1| PREDICTED: alanine--tRNA ligase [Beta vulgaris subsp. vulgaris]
Length=1007

 Score =   135 bits (340),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 99/190 (52%), Positives = 137/190 (72%), Gaps = 0/190 (0%)
 Frame = -3

Query  759   KKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAEN  580
             ++++ A  +E S  E+ V +L + VE A IP AKKD++++ +  LQ  V +A+K++A EN
Sbjct  818   QEVEHALKLEVSQQEKIVASLRSRVEAAPIPVAKKDDIQKIMKVLQDNVRKAQKKVAEEN  877

Query  579   SLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEAA  400
                AVK A+E AEAA+S GK +CI R+ +GLD AAVR+AV KV+++KGI+V +FS DE A
Sbjct  878   LQKAVKTATEKAEAAISEGKTFCISRVDVGLDAAAVREAVQKVIQKKGISVMVFSVDETA  937

Query  399   NKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMDL  220
             NK +V AGVP+KG+  K L V EWL  AL PL G+ G GKGGLAQGQ +D  +V+EA+ L
Sbjct  938   NKAIVYAGVPDKGNTWKGLEVSEWLTVALGPLKGRCGKGKGGLAQGQGTDASNVEEAIKL  997

Query  219   AASFASIKLS  190
             A  FAS+KL+
Sbjct  998   AVDFASMKLN  1007



>gb|AES89418.2| alanyl-tRNA synthetase [Medicago truncatula]
Length=453

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 94/174 (54%), Positives = 124/174 (71%), Gaps = 1/174 (1%)
 Frame = -3

Query  711  KVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAENSLNavkaasemaeaav  532
            KV +L ++VE   IPAAKK E K E+   Q ++ +A+K +A E+   AVK  +E A+ AV
Sbjct  281  KVLSLKSNVETLSIPAAKKAENKIEIVLPQDQMRKAQKHVAEEDKRKAVKITTEKADLAV  340

Query  531  SGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEAANKVLVCAGVPEKGDVC  352
            S GK +CI  + +GLD AAVR+AV KV++QKG++V +FSTDE+ NK +VCAGVPEKGD  
Sbjct  341  SDGKYFCISHVDVGLDVAAVREAVKKVIDQKGLSVMVFSTDESTNKAVVCAGVPEKGDKG  400

Query  351  KQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMDLAASFASIKLS  190
            K L   EWL+ AL PL G+ G GKGGLA GQ +D  H++EAM LA  FAS+KL+
Sbjct  401  K-LDASEWLSNALGPLKGRCGKGKGGLATGQGTDASHLNEAMGLAVKFASVKLT  453



>ref|XP_003607220.1| Alanyl-tRNA synthetase [Medicago truncatula]
Length=635

 Score =   130 bits (328),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 94/174 (54%), Positives = 124/174 (71%), Gaps = 1/174 (1%)
 Frame = -3

Query  711  KVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAENSLNavkaasemaeaav  532
            KV +L ++VE   IPAAKK E K E+   Q ++ +A+K +A E+   AVK  +E A+ AV
Sbjct  463  KVLSLKSNVETLSIPAAKKAENKIEIVLPQDQMRKAQKHVAEEDKRKAVKITTEKADLAV  522

Query  531  SGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEAANKVLVCAGVPEKGDVC  352
            S GK +CI  + +GLD AAVR+AV KV++QKG++V +FSTDE+ NK +VCAGVPEKGD  
Sbjct  523  SDGKYFCISHVDVGLDVAAVREAVKKVIDQKGLSVMVFSTDESTNKAVVCAGVPEKGDKG  582

Query  351  KQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMDLAASFASIKLS  190
            K L   EWL+ AL PL G+ G GKGGLA GQ +D  H++EAM LA  FAS+KL+
Sbjct  583  K-LDASEWLSNALGPLKGRCGKGKGGLATGQGTDASHLNEAMGLAVKFASVKLT  635



>gb|AES89417.2| alanyl-tRNA synthetase [Medicago truncatula]
Length=635

 Score =   130 bits (327),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 94/174 (54%), Positives = 124/174 (71%), Gaps = 1/174 (1%)
 Frame = -3

Query  711  KVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAENSLNavkaasemaeaav  532
            KV +L ++VE   IPAAKK E K E+   Q ++ +A+K +A E+   AVK  +E A+ AV
Sbjct  463  KVLSLKSNVETLSIPAAKKAENKIEIVLPQDQMRKAQKHVAEEDKRKAVKITTEKADLAV  522

Query  531  SGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEAANKVLVCAGVPEKGDVC  352
            S GK +CI  + +GLD AAVR+AV KV++QKG++V +FSTDE+ NK +VCAGVPEKGD  
Sbjct  523  SDGKYFCISHVDVGLDVAAVREAVKKVIDQKGLSVMVFSTDESTNKAVVCAGVPEKGDKG  582

Query  351  KQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMDLAASFASIKLS  190
            K L   EWL+ AL PL G+ G GKGGLA GQ +D  H++EAM LA  FAS+KL+
Sbjct  583  K-LDASEWLSNALGPLKGRCGKGKGGLATGQGTDASHLNEAMGLAVKFASVKLT  635



>ref|NP_001185186.1| Alanyl-tRNA synthetase [Arabidopsis thaliana]
 gb|AEE32525.1| Alanyl-tRNA synthetase [Arabidopsis thaliana]
Length=963

 Score =   131 bits (329),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 100/199 (50%), Positives = 142/199 (71%), Gaps = 8/199 (4%)
 Frame = -3

Query  762  EKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQ--------TRVIQ  607
            E+++++A+  E S LE+KV+ L + V+ A IPAAKK +++ +++ LQ          V +
Sbjct  765  EREVEDASRAEGSALEKKVSALKSRVDAAIIPAAKKADIRTKIASLQVISSFSLTNEVRK  824

Query  606  AKKRIAAENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAV  427
            A+K+IA +N   +VK A+E AE+A S GK +CI++L +GLD AAVR+AV KVME+KG+++
Sbjct  825  AQKKIAEQNLKKSVKLATEAAESAASDGKTFCIIQLDVGLDAAAVREAVSKVMEKKGMSI  884

Query  426  XIFSTDEAANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDL  247
             +FSTDE+ NK +VCAGVPEK D  K L V EWL  AL PL G+ G GKGGLA GQ +D 
Sbjct  885  MVFSTDESTNKAVVCAGVPEKSDQFKPLDVTEWLTTALGPLKGRCGKGKGGLASGQGTDA  944

Query  246  KHVDEAMDLAASFASIKLS  190
              V  A+D+A+SFAS+KL+
Sbjct  945  SQVQAALDMASSFASMKLN  963



>ref|XP_003619277.1| Alanyl-tRNA synthetase, partial [Medicago truncatula]
Length=452

 Score =   126 bits (317),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 76/146 (52%), Positives = 104/146 (71%), Gaps = 6/146 (4%)
 Frame = -3

Query  762  EKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAE  583
            EK++ E A +E SLLEEKV++L ++VE   IPAAKK E+K +++ LQ + +     +  E
Sbjct  313  EKQVDEVAKLEGSLLEEKVSSLKSNVETLSIPAAKKAEIKTKIALLQRKSV-----LLEE  367

Query  582  NSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEA  403
            N   AV   +E A+ AVS GK++CI  + +GLD AAVR+AV KV++QKG++V +FSTDE+
Sbjct  368  NKRKAVTITAEKADLAVSDGKSFCISHVNVGLDVAAVREAVTKVIDQKGLSVMVFSTDES  427

Query  402  ANKVLVCAGVPEKGDVCKQLSVKEWL  325
             NK +VCAGVPEKGD  K L V EWL
Sbjct  428  TNKAVVCAGVPEKGDKGK-LDVSEWL  452



>ref|XP_010904628.1| PREDICTED: LOW QUALITY PROTEIN: alanine--tRNA ligase-like [Elaeis 
guineensis]
Length=995

 Score =   129 bits (323),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 102/189 (54%), Positives = 140/189 (74%), Gaps = 3/189 (2%)
 Frame = -3

Query  756  KIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAENS  577
            +I +A+  E  LLE+KV +L + ++ A IPAA K +L+ ++S+L+ +V +AKK+I  EN 
Sbjct  809  EISDASKCEGGLLEKKVASLKSKIDAAAIPAAMKADLRAKISQLEDQVRKAKKKIGEENI  868

Query  576  LNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEAAN  397
              A++AA+++AEAA S GKA+CI R+ +GLDT AVR+AV+KVM+QKG+A  +FSTDE  N
Sbjct  869  QKAIQAATKIAEAAASEGKAFCISRVDVGLDTTAVREAVLKVMDQKGLATMVFSTDETLN  928

