BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF026P06

Length=503
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006346213.1|  PREDICTED: protein translation factor SUI1 h...    155   5e-45   Solanum tuberosum [potatoes]
ref|XP_004244116.1|  PREDICTED: protein translation factor SUI1 h...    155   6e-45   Solanum lycopersicum
ref|XP_011097879.1|  PREDICTED: protein translation factor SUI1 h...    155   7e-45   Sesamum indicum [beniseed]
ref|XP_011095399.1|  PREDICTED: protein translation factor SUI1 h...    154   9e-45   Sesamum indicum [beniseed]
ref|XP_009628718.1|  PREDICTED: protein translation factor SUI1 h...    154   2e-44   Nicotiana tomentosiformis
ref|XP_002280065.1|  PREDICTED: protein translation factor SUI1 h...    151   2e-43   Vitis vinifera
ref|XP_004500068.1|  PREDICTED: protein translation factor SUI1 h...    150   4e-43   Cicer arietinum [garbanzo]
ref|XP_006602202.1|  PREDICTED: protein translation factor SUI1 h...    149   9e-43   Glycine max [soybeans]
gb|ADK79108.1|  putative eukaryotic translation initiation factor...    149   1e-42   Catharanthus roseus [chatas]
ref|XP_010060345.1|  PREDICTED: protein translation factor SUI1 h...    149   2e-42   Eucalyptus grandis [rose gum]
gb|AFY13590.1|  translation factor SUI1                                 148   2e-42   Aeschynomene evenia
ref|XP_007146479.1|  hypothetical protein PHAVU_006G043900g             148   3e-42   Phaseolus vulgaris [French bean]
ref|XP_006586085.1|  PREDICTED: protein translation factor SUI1 h...    149   4e-42   Glycine max [soybeans]
gb|AFY13584.1|  translation factor SUI1                                 147   8e-42   Aeschynomene evenia
gb|AGS78110.1|  translation factor SUI1                                 147   1e-41   Aeschynomene filosa
gb|KCW66994.1|  hypothetical protein EUGRSUZ_F00759                     151   1e-41   Eucalyptus grandis [rose gum]
gb|KCW66993.1|  hypothetical protein EUGRSUZ_F00759                     151   2e-41   Eucalyptus grandis [rose gum]
ref|XP_010545223.1|  PREDICTED: protein translation factor SUI1 h...    146   2e-41   Tarenaya hassleriana [spider flower]
ref|XP_004152930.1|  PREDICTED: protein translation factor SUI1 h...    145   3e-41   
ref|XP_004139787.1|  PREDICTED: protein translation factor SUI1 h...    145   4e-41   Cucumis sativus [cucumbers]
gb|AFK38938.1|  unknown                                                 145   4e-41   Lotus japonicus
gb|AGS78105.1|  translation factor SUI1                                 144   8e-41   Aeschynomene indica
ref|XP_003600096.1|  Translation factor SUI1-like protein               144   8e-41   Medicago truncatula
emb|CDP05760.1|  unnamed protein product                                144   1e-40   Coffea canephora [robusta coffee]
gb|ABY75807.1|  SUI1 B protein                                          143   2e-40   Opuntia streptacantha
ref|XP_008359266.1|  PREDICTED: protein translation factor SUI1 h...    143   2e-40   
ref|XP_004491401.1|  PREDICTED: protein translation factor SUI1 h...    143   2e-40   Cicer arietinum [garbanzo]
gb|EYU33643.1|  hypothetical protein MIMGU_mgv1a016664mg                143   3e-40   Erythranthe guttata [common monkey flower]
emb|CDY43020.1|  BnaA03g11670D                                          143   3e-40   Brassica napus [oilseed rape]
ref|XP_009132417.1|  PREDICTED: protein translation factor SUI1 h...    143   3e-40   Brassica rapa
ref|XP_009360995.1|  PREDICTED: protein translation factor SUI1 h...    143   3e-40   Pyrus x bretschneideri [bai li]
gb|EPS65465.1|  hypothetical protein M569_09317                         143   3e-40   Genlisea aurea
emb|CDY52575.1|  BnaC03g71830D                                          144   4e-40   Brassica napus [oilseed rape]
ref|XP_002866067.1|  hypothetical protein ARALYDRAFT_918633             142   5e-40   Arabidopsis lyrata subsp. lyrata
ref|XP_010448878.1|  PREDICTED: protein translation factor SUI1 h...    142   6e-40   Camelina sativa [gold-of-pleasure]
ref|XP_006401506.1|  hypothetical protein EUTSA_v10015063mg             142   6e-40   Eutrema salsugineum [saltwater cress]
gb|ACJ85979.1|  unknown                                                 142   6e-40   Medicago truncatula
ref|XP_007142286.1|  hypothetical protein PHAVU_008G267800g             142   7e-40   Phaseolus vulgaris [French bean]
gb|ACV50429.1|  eukaryotic translation initiation factor SUI1           142   8e-40   Jatropha curcas
ref|XP_009120023.1|  PREDICTED: protein translation factor SUI1 h...    142   8e-40   
ref|NP_568818.1|  translation initiation factor SUI1 family protein     142   1e-39   Arabidopsis thaliana [mouse-ear cress]
gb|KHN11920.1|  Protein translation factor SUI1-like protein            142   1e-39   Glycine soja [wild soybean]
gb|ADB85107.1|  translation initiation factor-like protein              141   1e-39   Jatropha curcas
ref|XP_010675717.1|  PREDICTED: protein translation factor SUI1 h...    141   1e-39   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004171416.1|  PREDICTED: protein translation factor SUI1 h...    141   1e-39   
ref|XP_008349901.1|  PREDICTED: protein translation factor SUI1 h...    141   2e-39   
ref|XP_003617548.1|  Translation factor SUI1-like protein               140   2e-39   Medicago truncatula
ref|XP_007212250.1|  hypothetical protein PRUPE_ppa013625mg             140   3e-39   Prunus persica
ref|XP_010276095.1|  PREDICTED: protein translation factor SUI1 h...    140   4e-39   Nelumbo nucifera [Indian lotus]
gb|KJB11840.1|  hypothetical protein B456_002G088900                    140   4e-39   Gossypium raimondii
ref|XP_006281351.1|  hypothetical protein CARUB_v10027407mg             139   6e-39   
ref|XP_010482910.1|  PREDICTED: protein translation factor SUI1 h...    139   1e-38   Camelina sativa [gold-of-pleasure]
ref|XP_006279715.1|  hypothetical protein CARUB_v10027405mg             139   1e-38   Capsella rubella
ref|XP_007020819.1|  Translation initiation factor SUI1 family pr...    139   1e-38   
ref|XP_008365050.1|  PREDICTED: protein translation factor SUI1 h...    139   1e-38   
gb|KHN38274.1|  Protein translation factor SUI1 like                    139   1e-38   Glycine soja [wild soybean]
emb|CDY17292.1|  BnaA10g09260D                                          142   2e-38   Brassica napus [oilseed rape]
ref|XP_009338696.1|  PREDICTED: protein translation factor SUI1 h...    138   2e-38   Pyrus x bretschneideri [bai li]
ref|XP_010448172.1|  PREDICTED: protein translation factor SUI1 h...    138   3e-38   Camelina sativa [gold-of-pleasure]
ref|XP_006304318.1|  hypothetical protein CARUB_v10010698mg             138   3e-38   Capsella rubella
gb|KHG12156.1|  hypothetical protein F383_20129                         138   3e-38   Gossypium arboreum [tree cotton]
ref|NP_200287.1|  translation initiation factor SUI1 family protein     137   3e-38   Arabidopsis thaliana [mouse-ear cress]
gb|KJB62620.1|  hypothetical protein B456_009G426500                    137   4e-38   Gossypium raimondii
ref|XP_004294387.1|  PREDICTED: protein translation factor SUI1 h...    137   4e-38   Fragaria vesca subsp. vesca
ref|NP_175831.1|  protein translation factor SUI1-2                     137   4e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002867520.1|  hypothetical protein ARALYDRAFT_492082             137   4e-38   
ref|NP_194443.1|  protein translation factor SUI1-1                     137   4e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007213988.1|  hypothetical protein PRUPE_ppa013607mg             137   4e-38   Prunus persica
ref|XP_007215170.1|  hypothetical protein PRUPE_ppa013601mg             137   4e-38   Prunus persica
ref|XP_010092161.1|  Protein translation factor SUI1-2-like protein     137   4e-38   Morus notabilis
ref|XP_008244365.1|  PREDICTED: protein translation factor SUI1 h...    137   6e-38   Prunus mume [ume]
ref|XP_009378877.1|  PREDICTED: protein translation factor SUI1 h...    137   7e-38   Pyrus x bretschneideri [bai li]
ref|XP_008365631.1|  PREDICTED: protein translation factor SUI1 h...    137   7e-38   Malus domestica [apple tree]
ref|XP_010501111.1|  PREDICTED: protein translation factor SUI1 h...    137   9e-38   Camelina sativa [gold-of-pleasure]
gb|KHG11307.1|  hypothetical protein F383_12372                         136   9e-38   Gossypium arboreum [tree cotton]
gb|AAM77753.1|AF521961_1  translation initiation factor B04             136   1e-37   Helianthus annuus
emb|CDY26128.1|  BnaC06g10680D                                          136   1e-37   Brassica napus [oilseed rape]
ref|XP_011011189.1|  PREDICTED: protein translation factor SUI1 h...    136   1e-37   Populus euphratica
gb|AFD22856.1|  eukaryotic translation initiation factor SUI1-lik...    136   1e-37   Tamarix androssowii
ref|XP_010278682.1|  PREDICTED: protein translation factor SUI1 h...    136   1e-37   Nelumbo nucifera [Indian lotus]
ref|XP_009106912.1|  PREDICTED: protein translation factor SUI1 h...    136   2e-37   Brassica rapa
sp|Q9SQF4.1|SUI1_BRAOL  RecName: Full=Protein translation factor ...    136   2e-37   Brassica oleracea
emb|CDY46663.1|  BnaA03g48450D                                          139   2e-37   Brassica napus [oilseed rape]
ref|XP_006284787.1|  hypothetical protein CARUB_v10006056mg             136   2e-37   
gb|AFK35113.1|  unknown                                                 136   2e-37   Lotus japonicus
ref|XP_002281872.1|  PREDICTED: protein translation factor SUI1 h...    135   2e-37   Vitis vinifera
ref|XP_009109147.1|  PREDICTED: protein translation factor SUI1 h...    135   2e-37   Brassica rapa
ref|NP_001055949.1|  Os05g0498400                                       135   2e-37   
ref|XP_004294347.1|  PREDICTED: protein translation factor SUI1 h...    135   2e-37   Fragaria vesca subsp. vesca
gb|ABQ42057.1|  putative translation factor                             135   2e-37   Sonneratia alba
gb|EYU27827.1|  hypothetical protein MIMGU_mgv1a016640mg                135   3e-37   Erythranthe guttata [common monkey flower]
ref|XP_008341842.1|  PREDICTED: protein translation factor SUI1 h...    135   3e-37   Malus domestica [apple tree]
ref|XP_009137639.1|  PREDICTED: protein translation factor SUI1 h...    135   3e-37   Brassica rapa
ref|NP_001239651.1|  uncharacterized protein LOC100784390               135   4e-37   Glycine max [soybeans]
gb|KJB13596.1|  hypothetical protein B456_002G083300                    135   4e-37   Gossypium raimondii
ref|XP_010539284.1|  PREDICTED: protein translation factor SUI1 h...    135   4e-37   Tarenaya hassleriana [spider flower]
emb|CDX92777.1|  BnaC07g40350D                                          137   5e-37   
ref|XP_011096112.1|  PREDICTED: protein translation factor SUI1 h...    135   5e-37   Sesamum indicum [beniseed]
ref|XP_010545205.1|  PREDICTED: protein translation factor SUI1 h...    135   5e-37   Tarenaya hassleriana [spider flower]
ref|XP_010542418.1|  PREDICTED: protein translation factor SUI1 h...    135   5e-37   Tarenaya hassleriana [spider flower]
gb|KHG06773.1|  hypothetical protein F383_09794                         135   5e-37   Gossypium arboreum [tree cotton]
ref|XP_003596650.1|  Translation factor Sui1-like protein               134   5e-37   Medicago truncatula
gb|KHG23747.1|  hypothetical protein F383_10557                         134   7e-37   Gossypium arboreum [tree cotton]
ref|XP_002310460.1|  hypothetical protein POPTR_0007s02520g             134   7e-37   Populus trichocarpa [western balsam poplar]
gb|AFK48465.1|  unknown                                                 134   7e-37   Lotus japonicus
ref|XP_002310461.1|  SUI1 family protein                                134   8e-37   Populus trichocarpa [western balsam poplar]
ref|XP_004304159.1|  PREDICTED: protein translation factor SUI1 h...    134   8e-37   Fragaria vesca subsp. vesca
ref|XP_006413104.1|  hypothetical protein EUTSA_v10026037mg             138   8e-37   
gb|ACG24808.1|  protein translation factor SUI1                         134   8e-37   Zea mays [maize]
gb|AFC01199.1|  eukaryotic translation initiation factor                134   8e-37   Ammopiptanthus mongolicus
gb|EPS65463.1|  hypothetical protein M569_09315                         134   8e-37   Genlisea aurea
ref|XP_010240920.1|  PREDICTED: protein translation factor SUI1 h...    134   8e-37   Nelumbo nucifera [Indian lotus]
ref|XP_009417250.1|  PREDICTED: protein translation factor SUI1 h...    134   9e-37   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAC84489.1|  putative translation factor                            134   1e-36   Pinus pinaster [cluster pine]
gb|AFK48865.1|  unknown                                                 134   1e-36   Lotus japonicus
ref|XP_007021029.1|  Translation initiation factor SUI1 family pr...    134   1e-36   
gb|ACN30624.1|  unknown                                                 134   1e-36   Zea mays [maize]
gb|ABQ42058.1|  putative translation factor                             134   1e-36   Sonneratia caseolaris
ref|XP_004957905.1|  PREDICTED: protein translation factor SUI1 h...    134   1e-36   
gb|KHG30632.1|  hypothetical protein F383_00215                         134   1e-36   Gossypium arboreum [tree cotton]
ref|XP_006363526.1|  PREDICTED: protein translation factor SUI1 h...    134   1e-36   Solanum tuberosum [potatoes]
ref|NP_001104887.1|  protein translation factor SUI1 homolog            134   1e-36   Zea mays [maize]
ref|XP_010923943.1|  PREDICTED: protein translation factor SUI1 h...    134   1e-36   Elaeis guineensis
ref|XP_007132567.1|  hypothetical protein PHAVU_011G105700g             134   1e-36   Phaseolus vulgaris [French bean]
ref|XP_010035571.1|  PREDICTED: protein translation factor SUI1 h...    134   1e-36   Eucalyptus grandis [rose gum]
ref|XP_010062975.1|  PREDICTED: protein translation factor SUI1 h...    134   1e-36   Eucalyptus grandis [rose gum]
ref|NP_001059843.1|  Os07g0529800                                       134   1e-36   
sp|Q9SM41.1|SUI1_SPOST  RecName: Full=Protein translation factor ...    134   1e-36   Sporobolus stapfianus [resurrection grass]
ref|XP_011097918.1|  PREDICTED: protein translation factor SUI1 h...    133   2e-36   Sesamum indicum [beniseed]
ref|XP_004487600.1|  PREDICTED: protein translation factor SUI1 h...    133   2e-36   
ref|XP_010930963.1|  PREDICTED: protein translation factor SUI1 h...    133   2e-36   Elaeis guineensis
gb|EEC79466.1|  hypothetical protein OsI_20483                          136   2e-36   Oryza sativa Indica Group [Indian rice]
ref|XP_004244151.1|  PREDICTED: protein translation factor SUI1 h...    133   2e-36   Solanum lycopersicum
ref|NP_001152681.1|  LOC100286322                                       133   2e-36   Zea mays [maize]
ref|XP_003568176.1|  PREDICTED: protein translation factor SUI1 h...    133   2e-36   Brachypodium distachyon [annual false brome]
ref|XP_008803218.1|  PREDICTED: protein translation factor SUI1 h...    133   2e-36   Phoenix dactylifera
ref|XP_004144489.1|  PREDICTED: protein translation factor SUI1 h...    133   2e-36   Cucumis sativus [cucumbers]
ref|XP_002280157.1|  PREDICTED: protein translation factor SUI1 h...    133   2e-36   
sp|O48650.1|SUI1_SALBA  RecName: Full=Protein translation factor ...    133   2e-36   Salix bakko [Japanese willow]
ref|XP_009397784.1|  PREDICTED: protein translation factor SUI1 h...    133   2e-36   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008784556.1|  PREDICTED: protein translation factor SUI1 h...    133   2e-36   Phoenix dactylifera
ref|XP_010267759.1|  PREDICTED: protein translation factor SUI1 h...    133   2e-36   Nelumbo nucifera [Indian lotus]
gb|KJB62619.1|  hypothetical protein B456_009G426400                    136   3e-36   Gossypium raimondii
ref|NP_001150984.1|  GOS2 homolog                                       133   3e-36   
ref|NP_001236633.1|  uncharacterized protein LOC100499833               133   3e-36   Glycine max [soybeans]
emb|CDP20340.1|  unnamed protein product                                133   3e-36   Coffea canephora [robusta coffee]
sp|O82569.1|SUI1_PIMBR  RecName: Full=Protein translation factor ...    133   3e-36   Spuriopimpinella brachycarpa
gb|KDP39065.1|  hypothetical protein JCGZ_00822                         133   3e-36   Jatropha curcas
gb|ADV04053.1|  eukaryotic translation initiation factor 2              133   3e-36   Hevea brasiliensis [jebe]
gb|KHN46541.1|  Protein translation factor SUI1 like 1                  134   3e-36   Glycine soja [wild soybean]
ref|XP_006370639.1|  hypothetical protein POPTR_0001s44450g             132   3e-36   Populus trichocarpa [western balsam poplar]
ref|XP_003527319.1|  PREDICTED: protein translation factor SUI1 h...    132   3e-36   Glycine max [soybeans]
ref|XP_011048301.1|  PREDICTED: protein translation factor SUI1 h...    132   4e-36   Populus euphratica
ref|XP_004234488.1|  PREDICTED: protein translation factor SUI1 h...    132   4e-36   Solanum lycopersicum
ref|XP_010909791.1|  PREDICTED: protein translation factor SUI1 h...    132   4e-36   Elaeis guineensis
gb|KHG06771.1|  hypothetical protein F383_09792                         132   4e-36   Gossypium arboreum [tree cotton]
ref|XP_007132953.1|  hypothetical protein PHAVU_011G139000g             132   4e-36   Phaseolus vulgaris [French bean]
ref|XP_007132952.1|  hypothetical protein PHAVU_011G138900g             132   4e-36   Phaseolus vulgaris [French bean]
ref|XP_009774027.1|  PREDICTED: protein translation factor SUI1 h...    132   5e-36   Nicotiana sylvestris
gb|KJB81730.1|  hypothetical protein B456_013G159400                    132   6e-36   Gossypium raimondii
ref|XP_009594373.1|  PREDICTED: protein translation factor SUI1 h...    132   6e-36   Nicotiana tomentosiformis
ref|XP_009342251.1|  PREDICTED: protein translation factor SUI1 h...    132   6e-36   Pyrus x bretschneideri [bai li]
ref|XP_008341979.1|  PREDICTED: protein translation factor SUI1 h...    132   6e-36   Malus domestica [apple tree]
ref|XP_003527483.1|  PREDICTED: protein translation factor SUI1 h...    132   6e-36   Glycine max [soybeans]
ref|XP_006475205.1|  PREDICTED: protein translation factor SUI1 h...    132   7e-36   Citrus sinensis [apfelsine]
ref|XP_010931827.1|  PREDICTED: protein translation factor SUI1 h...    132   7e-36   Elaeis guineensis
ref|XP_008809850.1|  PREDICTED: protein translation factor SUI1 h...    132   7e-36   Phoenix dactylifera
ref|XP_011030847.1|  PREDICTED: protein translation factor SUI1 h...    132   8e-36   Populus euphratica
ref|XP_003564393.1|  PREDICTED: protein translation factor SUI1 h...    132   8e-36   Brachypodium distachyon [annual false brome]
ref|XP_009401666.1|  PREDICTED: protein translation factor SUI1 h...    131   9e-36   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002316065.1|  hypothetical protein POPTR_0010s16160g             131   1e-35   Populus trichocarpa [western balsam poplar]
ref|XP_004248369.1|  PREDICTED: protein translation factor SUI1 h...    131   1e-35   Solanum lycopersicum
gb|ADV04054.1|  eukaryotic translation initiation factor 3              131   1e-35   Hevea brasiliensis [jebe]
ref|XP_009624679.1|  PREDICTED: protein translation factor SUI1 h...    131   1e-35   Nicotiana tomentosiformis
emb|CDY10602.1|  BnaC03g70120D                                          131   1e-35   Brassica napus [oilseed rape]
gb|AFW78548.1|  LOW QUALITY PROTEIN: protein translation factor SUI1    133   1e-35   
ref|XP_009771770.1|  PREDICTED: protein translation factor SUI1 h...    131   1e-35   Nicotiana sylvestris
ref|XP_006352492.1|  PREDICTED: protein translation factor SUI1 h...    131   1e-35   Solanum tuberosum [potatoes]
ref|NP_001238017.1|  uncharacterized protein LOC100306129               131   1e-35   Glycine max [soybeans]
gb|EYU33614.1|  hypothetical protein MIMGU_mgv1a016641mg                131   1e-35   Erythranthe guttata [common monkey flower]
ref|XP_002458630.1|  hypothetical protein SORBIDRAFT_03g036990          131   1e-35   Sorghum bicolor [broomcorn]
emb|CDP05794.1|  unnamed protein product                                131   2e-35   Coffea canephora [robusta coffee]
ref|XP_002960838.1|  hypothetical protein SELMODRAFT_437304             131   2e-35   Selaginella moellendorffii
gb|KHN41202.1|  Protein translation factor SUI1 like                    130   2e-35   Glycine soja [wild soybean]
ref|XP_010232448.1|  PREDICTED: protein translation factor SUI1 h...    132   2e-35   Brachypodium distachyon [annual false brome]
ref|XP_009412007.1|  PREDICTED: protein translation factor SUI1 h...    130   2e-35   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAD58628.1|  SUI1 protein                                           130   2e-35   Coffea arabica [arabica coffee]
gb|EEE67305.1|  hypothetical protein OsJ_24532                          134   2e-35   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009388867.1|  PREDICTED: protein translation factor SUI1 h...    130   2e-35   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004515084.1|  PREDICTED: protein translation factor SUI1 h...    130   2e-35   Cicer arietinum [garbanzo]
gb|EYU19220.1|  hypothetical protein MIMGU_mgv1a016636mg                130   2e-35   Erythranthe guttata [common monkey flower]
ref|XP_004287929.1|  PREDICTED: protein translation factor SUI1 h...    130   2e-35   Fragaria vesca subsp. vesca
ref|XP_006447521.1|  hypothetical protein CICLE_v10017243mg             130   2e-35   Citrus clementina [clementine]
ref|XP_002316980.1|  hypothetical protein POPTR_0011s13810g             130   2e-35   Populus trichocarpa [western balsam poplar]
ref|XP_009611793.1|  PREDICTED: protein translation factor SUI1 h...    130   2e-35   Nicotiana tomentosiformis
gb|KEH29652.1|  eukaryotic translation initiation factor SUI1           130   2e-35   Medicago truncatula
ref|XP_009603077.1|  PREDICTED: protein translation factor SUI1 h...    130   2e-35   Nicotiana tomentosiformis
ref|XP_009408662.1|  PREDICTED: protein translation factor SUI1 h...    130   3e-35   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008230087.1|  PREDICTED: protein translation factor SUI1 h...    130   3e-35   Prunus mume [ume]
ref|NP_001044504.2|  Os01g0794500                                       130   3e-35   
gb|ABO15891.1|  translation initiation factor eIF1                      130   3e-35   synthetic construct
ref|XP_010694233.1|  PREDICTED: protein translation factor SUI1 h...    130   3e-35   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004970238.1|  PREDICTED: protein translation factor SUI1 h...    130   3e-35   Setaria italica
gb|AGT16828.1|  protein translation factor SUI1                         130   4e-35   Saccharum hybrid cultivar R570
emb|CDO99708.1|  unnamed protein product                                130   4e-35   Coffea canephora [robusta coffee]
gb|AFK43238.1|  unknown                                                 130   4e-35   Medicago truncatula
gb|KHG17081.1|  Protein translation factor SUI1                         131   4e-35   Gossypium arboreum [tree cotton]
ref|XP_002522857.1|  translation factor sui1, putative                  130   4e-35   
gb|ABI48954.1|  putative protein translation factor Sui1                130   4e-35   Viola baoshanensis
gb|EPS74118.1|  hypothetical protein M569_00639                         129   6e-35   Genlisea aurea
ref|XP_009800522.1|  PREDICTED: protein translation factor SUI1 h...    129   6e-35   Nicotiana sylvestris
gb|EEE55519.1|  hypothetical protein OsJ_03741                          130   7e-35   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007216425.1|  hypothetical protein PRUPE_ppa022105mg             131   8e-35   
gb|KCW46999.1|  hypothetical protein EUGRSUZ_K00804                     129   1e-34   Eucalyptus grandis [rose gum]
gb|KEH38844.1|  eukaryotic translation initiation factor SUI1           129   1e-34   Medicago truncatula
emb|CAD58629.1|  SUI1 protein                                           129   1e-34   Coffea arabica [arabica coffee]
ref|XP_002532561.1|  translation factor sui1, putative                  128   2e-34   Ricinus communis
gb|ABY75806.1|  SUI1 A protein                                          128   2e-34   Opuntia streptacantha
ref|XP_010272070.1|  PREDICTED: protein translation factor SUI1 h...    128   2e-34   Nelumbo nucifera [Indian lotus]
ref|XP_004159225.1|  PREDICTED: protein translation factor SUI1 h...    130   2e-34   
ref|XP_008810164.1|  PREDICTED: protein translation factor SUI1 h...    130   3e-34   
ref|XP_002985789.1|  hypothetical protein SELMODRAFT_234882             127   3e-34   Selaginella moellendorffii
gb|KDP20792.1|  hypothetical protein JCGZ_21263                         127   3e-34   Jatropha curcas
ref|XP_009398183.1|  PREDICTED: protein translation factor SUI1 h...    127   4e-34   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006644837.1|  PREDICTED: protein translation factor SUI1 h...    127   6e-34   Oryza brachyantha
ref|XP_008647990.1|  PREDICTED: LOC100286322 isoform X2                 127   8e-34   Zea mays [maize]
ref|NP_001274850.1|  uncharacterized protein LOC102577437               126   8e-34   Solanum tuberosum [potatoes]
ref|XP_006827315.1|  hypothetical protein AMTR_s00010p00266770          127   2e-33   
ref|XP_006352509.1|  PREDICTED: protein translation factor SUI1 h...    125   3e-33   Solanum tuberosum [potatoes]
gb|EMT21575.1|  Protein translation factor SUI1-like protein            125   4e-33   
ref|XP_006833020.1|  hypothetical protein AMTR_s00094p00033760          124   6e-33   
gb|EEC82174.1|  hypothetical protein OsI_26284                          134   7e-33   Oryza sativa Indica Group [Indian rice]
gb|AAM34279.1|AF508969_1  translation initiation factor                 124   8e-33   Triticum aestivum [Canadian hard winter wheat]
gb|ABK24036.1|  unknown                                                 124   9e-33   Picea sitchensis
ref|XP_002976303.1|  hypothetical protein SELMODRAFT_232756             124   1e-32   Selaginella moellendorffii
ref|XP_001756581.1|  predicted protein                                  123   1e-32   
gb|KJB39023.1|  hypothetical protein B456_007G314400                    123   2e-32   Gossypium raimondii
ref|XP_008351221.1|  PREDICTED: protein translation factor SUI1 h...    123   2e-32   
ref|XP_003562997.1|  PREDICTED: protein translation factor SUI1 h...    123   2e-32   Brachypodium distachyon [annual false brome]
gb|ADJ67213.1|  hypothetical protein                                    122   2e-32   Jatropha curcas
gb|EMS51805.1|  Protein translation factor SUI1-like protein            124   3e-32   Triticum urartu
gb|EMS63057.1|  Protein translation factor SUI1-like protein            122   4e-32   Triticum urartu
ref|XP_006452372.1|  hypothetical protein CICLE_v10009975mg             122   4e-32   Citrus clementina [clementine]
gb|ACS68685.1|  putative translation factor                             121   5e-32   Sonneratia alba
gb|KCW70138.1|  hypothetical protein EUGRSUZ_F03432                     122   2e-31   Eucalyptus grandis [rose gum]
gb|ADU56181.1|  hypothetical protein                                    119   3e-31   Jatropha curcas
gb|EMT13356.1|  Protein translation factor SUI1-like protein            120   3e-31   
ref|XP_010109526.1|  Protein translation factor SUI1-1-like protein     120   3e-31   
gb|ADJ67174.1|  hypothetical protein                                    119   4e-31   Jatropha curcas
gb|KHN02839.1|  Protein translation factor SUI1 like 2                  120   5e-31   Glycine soja [wild soybean]
emb|CAB56294.1|  putative protein translation factor                    119   5e-31   Phleum pratense [timothy]
gb|KEH38847.1|  eukaryotic translation initiation factor SUI1           119   8e-31   Medicago truncatula
gb|KEH38845.1|  eukaryotic translation initiation factor SUI1           119   9e-31   Medicago truncatula
ref|XP_010533344.1|  PREDICTED: protein translation factor SUI1 h...    117   1e-30   Tarenaya hassleriana [spider flower]
ref|XP_006372949.1|  hypothetical protein POPTR_0017s06480g             117   1e-30   
ref|XP_010105571.1|  Protein translation factor SUI1-1-like protein     120   2e-30   
ref|XP_004487599.1|  PREDICTED: protein translation factor SUI1 h...    117   3e-30   
ref|XP_006475204.1|  PREDICTED: protein translation factor SUI1 h...    117   3e-30   
ref|XP_004144491.1|  PREDICTED: protein translation factor SUI1 h...    117   4e-30   
ref|XP_004961617.1|  PREDICTED: protein translation factor SUI1 h...    117   4e-30   
ref|XP_001752498.1|  predicted protein                                  116   8e-30   
gb|AFW78550.1|  hypothetical protein ZEAMMB73_586492                    116   1e-29   
ref|XP_009624686.1|  PREDICTED: protein translation factor SUI1 h...    115   1e-29   
ref|XP_007021023.1|  Translation initiation factor SUI1 family pr...    117   1e-29   
ref|XP_006370638.1|  hypothetical protein POPTR_0001s44450g             116   1e-29   Populus trichocarpa [western balsam poplar]
ref|XP_006591819.1|  PREDICTED: uncharacterized protein LOC100306...    115   2e-29   
ref|XP_010327265.1|  PREDICTED: protein translation factor SUI1 h...    115   2e-29   Solanum lycopersicum
ref|XP_004970237.1|  PREDICTED: protein translation factor SUI1 h...    114   6e-29   
dbj|BAN10309.1|  eukaryotic translation initiation factor SUI1          113   8e-29   Chamaecyparis obtusa
dbj|BAN10326.1|  translation initiation factor SUI1 family protein      112   1e-28   Buxus microphylla var. japonica
ref|XP_005645489.1|  translation initiation factor SU                   112   2e-28   Coccomyxa subellipsoidea C-169
gb|KJB39025.1|  hypothetical protein B456_007G314400                    111   5e-28   Gossypium raimondii
dbj|BAF63490.1|  translational initiation factor eIF1                   107   7e-27   Potamogeton distinctus
gb|KDD75795.1|  hypothetical protein H632_c495p1                        107   2e-26   Helicosporidium sp. ATCC 50920
ref|XP_010092162.1|  Protein translation factor SUI1-like protein       105   2e-25   Morus notabilis
gb|EMT19520.1|  Protein translation factor SUI1-like protein            106   3e-25   
ref|XP_002949286.1|  hypothetical protein VOLCADRAFT_109710             103   7e-25   Volvox carteri f. nagariensis
ref|XP_001691459.1|  translation initiation protein                     103   8e-25   Chlamydomonas reinhardtii
ref|XP_008382302.1|  PREDICTED: protein translation factor SUI1 h...    102   3e-24   Malus domestica [apple tree]
gb|AFN10635.1|  translation initiation factor-like protein              100   4e-24   
dbj|GAN03056.1|  eukaryotic translation initiation factor SUI1          100   7e-24   
gb|EPB81403.1|  hypothetical protein HMPREF1544_11892                   100   7e-24   
emb|CEG78008.1|  Putative Translation initiation factor SUI1            100   8e-24   
ref|XP_008776100.1|  PREDICTED: protein translation factor SUI1 h...    101   8e-24   
gb|KJB62621.1|  hypothetical protein B456_009G426500                    100   9e-24   
gb|EIE79257.1|  translation initiation factor SUI1                      100   1e-23   
ref|XP_006284788.1|  hypothetical protein CARUB_v10006056mg           99.8    2e-23   
gb|KJB45591.1|  hypothetical protein B456_007G314200                  98.6    3e-23   
emb|CDH49154.1|  eukaryotic translation initiation factor 1           99.4    3e-23   
gb|KEH38846.1|  eukaryotic translation initiation factor SUI1         99.0    3e-23   
ref|XP_011396751.1|  Translation factor SUI1-like protein 1             100   3e-23   
gb|AFW75026.1|  hypothetical protein ZEAMMB73_109319                  98.2    3e-23   
tpg|DAA62968.1|  TPA: translation initiation factor1                  99.0    4e-23   
ref|XP_009025362.1|  hypothetical protein HELRODRAFT_163156           99.0    4e-23   
ref|XP_008650268.1|  PREDICTED: protein translation factor SUI1 h...  98.2    4e-23   
gb|AFW78551.1|  hypothetical protein ZEAMMB73_586492                  99.0    5e-23   
gb|KJB78392.1|  hypothetical protein B456_013G163400                  98.2    5e-23   
ref|XP_005847583.1|  hypothetical protein CHLNCDRAFT_133842           98.2    1e-22   
gb|EAY95661.1|  hypothetical protein OsI_17527                          100   1e-22   
gb|ACD99647.1|  translation initiation factor                           100   1e-22   
emb|CAJ86367.1|  OSIGBa0117N13.11                                       100   1e-22   
dbj|BAK05450.1|  predicted protein                                    97.4    2e-22   
gb|KJB13598.1|  hypothetical protein B456_002G083300                  96.7    3e-22   
ref|XP_006041882.1|  PREDICTED: eukaryotic translation initiation...  96.7    3e-22   
gb|KJB13597.1|  hypothetical protein B456_002G083300                  96.3    3e-22   
ref|XP_004177891.1|  hypothetical protein TBLA_0A05790                96.3    4e-22   
gb|ADB54840.1|  eukaryotic translation initiation factor 1            96.3    5e-22   
ref|XP_002554352.1|  KLTH0F03234p                                     95.9    5e-22   
emb|CDO92794.1|  unnamed protein product                              95.9    6e-22   