Query  396  KVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMDLA  217
            K +V AGVP+  D    L V EWL AA+ PL GKGGGGK G+AQGQ SD  +VDEAMD+A
Sbjct  929  KAVVYAGVPKSKD---GLGVLEWLTAAMGPLKGKGGGGKNGIAQGQGSDASYVDEAMDVA  985

Query  216  ASFASIKLS  190
            +  AS+KL 
Sbjct  986  SKLASMKLG  994



>ref|XP_010927937.1| PREDICTED: alanine--tRNA ligase-like [Elaeis guineensis]
Length=995

 Score =   126 bits (316),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 103/189 (54%), Positives = 141/189 (75%), Gaps = 3/189 (2%)
 Frame = -3

Query  756  KIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAENS  577
            +I  A+  E SLLE+KV +L + ++ A IPAA K +L+ ++S+L+ +V +AKK+I  EN 
Sbjct  809  EISSASKFEGSLLEKKVASLKSKIDAAAIPAAMKADLRAKISQLEDQVRKAKKKIGEENI  868

Query  576  LNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEAAN  397
              A++AA+E+AEAA S GKA+CI ++ +GLDT AVR+AV+KVM+QKG+AV +FSTD+  N
Sbjct  869  QKAIEAATEIAEAAASEGKAFCISQVDVGLDTTAVREAVLKVMDQKGLAVMVFSTDKTLN  928

Query  396  KVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMDLA  217
            K +V AGVP+  D    L V EWL AA+ PL GKGGGGK G+AQGQ SD   V+EAMD+A
Sbjct  929  KAVVYAGVPKSRD---GLVVLEWLTAAMGPLKGKGGGGKNGIAQGQGSDASRVEEAMDVA  985

Query  216  ASFASIKLS  190
            + FAS+KL 
Sbjct  986  SKFASMKLG  994



>ref|XP_003619276.1| Alanyl-tRNA synthetase, partial [Medicago truncatula]
Length=900

 Score =   125 bits (314),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 76/146 (52%), Positives = 104/146 (71%), Gaps = 6/146 (4%)
 Frame = -3

Query  762  EKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAE  583
            EK++ E A +E SLLEEKV++L ++VE   IPAAKK E+K +++ LQ + +     +  E
Sbjct  761  EKQVDEVAKLEGSLLEEKVSSLKSNVETLSIPAAKKAEIKTKIALLQRKSV-----LLEE  815

Query  582  NSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEA  403
            N   AV   +E A+ AVS GK++CI  + +GLD AAVR+AV KV++QKG++V +FSTDE+
Sbjct  816  NKRKAVTITAEKADLAVSDGKSFCISHVNVGLDVAAVREAVTKVIDQKGLSVMVFSTDES  875

Query  402  ANKVLVCAGVPEKGDVCKQLSVKEWL  325
             NK +VCAGVPEKGD  K L V EWL
Sbjct  876  TNKAVVCAGVPEKGDKGK-LDVSEWL  900



>ref|XP_009386816.1| PREDICTED: alanine--tRNA ligase {ECO:0000255|HAMAP-Rule:MF_03133} 
[Musa acuminata subsp. malaccensis]
Length=990

 Score =   125 bits (315),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 106/188 (56%), Positives = 142/188 (76%), Gaps = 1/188 (1%)
 Frame = -3

Query  756  KIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAENS  577
            +I E++  E SLLE+KV TL + ++ A IPAA K +L+ ++S+L+ RV +AKK+IA EN 
Sbjct  803  EITESSKSEGSLLEKKVATLKSKIDAAAIPAAIKADLRAKISQLEDRVRKAKKKIAEENI  862

Query  576  LNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEAAN  397
              AVKAA+E+A+AA S  KA+CI ++ +GLDTAAVR+AV+KV+E +G+AV +FSTDE  N
Sbjct  863  QKAVKAATEVAKAAASERKAFCIAQVDVGLDTAAVREAVLKVLELQGLAVMVFSTDETLN  922

Query  396  KVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMDLA  217
            K +V AGVP  G     L+V EWLN  +KPL GKGGGGK G+AQGQ SD   ++EAMD+A
Sbjct  923  KAVVYAGVPNSGSKTG-LAVLEWLNEVMKPLKGKGGGGKNGIAQGQGSDASRLEEAMDVA  981

Query  216  ASFASIKL  193
            A FAS+KL
Sbjct  982  AKFASLKL  989



>ref|XP_008810673.1| PREDICTED: alanine--tRNA ligase-like isoform X2 [Phoenix dactylifera]
Length=983

 Score =   125 bits (314),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 104/189 (55%), Positives = 140/189 (74%), Gaps = 3/189 (2%)
 Frame = -3

Query  756  KIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAENS  577
            +I +A+  E SLLE+KV +L + ++ A IPAA K +L+ + S+L+ +V +AKK+I  EN 
Sbjct  797  EISDASKYEGSLLEKKVASLKSKIDAAAIPAAIKADLRAKTSQLEDQVRKAKKKIGEENI  856

Query  576  LNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEAAN  397
              A+KAA+++AEAA S GKA+CI R+ +GLDT AVR+AV+KVM+QK +A+ +FSTDE  N
Sbjct  857  QKAIKAATKIAEAAASEGKAFCISRVDVGLDTTAVREAVLKVMDQKALAIMVFSTDETLN  916

Query  396  KVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMDLA  217
            K +V AGVP+  D    L V EWL AA+ PL GKGGGGK G+AQGQ SD   VDEAMD+A
Sbjct  917  KAVVYAGVPKSKD---GLVVLEWLTAAMGPLKGKGGGGKNGIAQGQGSDASRVDEAMDVA  973

Query  216  ASFASIKLS  190
            + FAS+KL 
Sbjct  974  SKFASMKLG  982



>ref|XP_008810668.1| PREDICTED: alanine--tRNA ligase-like isoform X1 [Phoenix dactylifera]
Length=993

 Score =   125 bits (313),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 104/189 (55%), Positives = 140/189 (74%), Gaps = 3/189 (2%)
 Frame = -3

Query  756  KIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAENS  577
            +I +A+  E SLLE+KV +L + ++ A IPAA K +L+ + S+L+ +V +AKK+I  EN 
Sbjct  807  EISDASKYEGSLLEKKVASLKSKIDAAAIPAAIKADLRAKTSQLEDQVRKAKKKIGEENI  866

Query  576  LNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEAAN  397
              A+KAA+++AEAA S GKA+CI R+ +GLDT AVR+AV+KVM+QK +A+ +FSTDE  N
Sbjct  867  QKAIKAATKIAEAAASEGKAFCISRVDVGLDTTAVREAVLKVMDQKALAIMVFSTDETLN  926

Query  396  KVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMDLA  217
            K +V AGVP+  D    L V EWL AA+ PL GKGGGGK G+AQGQ SD   VDEAMD+A
Sbjct  927  KAVVYAGVPKSKD---GLVVLEWLTAAMGPLKGKGGGGKNGIAQGQGSDASRVDEAMDVA  983

Query  216  ASFASIKLS  190
            + FAS+KL 
Sbjct  984  SKFASMKLG  992



>emb|CDY29328.1| BnaA05g15950D [Brassica napus]
Length=928

 Score =   124 bits (311),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 92/190 (48%), Positives = 128/190 (67%), Gaps = 11/190 (6%)
 Frame = -3

Query  759  KKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAEN  580
            K++ EA+    + LE+KV  L   V+   IPAAK+ ++K ++++LQ  V +A+K+IA EN
Sbjct  750  KEVDEASKAVGNALEKKVNALKRRVDEVDIPAAKRADIKAKIAQLQNEVRKAQKKIAKEN  809

Query  579  SLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEAA  400
               +V+ A+E AE+A S GK +CI++L +GLD AAVR+AV KVM++KG++V +FSTDE+ 
Sbjct  810  LKKSVEIATEAAESAASDGKNFCIVQLDVGLDAAAVREAVSKVMQKKGMSVMVFSTDEST  869

Query  399  NKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMDL  220
            NK            V KQL V EWL  AL P+ GK G GK GLA GQ +D   V  A+DL
Sbjct  870  NKA-----------VFKQLDVTEWLTTALSPIKGKCGKGKSGLASGQGTDASQVSSALDL  918

Query  219  AASFASIKLS  190
            AASFAS+KL+
Sbjct  919  AASFASMKLN  928



>gb|KDO52981.1| hypothetical protein CISIN_1g001826mg [Citrus sinensis]
Length=972

 Score =   123 bits (309),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 90/148 (61%), Positives = 109/148 (74%), Gaps = 2/148 (1%)
 Frame = -3