ref|XP_452335.1|  hypothetical protein                                95.9    6e-22   
ref|XP_003580602.2|  PREDICTED: splicing factor, proline- and glu...  99.8    7e-22   
ref|XP_004706531.1|  PREDICTED: eukaryotic translation initiation...  96.3    7e-22   
ref|XP_004515083.1|  PREDICTED: protein translation factor SUI1 h...  95.9    8e-22   
ref|XP_002130503.1|  PREDICTED: eukaryotic translation initiation...  95.5    8e-22   
emb|CEP64385.1|  LALA0S11e02872g1_1                                   95.5    8e-22   
gb|ELU11301.1|  hypothetical protein CAPTEDRAFT_160473                95.5    8e-22   
emb|CEG82542.1|  Putative Translation initiation factor SUI1          95.5    9e-22   
ref|XP_006675909.1|  hypothetical protein BATDEDRAFT_84447            95.5    9e-22   
emb|CEJ03608.1|  Putative Translation initiation factor SUI1          95.5    1e-21   
ref|NP_001053955.1|  Os04g0627900                                     98.6    1e-21   
dbj|BAD97168.1|  translation factor sui1 homolog                      95.5    1e-21   
emb|CCK70740.1|  hypothetical protein KNAG_0F00710                    94.7    2e-21   
ref|XP_005539321.1|  probable eukaryotic translation initiation f...  94.7    2e-21   
gb|ACO10483.1|  translation factor SUI1 homolog                       94.4    3e-21   
ref|XP_004895335.1|  PREDICTED: eukaryotic translation initiation...  94.4    3e-21   
ref|XP_003684518.1|  hypothetical protein TPHA_0B04140                94.0    3e-21   
ref|NP_983701.1|  ADL395Cp                                            94.0    3e-21   
gb|KIZ01467.1|  putative Protein translation factor SUI1 like pro...  96.3    4e-21   
ref|XP_003670956.1|  hypothetical protein NDAI_0F03950                93.6    4e-21   
dbj|BAH71030.1|  ACYPI004195                                          93.6    4e-21   
ref|XP_003957154.1|  hypothetical protein KAFR_0D03710                93.6    4e-21   
gb|ACO12696.1|  translation factor SUI1 homolog                       93.6    4e-21   
ref|XP_001948896.1|  PREDICTED: protein translation factor SUI1 h...  93.6    4e-21   
ref|XP_002497891.1|  ZYRO0F15884p                                     93.6    4e-21   
ref|XP_005187256.1|  PREDICTED: protein translation factor SUI1 h...  93.6    5e-21   
gb|ENN73110.1|  hypothetical protein YQE_10251                        93.6    5e-21   
ref|XP_001646920.1|  hypothetical protein Kpol_2000p26                93.6    5e-21   
ref|XP_002448570.1|  hypothetical protein SORBIDRAFT_06g029340        96.7    5e-21   
ref|XP_003680684.1|  hypothetical protein TDEL_0C05840                93.2    6e-21   
ref|XP_004712205.1|  PREDICTED: eukaryotic translation initiation...  93.2    6e-21   
gb|AJT06393.1|  Sui1p                                                 93.2    6e-21   
ref|XP_011105142.1|  sui1p                                            93.2    6e-21   
emb|CAE04242.3|  OSJNBa0089N06.3                                      99.4    6e-21   
ref|NP_014155.1|  translation initiation factor eIF1                  93.2    6e-21   
ref|XP_004519899.1|  PREDICTED: protein translation factor SUI1 h...  93.2    6e-21   
ref|XP_009138116.1|  PREDICTED: probable phenylalanine--tRNA liga...  95.5    6e-21   
dbj|GAA25864.1|  K7_Sui1p                                             92.8    6e-21   
gb|KJB24471.1|  hypothetical protein B456_004G147000                  92.4    7e-21   
gb|EIE77311.1|  translation initiation factor SUI1                    92.8    9e-21   
gb|ETN67045.1|  sui1                                                  92.8    9e-21   
ref|XP_001661080.1|  AAEL010843-PA                                    92.8    9e-21   
ref|XP_002432016.1|  translation factor sui1, putative                92.8    1e-20   
gb|ACO10238.1|  translation factor SUI1 homolog                       92.4    1e-20   
gb|ABR27954.1|  translation initiation factor 1                       92.4    1e-20   
dbj|BAN20281.1|  conserved hypothetical protein                       92.4    1e-20   
ref|XP_003673034.1|  hypothetical protein NCAS_0A00830                92.4    1e-20   
ref|XP_008551957.1|  PREDICTED: protein translation factor SUI1 h...  92.4    1e-20   
ref|XP_002019643.1|  GL12102                                          92.4    1e-20   
ref|XP_003486256.1|  PREDICTED: protein translation factor SUI1 h...  92.4    1e-20   
ref|XP_001731784.1|  hypothetical protein MGL_1052                    92.4    1e-20   
ref|XP_972771.1|  PREDICTED: protein translation factor SUI1 homolog  92.4    1e-20   
gb|ABV44713.1|  translation initiation factor 1-like protein          92.4    1e-20   
ref|NP_001155788.1|  eukaryotic translation initiation factor 1       92.4    1e-20   
ref|XP_005344888.1|  PREDICTED: eukaryotic translation initiation...  92.4    2e-20   
gb|KIY50999.1|  eukaryotic translation initiation factor 1            92.0    2e-20   
ref|NP_001037082.1|  protein translation factor SUI1 homolog          92.0    2e-20   
gb|ACN30667.1|  unknown                                               92.0    2e-20   
gb|EFX82803.1|  hypothetical protein DAPPUDRAFT_302358                91.7    2e-20   
ref|XP_011122353.1|  hypothetical protein AOL_s00079g176              91.7    2e-20   
gb|AFN10636.1|  translation initiation factor-like protein            90.9    2e-20   
emb|CBQ73048.1|  probable translation initiation factor SUI1          91.7    3e-20   
dbj|GAC71792.1|  translation initiation factor 1                      91.7    3e-20   
gb|AFM87132.1|  translation factor sui1-like protein                  91.7    3e-20   
ref|XP_011056576.1|  PREDICTED: protein translation factor SUI1 h...  94.0    3e-20   
ref|XP_448041.1|  hypothetical protein                                91.3    3e-20   
ref|XP_004194644.1|  Piso0_005151                                     91.3    4e-20   
ref|XP_011257191.1|  PREDICTED: LOW QUALITY PROTEIN: protein tran...  93.6    4e-20   
ref|XP_002066294.1|  GK18213                                          90.9    4e-20   
gb|KHK00035.1|  Translation initiation factor SUI1                    91.7    4e-20   
gb|KIL68601.1|  hypothetical protein M378DRAFT_120853                 91.7    4e-20   
emb|CDF91750.1|  ZYBA0S14-00166g1_1                                   90.9    4e-20   
gb|AGM32795.1|  eukaryotic initiation factor 1                        90.9    5e-20   
gb|ESW98385.1|  Eukaryotic translation initiation factor eIF-1        90.9    5e-20   
ref|XP_011423571.1|  PREDICTED: eukaryotic translation initiation...  90.9    5e-20   
ref|XP_004477759.1|  PREDICTED: eukaryotic translation initiation...  90.9    5e-20   
emb|CDY33072.1|  BnaC06g07070D                                        91.3    7e-20   
ref|XP_001863733.1|  sui1                                             90.5    7e-20   
ref|XP_005093096.1|  PREDICTED: protein translation factor SUI1 h...  90.5    7e-20   
ref|XP_316499.2|  AGAP006459-PA                                       90.5    7e-20   
emb|CDI53525.1|  probable translation initiation factor SUI1          90.5    8e-20   
ref|XP_007300579.1|  eukaryotic translation initiation factor 1       90.5    8e-20   
ref|XP_007763994.1|  eukaryotic translation initiation factor SUI1    90.1    8e-20   
gb|KIM49411.1|  hypothetical protein M413DRAFT_438590                 90.1    9e-20   
ref|XP_003362611.1|  PREDICTED: eukaryotic translation initiation...  90.1    1e-19   
ref|XP_003477467.1|  PREDICTED: eukaryotic translation initiation...  90.1    1e-19   
emb|CDJ79841.1|  eukaryotic translation initiation factor 1           90.1    1e-19   
ref|XP_004717826.1|  PREDICTED: eukaryotic translation initiation...  90.1    1e-19   
gb|AAP36749.1|  Homo sapiens putative translation initiation factor   90.1    1e-19   
ref|XP_002134050.1|  GA28869                                          89.7    1e-19   
ref|XP_011389050.1|  putative translation initiation factor eIF1      90.1    1e-19   
gb|ERZ95524.1|  hypothetical protein GLOINDRAFT_341178                89.7    1e-19   
emb|CCG84468.1|  protein of unknown function                          89.7    1e-19   
emb|CCO28058.1|  Protein translation factor SUI1                      89.7    1e-19   
ref|XP_005876693.1|  PREDICTED: eukaryotic translation initiation...  90.1    1e-19   
gb|AAD19900.1|  putative translation initiation factor A121/Sui1      89.7    1e-19   
ref|NP_647792.1|  CG17737                                             89.7    1e-19   
ref|XP_004195741.1|  Piso0_005151                                     89.7    1e-19   
gb|KFB35115.1|  AGAP006459-PA-like protein                            89.7    1e-19   
ref|XP_007267881.1|  eukaryotic translation initiation factor SUI1    89.7    1e-19   
ref|XP_004434545.1|  PREDICTED: eukaryotic translation initiation...  89.7    1e-19   
gb|ELR53946.1|  Eukaryotic translation initiation factor 1            89.7    1e-19   
emb|CCF52891.1|  probable translation initiation factor SUI1          89.7    1e-19   
ref|XP_003756178.1|  PREDICTED: eukaryotic translation initiation...  89.7    1e-19   
ref|XP_007418771.1|  hypothetical protein MELLADRAFT_84135            89.7    1e-19   
ref|NP_001291770.1|  eukaryotic translation initiation factor 1       89.7    2e-19   
ref|NP_005792.1|  eukaryotic translation initiation factor 1          89.7    2e-19   
ref|XP_003799943.1|  PREDICTED: eukaryotic translation initiation...  89.7    2e-19   
ref|XP_006099297.1|  PREDICTED: eukaryotic translation initiation...  89.7    2e-19   
gb|EUC62160.1|  eukaryotic translation initiation factor SUI1         89.7    2e-19   
ref|XP_002838067.1|  hypothetical protein                             89.7    2e-19   
ref|XP_003499225.1|  PREDICTED: eukaryotic translation initiation...  89.7    2e-19   
gb|EST05525.1|  translation initiation factor 1                       89.7    2e-19   
ref|XP_001863732.1|  eukaryotic translation initiation factor 1b      89.4    2e-19   
gb|AFM90303.1|  translation factor sui1-like protein                  89.4    2e-19   
gb|ELK01507.1|  Eukaryotic translation initiation factor 1            90.5    2e-19   
emb|CBY19102.1|  unnamed protein product                              89.4    2e-19   
pdb|2IF1|A  Chain A, Human Translation Initiation Factor Eif1, Nm...  89.7    2e-19   
gb|KIM87020.1|  hypothetical protein PILCRDRAFT_815455                89.4    2e-19   
ref|XP_002400283.1|  translation factor Sui1, putative                89.4    2e-19   
ref|NP_035638.1|  eukaryotic translation initiation factor 1          89.4    2e-19   
ref|XP_004855393.1|  PREDICTED: eukaryotic translation initiation...  89.4    2e-19   
ref|XP_007618569.1|  PREDICTED: eukaryotic translation initiation...  89.4    2e-19   
emb|CDY02665.1|  BnaC02g07700D                                        92.8    2e-19   
ref|XP_006883883.1|  PREDICTED: eukaryotic translation initiation...  89.0    2e-19   
ref|XP_004334397.1|  protein translation factor, putative             89.0    2e-19   
ref|XP_006770429.1|  PREDICTED: eukaryotic translation initiation...  89.0    2e-19   
ref|NP_001161207.1|  eukaryotic translation initiation factor 1       89.0    2e-19   
ref|XP_001833664.2|  eukaryotic translation initiation factor 1       89.0    3e-19   
emb|CDK25787.1|  unnamed protein product                              89.0    3e-19   
gb|KJA27496.1|  hypothetical protein HYPSUDRAFT_35413                 89.0    3e-19   
gb|KIM24002.1|  hypothetical protein M408DRAFT_332058                 89.0    3e-19   
ref|XP_005973972.1|  PREDICTED: eukaryotic translation initiation...  89.7    3e-19   
ref|XP_004416968.1|  PREDICTED: eukaryotic translation initiation...  90.5    3e-19   
gb|KDR81774.1|  hypothetical protein GALMADRAFT_239964                88.6    3e-19   
gb|EHB08738.1|  Eukaryotic translation initiation factor 1            88.6    3e-19   
ref|XP_006264602.1|  PREDICTED: eukaryotic translation initiation...  88.6    3e-19   
ref|XP_005954640.1|  PREDICTED: eukaryotic translation initiation...  88.6    4e-19   
ref|XP_001878593.1|  predicted protein                                88.6    4e-19   
ref|XP_004363304.1|  translation initiation factor SUI1               88.6    4e-19   
ref|XP_004028071.1|  PREDICTED: uncharacterized protein LOC101129727  90.9    5e-19   
ref|XP_006108120.1|  PREDICTED: eukaryotic translation initiation...  88.2    5e-19   
ref|XP_004410340.1|  PREDICTED: eukaryotic translation initiation...  89.0    6e-19   
gb|ACO52071.1|  Eukaryotic translation initiation factor 1b           88.2    6e-19   
ref|XP_006008886.1|  PREDICTED: eukaryotic translation initiation...  88.2    6e-19   
ref|XP_006051026.1|  PREDICTED: eukaryotic translation initiation...  88.2    6e-19   
ref|XP_006377837.1|  hypothetical protein POPTR_0011s13810g           87.0    6e-19   
ref|XP_006196298.1|  PREDICTED: eukaryotic translation initiation...  88.6    6e-19   
ref|XP_002199008.1|  PREDICTED: eukaryotic translation initiation...  87.8    6e-19   
emb|CDR41170.1|  CYFA0S06e03092g1_1                                   89.0    6e-19   
ref|XP_005707772.1|  protein translation factor                       87.8    7e-19   
ref|XP_534229.2|  PREDICTED: eukaryotic translation initiation fa...  87.8    7e-19   
gb|KDR15926.1|  Translation factor SUI1-like protein                  87.4    7e-19   
ref|XP_004634274.1|  PREDICTED: eukaryotic translation initiation...  87.8    7e-19   
ref|XP_002140813.1|  translation initiation factor SUI1               87.8    7e-19   
ref|XP_007338565.1|  eukaryotic translation initiation factor 1       87.8    7e-19   
ref|XP_002052718.1|  GJ20177                                          87.8    7e-19   
gb|ADM67806.1|  putative eukaryotic translation initiation factor...  86.3    8e-19   
ref|XP_006634521.1|  PREDICTED: eukaryotic translation initiation...  87.8    8e-19   
ref|XP_010723031.1|  PREDICTED: eukaryotic translation initiation...  88.2    9e-19   
ref|XP_007631465.1|  PREDICTED: eukaryotic translation initiation...  89.0    9e-19   
gb|KIK06524.1|  hypothetical protein K443DRAFT_129804                 87.4    9e-19   
ref|XP_001989273.1|  GH10143                                          87.4    9e-19   
ref|XP_006638396.1|  PREDICTED: eukaryotic translation initiation...  87.4    9e-19   
dbj|BAE29876.1|  unnamed protein product                              87.4    9e-19   
gb|EPX75032.1|  translation initiation factor eIF1                    87.4    9e-19   
ref|XP_008328667.1|  PREDICTED: eukaryotic translation initiation...  87.4    1e-18   
gb|ETE68217.1|  Eukaryotic translation initiation factor 1            88.6    1e-18   
ref|XP_005513423.1|  PREDICTED: eukaryotic translation initiation...  88.6    1e-18   
ref|XP_002023379.1|  GL20331                                          87.4    1e-18   
ref|XP_004711626.1|  PREDICTED: eukaryotic translation initiation...  87.4    1e-18   
gb|EHB02833.1|  Eukaryotic translation initiation factor 1            87.4    1e-18   
ref|XP_010209549.1|  PREDICTED: eukaryotic translation initiation...  87.4    1e-18   
ref|XP_004707211.1|  PREDICTED: eukaryotic translation initiation...  87.4    1e-18   
ref|XP_005232732.1|  PREDICTED: eukaryotic translation initiation...  88.2    1e-18   
ref|XP_010872984.1|  PREDICTED: eukaryotic translation initiation...  87.4    1e-18   
ref|XP_009553786.1|  PREDICTED: eukaryotic translation initiation...  87.4    1e-18   
ref|XP_003035163.1|  hypothetical protein SCHCODRAFT_81353            87.4    1e-18   
ref|XP_005439417.1|  PREDICTED: eukaryotic translation initiation...  88.2    1e-18   
ref|XP_006894618.1|  PREDICTED: eukaryotic translation initiation...  87.0    1e-18   
gb|KII88592.1|  hypothetical protein PLICRDRAFT_111559                87.0    1e-18   
ref|XP_008066763.1|  PREDICTED: eukaryotic translation initiation...  87.0    1e-18   
ref|XP_001364419.2|  PREDICTED: uncharacterized protein LOC100012315  90.1    1e-18   
gb|AAT40136.1|  putative translation initiation factor                85.9    1e-18   
emb|CEP08372.1|  hypothetical protein                                 87.4    1e-18   
gb|EPY49607.1|  translation initiation factor eIF1                    87.0    2e-18   
ref|NP_005866.1|  eukaryotic translation initiation factor 1b         87.0    2e-18   
gb|KDQ60757.1|  hypothetical protein JAAARDRAFT_31728                 87.0    2e-18   
ref|XP_009068506.1|  PREDICTED: eukaryotic translation initiation...  86.7    2e-18   
ref|XP_010289256.1|  PREDICTED: eukaryotic translation initiation...  86.7    2e-18   
ref|XP_009686092.1|  PREDICTED: eukaryotic translation initiation...  87.0    2e-18   