Query  636  LSKLQTRVIQAKKRIAAENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVV  457
            L K Q R  +A+K++A EN   AVK A+E AEAA S GK +CI R+ +GLD AAVR+AV+
Sbjct  826  LEKNQVR--KAQKKVAEENLQKAVKVATETAEAAASNGKPFCISRVEVGLDAAAVREAVL  883

Query  456  KVMEQKGIAVXIFSTDEAANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkg  277
            KV+EQKG+ V +FSTDE  NK +VCAGVPEK D  KQL V EWL AAL+PL G+ G GKG
Sbjct  884  KVIEQKGMPVMVFSTDETTNKAVVCAGVPEKSDQSKQLEVSEWLTAALQPLKGRCGKGKG  943

Query  276  glaqgqASDLKHVDEAMDLAASFASIKL  193
            GLA GQ +D   V  AMDLAA FA++KL
Sbjct  944  GLASGQGTDAAQVTPAMDLAAEFAAMKL  971



>gb|KJB50041.1| hypothetical protein B456_008G149700 [Gossypium raimondii]
Length=997

 Score =   122 bits (305),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 107/151 (71%), Gaps = 0/151 (0%)
 Frame = -3

Query  759  KKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAEN  580
            +++ +A+ +E +LLE+KV +L  SV+ A IPAAKK +++ ++++LQ ++ +A+K+IA +N
Sbjct  821  QEVDDASKMEVNLLEKKVASLKTSVDSASIPAAKKADIRAKIAQLQNQLKKAQKKIAEQN  880

Query  579  SLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEAA  400
               AV  A E+AE A   GK +CI R+ +GLD AA+R+AV KV++QK + V +FS DE  
Sbjct  881  MQKAVTIAIELAELAAKEGKTFCISRIDVGLDAAALREAVSKVIQQKEMPVMVFSIDETT  940

Query  399  NKVLVCAGVPEKGDVCKQLSVKEWLNAALKP  307
            NK +V AGVPEK +  K+L V EWL  AL P
Sbjct  941  NKAVVYAGVPEKSESIKRLEVSEWLTKALGP  971



>gb|KJB50037.1| hypothetical protein B456_008G149700 [Gossypium raimondii]
Length=1070

 Score =   122 bits (305),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 107/151 (71%), Gaps = 0/151 (0%)
 Frame = -3

Query  759  KKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAEN  580
            +++ +A+ +E +LLE+KV +L  SV+ A IPAAKK +++ ++++LQ ++ +A+K+IA +N
Sbjct  821  QEVDDASKMEVNLLEKKVASLKTSVDSASIPAAKKADIRAKIAQLQNQLKKAQKKIAEQN  880

Query  579  SLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEAA  400
               AV  A E+AE A   GK +CI R+ +GLD AA+R+AV KV++QK + V +FS DE  
Sbjct  881  MQKAVTIAIELAELAAKEGKTFCISRIDVGLDAAALREAVSKVIQQKEMPVMVFSIDETT  940

Query  399  NKVLVCAGVPEKGDVCKQLSVKEWLNAALKP  307
            NK +V AGVPEK +  K+L V EWL  AL P
Sbjct  941  NKAVVYAGVPEKSESIKRLEVSEWLTKALGP  971


 Score = 68.6 bits (166),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = -3

Query  435   IAVXIFSTDEAANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqA  256
             + V +FS DE  NK +V AGVPEK +  K+L V EWL  AL PL GK G GKGGLA GQ 
Sbjct  989   MPVMVFSIDETTNKAVVYAGVPEKSESIKRLEVSEWLTKALGPLKGKCGRGKGGLATGQG  1048

Query  255   SDLKHVDEAMDLAASFASIKL  193
             +D   V+EA+DLA SFAS+KL
Sbjct  1049  TDASRVNEAIDLATSFASMKL  1069



>gb|KJB50039.1| hypothetical protein B456_008G149700 [Gossypium raimondii]
Length=1001

 Score =   122 bits (305),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 107/151 (71%), Gaps = 0/151 (0%)
 Frame = -3

Query  759  KKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAEN  580
            +++ +A+ +E +LLE+KV +L  SV+ A IPAAKK +++ ++++LQ ++ +A+K+IA +N
Sbjct  821  QEVDDASKMEVNLLEKKVASLKTSVDSASIPAAKKADIRAKIAQLQNQLKKAQKKIAEQN  880

Query  579  SLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEAA  400
               AV  A E+AE A   GK +CI R+ +GLD AA+R+AV KV++QK + V +FS DE  
Sbjct  881  MQKAVTIAIELAELAAKEGKTFCISRIDVGLDAAALREAVSKVIQQKEMPVMVFSIDETT  940

Query  399  NKVLVCAGVPEKGDVCKQLSVKEWLNAALKP  307
            NK +V AGVPEK +  K+L V EWL  AL P
Sbjct  941  NKAVVYAGVPEKSESIKRLEVSEWLTKALGP  971



>gb|EPS72880.1| hypothetical protein M569_01869, partial [Genlisea aurea]
Length=950

 Score =   120 bits (301),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 91/190 (48%), Positives = 129/190 (68%), Gaps = 4/190 (2%)
 Frame = -3

Query  762  EKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAE  583
            E+++ EA   E S+LE+KV +LN+ V  A I ++KK +LK +LS LQ++V++ KK+IA  
Sbjct  765  EQEVNEAFDAEGSILEQKVASLNSRVASAAISSSKKADLKAKLSVLQSQVLKEKKKIAEA  824

Query  582  NSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEA  403
            N   AV AA++ AE A S GK +CI  + +G DT A+R+AV+KVM+ KG+AV +FS DE 
Sbjct  825  NMQKAVDAATKTAEIASSNGKNFCISVVEVGSDTTAIREAVIKVMDDKGMAVMVFSKDEE  884

Query  402  ANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMD  223
            ANK  VCAG+PE+     +LS  EWL   L+ L    GGGKG +AQGQ S    ++ A+D
Sbjct  885  ANKAFVCAGIPEQ---LSELSPAEWLKEVLE-LINGKGGGKGSVAQGQGSYASGIESAVD  940

Query  222  LAASFASIKL  193
            +A  FA++KL
Sbjct  941  VAEKFAALKL  950



>ref|XP_008778009.1| PREDICTED: alanine--tRNA ligase-like [Phoenix dactylifera]
 ref|XP_008778010.1| PREDICTED: alanine--tRNA ligase-like [Phoenix dactylifera]
 ref|XP_008778012.1| PREDICTED: alanine--tRNA ligase-like [Phoenix dactylifera]
 ref|XP_008778013.1| PREDICTED: alanine--tRNA ligase-like [Phoenix dactylifera]
 ref|XP_008778014.1| PREDICTED: alanine--tRNA ligase-like [Phoenix dactylifera]
Length=991

 Score =   120 bits (300),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 100/189 (53%), Positives = 134/189 (71%), Gaps = 3/189 (2%)
 Frame = -3

Query  756  KIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAENS  577
            +I  A     SLLE+KV +L   ++ A IPAA K +L+ ++S+L+ +V +AKK++  EN 
Sbjct  805  EISGAPKFGGSLLEKKVASLKNKIDAAAIPAAMKADLRVKVSQLEDQVRKAKKKMGEENI  864

Query  576  LNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEAAN  397
              A+KAA+E+AE+A S GKA+CI R+ +GLDT A+R+AV+KVM+QKG+A  +FSTDE  N
Sbjct  865  QKAIKAATEIAESAASEGKAFCISRVDVGLDTTAIREAVLKVMDQKGLATMVFSTDETLN  924

Query  396  KVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMDLA  217
            K +V AGVP+  D    L V EWL  A+ PL GKGGGGK G AQGQ SD   V EAMD+A
Sbjct  925  KAVVYAGVPKSRD---GLVVLEWLTTAMGPLKGKGGGGKNGTAQGQGSDASRVAEAMDVA  981

Query  216  ASFASIKLS  190
            + FAS+KL 
Sbjct  982  SKFASMKLG  990



>emb|CDY42520.1| BnaC06g03380D [Brassica napus]
Length=947

 Score =   118 bits (295),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 85/112 (76%), Gaps = 0/112 (0%)
 Frame = -3

Query  525  GKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEAANKVLVCAGVPEKGDVCKQ  346
            GK +CI++L +GLD AAVR+AV KVME+KG+++ +FSTDE  NK +VCAGVP+K D  KQ
Sbjct  836  GKTFCIIQLDVGLDAAAVREAVSKVMEKKGMSIMVFSTDETTNKAVVCAGVPDKSDEFKQ  895

Query  345  LSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMDLAASFASIKLS  190
            L V EWL  AL PL G+ G GK GLA GQ +D   V  A+DLAASFAS+KL+
Sbjct  896  LDVTEWLTTALGPLKGRCGKGKSGLASGQGTDASQVKAALDLAASFASMKLN  947