>ref|XP_006346213.1| PREDICTED: protein translation factor SUI1 homolog [Solanum tuberosum]
Length=112

 Score =   155 bits (392),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 78/104 (75%), Positives = 82/104 (79%), Gaps = 0/104 (0%)
 Frame = -3

Query  501  PTAFDPFXEAKEXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFXC  322
            P+AFDPF EAK+ GAPG KEY H RIQQR GKKSLTTVQG+RKE S+ KILKDLKKEF C
Sbjct  9    PSAFDPFAEAKDSGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEFSYEKILKDLKKEFCC  68

Query  321  NGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            NG  VQDKE GK  Q QGDQ KN S FLV  G  KKDQIKIHGF
Sbjct  69   NGNVVQDKELGKVIQLQGDQRKNVSHFLVTAGVVKKDQIKIHGF  112



>ref|XP_004244116.1| PREDICTED: protein translation factor SUI1 homolog [Solanum lycopersicum]
Length=112

 Score =   155 bits (391),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 78/104 (75%), Positives = 82/104 (79%), Gaps = 0/104 (0%)
 Frame = -3

Query  501  PTAFDPFXEAKEXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFXC  322
            P+AFDPF EAK+ GAPG KEY H RIQQR GKKSLTTVQG+RKE S+ KILKDLKKEF C
Sbjct  9    PSAFDPFAEAKDSGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEFSYEKILKDLKKEFCC  68

Query  321  NGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            NG  VQDKE GK  Q QGDQ KN S FLV  G  KKDQIKIHGF
Sbjct  69   NGNVVQDKELGKVIQLQGDQRKNVSHFLVTAGVVKKDQIKIHGF  112



>ref|XP_011097879.1| PREDICTED: protein translation factor SUI1 homolog [Sesamum indicum]
Length=112

 Score =   155 bits (391),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 82/104 (79%), Gaps = 0/104 (0%)
 Frame = -3

Query  501  PTAFDPFXEAKEXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFXC  322
            P+AFDPF EAK+ GAPG KEY H RIQQR GKKSLTTVQG+RKE S+ KILKDLKKEF C
Sbjct  9    PSAFDPFAEAKDSGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEFSYEKILKDLKKEFCC  68

Query  321  NGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            NG  VQDKE GK  Q QGDQ KN S FL+  G  KKDQIKIHGF
Sbjct  69   NGTVVQDKELGKVIQLQGDQRKNVSQFLISAGIVKKDQIKIHGF  112



>ref|XP_011095399.1| PREDICTED: protein translation factor SUI1 homolog [Sesamum indicum]
 ref|XP_011095400.1| PREDICTED: protein translation factor SUI1 homolog [Sesamum indicum]
Length=112

 Score =   154 bits (390),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 82/104 (79%), Gaps = 0/104 (0%)
 Frame = -3

Query  501  PTAFDPFXEAKEXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFXC  322
            PTAFDPF EAK+ GAPG KEY H RIQQR GKKSLTTVQG+RKE S+ KILKD+KKEF C
Sbjct  9    PTAFDPFAEAKDSGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEFSYEKILKDVKKEFCC  68

Query  321  NGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            NG  VQDKE GK  Q QGDQ KN S FL+  G  KKDQIKIHGF
Sbjct  69   NGNVVQDKELGKVIQLQGDQRKNVSQFLISAGIVKKDQIKIHGF  112



>ref|XP_009628718.1| PREDICTED: protein translation factor SUI1 homolog [Nicotiana 
tomentosiformis]
 ref|XP_009778004.1| PREDICTED: protein translation factor SUI1 homolog [Nicotiana 
sylvestris]
Length=112

 Score =   154 bits (388),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 82/104 (79%), Gaps = 0/104 (0%)
 Frame = -3

Query  501  PTAFDPFXEAKEXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFXC  322
            P+AFDPF EAK+ GAPG KEY H RIQQR GKKSLTTVQG+RK+ S+ KILKDLKKEF C
Sbjct  9    PSAFDPFAEAKDSGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKQFSYEKILKDLKKEFCC  68

Query  321  NGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            NG  VQDKE GK  Q QGDQ KN S FLV  G  KKDQIKIHGF
Sbjct  69   NGNVVQDKELGKVIQLQGDQRKNVSHFLVTAGVVKKDQIKIHGF  112



>ref|XP_002280065.1| PREDICTED: protein translation factor SUI1 homolog [Vitis vinifera]
 emb|CBI26638.3| unnamed protein product [Vitis vinifera]
Length=112

 Score =   151 bits (381),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/104 (72%), Positives = 82/104 (79%), Gaps = 0/104 (0%)
 Frame = -3

Query  501  PTAFDPFXEAKEXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFXC  322
            P+AFDPF EAK+ GAPG KEY H RIQQR GKKSLTTVQG++K+ S+ KILKDLKKEF C
Sbjct  9    PSAFDPFAEAKDSGAPGAKEYVHIRIQQRNGKKSLTTVQGLKKDYSYEKILKDLKKEFCC  68

Query  321  NGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            NG  VQDKE GK  Q QGDQ KN S FLV  G  KK+QIKIHGF
Sbjct  69   NGNVVQDKELGKVIQLQGDQRKNVSNFLVQAGLVKKEQIKIHGF  112



>ref|XP_004500068.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Cicer 
arietinum]
Length=112

 Score =   150 bits (379),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 76/104 (73%), Positives = 80/104 (77%), Gaps = 0/104 (0%)
 Frame = -3

Query  501  PTAFDPFXEAKEXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFXC  322
            PT FDPF EAKE  APG KEY H RIQQR GKKSLTTVQG++KE S+ KILKDLKKEF C
Sbjct  9    PTPFDPFAEAKESDAPGAKEYVHIRIQQRNGKKSLTTVQGLKKEFSYEKILKDLKKEFCC  68

Query  321  NGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            NG  VQDKE GK  Q QGDQ KN S FLV  G  +KDQIKIHGF
Sbjct  69   NGNVVQDKELGKIIQLQGDQRKNVSQFLVQVGLVRKDQIKIHGF  112



>ref|XP_006602202.1| PREDICTED: protein translation factor SUI1 homolog 2-like isoform 
X1 [Glycine max]
 ref|XP_006602203.1| PREDICTED: protein translation factor SUI1 homolog 2-like isoform 
X2 [Glycine max]
Length=112

 Score =   149 bits (377),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 75/104 (72%), Positives = 80/104 (77%), Gaps = 0/104 (0%)
 Frame = -3

Query  501  PTAFDPFXEAKEXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFXC  322
            PT FDPF EA+E  APG KEY H RIQQR GKKSLTTVQG++KE S+ KILKDLKKEF C
Sbjct  9    PTPFDPFAEARESDAPGAKEYVHIRIQQRNGKKSLTTVQGLKKEFSYEKILKDLKKEFCC  68

Query  321  NGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            NG  VQDKE GK  Q QGDQ KN S FLV  G  +KDQIKIHGF
Sbjct  69   NGTVVQDKELGKIIQLQGDQRKNVSHFLVQAGLVRKDQIKIHGF  112



>gb|ADK79108.1| putative eukaryotic translation initiation factor SUI1 [Catharanthus 
roseus]
Length=112

 Score =   149 bits (377),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 80/104 (77%), Gaps = 0/104 (0%)
 Frame = -3

Query  501  PTAFDPFXEAKEXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFXC  322
            PTAFDPF EAK+ GAPG KEY H R+QQR GKK LTT+QG++KE S  KILKDLKK+F C
Sbjct  9    PTAFDPFAEAKDSGAPGAKEYVHIRVQQRNGKKCLTTIQGLKKEFSLEKILKDLKKDFCC  68

Query  321  NGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            NG  VQDKE GK  Q QGDQ KN S FL+  G  KKDQIKIHGF
Sbjct  69   NGNVVQDKELGKVIQLQGDQRKNVSQFLITAGIVKKDQIKIHGF  112



>ref|XP_010060345.1| PREDICTED: protein translation factor SUI1 homolog 1-like [Eucalyptus 
grandis]
 ref|XP_010060381.1| PREDICTED: protein translation factor SUI1 homolog 1-like [Eucalyptus 
grandis]
 gb|KCW67040.1| hypothetical protein EUGRSUZ_F00808 [Eucalyptus grandis]
 gb|KCW67041.1| hypothetical protein EUGRSUZ_F00808 [Eucalyptus grandis]
 gb|KCW67042.1| hypothetical protein EUGRSUZ_F00808 [Eucalyptus grandis]
Length=112

 Score =   149 bits (375),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/104 (72%), Positives = 80/104 (77%), Gaps = 0/104 (0%)
 Frame = -3

Query  501  PTAFDPFXEAKEXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFXC  322
            PTAFDPF E K+ GAPG KEY H RIQQR GKKSLTTVQG++K+ S+ KILKDLKKEF C
Sbjct  9    PTAFDPFAEGKDSGAPGAKEYVHIRIQQRNGKKSLTTVQGLKKDYSYEKILKDLKKEFCC  68