>ref|XP_006662230.1| PREDICTED: alanine--tRNA ligase-like, partial [Oryza brachyantha]
Length=898

 Score =   116 bits (290),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 84/190 (44%), Positives = 128/190 (67%), Gaps = 2/190 (1%)
 Frame = -3

Query  762  EKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAE  583
            +  I EA+ +E +LLE+ + ++ + ++ A IPAA+K +LK  + KL+  + +AKK++  E
Sbjct  710  DSDINEASKLEGALLEKNIASIKSKLDTAPIPAARKADLKARVLKLEDELRKAKKKMGEE  769

Query  582  NSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEA  403
            N   A+K A + A+ A+S GK +C+  + +GLDT+A+R+AV+KV +QK + + +FSTDEA
Sbjct  770  NMQKAIKFAIDAAQTALSEGKRFCVAHVDVGLDTSAIREAVIKVKDQKDLPIMLFSTDEA  829

Query  402  ANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMD  223
             NK ++ AGVP        L V +WL  ++ PL GKGGGGK G+AQGQ SD   + EAM+
Sbjct  830  TNKAVIYAGVPPS--ATNSLKVLDWLTPSIVPLKGKGGGGKNGVAQGQGSDASQIKEAME  887

Query  222  LAASFASIKL  193
            LA   AS+KL
Sbjct  888  LATQIASLKL  897



>gb|KFK23692.1| hypothetical protein AALP_AAs48168U000100, partial [Arabis alpina]
Length=796

 Score =   116 bits (290),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 84/191 (44%), Positives = 117/191 (61%), Gaps = 3/191 (2%)
 Frame = -3

Query  756  KIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAENS  577
            ++ +A   E+  LEEKV +L    + A I    K  +KR+L  LQ  V +A+K+ A  N 
Sbjct  606  ELYDALIAEEFELEEKVNSLERRCDEAVISPDIKAGIKRKLVGLQNEVRKAQKKRAQLNL  665

Query  576  LNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEAAN  397
              AV+ A+E AE+A S GK +C++++ IGLD  AVR AV++VME+KG+++ + S DE  N
Sbjct  666  KRAVELATEAAESATSEGKTFCVVKVDIGLDIVAVRAAVLQVMEKKGMSIMVLSADETTN  725

Query  396  KVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqAS---DLKHVDEAM  226
            KV VCAGVPEK D  ++L V EW N A+ P+ GKG G         +    D   +D A 
Sbjct  726  KVDVCAGVPEKSDQFRKLDVIEWFNTAMAPINGKGKGKDKDKDGRVSGQGMDASQLDAAF  785

Query  225  DLAASFASIKL  193
            DLA SFAS+KL
Sbjct  786  DLAVSFASLKL  796



>gb|AAK70636.1|AC091238_14 Putative cytosolic tRNA-Ala synthetase [Oryza sativa Japonica 
Group]
Length=694

 Score =   112 bits (281),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 82/190 (43%), Positives = 130/190 (68%), Gaps = 2/190 (1%)
 Frame = -3

Query  762  EKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAE  583
            + +I EA+ +E ++LE+ + ++ + ++ A IPAA+K +LK  +SKL+  + +AKK++  E
Sbjct  506  DSEINEASKLEGAILEKTIASIKSKLDTALIPAARKADLKGRVSKLEDELRKAKKKMGEE  565

Query  582  NSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEA  403
            N   AVK A + A+ A+S GK +C+  + +GLDT+A+R+AV+KV +QK + + +FSTDEA
Sbjct  566  NIQKAVKFAIDAAQTALSEGKRFCVAHVDVGLDTSAIREAVIKVKDQKDLPIMLFSTDEA  625

Query  402  ANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMD  223
             NK ++ AGVP        L V +WL  ++ PL GKGGGGK G+AQGQ ++   + EAM+
Sbjct  626  TNKAVIYAGVPPS--AANSLKVLDWLTPSIAPLKGKGGGGKNGIAQGQGTEASQLKEAME  683

Query  222  LAASFASIKL  193
            +A   AS+KL
Sbjct  684  VATQIASMKL  693



>ref|XP_003571715.1| PREDICTED: LOW QUALITY PROTEIN: alanine--tRNA ligase [Brachypodium 
distachyon]
Length=993

 Score =   113 bits (282),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 86/189 (46%), Positives = 132/189 (70%), Gaps = 3/189 (2%)
 Frame = -3

Query  753  IKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAENSL  574
            I EA+ +E ++LE+K+ ++  +++ A IPAA+K +L+ +++KL+ ++ +AKK++  EN  
Sbjct  807  IDEASKLEGAILEKKIASIKNTLDAASIPAARKADLRGKVTKLEDQLRKAKKKMGDENIQ  866

Query  573  NavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQ-KGIAVXIFSTDEAAN  397
             AVK A + AEAA+S GK +C+  + +GLDT AVR+AVVK M + K + + +FS+DEA+N
Sbjct  867  KAVKTAIDAAEAALSDGKPFCVAHVDVGLDTTAVREAVVKAMNRFKSLPIMLFSSDEASN  926

Query  396  KVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMDLA  217
            K ++ AGVP   D      V +WL  ++ PL G+GGGGK GLAQGQ SD   + EAM+LA
Sbjct  927  KAVIYAGVPP--DAPDGFKVLDWLTPSIAPLKGRGGGGKNGLAQGQGSDASQLKEAMELA  984

Query  216  ASFASIKLS  190
               AS+KL+
Sbjct  985  TQIASMKLN  993



>gb|EEE50661.1| hypothetical protein OsJ_30891 [Oryza sativa Japonica Group]
Length=901

 Score =   112 bits (280),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 82/190 (43%), Positives = 130/190 (68%), Gaps = 2/190 (1%)
 Frame = -3

Query  762  EKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAE  583
            + +I EA+ +E ++LE+ + ++ + ++ A IPAA+K +LK  +SKL+  + +AKK++  E
Sbjct  713  DSEINEASKLEGAILEKTIASIKSKLDTALIPAARKADLKGRVSKLEDELRKAKKKMGEE  772

Query  582  NSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEA  403
            N   AVK A + A+ A+S GK +C+  + +GLDT+A+R+AV+KV +QK + + +FSTDEA
Sbjct  773  NIQKAVKFAIDAAQTALSEGKRFCVAHVDVGLDTSAIREAVIKVKDQKDLPIMLFSTDEA  832

Query  402  ANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMD  223
             NK ++ AGVP        L V +WL  ++ PL GKGGGGK G+AQGQ ++   + EAM+
Sbjct  833  TNKAVIYAGVPPS--AANSLKVLDWLTPSIAPLKGKGGGGKNGIAQGQGTEASQLKEAME  890

Query  222  LAASFASIKL  193
            +A   AS+KL
Sbjct  891  VATQIASMKL  900



>gb|EEC66648.1| hypothetical protein OsI_32912 [Oryza sativa Indica Group]
Length=953

 Score =   112 bits (280),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 82/190 (43%), Positives = 130/190 (68%), Gaps = 2/190 (1%)
 Frame = -3

Query  762  EKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAE  583
            + +I EA+ +E ++LE+ + ++ + ++ A IPAA+K +LK  +SKL+  + +AKK++  E
Sbjct  765  DSEINEASKLEGAILEKTIASIKSKLDTALIPAARKADLKGRVSKLEDELRKAKKKMGEE  824

Query  582  NSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEA  403
            N   AVK A + A+ A+S GK +C+  + +GLDT+A+R+AV+KV +QK + + +FSTDEA
Sbjct  825  NIQKAVKFAIDAAQTALSEGKRFCVAHVDVGLDTSAIREAVIKVKDQKDLPIMLFSTDEA  884

Query  402  ANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMD  223
             NK ++ AGVP        L V +WL  ++ PL GKGGGGK G+AQGQ ++   + EAM+
Sbjct  885  TNKAVIYAGVPPS--AANSLKVLDWLTPSIAPLKGKGGGGKNGIAQGQGTEASQLKEAME  942

Query  222  LAASFASIKL  193
            +A   AS+KL
Sbjct  943  VATQIASMKL  952



>ref|NP_001064254.1| Os10g0182000 [Oryza sativa Japonica Group]
 gb|ABG65948.1| Alanyl-tRNA synthetase, mitochondrial precursor, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF26168.1| Os10g0182000 [Oryza sativa Japonica Group]
 dbj|BAG89937.1| unnamed protein product [Oryza sativa Japonica Group]
Length=999

 Score =   112 bits (280),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 82/190 (43%), Positives = 130/190 (68%), Gaps = 2/190 (1%)
 Frame = -3