Query  321  NGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            NG  VQDKE GK  Q QGDQ KN S FLV     KKDQIKIHGF
Sbjct  69   NGNVVQDKELGKIIQLQGDQRKNVSQFLVHNNIVKKDQIKIHGF  112



>gb|AFY13590.1| translation factor SUI1 [Aeschynomene evenia]
 gb|AFY13591.1| translation factor SUI1 [Aeschynomene evenia]
 gb|AFY13592.1| translation factor SUI1 [Aeschynomene evenia]
 gb|AFY13593.1| translation factor SUI1 [Aeschynomene evenia]
 gb|AFY13594.1| translation factor SUI1 [Aeschynomene evenia]
 gb|AFY13595.1| translation factor SUI1 [Aeschynomene evenia]
 gb|AFY13596.1| translation factor SUI1 [Aeschynomene denticulata]
 gb|AGC95066.1| translation factor SUI1 [Aeschynomene evenia]
 gb|AGC95067.1| translation factor SUI1 [Aeschynomene evenia]
 gb|AGC95068.1| translation factor SUI1 [Aeschynomene ciliata]
 gb|AGS78101.1| translation factor SUI1 [Aeschynomene indica]
 gb|AGS78102.1| translation factor SUI1 [Aeschynomene indica]
 gb|AGS78103.1| translation factor SUI1 [Aeschynomene indica]
 gb|AGS78104.1| translation factor SUI1 [Aeschynomene indica]
 gb|AGS78106.1| translation factor SUI1 [Aeschynomene scabra]
 gb|AGS78107.1| translation factor SUI1 [Aeschynomene rudis]
 gb|AGS78108.1| translation factor SUI1 [Aeschynomene sensitiva]
 gb|AGS78109.1| translation factor SUI1 [Aeschynomene sp. CPI104040]
 gb|AGS78111.1| translation factor SUI1 [Aeschynomene tambacoundensis]
 gb|AGS78112.1| translation factor SUI1 [Aeschynomene deamii]
 gb|AGS78114.1| translation factor SUI1 [Aeschynomene pratensis]
 gb|AGS78115.1| translation factor SUI1 [Aeschynomene virginica]
 gb|AGS78116.1| translation factor SUI1 [Aeschynomene virginica]
Length=112

 Score =   148 bits (374),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/104 (72%), Positives = 80/104 (77%), Gaps = 0/104 (0%)
 Frame = -3

Query  501  PTAFDPFXEAKEXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFXC  322
            PT FDPF EAKE  APG KEY H RIQQR GKKSLTTVQG++K+ S+ KILKDLKKEF C
Sbjct  9    PTPFDPFAEAKESDAPGAKEYVHIRIQQRNGKKSLTTVQGLKKDFSYEKILKDLKKEFCC  68

Query  321  NGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            NG  VQDKE GK  Q QGDQ KN S FLV  G  +KDQIKIHGF
Sbjct  69   NGNVVQDKELGKIIQLQGDQRKNVSHFLVQAGLVRKDQIKIHGF  112



>ref|XP_007146479.1| hypothetical protein PHAVU_006G043900g [Phaseolus vulgaris]
 gb|ESW18473.1| hypothetical protein PHAVU_006G043900g [Phaseolus vulgaris]
Length=112

 Score =   148 bits (373),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 74/104 (71%), Positives = 80/104 (77%), Gaps = 0/104 (0%)
 Frame = -3

Query  501  PTAFDPFXEAKEXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFXC  322
            PT FDPF EA+E  APG KEY H RIQQR GKKSLTTVQG++KE S+ KILKDLKK+F C
Sbjct  9    PTPFDPFAEARESDAPGAKEYVHIRIQQRNGKKSLTTVQGLKKEFSYEKILKDLKKDFCC  68

Query  321  NGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            NG  VQDKE GK  Q QGDQ KN S FLV  G  +KDQIKIHGF
Sbjct  69   NGNVVQDKELGKIIQLQGDQRKNVSHFLVQAGLVRKDQIKIHGF  112



>ref|XP_006586085.1| PREDICTED: protein translation factor SUI1 homolog 2 [Glycine 
max]
 gb|KHM99561.1| Protein translation factor SUI1 like 2 [Glycine soja]
Length=157

 Score =   149 bits (376),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 81/104 (78%), Gaps = 0/104 (0%)
 Frame = -3

Query  501  PTAFDPFXEAKEXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFXC  322
            P+AFDPF EA+E  APG KEY H RIQQR GKKSLTTVQG++KE S+ KILKDLKK+F C
Sbjct  54   PSAFDPFAEARESDAPGAKEYVHIRIQQRNGKKSLTTVQGLKKEFSYEKILKDLKKDFCC  113

Query  321  NGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            NG  VQDKE GK  Q QGDQ KN S FLV  G  +KDQ+KIHGF
Sbjct  114  NGTVVQDKELGKIIQLQGDQRKNVSHFLVQAGLVRKDQVKIHGF  157



>gb|AFY13584.1| translation factor SUI1 [Aeschynomene evenia]
 gb|AFY13585.1| translation factor SUI1 [Aeschynomene evenia]
 gb|AFY13586.1| translation factor SUI1 [Aeschynomene evenia]
 gb|AFY13587.1| translation factor SUI1 [Aeschynomene evenia]
 gb|AFY13588.1| translation factor SUI1 [Aeschynomene evenia]
 gb|AFY13589.1| translation factor SUI1 [Aeschynomene evenia]
 gb|AGS78113.1| translation factor SUI1 [Aeschynomene pratensis]
Length=112

 Score =   147 bits (371),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 74/104 (71%), Positives = 80/104 (77%), Gaps = 0/104 (0%)
 Frame = -3

Query  501  PTAFDPFXEAKEXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFXC  322
            PT FDPF EAKE  APG KEY H RIQQR GKKSLTTVQG++K+ S+ KILKDLKK+F C
Sbjct  9    PTPFDPFAEAKESDAPGAKEYVHIRIQQRNGKKSLTTVQGLKKDFSYEKILKDLKKDFCC  68

Query  321  NGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            NG  VQDKE GK  Q QGDQ KN S FLV  G  +KDQIKIHGF
Sbjct  69   NGNVVQDKELGKIIQLQGDQRKNVSHFLVQAGLVRKDQIKIHGF  112



>gb|AGS78110.1| translation factor SUI1 [Aeschynomene filosa]
Length=112

 Score =   147 bits (370),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/104 (71%), Positives = 79/104 (76%), Gaps = 0/104 (0%)
 Frame = -3

Query  501  PTAFDPFXEAKEXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFXC  322
            PT FDPF EAKE  APG KEY H RIQQR GKKSLTTVQG++K+ S+ KILKDLKKEF C
Sbjct  9    PTPFDPFAEAKESDAPGAKEYVHIRIQQRNGKKSLTTVQGLKKDFSYEKILKDLKKEFCC  68

Query  321  NGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            NG  V DKE GK  Q QGDQ KN S FLV  G  +KDQIKIHGF
Sbjct  69   NGNVVHDKELGKIIQLQGDQRKNVSHFLVQAGLVRKDQIKIHGF  112



>gb|KCW66994.1| hypothetical protein EUGRSUZ_F00759 [Eucalyptus grandis]
Length=260

 Score =   151 bits (381),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/104 (72%), Positives = 80/104 (77%), Gaps = 0/104 (0%)
 Frame = -3

Query  501  PTAFDPFXEAKEXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFXC  322
            PTAFDPF E K+ GAPG KEY H RIQQR GKKSLTTVQG++K+ S+ KILKDLKKEF C
Sbjct  157  PTAFDPFAEGKDSGAPGAKEYVHIRIQQRNGKKSLTTVQGLKKDYSYEKILKDLKKEFCC  216

Query  321  NGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            NG  VQDKE GK  Q QGDQ KN S FLV     KKDQIKIHGF
Sbjct  217  NGNVVQDKELGKIIQLQGDQRKNVSQFLVHNNIVKKDQIKIHGF  260



>gb|KCW66993.1| hypothetical protein EUGRSUZ_F00759 [Eucalyptus grandis]
Length=261

 Score =   151 bits (381),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 75/104 (72%), Positives = 80/104 (77%), Gaps = 0/104 (0%)
 Frame = -3

Query  501  PTAFDPFXEAKEXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFXC  322
            PTAFDPF E K+ GAPG KEY H RIQQR GKKSLTTVQG++K+ S+ KILKDLKKEF C
Sbjct  158  PTAFDPFAEGKDSGAPGAKEYVHIRIQQRNGKKSLTTVQGLKKDYSYEKILKDLKKEFCC  217

Query  321  NGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            NG  VQDKE GK  Q QGDQ KN S FLV     KKDQIKIHGF
Sbjct  218  NGNVVQDKELGKIIQLQGDQRKNVSQFLVHNNIVKKDQIKIHGF  261



>ref|XP_010545223.1| PREDICTED: protein translation factor SUI1 homolog [Tarenaya 
hassleriana]
Length=112

 Score =   146 bits (368),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 79/104 (76%), Gaps = 0/104 (0%)
 Frame = -3

Query  501  PTAFDPFXEAKEXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFXC  322
            PTAFDPF EA++  APG KEY H RIQQR GKKSLTTVQG++KE S+ +ILKDLKKEF C
Sbjct  9    PTAFDPFAEARDSDAPGAKEYIHIRIQQRNGKKSLTTVQGLKKEYSYERILKDLKKEFCC  68

Query  321  NGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            NG  V DKE GK  Q QGDQ KN S F V  G  KKDQIKIHGF
Sbjct  69   NGNVVHDKEQGKIIQLQGDQRKNVSQFFVQKGICKKDQIKIHGF  112



>ref|XP_004152930.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Cucumis 
sativus]
 ref|XP_004168731.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Cucumis 
sativus]
 ref|XP_008463414.1| PREDICTED: protein translation factor SUI1 homolog 2 [Cucumis 
melo]
 gb|KGN56126.1| hypothetical protein Csa_3G077610 [Cucumis sativus]
Length=112

 Score =   145 bits (367),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 80/104 (77%), Gaps = 0/104 (0%)
 Frame = -3

Query  501  PTAFDPFXEAKEXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFXC  322
            P+AFDPF +AK+  APG KEY H R+QQR GKK LTTVQG++KE S+ KILKDLKK+F C
Sbjct  9    PSAFDPFADAKDSDAPGTKEYVHIRVQQRNGKKCLTTVQGLKKEFSYDKILKDLKKDFCC  68

Query  321  NGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            NG  VQDKE GK  Q QGDQ KN S FLV  G  KKDQIKIHGF
Sbjct  69   NGNVVQDKELGKIIQLQGDQRKNVSQFLVQAGLVKKDQIKIHGF  112



>ref|XP_004139787.1| PREDICTED: protein translation factor SUI1 homolog 1-like [Cucumis 
sativus]
 ref|XP_008447738.1| PREDICTED: protein translation factor SUI1 homolog 1-like [Cucumis 
melo]
 gb|KGN44162.1| hypothetical protein Csa_7G209580 [Cucumis sativus]
Length=112

 Score =   145 bits (366),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 80/104 (77%), Gaps = 0/104 (0%)
 Frame = -3

Query  501  PTAFDPFXEAKEXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFXC  322
            P+AFDPF +AK+  APG KEY H R+QQR GKK LTTVQG++KE S+ KILKD+KKEF C
Sbjct  9    PSAFDPFADAKDSDAPGTKEYVHIRVQQRNGKKCLTTVQGLKKEFSYEKILKDVKKEFCC  68

Query  321  NGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            NG  VQDKE GK  Q QGDQ KN S FLV  G  KKDQIKIHGF
Sbjct  69   NGNVVQDKELGKIIQLQGDQRKNVSQFLVQAGLVKKDQIKIHGF  112



>gb|AFK38938.1| unknown [Lotus japonicus]
Length=112

 Score =   145 bits (366),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 74/104 (71%), Positives = 78/104 (75%), Gaps = 0/104 (0%)
 Frame = -3

Query  501  PTAFDPFXEAKEXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFXC  322
            P  FDPF EAKE  APG KEY H RIQQR GKKSLTTVQG++KE S+ KILKDLKKEF C
Sbjct  9    PNRFDPFAEAKESDAPGVKEYVHVRIQQRNGKKSLTTVQGLKKEFSYEKILKDLKKEFCC  68

Query  321  NGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            NG  V DKE GK  Q QGDQ KN S FLV  G  KKD+IKIHGF
Sbjct  69   NGNVVHDKELGKIIQLQGDQRKNVSHFLVQAGLVKKDRIKIHGF  112



>gb|AGS78105.1| translation factor SUI1 [Aeschynomene indica]
Length=112

 Score =   144 bits (364),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 79/104 (76%), Gaps = 0/104 (0%)
 Frame = -3

Query  501  PTAFDPFXEAKEXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFXC  322
            P+ FDPF EAKE  APG KEY H R+QQR GKKSLTTVQG++K  S+ KILKDLKKEF C
Sbjct  9    PSPFDPFAEAKESDAPGAKEYVHIRVQQRNGKKSLTTVQGLKKGFSYEKILKDLKKEFCC  68

Query  321  NGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            NG  VQDKE GK  Q QGDQ KN S FLV  G  +KDQIKIHGF
Sbjct  69   NGNVVQDKELGKIIQLQGDQRKNVSHFLVQAGLVRKDQIKIHGF  112



>ref|XP_003600096.1| Translation factor SUI1-like protein [Medicago truncatula]
 gb|AES70347.1| eukaryotic translation initiation factor SUI1 [Medicago truncatula]
 gb|AFK42757.1| unknown [Medicago truncatula]
Length=112

 Score =   144 bits (364),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 79/104 (76%), Gaps = 0/104 (0%)
 Frame = -3

Query  501  PTAFDPFXEAKEXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFXC  322
            PTAFDPF +A E  APG KEY H RIQQR GKKSLTTVQG++K+ S+ KILKDLKKEF C
Sbjct  9    PTAFDPFADAIESDAPGGKEYVHIRIQQRNGKKSLTTVQGLKKDYSYEKILKDLKKEFCC  68

Query  321  NGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            NG  VQDKE GK  Q QGDQ K  S FLV  G  +KDQIKIHGF
Sbjct  69   NGNVVQDKELGKIIQLQGDQRKKVSQFLVQAGLVRKDQIKIHGF  112



>emb|CDP05760.1| unnamed protein product [Coffea canephora]
Length=112

 Score =   144 bits (363),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 77/104 (74%), Gaps = 0/104 (0%)
 Frame = -3

Query  501  PTAFDPFXEAKEXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFXC  322
            P AFDPF E  + GAPG KEY H R+QQR GKK LTT+QG++K+ S  KILKDLKKEF C
Sbjct  9    PAAFDPFTEDNDSGAPGAKEYVHIRVQQRNGKKCLTTIQGLKKDFSLEKILKDLKKEFCC  68

Query  321  NGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            NG  VQDKE GK  Q QGDQ KN S FLV  G  KKDQIKIHGF
Sbjct  69   NGNVVQDKELGKVIQLQGDQRKNASQFLVTAGIVKKDQIKIHGF  112



>gb|ABY75807.1| SUI1 B protein [Opuntia streptacantha]
Length=112

 Score =   143 bits (361),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 78/104 (75%), Gaps = 0/104 (0%)
 Frame = -3

Query  501  PTAFDPFXEAKEXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFXC  322
            P AFDPF  AK+ GAPG KEY   RIQQR GKKSLTTVQG+RK+ S+ +ILKDLKKEF C
Sbjct  9    PAAFDPFSGAKDSGAPGAKEYVRIRIQQRNGKKSLTTVQGLRKDFSYERILKDLKKEFCC  68