Query  762  EKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAE  583
            + +I EA+ +E ++LE+ + ++ + ++ A IPAA+K +LK  +SKL+  + +AKK++  E
Sbjct  811  DSEINEASKLEGAILEKTIASIKSKLDTALIPAARKADLKGRVSKLEDELRKAKKKMGEE  870

Query  582  NSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEA  403
            N   AVK A + A+ A+S GK +C+  + +GLDT+A+R+AV+KV +QK + + +FSTDEA
Sbjct  871  NIQKAVKFAIDAAQTALSEGKRFCVAHVDVGLDTSAIREAVIKVKDQKDLPIMLFSTDEA  930

Query  402  ANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMD  223
             NK ++ AGVP        L V +WL  ++ PL GKGGGGK G+AQGQ ++   + EAM+
Sbjct  931  TNKAVIYAGVPPS--AANSLKVLDWLTPSIAPLKGKGGGGKNGIAQGQGTEASQLKEAME  988

Query  222  LAASFASIKL  193
            +A   AS+KL
Sbjct  989  VATQIASMKL  998



>ref|XP_002443089.1| hypothetical protein SORBIDRAFT_08g008230 [Sorghum bicolor]
 gb|EES16927.1| hypothetical protein SORBIDRAFT_08g008230 [Sorghum bicolor]
Length=1006

 Score =   111 bits (277),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 90/191 (47%), Positives = 136/191 (71%), Gaps = 2/191 (1%)
 Frame = -3

Query  762   EKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAE  583
             +  I EA+ +E +LLE+K+ ++ + ++ A IPAAKK +L+ ++SKL+  + +AKK++  +
Sbjct  818   DSDINEASQLEGALLEKKIASIKSGLDAAAIPAAKKADLRGKVSKLEDELRKAKKKMGEQ  877

Query  582   NSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEA  403
             N   AVK+A + AEAA+SG K +C+  + +GLDT AVR+AV+KVM++KG+ + +FSTDEA
Sbjct  878   NIQKAVKSAMDAAEAALSGNKLFCVTHVDVGLDTTAVREAVIKVMDKKGLPIMLFSTDEA  937

Query  402   ANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMD  223
             +NK ++ AGVP   +      V +WL  ++ PL G+GGGGK G+AQGQ SD   + EAM 
Sbjct  938   SNKAVIYAGVPP--NAPNGFKVLDWLTPSIAPLKGRGGGGKNGIAQGQGSDASQLKEAMA  995

Query  222   LAASFASIKLS  190
             LA S AS+KLS
Sbjct  996   LANSIASMKLS  1006



>ref|XP_008662576.1| PREDICTED: alanine--tRNA ligase [Zea mays]
 gb|AFW56406.1| hypothetical protein ZEAMMB73_266824 [Zea mays]
Length=1002

 Score =   110 bits (275),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 88/190 (46%), Positives = 135/190 (71%), Gaps = 2/190 (1%)
 Frame = -3

Query  762   EKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAE  583
             +  I +A+ +E +LLE+K+ ++ + ++ A IPAA+K +L+ ++SKL+  + +AKK++  +
Sbjct  814   DSDINKASQLEGALLEKKIASIKSGLDAAAIPAARKADLRGKVSKLEDELRKAKKKMGEQ  873

Query  582   NSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEA  403
             N   AVK+A + AEAA+SG K +C+  + +GLDT AVR+AV+KVM+QKG+ + +FSTDEA
Sbjct  874   NIQKAVKSAMDAAEAALSGNKPFCVTHVDVGLDTTAVREAVIKVMDQKGLPIMLFSTDEA  933

Query  402   ANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMD  223
             +NK ++ AGVP   +      V +WL  ++ PL G+GGGGK G+AQGQ SD   + EAM 
Sbjct  934   SNKAVIYAGVPP--NAPSGFKVLDWLTPSIAPLKGRGGGGKNGVAQGQGSDASQLKEAMA  991

Query  222   LAASFASIKL  193
             LA S AS+KL
Sbjct  992   LANSIASMKL  1001



>ref|XP_008350821.1| PREDICTED: alanine--tRNA ligase-like [Malus domestica]
Length=133

 Score =   100 bits (248),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 79/111 (71%), Gaps = 3/111 (3%)
 Frame = -3

Query  525  GKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEAANKVLVCAGVPEKGDVCKQ  346
            GKAYC+ ++ +GLD AAVR+AV+K+    GI   +FSTDE  NK LVCAGVP  GD   Q
Sbjct  25   GKAYCVSQVDVGLDAAAVREAVLKITGM-GIPAMVFSTDETTNKALVCAGVP--GDKGTQ  81

Query  345  LSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMDLAASFASIKL  193
            L V EWL AA+ PL G+ G GKGGLA GQ +D   ++EA+DLA SFA +KL
Sbjct  82   LEVSEWLTAAMGPLNGRCGKGKGGLASGQGTDASRLNEAIDLATSFAQMKL  132



>gb|EMT00983.1| Alanyl-tRNA synthetase, mitochondrial [Aegilops tauschii]
Length=712

 Score =   105 bits (263),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 93/192 (48%), Positives = 132/192 (69%), Gaps = 3/192 (2%)
 Frame = -3

Query  762  EKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAE  583
            E  I EA+ ++ + LE+K+ ++  +++ A IPAA+K +LK  +SKL+ ++ +AKK++  E
Sbjct  523  ETDINEASKLDGATLEKKIGSIKNTLDAAAIPAARKADLKGNVSKLEDQLREAKKKMGKE  582

Query  582  NSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQ-KGIAVXIFSTDE  406
            N   AVK A + AEAAVS GK +C++   +GLDT AVR+AVVK M++ KG+ + +FSTDE
Sbjct  583  NIQKAVKTAIDAAEAAVSEGKPFCVIHADVGLDTTAVREAVVKAMDRFKGLPIMVFSTDE  642

Query  405  AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAM  226
            A+NK ++ AGVP   D      V +WL  ++ PL GKGGGGK GLAQGQ SD   V EAM
Sbjct  643  ASNKAVIYAGVPP--DAPNGFKVLDWLTPSIAPLKGKGGGGKNGLAQGQGSDGSRVKEAM  700

Query  225  DLAASFASIKLS  190
            +LA   AS+KL 
Sbjct  701  ELATQIASMKLG  712



>ref|XP_006826671.1| hypothetical protein AMTR_s00137p00047050 [Amborella trichopoda]
 gb|ERM93908.1| hypothetical protein AMTR_s00137p00047050 [Amborella trichopoda]
Length=996

 Score =   106 bits (265),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 99/192 (52%), Positives = 137/192 (71%), Gaps = 2/192 (1%)
 Frame = -3

Query  762  EKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAE  583
            +++I EA+  E SLLE+KV +L + ++ A IPAA K +L+  +S+LQ +V +A+K+IA  
Sbjct  806  DEEINEASMGEGSLLEKKVASLKSRLDAAAIPAAMKADLRARISQLQDQVRKAQKQIAEG  865

Query  582  NSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVME-QKGIAVXIFSTDE  406
            N   A+KAA E+AE A S GK +C+ ++ +GLDT+AVR+AVVKV+E QKGI + I STD 
Sbjct  866  NLQKAIKAAIEIAETAASEGKPFCVAQIDVGLDTSAVREAVVKVLEKQKGIPIMIISTDA  925

Query  405  AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAM  226
             +NK +V  GVP+  +  K L   EWL  ALKPL GKGGGGKGG+AQGQ SD   V +A+
Sbjct  926  TSNKAVVYTGVPDTVEK-KGLLPLEWLRTALKPLKGKGGGGKGGIAQGQGSDASRVTDAL  984

Query  225  DLAASFASIKLS  190
            + A +FA +KLS
Sbjct  985  EAAENFAKMKLS  996



>gb|EMT18589.1| Alanyl-tRNA synthetase, mitochondrial [Aegilops tauschii]
Length=1012

 Score =   106 bits (264),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 93/192 (48%), Positives = 131/192 (68%), Gaps = 3/192 (2%)
 Frame = -3

Query  762   EKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAE  583
             +  I EA+ +E + LE+K+ ++  +++ A IPAA+K +LK  +SKL+ ++ +AKK++  E
Sbjct  823   DTDINEASKLEGATLEKKIGSIKNTLDAAAIPAARKADLKGNISKLEDQLRKAKKKMGEE  882

Query  582   NSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQ-KGIAVXIFSTDE  406
             N   AVK A + AEAA+S GK +C+    +GLDT AVR+AVVK M + KG+ + +FSTDE
Sbjct  883   NIQKAVKIAIDAAEAALSEGKTFCVTHADVGLDTTAVREAVVKAMNRFKGLPIMVFSTDE  942