Query  321  NGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            NG  VQDKE GK  Q QGDQ KN + FLV  G  KKD IKIHGF
Sbjct  69   NGNVVQDKELGKIIQLQGDQRKNVANFLVQAGLVKKDHIKIHGF  112



>ref|XP_008359266.1| PREDICTED: protein translation factor SUI1 homolog [Malus domestica]
Length=112

 Score =   143 bits (361),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 79/104 (76%), Gaps = 0/104 (0%)
 Frame = -3

Query  501  PTAFDPFXEAKEXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFXC  322
            PTAFDPF EAK+  APG KEY H R+QQR GKK LTTVQG++K+ S+XKILKDLKKEF C
Sbjct  9    PTAFDPFSEAKDADAPGAKEYVHIRVQQRNGKKCLTTVQGLKKDFSYXKILKDLKKEFCC  68

Query  321  NGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            NG  VQDKE GK  Q QGDQ KN   FLV     KKDQIKIHGF
Sbjct  69   NGNVVQDKELGKIIQLQGDQRKNVLQFLVQAKIVKKDQIKIHGF  112



>ref|XP_004491401.1| PREDICTED: protein translation factor SUI1 homolog [Cicer arietinum]
Length=110

 Score =   143 bits (361),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 77/104 (74%), Gaps = 0/104 (0%)
 Frame = -3

Query  501  PTAFDPFXEAKEXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFXC  322
            PT FDPF EAKE  APG KEY H RIQQR GKKSLTTVQG++KE S+ KILKDLKKEF C
Sbjct  7    PTTFDPFSEAKESDAPGAKEYVHIRIQQRNGKKSLTTVQGLKKEFSYEKILKDLKKEFCC  66

Query  321  NGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            NG  V  KE GK  Q QGDQ KN + FLV  G  +KD IKIHGF
Sbjct  67   NGNVVNCKELGKIIQLQGDQRKNVTHFLVHAGLVRKDNIKIHGF  110



>gb|EYU33643.1| hypothetical protein MIMGU_mgv1a016664mg [Erythranthe guttata]
Length=112

 Score =   143 bits (361),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 81/104 (78%), Gaps = 0/104 (0%)
 Frame = -3

Query  501  PTAFDPFXEAKEXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFXC  322
            P+AFDPF +A++ GA G KEY H RIQQR GKKSLTTVQG++KE ++ KILK+LKKEF C
Sbjct  9    PSAFDPFADAEDLGAIGAKEYVHIRIQQRNGKKSLTTVQGLKKEFNYEKILKNLKKEFCC  68

Query  321  NGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            NG  VQDKE GK  Q QGDQ KN S FL+  G  KKDQIKIHGF
Sbjct  69   NGNVVQDKELGKVVQLQGDQRKNVSQFLIGAGIVKKDQIKIHGF  112



>emb|CDY43020.1| BnaA03g11670D [Brassica napus]
Length=112

 Score =   143 bits (360),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 79/104 (76%), Gaps = 0/104 (0%)
 Frame = -3

Query  501  PTAFDPFXEAKEXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFXC  322
            P+AFDPF EA+E  APG KEY H RIQQR GKKSLTTVQG++K  S+ KILKDLKK+F C
Sbjct  9    PSAFDPFAEAQESDAPGTKEYIHVRIQQRNGKKSLTTVQGLKKAYSYEKILKDLKKDFCC  68

Query  321  NGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            NG  VQDKE GK  Q QGDQ K  S FLV  G  KK+QIKIHGF
Sbjct  69   NGNVVQDKELGKIIQLQGDQRKKVSHFLVQTGIAKKEQIKIHGF  112



>ref|XP_009132417.1| PREDICTED: protein translation factor SUI1 homolog [Brassica 
rapa]
Length=112

 Score =   143 bits (360),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 78/104 (75%), Gaps = 0/104 (0%)
 Frame = -3

Query  501  PTAFDPFXEAKEXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFXC  322
            P+AFDPF EA+E  APG KEY H RIQQR GKKSLTTVQG++K  S+ KILKDLKK+F C
Sbjct  9    PSAFDPFAEAQESDAPGTKEYIHVRIQQRNGKKSLTTVQGLKKAYSYEKILKDLKKDFCC  68

Query  321  NGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            NG  VQDKE GK  Q QGDQ K  S F V  G  KKDQIKIHGF
Sbjct  69   NGNVVQDKELGKIIQLQGDQRKKVSHFFVQTGIAKKDQIKIHGF  112



>ref|XP_009360995.1| PREDICTED: protein translation factor SUI1 homolog [Pyrus x bretschneideri]
Length=112

 Score =   143 bits (360),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 78/104 (75%), Gaps = 0/104 (0%)
 Frame = -3

Query  501  PTAFDPFXEAKEXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFXC  322
            PTAFDPF EAK+  APG KEY H R+QQR GKK LTTVQG++K+ S+ KILKDLKKEF C
Sbjct  9    PTAFDPFAEAKDVDAPGAKEYVHIRVQQRNGKKCLTTVQGLKKDFSYDKILKDLKKEFCC  68

Query  321  NGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            NG  VQDKE GK  Q QGDQ KN   FLV     KKDQIKIHGF
Sbjct  69   NGNVVQDKELGKIIQLQGDQRKNVLQFLVQAKIVKKDQIKIHGF  112



>gb|EPS65465.1| hypothetical protein M569_09317 [Genlisea aurea]
Length=113

 Score =   143 bits (360),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 74/104 (71%), Positives = 79/104 (76%), Gaps = 1/104 (1%)
 Frame = -3

Query  498  TAFDPFXEAKEXG-APGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFXC  322
            +AFDPF EAKE   APG KEY H RIQQR GKKSLTTVQG+RKE S+ KILKDLKK+F C
Sbjct  10   SAFDPFAEAKEDSDAPGAKEYIHIRIQQRNGKKSLTTVQGLRKEFSYEKILKDLKKDFCC  69

Query  321  NGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            NG  V DKE GK  Q QGDQ KN S FL+  G  KKDQIKIHGF
Sbjct  70   NGNVVHDKELGKVIQLQGDQRKNVSQFLINAGLVKKDQIKIHGF  113



>emb|CDY52575.1| BnaC03g71830D, partial [Brassica napus]
Length=158

 Score =   144 bits (363),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 79/104 (76%), Gaps = 0/104 (0%)
 Frame = -3

Query  501  PTAFDPFXEAKEXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFXC  322
            P+AFDPF EA+E  APG KEY H RIQQR GKKSLTTVQG++K  S+ KILKDLKK+F C
Sbjct  55   PSAFDPFAEAQESDAPGTKEYIHVRIQQRNGKKSLTTVQGLKKAYSYEKILKDLKKDFCC  114

Query  321  NGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            NG  VQDKE GK  Q QGDQ K  S FLV  G  KK+QIKIHGF
Sbjct  115  NGNVVQDKELGKIIQLQGDQRKKVSHFLVQTGIAKKEQIKIHGF  158



>ref|XP_002866067.1| hypothetical protein ARALYDRAFT_918633 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42326.1| hypothetical protein ARALYDRAFT_918633 [Arabidopsis lyrata subsp. 
lyrata]
Length=112

 Score =   142 bits (359),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 79/104 (76%), Gaps = 0/104 (0%)
 Frame = -3

Query  501  PTAFDPFXEAKEXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFXC  322
            P+AFDPF EAK+  APG KE  H RIQQR GKKSLTTVQG++KE S+ +ILKDLKK+F C
Sbjct  9    PSAFDPFAEAKDSDAPGAKENIHIRIQQRNGKKSLTTVQGLKKEYSYERILKDLKKDFCC  68

Query  321  NGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            NG  VQDKE GK  Q QGDQ K  S FLV  G  KKDQIKIHGF
Sbjct  69   NGNVVQDKELGKIIQLQGDQRKKVSQFLVQTGIAKKDQIKIHGF  112



>ref|XP_010448878.1| PREDICTED: protein translation factor SUI1 homolog [Camelina 
sativa]
 ref|XP_010443083.1| PREDICTED: protein translation factor SUI1 homolog [Camelina 
sativa]
Length=112

 Score =   142 bits (358),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 79/104 (76%), Gaps = 0/104 (0%)
 Frame = -3

Query  501  PTAFDPFXEAKEXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFXC  322
            P+A+DPF EAK+  APG K+Y H RIQQR GKKSLTTVQG++KE S+ +ILKDLKK+F C
Sbjct  9    PSAYDPFAEAKDSDAPGAKDYIHIRIQQRNGKKSLTTVQGLKKEYSYERILKDLKKDFCC  68

Query  321  NGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            NG  VQDKE GK  Q QGDQ K  S FLV  G  KKD IKIHGF
Sbjct  69   NGNVVQDKELGKIIQLQGDQRKKVSQFLVQTGIAKKDHIKIHGF  112



>ref|XP_006401506.1| hypothetical protein EUTSA_v10015063mg [Eutrema salsugineum]
 dbj|BAJ34327.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ42959.1| hypothetical protein EUTSA_v10015063mg [Eutrema salsugineum]
Length=112

 Score =   142 bits (358),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 79/104 (76%), Gaps = 0/104 (0%)
 Frame = -3

Query  501  PTAFDPFXEAKEXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFXC  322
            P+AFDPF EA++  APG KEY H RIQQR GKKSLTTVQG++K+ S+ +ILKDLKK+F C
Sbjct  9    PSAFDPFAEAQDTDAPGTKEYVHIRIQQRNGKKSLTTVQGLKKDYSYERILKDLKKDFCC  68

Query  321  NGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            NG  VQDKE GK  Q QGDQ K  S FLV  G   KDQIKIHGF
Sbjct  69   NGNVVQDKELGKIIQLQGDQRKKVSQFLVQTGIANKDQIKIHGF  112



>gb|ACJ85979.1| unknown [Medicago truncatula]
Length=112

 Score =   142 bits (358),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 78/104 (75%), Gaps = 0/104 (0%)
 Frame = -3

Query  501  PTAFDPFXEAKEXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFXC  322
            PTAFDPF +A E  APG KEY H RIQQR GKK LTTVQG++K+ S+ KILKDLKKEF C
Sbjct  9    PTAFDPFADAIESDAPGGKEYVHIRIQQRNGKKGLTTVQGLKKDYSYEKILKDLKKEFCC  68

Query  321  NGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            NG  VQDKE GK  Q QGDQ K  S FLV  G  +KDQIKIHGF
Sbjct  69   NGNVVQDKELGKIIQLQGDQRKKVSQFLVQAGLVRKDQIKIHGF  112



>ref|XP_007142286.1| hypothetical protein PHAVU_008G267800g [Phaseolus vulgaris]
 gb|ESW14280.1| hypothetical protein PHAVU_008G267800g [Phaseolus vulgaris]
Length=114

 Score =   142 bits (358),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 71/103 (69%), Positives = 77/103 (75%), Gaps = 0/103 (0%)
 Frame = -3

Query  498  TAFDPFXEAKEXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFXCN  319
             +FDPF EA +  APG KEY H RIQQR GKKSLTTVQG+RKE S+ KILKDLKKEF CN
Sbjct  12   NSFDPFAEATDRDAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEFSYEKILKDLKKEFCCN  71

Query  318  GXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            G  V DKE GK  Q QGDQ KN S FL+  G  +KDQIKIHGF
Sbjct  72   GNVVHDKELGKIIQLQGDQRKNVSHFLIQAGLVRKDQIKIHGF  114



>gb|ACV50429.1| eukaryotic translation initiation factor SUI1 [Jatropha curcas]
Length=120

 Score =   142 bits (358),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 77/104 (74%), Gaps = 0/104 (0%)
 Frame = -3

Query  501  PTAFDPFXEAKEXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFXC  322
            P AFDPF EAK+ GAPG KEY H RIQQR G+KSLTTVQG+ KE S+ KI+K LKKEF C
Sbjct  9    PAAFDPFSEAKDSGAPGAKEYVHIRIQQRNGRKSLTTVQGLPKEFSYEKIVKALKKEFCC  68

Query  321  NGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            NG  VQDKE GK  Q QGDQ KN   FLV     +KDQIKIHGF
Sbjct  69   NGNVVQDKELGKVIQLQGDQLKNVQSFLVNAQLVRKDQIKIHGF  112



>ref|XP_009120023.1| PREDICTED: protein translation factor SUI1 homolog [Brassica 
rapa]
Length=112

 Score =   142 bits (357),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 78/104 (75%), Gaps = 0/104 (0%)
 Frame = -3

Query  501  PTAFDPFXEAKEXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFXC  322
            P A+DPF EA++  APG KEY H RIQQR GKKSLTTVQG++KE S+ KILKDLKK+F C
Sbjct  9    PLAYDPFAEAQDTDAPGTKEYIHVRIQQRNGKKSLTTVQGLKKEYSYEKILKDLKKDFCC  68

Query  321  NGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            NG  VQDK  GK  Q QGDQ K  S FLV  G  KKDQIKIHGF
Sbjct  69   NGNVVQDKVLGKIIQLQGDQRKKVSHFLVQTGIAKKDQIKIHGF  112



>ref|NP_568818.1| translation initiation factor SUI1 family protein [Arabidopsis 
thaliana]
 ref|NP_851192.1| translation initiation factor SUI1 family protein [Arabidopsis 
thaliana]
 gb|AAK60326.1|AF385736_1 AT5g54940/MBG8_21 [Arabidopsis thaliana]
 dbj|BAB08773.1| translation initiation factor-like protein [Arabidopsis thaliana]
 gb|AAM64690.1| translation initiation factor-like protein [Arabidopsis thaliana]
 gb|AAM91507.1| AT5g54940/MBG8_21 [Arabidopsis thaliana]
 gb|AED96560.1| translation initiation factor SUI1 family protein [Arabidopsis 
thaliana]
 gb|AED96561.1| translation initiation factor SUI1 family protein [Arabidopsis 
thaliana]
Length=112

 Score =   142 bits (357),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 79/104 (76%), Gaps = 0/104 (0%)
 Frame = -3

Query  501  PTAFDPFXEAKEXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFXC  322
            P+A+DPF EAK+  APG KE  H RIQQR GKKSLTTVQG++KE S+ +ILKDLKK+F C
Sbjct  9    PSAYDPFAEAKDSDAPGAKENIHIRIQQRNGKKSLTTVQGLKKEYSYERILKDLKKDFCC  68

Query  321  NGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            NG  VQDKE GK  Q QGDQ K  S FLV  G  KKDQIKIHGF
Sbjct  69   NGNVVQDKELGKIIQLQGDQRKKVSQFLVQTGIAKKDQIKIHGF  112



>gb|KHN11920.1| Protein translation factor SUI1-like protein [Glycine soja]
Length=114

 Score =   142 bits (357),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 79/105 (75%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTA-FDPFXEAKEXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PT+ FDPF EAKE  APG KEY H RIQQR GKKSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  10   PTSTFDPFAEAKETDAPGAKEYVHIRIQQRNGKKSLTTVQGLKKEFSYEKILKDLKKEFC  69

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  V DKE GK  Q QGDQ KN S FL+     +KDQIKIHGF
Sbjct  70   CNGNVVHDKELGKIIQLQGDQRKNVSHFLIHARLVRKDQIKIHGF  114



>gb|ADB85107.1| translation initiation factor-like protein [Jatropha curcas]
 gb|KDP39133.1| hypothetical protein JCGZ_00890 [Jatropha curcas]
Length=112

 Score =   141 bits (356),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 77/104 (74%), Gaps = 0/104 (0%)
 Frame = -3

Query  501  PTAFDPFXEAKEXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFXC  322
            P AFDPF EAK+ GAPG KEY H RIQQR G+KSLTTVQG+ KE S+ KI+K LKKEF C
Sbjct  9    PAAFDPFSEAKDSGAPGAKEYVHIRIQQRNGRKSLTTVQGLPKEFSYEKIVKALKKEFCC  68

Query  321  NGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            NG  VQDKE GK  Q QGDQ KN   FLV     +KDQIKIHGF
Sbjct  69   NGNVVQDKELGKVIQLQGDQRKNVQSFLVNAQLVRKDQIKIHGF  112



>ref|XP_010675717.1| PREDICTED: protein translation factor SUI1 homolog [Beta vulgaris 
subsp. vulgaris]
Length=111

 Score =   141 bits (356),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 78/104 (75%), Gaps = 1/104 (1%)
 Frame = -3

Query  501  PTAFDPFXEAKEXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFXC  322
            P A DPF EA E GAPG KEY H RIQQR GKKSLTTVQG++K+ S+ KILKDLKKEF C
Sbjct  9    PAALDPFAEA-ESGAPGVKEYVHIRIQQRNGKKSLTTVQGLKKDYSYEKILKDLKKEFCC  67

Query  321  NGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            NG  VQDKE GK  Q QGDQ K  + FLV  G  KKDQIKIHGF
Sbjct  68   NGNVVQDKELGKVIQLQGDQRKKVANFLVQAGLVKKDQIKIHGF  111



>ref|XP_004171416.1| PREDICTED: protein translation factor SUI1 homolog 1-like, partial 
[Cucumis sativus]
Length=110

 Score =   141 bits (356),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 70/102 (69%), Positives = 78/102 (76%), Gaps = 0/102 (0%)
 Frame = -3

Query  501  PTAFDPFXEAKEXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFXC  322
            P+AFDPF +AK+  APG KEY H R+QQR GKK LTTVQG++KE S+ KILKD+KKEF C
Sbjct  9    PSAFDPFADAKDSDAPGTKEYVHIRVQQRNGKKCLTTVQGLKKEFSYEKILKDVKKEFCC  68

Query  321  NGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIH  196
            NG  VQDKE GK  Q QGDQ KN S FLV  G  KKDQIKIH
Sbjct  69   NGNVVQDKELGKIIQLQGDQRKNVSQFLVQAGLVKKDQIKIH  110



>ref|XP_008349901.1| PREDICTED: protein translation factor SUI1 homolog [Malus domestica]
 ref|XP_008349902.1| PREDICTED: protein translation factor SUI1 homolog [Malus domestica]
Length=112

 Score =   141 bits (355),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 78/104 (75%), Gaps = 0/104 (0%)
 Frame = -3

Query  501  PTAFDPFXEAKEXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFXC  322
            PTAFDPF EAK+  APG KEY H R+QQR GKK LTTVQG++K+ S+XKILKDLKK F C
Sbjct  9    PTAFDPFSEAKDADAPGAKEYVHIRVQQRNGKKCLTTVQGLKKDFSYXKILKDLKKVFCC  68

Query  321  NGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            NG  VQDKE GK  Q QGDQ KN   FLV     KKDQIKIHGF
Sbjct  69   NGNVVQDKELGKIIQLQGDQRKNVLQFLVQAKIVKKDQIKIHGF  112



>ref|XP_003617548.1| Translation factor SUI1-like protein [Medicago truncatula]
 gb|AET00507.1| eukaryotic translation initiation factor SUI1 [Medicago truncatula]
 gb|AFK47392.1| unknown [Medicago truncatula]
Length=110

 Score =   140 bits (354),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 77/104 (74%), Gaps = 0/104 (0%)
 Frame = -3

Query  501  PTAFDPFXEAKEXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFXC  322
            P+ FDPF EAKE  APG KEY H RIQQR GKKSLTTVQG++KE S+ KILKDLKKEF C
Sbjct  7    PSTFDPFAEAKESDAPGAKEYVHIRIQQRNGKKSLTTVQGLKKEFSYEKILKDLKKEFCC  66

Query  321  NGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            NG  V  K+ GK  Q QGDQ KN S FL+  G  +KD IKIHGF
Sbjct  67   NGNVVNCKDLGKIIQLQGDQRKNVSHFLIHAGLVRKDNIKIHGF  110



>ref|XP_007212250.1| hypothetical protein PRUPE_ppa013625mg [Prunus persica]
 ref|XP_007212251.1| hypothetical protein PRUPE_ppa013625mg [Prunus persica]
 ref|XP_008226898.1| PREDICTED: protein translation factor SUI1 homolog [Prunus mume]
 ref|XP_008226900.1| PREDICTED: protein translation factor SUI1 homolog [Prunus mume]
 gb|EMJ13449.1| hypothetical protein PRUPE_ppa013625mg [Prunus persica]
 gb|EMJ13450.1| hypothetical protein PRUPE_ppa013625mg [Prunus persica]
Length=112

 Score =   140 bits (353),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 78/104 (75%), Gaps = 0/104 (0%)
 Frame = -3

Query  501  PTAFDPFXEAKEXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFXC  322
            PTAFDPF EAK+  APG KEY H R+QQR GKK LTTVQG++K+ S+ KILKDLKKEF C
Sbjct  9    PTAFDPFAEAKDADAPGAKEYVHIRVQQRNGKKCLTTVQGLKKDFSYEKILKDLKKEFCC  68

Query  321  NGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            NG  VQDKE GK  Q QGDQ KN   FLV     KK+QIK+HGF
Sbjct  69   NGNVVQDKELGKIIQLQGDQRKNVLQFLVQAKIVKKEQIKMHGF  112



>ref|XP_010276095.1| PREDICTED: protein translation factor SUI1 homolog [Nelumbo nucifera]
Length=113

 Score =   140 bits (352),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 80/105 (76%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAKEXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFXC  322
            P+AFDPF EAK+ GAPG KEY H RIQQR GKKSLTTVQG++K  S+ KILKDLKKEF C
Sbjct  9    PSAFDPFFEAKDSGAPGAKEYVHIRIQQRNGKKSLTTVQGLKKTFSYEKILKDLKKEFCC  68

Query  321  NGXXVQDKEX-GKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            NG  V D+E  GK  Q QGDQ KN S FLV  G  KK+QIKIHGF
Sbjct  69   NGTVVPDEELGGKVIQLQGDQRKNVSNFLVKAGIVKKEQIKIHGF  113



>gb|KJB11840.1| hypothetical protein B456_002G088900 [Gossypium raimondii]
Length=112

 Score =   140 bits (352),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 76/104 (73%), Gaps = 0/104 (0%)
 Frame = -3

Query  501  PTAFDPFXEAKEXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFXC  322
            PT FDPF EA E G  G KEY H RIQQR GKKSLTTVQG+R + S+ KILK LKK+F C
Sbjct  9    PTTFDPFAEAGEFGGTGTKEYVHIRIQQRNGKKSLTTVQGLRHDLSYEKILKSLKKDFCC  68

Query  321  NGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            NG  V+DKE GK  Q QGDQ KN S FLV  G  KKDQIKIHGF
Sbjct  69   NGNVVKDKELGKIIQLQGDQRKNVSQFLVNAGIVKKDQIKIHGF  112



>ref|XP_006281351.1| hypothetical protein CARUB_v10027407mg [Capsella rubella]
 gb|EOA14249.1| hypothetical protein CARUB_v10027407mg [Capsella rubella]
Length=112

 Score =   139 bits (351),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 78/104 (75%), Gaps = 0/104 (0%)
 Frame = -3

Query  501  PTAFDPFXEAKEXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFXC  322
            P+A+DPF EA +  APG KE  H RIQQR GKKSLTTVQG++KE S+ +ILKDLKK+F C
Sbjct  9    PSAYDPFAEAIDSDAPGTKENIHIRIQQRNGKKSLTTVQGLKKEYSYERILKDLKKDFCC  68

Query  321  NGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            NG  VQDKE GK  Q QGDQ K  S FLV  G  KKDQIKIHGF
Sbjct  69   NGNVVQDKELGKIIQLQGDQRKKVSQFLVQSGLAKKDQIKIHGF  112



>ref|XP_010482910.1| PREDICTED: protein translation factor SUI1 homolog 1-like [Camelina 
sativa]
Length=112

 Score =   139 bits (349),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 79/104 (76%), Gaps = 0/104 (0%)
 Frame = -3

Query  501  PTAFDPFXEAKEXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFXC  322
            P+A+DPF EAK+  APG KE  H RIQQR GKKSLTTVQG++KE S+ +ILKDLKK+F C
Sbjct  9    PSAYDPFAEAKDSDAPGAKENIHIRIQQRNGKKSLTTVQGLKKEYSYERILKDLKKDFCC  68

Query  321  NGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            NG  VQ+KE GK  Q QGDQ K  S FLV  G  +KDQIKIHGF
Sbjct  69   NGNVVQNKELGKIIQLQGDQRKKVSQFLVQAGIAEKDQIKIHGF  112



>ref|XP_006279715.1| hypothetical protein CARUB_v10027405mg [Capsella rubella]
 gb|EOA12613.1| hypothetical protein CARUB_v10027405mg [Capsella rubella]
Length=113

 Score =   139 bits (349),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 77/105 (73%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PTAFDPF +A  E  + G KEY H R+QQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  9    PTAFDPFADANVEDSSAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSYTKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV  G  KKD IKIHGF
Sbjct  69   CNGTVVQDSELGQVIQLQGDQRKNVSTFLVQAGLVKKDNIKIHGF  113



>ref|XP_007020819.1| Translation initiation factor SUI1 family protein [Theobroma 
cacao]
 gb|EOY12344.1| Translation initiation factor SUI1 family protein [Theobroma 
cacao]
Length=112

 Score =   139 bits (349),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 77/104 (74%), Gaps = 0/104 (0%)
 Frame = -3

Query  501  PTAFDPFXEAKEXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFXC  322
            PT FDPF EA+E G  G KEY H RIQQR GKKSLTTVQG++++ S+ KILK LKK+F C
Sbjct  9    PTTFDPFAEAEEFGGTGTKEYVHIRIQQRNGKKSLTTVQGLKQDLSYEKILKCLKKDFCC  68

Query  321  NGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            NG  V DKE GK  Q QGDQ KN S FLV  G  KKDQIKIHGF
Sbjct  69   NGNVVNDKELGKIIQLQGDQRKNVSQFLVNAGIVKKDQIKIHGF  112



>ref|XP_008365050.1| PREDICTED: protein translation factor SUI1 homolog [Malus domestica]
Length=113

 Score =   139 bits (349),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 77/104 (74%), Gaps = 0/104 (0%)
 Frame = -3

Query  501  PTAFDPFXEAKEXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFXC  322
            PTAFDPF EAK+  APG KEY H R+QQR GKK LTTVQG++K+ ++ KILKDLKKEF C
Sbjct  10   PTAFDPFAEAKDADAPGAKEYVHVRVQQRNGKKCLTTVQGLKKDFNYDKILKDLKKEFCC  69

Query  321  NGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            NG  VQDKE GK  Q QGDQ K    FLV     KKDQIKIHGF
Sbjct  70   NGNVVQDKELGKIIQLQGDQRKKVLQFLVQAKIVKKDQIKIHGF  113



>gb|KHN38274.1| Protein translation factor SUI1 like [Glycine soja]
Length=114

 Score =   139 bits (349),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/103 (67%), Positives = 76/103 (74%), Gaps = 0/103 (0%)
 Frame = -3

Query  498  TAFDPFXEAKEXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFXCN  319
            ++ DPF EAKE  APG KEY H RIQQR GKKSLTTVQG++KE S+ KILKDLKKE  CN
Sbjct  12   SSLDPFAEAKETDAPGAKEYVHIRIQQRNGKKSLTTVQGLKKEFSYEKILKDLKKELCCN  71

Query  318  GXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            G  V DKE GK  Q QGDQ KN S FL+     +KDQIKIHGF
Sbjct  72   GNVVHDKELGKIIQLQGDQRKNVSHFLIHARLARKDQIKIHGF  114



>emb|CDY17292.1| BnaA10g09260D [Brassica napus]
Length=232

 Score =   142 bits (357),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 78/104 (75%), Gaps = 0/104 (0%)
 Frame = -3

Query  501  PTAFDPFXEAKEXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFXC  322
            P A+DPF EA++  APG KEY H RIQQR GKKSLTTVQG++KE S+ KILKDLKK+F C
Sbjct  129  PLAYDPFAEAQDTDAPGTKEYIHVRIQQRNGKKSLTTVQGLKKEYSYEKILKDLKKDFCC  188

Query  321  NGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            NG  VQDK  GK  Q QGDQ K  S FLV  G  KKDQIKIHGF
Sbjct  189  NGNVVQDKVLGKIIQLQGDQRKKVSHFLVQTGIAKKDQIKIHGF  232



>ref|XP_009338696.1| PREDICTED: protein translation factor SUI1 homolog [Pyrus x bretschneideri]
 ref|XP_009338697.1| PREDICTED: protein translation factor SUI1 homolog [Pyrus x bretschneideri]
Length=112

 Score =   138 bits (348),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 77/104 (74%), Gaps = 0/104 (0%)
 Frame = -3

Query  501  PTAFDPFXEAKEXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFXC  322
            PTAFDPF EAK+  APG K+Y H R+QQR GKK LTTVQG++K+  + KILKDLKKEF C
Sbjct  9    PTAFDPFSEAKDADAPGAKDYVHIRVQQRNGKKCLTTVQGLKKDFIYDKILKDLKKEFCC  68

Query  321  NGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            NG  VQDKE GK  Q QGDQ KN   FLV     KKD+IKIHGF
Sbjct  69   NGNVVQDKELGKIIQLQGDQRKNVLQFLVQAKIVKKDRIKIHGF  112



>ref|XP_010448172.1| PREDICTED: protein translation factor SUI1 homolog 1-like [Camelina 
sativa]
Length=113

 Score =   138 bits (347),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 76/105 (72%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PTAFDPF +A  E    G KEY H R+QQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  9    PTAFDPFADANAEDAGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSYTKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV  G  KKD IKIHGF
Sbjct  69   CNGTVVQDSELGQVIQLQGDQRKNVSTFLVQAGLVKKDNIKIHGF  113



>ref|XP_006304318.1| hypothetical protein CARUB_v10010698mg [Capsella rubella]
 ref|XP_010462345.1| PREDICTED: protein translation factor SUI1 homolog 2 [Camelina 
sativa]
 ref|XP_010480023.1| PREDICTED: protein translation factor SUI1 homolog 2 [Camelina 
sativa]
 gb|EOA37216.1| hypothetical protein CARUB_v10010698mg [Capsella rubella]
Length=113

 Score =   138 bits (347),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 76/105 (72%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PTAFDPF +A  E    G KEY H R+QQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  9    PTAFDPFADANAEDAGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSYSKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV  G  KKD IKIHGF
Sbjct  69   CNGTVVQDSELGQVIQLQGDQRKNVSTFLVQAGLVKKDNIKIHGF  113



>gb|KHG12156.1| hypothetical protein F383_20129 [Gossypium arboreum]
Length=113

 Score =   138 bits (347),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 71/105 (68%), Positives = 76/105 (72%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PTAFDPF +A  E    G KEY H RIQQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  9    PTAFDPFADANAEDAGAGAKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E GK  Q QGDQ KN S FLV  G  KKD IKIHGF
Sbjct  69   CNGTVVQDPELGKVIQLQGDQRKNVSTFLVQAGIVKKDSIKIHGF  113