Query  405   AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAM  226
             A+NK ++ AGVP   D      V +WL  ++ PL GKGGGGK GLAQGQ SD   V EAM
Sbjct  943   ASNKAVIYAGVPP--DAPNGFKVLDWLTPSIAPLKGKGGGGKNGLAQGQGSDASRVKEAM  1000

Query  225   DLAASFASIKLS  190
             +LA   AS+KLS
Sbjct  1001  ELATQIASMKLS  1012



>dbj|BAJ98134.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1004

 Score =   106 bits (264),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 93/192 (48%), Positives = 132/192 (69%), Gaps = 3/192 (2%)
 Frame = -3

Query  762   EKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAE  583
             +  I EA+ ++ + LE+K+ ++  +++ A IPAA+K +LK  +SKL+ ++ +AKK++  E
Sbjct  815   DSDINEASKLDGATLEKKIGSIKNTLDAAAIPAARKADLKGNVSKLEEQLREAKKKMGKE  874

Query  582   NSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQ-KGIAVXIFSTDE  406
             N   AVK A + AEAAVS GK +C+    +GLDT AVR+AVVK M++ KG+ + +FSTDE
Sbjct  875   NIQKAVKTAIDAAEAAVSEGKPFCVTHADVGLDTTAVREAVVKAMDRFKGLPIMVFSTDE  934

Query  405   AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAM  226
             A+NK ++ AGVP   D      V +WL  ++ PL GKGGGGK GLAQGQ SD   V EAM
Sbjct  935   ASNKAVIYAGVPP--DAPNGFKVLDWLTPSIAPLKGKGGGGKNGLAQGQGSDASRVKEAM  992

Query  225   DLAASFASIKLS  190
             +LA   AS+KLS
Sbjct  993   ELATQIASMKLS  1004



>dbj|BAJ92565.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=305

 Score =   102 bits (254),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 87/189 (46%), Positives = 128/189 (68%), Gaps = 3/189 (2%)
 Frame = -3

Query  753  IKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAENSL  574
            I EA+ ++ + LE+K+ ++  +++ A IPAA+K +L+  +SKL+ ++ +AKK++  EN  
Sbjct  119  INEASKLDGATLEKKIGSIKNTLDAAAIPAARKADLRGNISKLEDQLRKAKKKMGEENIQ  178

Query  573  NavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQ-KGIAVXIFSTDEAAN  397
             AVK   + AEA +S GK +C+  + +GLDT AVR+AVVK M + K + + +FSTDEA+N
Sbjct  179  KAVKTVIDAAEATLSEGKPFCVAHVDVGLDTTAVREAVVKAMNRFKSLPIMVFSTDEASN  238

Query  396  KVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMDLA  217
            K ++ AGVP   D      V +WL  ++ PL G+GGGGK GLAQGQ SD   V EAM+LA
Sbjct  239  KAVIYAGVPP--DAPNGFKVLDWLTPSIAPLKGRGGGGKNGLAQGQGSDASRVKEAMELA  296

Query  216  ASFASIKLS  190
               AS+KLS
Sbjct  297  TQIASMKLS  305



>ref|XP_001773539.1| predicted protein [Physcomitrella patens]
 gb|EDQ61577.1| predicted protein [Physcomitrella patens]
Length=937

 Score =   103 bits (258),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 69/152 (45%), Positives = 95/152 (63%), Gaps = 4/152 (3%)
 Frame = -3

Query  756  KIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAENS  577
            +I +A+ +E   LE++V +L  S+E   IPAAKK E +  L +LQ R+ +A+K  A  N 
Sbjct  761  QIDKASKLEGPALEKEVASLKNSLENVVIPAAKKAEFRTRLGELQERIRKAQKAAAGSNL  820

Query  576  LNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVME-QKGIAVXIFSTDEAA  400
              A+  A   A+ AV+  + +C+LR+ +GLDT AVR+AV  VME  K +AV IFS DE  
Sbjct  821  QTALNGAVSSADTAVAQNQPFCVLRIDVGLDTNAVREAVTLVMEKHKDLAVMIFSVDEQK  880

Query  399  NKVLVCAGVPEKGDVCKQ-LSVKEWLNAALKP  307
            NKVLV AGVP+     KQ L V +WL  +L P
Sbjct  881  NKVLVYAGVPDS--AAKQGLKVLDWLRGSLAP  910



>dbj|BAJ96541.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1008

 Score =   102 bits (254),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 87/192 (45%), Positives = 129/192 (67%), Gaps = 3/192 (2%)
 Frame = -3

Query  762   EKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAE  583
             +  I EA+ ++ + LE+K+ ++  +++ A IPAA+K +L+  +SKL+ ++ +AKK++  E
Sbjct  819   DTDINEASKLDGATLEKKIGSIKNTLDAAAIPAARKADLRGNISKLEDQLRKAKKKMGEE  878

Query  582   NSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQ-KGIAVXIFSTDE  406
             N   AVK   + AEA +S GK +C+  + +GLDT AVR+AVVK M + K + + +FSTDE
Sbjct  879   NIQKAVKTVIDAAEATLSEGKPFCVAHVDVGLDTTAVREAVVKAMNRFKSLPIMVFSTDE  938

Query  405   AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAM  226
             A+NK ++ AGVP   D      V +WL  ++ PL G+GGGGK GLAQGQ SD   V EAM
Sbjct  939   ASNKAVIYAGVPP--DAPNGFKVLDWLTPSIAPLKGRGGGGKNGLAQGQGSDASRVKEAM  996

Query  225   DLAASFASIKLS  190
             +LA   AS+KLS
Sbjct  997   ELATQIASMKLS  1008



>ref|XP_004983349.1| PREDICTED: alanine--tRNA ligase-like isoform X2 [Setaria italica]
Length=1005

 Score =   101 bits (252),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 83/188 (44%), Positives = 131/188 (70%), Gaps = 2/188 (1%)
 Frame = -3

Query  753   IKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAENSL  574
             I  A+ +E ++LE+K+ ++   ++ A IPAA+K +L+ ++SKL+ ++ +AKK++  +N  
Sbjct  820   ISGASQLEGAMLEKKIASIKNKLDAAAIPAARKADLRGKVSKLEDQLRKAKKKMGEQNIQ  879

Query  573   NavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEAANK  394
              AVK A + AEAA+   K +C+  + +GLDT AVR+AV+KVM+QKG+ + +FS DEA+NK
Sbjct  880   KAVKTAMDAAEAALFKKKPFCVTHVDVGLDTTAVREAVIKVMDQKGLPIMLFSKDEASNK  939

Query  393   VLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMDLAA  214
              ++ AGVP   +      V +WL  ++ PL G+GGGGK G+AQGQ SD   + EAM+LA 
Sbjct  940   AVIYAGVPP--NTPNGFKVLDWLTPSIAPLKGRGGGGKNGVAQGQGSDASQLKEAMELAN  997

Query  213   SFASIKLS  190
             + A++KLS
Sbjct  998   NIAAMKLS  1005



>ref|XP_004983350.1| PREDICTED: alanine--tRNA ligase-like isoform X3 [Setaria italica]
Length=1005

 Score =   101 bits (252),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 83/188 (44%), Positives = 131/188 (70%), Gaps = 2/188 (1%)
 Frame = -3

Query  753   IKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAENSL  574
             I  A+ +E ++LE+K+ ++   ++ A IPAA+K +L+ ++SKL+ ++ +AKK++  +N  
Sbjct  820   ISGASQLEGAMLEKKIASIKNKLDAAAIPAARKADLRGKVSKLEDQLRKAKKKMGEQNIQ  879

Query  573   NavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEAANK  394
              AVK A + AEAA+   K +C+  + +GLDT AVR+AV+KVM+QKG+ + +FS DEA+NK
Sbjct  880   KAVKTAMDAAEAALFKKKPFCVTHVDVGLDTTAVREAVIKVMDQKGLPIMLFSKDEASNK  939

Query  393   VLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMDLAA  214
              ++ AGVP   +      V +WL  ++ PL G+GGGGK G+AQGQ SD   + EAM+LA 
Sbjct  940   AVIYAGVPP--NTPNGFKVLDWLTPSIAPLKGRGGGGKNGVAQGQGSDASQLKEAMELAN  997

Query  213   SFASIKLS  190
             + A++KLS
Sbjct  998   NIAAMKLS  1005



>gb|EMT07345.1| Alanyl-tRNA synthetase, mitochondrial [Aegilops tauschii]
Length=949

 Score = 99.0 bits (245),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 92/193 (48%), Positives = 130/193 (67%), Gaps = 4/193 (2%)
 Frame = -3

Query  762  EKKIKEAASVED-SLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  586
            E  I EA+ + D + LE+K+ ++  +++ A IPAA+K +L+  +SKL+ ++ +AKK++  
Sbjct  759  ETDINEASKLLDGATLEKKIGSIKNTLDAAAIPAARKADLRGNISKLEDQLRKAKKKMGE  818

Query  585  ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQ-KGIAVXIFSTD  409
            EN   AVK A + AEAAVS GK +C+ R  +GLDT AVR+AVVK M + K + V +FS D
Sbjct  819  ENIQKAVKTAMDAAEAAVSQGKPFCVTRADVGLDTTAVREAVVKAMNRFKSLPVMVFSID  878

Query  408  EAANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEA  229
            E++NK +V AGVP   D      V +WL  ++ PL G+GGGGK GLAQGQ SD   V EA
Sbjct  879  ESSNKAVVYAGVPP--DAPNGFKVLDWLTPSIAPLKGRGGGGKNGLAQGQGSDASRVQEA  936

Query  228  MDLAASFASIKLS  190
            M++A   AS+KLS
Sbjct  937  MEIATQIASMKLS  949



>gb|EMS67609.1| Alanyl-tRNA synthetase [Triticum urartu]
Length=1858

 Score = 95.5 bits (236),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 66/153 (43%), Positives = 102/153 (67%), Gaps = 3/153 (2%)
 Frame = -3

Query  762  EKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAE  583
            +  I EA+ +E + LE+K+ ++  +++ A IPAA+K +LK  +SKL+ ++ +AKK++  E
Sbjct  823  DTDINEASKLEGATLEKKIGSIKNTLDAAAIPAARKADLKGNISKLEDQLRKAKKKMGEE  882

Query  582  NSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQ-KGIAVXIFSTDE  406
            N   AVK A + AEAA+S GK +C+    +GLDT AVR+AVVK M + KG+ + +FSTDE
Sbjct  883  NIQKAVKIAIDAAEAALSEGKTFCVTHADVGLDTTAVREAVVKAMNRFKGLPIMVFSTDE  942

Query  405  AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKP  307
            A+NK ++ AGVP   D      V +WL  ++ P
Sbjct  943  ASNKAVIYAGVPP--DAPNGFKVLDWLTPSIAP  973



>ref|XP_004983348.1| PREDICTED: alanine--tRNA ligase-like isoform X1 [Setaria italica]
Length=1022

 Score = 92.4 bits (228),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 84/205 (41%), Positives = 131/205 (64%), Gaps = 19/205 (9%)
 Frame = -3

Query  753   IKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKL-----------------  625
             I  A+ +E ++LE+K+ ++   ++ A IPAA+K +L+ ++SKL                 
Sbjct  820   ISGASQLEGAMLEKKIASIKNKLDAAAIPAARKADLRGKVSKLEVCKCFFFTSDCVCCMS  879

Query  624   QTRVIQAKKRIAAENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVME  445
             Q ++ +AKK++  +N   AVK A + AEAA+   K +C+  + +GLDT AVR+AV+KVM+
Sbjct  880   QDQLRKAKKKMGEQNIQKAVKTAMDAAEAALFKKKPFCVTHVDVGLDTTAVREAVIKVMD  939

Query  444   QKGIAVXIFSTDEAANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaq  265
             QKG+ + +FS DEA+NK ++ AGVP   +      V +WL  ++ PL G+GGGGK G+AQ
Sbjct  940   QKGLPIMLFSKDEASNKAVIYAGVPP--NTPNGFKVLDWLTPSIAPLKGRGGGGKNGVAQ  997

Query  264   gqASDLKHVDEAMDLAASFASIKLS  190
             GQ SD   + EAM+LA + A++KLS
Sbjct  998   GQGSDASQLKEAMELANNIAAMKLS  1022



>emb|CDY46263.1| BnaC05g50520D [Brassica napus]
Length=651

 Score = 85.1 bits (209),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 71/191 (37%), Positives = 96/191 (50%), Gaps = 51/191 (27%)
 Frame = -3

Query  762  EKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAE  583
            EK + + +    + LE+KV  L   V+   IPAAK+ ++K ++++LQ             
Sbjct  512  EKDVDDTSKAVGNALEKKVNALKRRVDEVDIPAAKRADIKAKIAQLQ-------------  558

Query  582  NSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEA  403
                                       L +G D AAVR AV KVM++KG++V +FSTDE+
Sbjct  559  ---------------------------LDVGFDAAAVRGAVSKVMQKKGMSVMVFSTDES  591

Query  402  ANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMD  223
             NK            V KQL V EWL  AL P+ GK G GK GLA GQ +D   V  A+D
Sbjct  592  TNKA-----------VFKQLDVTEWLTIALSPIKGKCGKGKSGLASGQGTDASQVSSALD  640

Query  222  LAASFASIKLS  190
            LAASFAS+ L+
Sbjct  641  LAASFASMNLN  651



>emb|CDY69088.1| BnaCnng61840D [Brassica napus]
Length=108

 Score = 78.2 bits (191),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = -3

Query  438  GIAVXIFSTDEAANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgq  259
            G+++ +FSTDE  NK +VCAGVP+K D  KQL V EWL  AL PL G+ G GK GLA GQ
Sbjct  26   GMSIMVFSTDETTNKAVVCAGVPDKSDEFKQLDVTEWLTTALGPLKGRCGKGKSGLASGQ  85

Query  258  ASDLKHVDEAMDLAASFASIKLS  190
             +D   V  A+DLAASFAS+KL+
Sbjct  86   GTDASQVKAALDLAASFASMKLN  108



>ref|XP_001769326.1| predicted protein [Physcomitrella patens]
 gb|EDQ65880.1| predicted protein, partial [Physcomitrella patens]
Length=222

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 59/152 (39%), Positives = 88/152 (58%), Gaps = 4/152 (3%)
 Frame = -3

Query  756  KIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAENS  577
            +I +A  ++ + L+++V+ L   +E A +PAAKK E +   S+LQ  + QA+K   A + 
Sbjct  49   QIDDANKMQGAALKKEVSALKNLLETAILPAAKKAEFRGRFSELQEGIKQAQKSAGAASL  108

Query  576  LNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVME-QKGIAVXIFSTDEAA  400
               +  A   A+ AV+  + YC+LR+  GLD  AVR+A   V+E  K +AV +FS DE  
Sbjct  109  QLKLNEAVTSADVAVALCQEYCVLRIDDGLDANAVREAASLVIEKHKYLAVMLFSVDEQR  168

Query  399  NKVLVCAGVPEKGDVCKQ-LSVKEWLNAALKP  307
            NKVL+CA VP      KQ L   +WL  +L P
Sbjct  169  NKVLICAFVPNSA--AKQGLGALDWLQGSLVP  198



>gb|KDO52985.1| hypothetical protein CISIN_1g001826mg [Citrus sinensis]
Length=936

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 81/108 (75%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  EKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAE  583
            EK++ +A+ +E SLLE+ V +L + V+ A IPA KK +++ +++ LQ +V +A+K++A E
Sbjct  812  EKEVDDASKIEGSLLEKTVASLKSKVDGAAIPAPKKADIRAKIALLQNQVRKAQKKVAEE  871

Query  582  NSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQK  439
            N   AVK A+E AEAA S GK +CI R+ +GLD AAVR+AV+KV+EQK
Sbjct  872  NLQKAVKVATETAEAAASNGKPFCISRVEVGLDAAAVREAVLKVIEQK  919



>gb|KDO52984.1| hypothetical protein CISIN_1g001826mg [Citrus sinensis]
Length=957

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 81/108 (75%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  EKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAE  583
            EK++ +A+ +E SLLE+ V +L + V+ A IPA KK +++ +++ LQ +V +A+K++A E
Sbjct  812  EKEVDDASKIEGSLLEKTVASLKSKVDGAAIPAPKKADIRAKIALLQNQVRKAQKKVAEE  871

Query  582  NSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQK  439
            N   AVK A+E AEAA S GK +CI R+ +GLD AAVR+AV+KV+EQK
Sbjct  872  NLQKAVKVATETAEAAASNGKPFCISRVEVGLDAAAVREAVLKVIEQK  919



>gb|KJB50034.1| hypothetical protein B456_008G149700 [Gossypium raimondii]
Length=927

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 79/107 (74%), Gaps = 0/107 (0%)
 Frame = -3

Query  759  KKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAEN  580
            +++ +A+ +E +LLE+KV +L  SV+ A IPAAKK +++ ++++LQ ++ +A+K+IA +N
Sbjct  821  QEVDDASKMEVNLLEKKVASLKTSVDSASIPAAKKADIRAKIAQLQNQLKKAQKKIAEQN  880

Query  579  SLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQK  439
               AV  A E+AE A   GK +CI R+ +GLD AA+R+AV KV++QK
Sbjct  881  MQKAVTIAIELAELAAKEGKTFCISRIDVGLDAAALREAVSKVIQQK  927



>gb|KJB50035.1| hypothetical protein B456_008G149700 [Gossypium raimondii]
Length=930

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 79/107 (74%), Gaps = 0/107 (0%)
 Frame = -3

Query  759  KKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAEN  580
            +++ +A+ +E +LLE+KV +L  SV+ A IPAAKK +++ ++++LQ ++ +A+K+IA +N
Sbjct  821  QEVDDASKMEVNLLEKKVASLKTSVDSASIPAAKKADIRAKIAQLQNQLKKAQKKIAEQN  880

Query  579  SLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQK  439
               AV  A E+AE A   GK +CI R+ +GLD AA+R+AV KV++QK
Sbjct  881  MQKAVTIAIELAELAAKEGKTFCISRIDVGLDAAALREAVSKVIQQK  927



>gb|KJB50038.1| hypothetical protein B456_008G149700 [Gossypium raimondii]
 gb|KJB50040.1| hypothetical protein B456_008G149700 [Gossypium raimondii]
Length=941

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 79/107 (74%), Gaps = 0/107 (0%)
 Frame = -3

Query  759  KKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAEN  580
            +++ +A+ +E +LLE+KV +L  SV+ A IPAAKK +++ ++++LQ ++ +A+K+IA +N
Sbjct  821  QEVDDASKMEVNLLEKKVASLKTSVDSASIPAAKKADIRAKIAQLQNQLKKAQKKIAEQN  880

Query  579  SLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQK  439
               AV  A E+AE A   GK +CI R+ +GLD AA+R+AV KV++QK
Sbjct  881  MQKAVTIAIELAELAAKEGKTFCISRIDVGLDAAALREAVSKVIQQK  927



>ref|XP_002462563.1| hypothetical protein SORBIDRAFT_02g028270 [Sorghum bicolor]
 gb|EER99084.1| hypothetical protein SORBIDRAFT_02g028270 [Sorghum bicolor]
Length=105

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 45/74 (61%), Gaps = 10/74 (14%)
 Frame = -3

Query  528  GGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEAANKVLVCAGVPEKGDVCK  349
            G K +C+  + +GLDT+AVR+AV+KVM+Q        ST+EA+NK  + AGVP   +   
Sbjct  23   GNKLFCVTHVNVGLDTSAVREAVIKVMDQ--------STEEASNKAAIYAGVPP--NAPS  72

Query  348  QLSVKEWLNAALKP  307
               V +WL  ++ P
Sbjct  73   GFKVLDWLTPSIAP  86



>ref|XP_005849315.1| hypothetical protein CHLNCDRAFT_143654 [Chlorella variabilis]
 gb|EFN57213.1| hypothetical protein CHLNCDRAFT_143654 [Chlorella variabilis]
Length=524

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 62/176 (35%), Positives = 98/176 (56%), Gaps = 4/176 (2%)
 Frame = -3

Query  720  LEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAENSLNavkaasemae  541
            ++ +V  L  +V  A IP  +K  L   L  L   +++ +K+ AA N   AV AA + ++
Sbjct  353  MQGEVKALTQAVSGAVIPTVRKAALAEALQGLTRLILEEQKKAAAANKERAVAAAVDASD  412

Query  540  aavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIFSTDEAANKVLVCAGVPEKG  361
            AA + G+ + + RL +GLD  AV++A    +++K  ++ +       +K L  AGVP+  
Sbjct  413  AAAAAGQKFLVTRLDVGLDAKAVQEAW-NAIQKKHPSLPVMFLTAGEDKALAYAGVPQ--  469

Query  360  DVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMDLAASFASIKL  193
            D+ KQLS  +W+   +    G  GGGK   AQG   ++  VDEA+  AASFAS+KL
Sbjct  470  DISKQLSAGDWIKE-VLGTLGGRGGGKPTNAQGTGPEVGKVDEALQAAASFASMKL  524



>emb|CCI40732.1| unnamed protein product [Albugo candida]
Length=1362

 Score = 60.1 bits (144),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 58/191 (30%), Positives = 97/191 (51%), Gaps = 5/191 (3%)
 Frame = -3

Query  762   EKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAE  583
             ++++     ++DS     VT     ++ A I    KD+L++EL  L  RV   KK+ AA 
Sbjct  838   QRQLDCIKQMQDSDFIANVTAFRPILDVALISLPLKDQLRKELDVLVDRVKALKKKEAAL  897

Query  582   NSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRD---AVVKVMEQKGIAVXIFST  412
              + +A+K A +  +        + + R+  G D    R+   A+ +V+ +    V  FST
Sbjct  898   RAADAIKNAIKQVKETREKSSEFLVARMQAGTDVKLGREILAAMSRVLPEGSFMV--FST  955

Query  411   DEAANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDE  232
             D+ ANK      V +     KQL  ++W+N A+KP+ GKGGG     A GQA  ++H++ 
Sbjct  956   DDDANKTAAFCQVSQHHADKKQLDARQWVNEAMKPMNGKGGGKSALNANGQAKTIEHIEV  1015

Query  231   AMDLAASFASI  199
             A+ +A SF  +
Sbjct  1016  AIAIAESFLPV  1026



>emb|CCA14233.1| unnamed protein product [Albugo laibachii Nc14]
Length=1022

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 56/187 (30%), Positives = 94/187 (50%), Gaps = 3/187 (2%)
 Frame = -3

Query  762   EKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAE  583
             +K++    +++DS     VT     ++ + I    KD L++EL  L  RV   KK+ AA 
Sbjct  835   QKQLDCIKAMQDSDFIANVTAFRPILDASLISLPLKDHLRKELEVLVDRVKTLKKKEAAL  894

Query  582   NSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQ--KGIAVXIFSTD  409
              + +A+  A +  + A      + + R+  G D    R+ +  +     +G +  +FSTD
Sbjct  895   RAADAITQAIKQVKEAQEKSTKFVVARMQAGTDVKLGREILAAMSNALPEG-SFMVFSTD  953

Query  408   EAANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEA  229
             + A K      V +     KQL  ++W+N A+KP+ GKGGG     A GQA  + H++EA
Sbjct  954   DDAKKTAAFCQVSQHHADTKQLDARQWVNEAMKPMNGKGGGKSALNANGQAKIMDHIEEA  1013

Query  228   MDLAASF  208
             M +A S+
Sbjct  1014  MAIAESY  1020



>ref|XP_002950616.1| hypothetical protein VOLCADRAFT_120886 [Volvox carteri f. nagariensis]
 gb|EFJ48362.1| hypothetical protein VOLCADRAFT_120886 [Volvox carteri f. nagariensis]
Length=1143

 Score = 57.0 bits (136),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 71/184 (39%), Positives = 101/184 (55%), Gaps = 4/184 (2%)
 Frame = -3

Query  741   ASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAENSLNavk  562
             A++ +  LE+       SV+ A IPA  K  L+ EL+ L  RVI+ +K  AA N   A +
Sbjct  962   ATLPEDQLEKACKGFKESVDAAVIPAVDKAALRDELAVLGRRVIEFQKAAAAANKALAAE  1021

Query  561   aasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVXIF-STDEAANKVLV  385
              A   A+AAV+ GK++ I RL +GLDT AV +A   ++ +      +F S D    K L 
Sbjct  1022  RAVAAADAAVAAGKSFVIGRLDVGLDTRAVGEACSAIIAKHSTLAALFVSVDAEKGKALA  1081

Query  384   CAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMDLAASFA  205
              A VP+   V  +L   EW++ AL    G  GGGK   AQGQ ++++ VDEA+  A +FA
Sbjct  1082  YAAVPDS--VTDRLKANEWVSTALG-PLGGKGGGKANNAQGQGANVEKVDEALGAATAFA  1138

Query  204   SIKL  193
               KL
Sbjct  1139  ESKL  1142



>gb|EMS64427.1| Alanyl-tRNA synthetase [Triticum urartu]
Length=751

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 71/104 (68%), Gaps = 0/104 (0%)
 Frame = -3

Query  753  IKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAENSL  574
            I EA+ ++ + LE+K+ ++N +++ A IPAA+K +LK  +SKL+ ++ +AKK+   EN  
Sbjct  197  INEASKLDGATLEKKIGSINNTLDAAAIPAARKADLKGNVSKLEDQLREAKKKTGKENVQ  256

Query  573  NavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQ  442
             A K   + AEAAVS  K +C+   G+GLDT A R+AVVK M++
Sbjct  257  KAAKTDIDAAEAAVSKEKLFCVTHAGVGLDTTAAREAVVKPMDR  300



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1441039810680