>ref|NP_200287.1| translation initiation factor SUI1 family protein [Arabidopsis 
thaliana]
 ref|NP_001119436.1| translation initiation factor SUI1 family protein [Arabidopsis 
thaliana]
 ref|NP_001190540.1| translation initiation factor SUI1 family protein [Arabidopsis 
thaliana]
 ref|XP_002864353.1| hypothetical protein ARALYDRAFT_495556 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_010433396.1| PREDICTED: protein translation factor SUI1 homolog 1-like [Camelina 
sativa]
 ref|XP_010438654.1| PREDICTED: protein translation factor SUI1 homolog 1-like [Camelina 
sativa]
 dbj|BAB08755.1| protein translation factor Sui1 homolog [Arabidopsis thaliana]
 gb|AAO64771.1| At5g54760 [Arabidopsis thaliana]
 gb|EFH40612.1| hypothetical protein ARALYDRAFT_495556 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AED96536.1| translation initiation factor SUI1 family protein [Arabidopsis 
thaliana]
 gb|AED96537.1| translation initiation factor SUI1 family protein [Arabidopsis 
thaliana]
 gb|AED96538.1| translation initiation factor SUI1 family protein [Arabidopsis 
thaliana]
Length=113

 Score =   137 bits (346),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 76/105 (72%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PTAFDPF +A  E    G KEY H R+QQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  9    PTAFDPFADANVEDSGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSYTKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV  G  KKD IKIHGF
Sbjct  69   CNGTVVQDSELGQVIQLQGDQRKNVSTFLVQAGLVKKDNIKIHGF  113



>gb|KJB62620.1| hypothetical protein B456_009G426500 [Gossypium raimondii]
 gb|KJB62622.1| hypothetical protein B456_009G426500 [Gossypium raimondii]
Length=113

 Score =   137 bits (346),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 71/105 (68%), Positives = 76/105 (72%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PTAFDPF +A  E    G KEY H RIQQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  9    PTAFDPFADANAEDAGAGAKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E GK  Q QGDQ KN S FLV  G  KKD IKIHGF
Sbjct  69   CNGTVVQDPELGKVIQLQGDQRKNVSTFLVQAGIVKKDSIKIHGF  113



>ref|XP_004294387.1| PREDICTED: protein translation factor SUI1 homolog [Fragaria 
vesca subsp. vesca]
Length=112

 Score =   137 bits (346),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 77/103 (75%), Gaps = 0/103 (0%)
 Frame = -3

Query  498  TAFDPFXEAKEXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFXCN  319
            TAFDPF EA++  APG KEY H R+QQR GKK LTTVQG++K+ S+ KILKDLKKEF CN
Sbjct  10   TAFDPFAEARDADAPGAKEYVHIRVQQRNGKKCLTTVQGLKKDFSYEKILKDLKKEFCCN  69

Query  318  GXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            G  VQDKE GK  Q QGDQ KN   FL+     KK+QIKIHGF
Sbjct  70   GNVVQDKELGKIIQLQGDQRKNVLQFLIQARIVKKEQIKIHGF  112



>ref|NP_175831.1| protein translation factor SUI1-2 [Arabidopsis thaliana]
 ref|XP_002894486.1| hypothetical protein ARALYDRAFT_474560 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_006392693.1| hypothetical protein EUTSA_v10011880mg [Eutrema salsugineum]
 sp|Q94JV4.1|SUI12_ARATH RecName: Full=Protein translation factor SUI1 homolog 2 [Arabidopsis 
thaliana]
 gb|AAD25609.1|AC005287_11 translation initiation factor [Arabidopsis thaliana]
 gb|AAK49626.1|AF372910_1 At1g54290/F20D21_53 [Arabidopsis thaliana]
 gb|AAN18215.1| At1g54290/F20D21_53 [Arabidopsis thaliana]
 gb|EFH70745.1| hypothetical protein ARALYDRAFT_474560 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AEE33076.1| protein translation factor SUI1-2 [Arabidopsis thaliana]
 gb|ESQ29979.1| hypothetical protein EUTSA_v10011880mg [Eutrema salsugineum]
Length=113

 Score =   137 bits (346),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 76/105 (72%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PTAFDPF +A  E    G KEY H R+QQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  9    PTAFDPFADANAEDSGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSYSKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV  G  KKD IKIHGF
Sbjct  69   CNGTVVQDSELGQVIQLQGDQRKNVSTFLVQAGLVKKDNIKIHGF  113



>ref|XP_002867520.1| hypothetical protein ARALYDRAFT_492082 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_009143120.1| PREDICTED: protein translation factor SUI1 homolog 1 [Brassica 
rapa]
 gb|EFH43779.1| hypothetical protein ARALYDRAFT_492082 [Arabidopsis lyrata subsp. 
lyrata]
 emb|CDY29277.1| BnaC01g19290D [Brassica napus]
 emb|CDX89276.1| BnaA01g16170D [Brassica napus]
Length=113

 Score =   137 bits (346),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 76/105 (72%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PTAFDPF +A  E    G KEY H R+QQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  9    PTAFDPFADANAEDSGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSYSKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV  G  KKD IKIHGF
Sbjct  69   CNGTVVQDSELGQVIQLQGDQRKNVSTFLVQAGLVKKDNIKIHGF  113



>ref|NP_194443.1| protein translation factor SUI1-1 [Arabidopsis thaliana]
 ref|XP_010448590.1| PREDICTED: protein translation factor SUI1 homolog 1 [Camelina 
sativa]
 ref|XP_010443052.1| PREDICTED: protein translation factor SUI1 homolog 1 [Camelina 
sativa]
 ref|XP_010482884.1| PREDICTED: protein translation factor SUI1 homolog 1 [Camelina 
sativa]
 sp|P41568.2|SUI11_ARATH RecName: Full=Protein translation factor SUI1 homolog 1 [Arabidopsis 
thaliana]
 gb|AAB68033.1| translation initiation factor [Arabidopsis thaliana]
 emb|CAB38843.1| translation initiation factor [Arabidopsis thaliana]
 emb|CAB79568.1| translation initiation factor [Arabidopsis thaliana]
 gb|AAK59834.1| AT4g27130/T24A18_80 [Arabidopsis thaliana]
 gb|AAL31168.1| AT4g27130/T24A18_80 [Arabidopsis thaliana]
 gb|AAM65827.1| translation initiation factor [Arabidopsis thaliana]
 gb|AEE85305.1| protein translation factor SUI1-1 [Arabidopsis thaliana]
 emb|CDY14282.1| BnaA08g14130D [Brassica napus]
 emb|CDX97378.1| BnaC08g12430D [Brassica napus]
Length=113

 Score =   137 bits (346),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 76/105 (72%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PTAFDPF +A  E    G KEY H R+QQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  9    PTAFDPFADANAEDSGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSYTKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV  G  KKD IKIHGF
Sbjct  69   CNGTVVQDSELGQVIQLQGDQRKNVSTFLVQAGLVKKDNIKIHGF  113



>ref|XP_007213988.1| hypothetical protein PRUPE_ppa013607mg [Prunus persica]
 gb|EMJ15187.1| hypothetical protein PRUPE_ppa013607mg [Prunus persica]
Length=113

 Score =   137 bits (346),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 71/105 (68%), Positives = 76/105 (72%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PTAFDPF EA  E    G KEY H RIQQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  9    PTAFDPFAEANAEDSGAGTKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV  G  KKD IKIHGF
Sbjct  69   CNGTVVQDPELGQVIQLQGDQRKNVSSFLVQAGIVKKDNIKIHGF  113



>ref|XP_007215170.1| hypothetical protein PRUPE_ppa013601mg [Prunus persica]
 ref|XP_008230362.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Prunus 
mume]
 gb|EMJ16369.1| hypothetical protein PRUPE_ppa013601mg [Prunus persica]
Length=113

 Score =   137 bits (346),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 71/105 (68%), Positives = 76/105 (72%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PTAFDPF EA  E    G KEY H RIQQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  9    PTAFDPFAEANAEDSGAGTKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV  G  KKD IKIHGF
Sbjct  69   CNGTVVQDPEQGQVIQLQGDQRKNVSSFLVQAGIVKKDNIKIHGF  113



>ref|XP_010092161.1| Protein translation factor SUI1-2-like protein [Morus notabilis]
 gb|EXB50312.1| Protein translation factor SUI1-2-like protein [Morus notabilis]
Length=111

 Score =   137 bits (345),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 76/104 (73%), Gaps = 1/104 (1%)
 Frame = -3

Query  501  PTAFDPFXEAKEXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFXC  322
            PT FDPF  A +  APG KEY H R+QQR GKK LTTVQG++KE S+ KILKDLKKEF C
Sbjct  9    PTTFDPFA-AIDSDAPGAKEYVHIRVQQRNGKKCLTTVQGLKKEFSYEKILKDLKKEFCC  67

Query  321  NGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            NG  VQDKE GK  Q QGDQ KN S FLV  G  KKD IKIHGF
Sbjct  68   NGNVVQDKELGKIIQLQGDQRKNVSQFLVQAGLVKKDHIKIHGF  111



>ref|XP_008244365.1| PREDICTED: protein translation factor SUI1 homolog 2 [Prunus 
mume]
Length=113

 Score =   137 bits (345),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 70/105 (67%), Positives = 76/105 (72%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PTAFDPF EA  E    G KEY H RIQQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  9    PTAFDPFAEANAEDSGAGTKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FL+  G  KKD IKIHGF
Sbjct  69   CNGTVVQDPELGQVIQLQGDQRKNVSSFLIQAGIVKKDNIKIHGF  113



>ref|XP_009378877.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Pyrus 
x bretschneideri]
Length=113

 Score =   137 bits (344),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 70/105 (67%), Positives = 76/105 (72%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PTAFDPF EA  E    G KEY H R+QQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  9    PTAFDPFAEATAEDSGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV  G  KKD IKIHGF
Sbjct  69   CNGTVVQDPELGQVIQLQGDQRKNVSSFLVQAGIVKKDNIKIHGF  113



>ref|XP_008365631.1| PREDICTED: protein translation factor SUI1 homolog 2 [Malus domestica]
 ref|XP_009358111.1| PREDICTED: protein translation factor SUI1 homolog 2 [Pyrus x 
bretschneideri]
 ref|XP_009345194.1| PREDICTED: protein translation factor SUI1 homolog 2 [Pyrus x 
bretschneideri]
Length=113

 Score =   137 bits (344),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 70/105 (67%), Positives = 76/105 (72%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PTAFDPF EA  E    G KEY H R+QQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  9    PTAFDPFAEATAEDSGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV  G  KKD IKIHGF
Sbjct  69   CNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKDNIKIHGF  113



>ref|XP_010501111.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Camelina 
sativa]
Length=113

 Score =   137 bits (344),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 76/105 (72%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PTAFDPF +A  E    G KEY H R+QQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  9    PTAFDPFADANAEDVGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSYSKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV  G  KKD IKIHGF
Sbjct  69   CNGTVVQDSELGQVIQLQGDQRKNVSTFLVQAGLVKKDNIKIHGF  113



>gb|KHG11307.1| hypothetical protein F383_12372 [Gossypium arboreum]
Length=113

 Score =   136 bits (343),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 70/105 (67%), Positives = 76/105 (72%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PTAFDPF +A  E    G KEY H RIQQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  9    PTAFDPFADANAEDSGAGTKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV  G  KKD IKIHGF
Sbjct  69   CNGIVVQDLELGQVIQLQGDQRKNVSTFLVQAGIVKKDNIKIHGF  113



>gb|AAM77753.1|AF521961_1 translation initiation factor B04 [Helianthus annuus]
Length=114

 Score =   136 bits (343),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 78/106 (74%), Gaps = 2/106 (2%)
 Frame = -3

Query  501  PTAFDPFXEAKEX--GAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEF  328
            P+AFDPF + ++   G  G KEY H RIQQR G+KSLTTVQG++KE S+ KILKDLKKEF
Sbjct  9    PSAFDPFADVEQDSGGGAGVKEYVHIRIQQRNGRKSLTTVQGLKKELSYDKILKDLKKEF  68

Query  327  XCNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
             CNG  VQDKE GK  Q QGDQ KN S FL   G  KKDQIKIHGF
Sbjct  69   CCNGTVVQDKELGKVIQLQGDQRKNVSAFLSRAGIVKKDQIKIHGF  114



>emb|CDY26128.1| BnaC06g10680D [Brassica napus]
 emb|CDY08222.1| BnaA05g13970D [Brassica napus]
Length=115

 Score =   136 bits (343),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 76/107 (71%), Gaps = 3/107 (3%)
 Frame = -3

Query  501  PTAFDPFXEAKEXGA---PGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKE  331
            PTAFDPF +A    A    G KEY H R+QQR G+KSLTTVQG++KE S+ KILKDLKKE
Sbjct  9    PTAFDPFADANAEDAGAGAGTKEYVHIRVQQRNGRKSLTTVQGIKKEYSYTKILKDLKKE  68

Query  330  FXCNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            F CNG  VQD E G+  Q QGDQ KN S FL+  G  KKD IKIHGF
Sbjct  69   FCCNGTVVQDSELGQVIQLQGDQRKNVSTFLIQAGLVKKDNIKIHGF  115



>ref|XP_011011189.1| PREDICTED: protein translation factor SUI1 homolog 2 [Populus 
euphratica]
Length=112

 Score =   136 bits (342),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 75/104 (72%), Gaps = 0/104 (0%)
 Frame = -3

Query  501  PTAFDPFXEAKEXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFXC  322
            P+AFDPF +AK+ G  G KEY H RIQQR GKKSLTTVQG+ KE S+  ILK LKK+F C
Sbjct  9    PSAFDPFADAKQSGGAGTKEYVHIRIQQRNGKKSLTTVQGLPKELSYETILKTLKKDFCC  68

Query  321  NGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            NG  VQDKE GK  Q QGDQ KN   FLV     KKDQIKIHGF
Sbjct  69   NGNVVQDKELGKVIQLQGDQRKNVQNFLVNQNIVKKDQIKIHGF  112



>gb|AFD22856.1| eukaryotic translation initiation factor SUI1-like protein [Tamarix 
androssowii]
Length=113

 Score =   136 bits (342),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/105 (67%), Positives = 79/105 (75%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDP-FXEAKEXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PTAFDP F +AK+  APG KEY H RIQQR G+KSLTTVQG++K+ S+ KILKDLK+EF 
Sbjct  9    PTAFDPGFADAKDTDAPGVKEYVHIRIQQRNGRKSLTTVQGLKKDFSYEKILKDLKREFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQDKE GK  Q QGDQ K  +  LV  G  KKDQIKIHGF
Sbjct  69   CNGNVVQDKESGKIIQLQGDQRKKVAQSLVQAGITKKDQIKIHGF  113



>ref|XP_010278682.1| PREDICTED: protein translation factor SUI1 homolog [Nelumbo nucifera]
 ref|XP_010278683.1| PREDICTED: protein translation factor SUI1 homolog [Nelumbo nucifera]
 ref|XP_010278684.1| PREDICTED: protein translation factor SUI1 homolog [Nelumbo nucifera]
Length=113

 Score =   136 bits (342),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/105 (67%), Positives = 78/105 (74%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAKEXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFXC  322
            P+AFDPF EAK+ G PG KEY H RIQQR GKK LTTVQG++KE S+ KILK+LKKEF C
Sbjct  9    PSAFDPFAEAKDSGVPGVKEYVHIRIQQRNGKKCLTTVQGLKKEFSYEKILKNLKKEFCC  68

Query  321  NGXXVQDKEX-GKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            NG  V D+E  GK  Q QGDQ KN S FLV  G  KK+ IKIHGF
Sbjct  69   NGTIVPDEELGGKVIQLQGDQRKNVSNFLVKAGIVKKEHIKIHGF  113



>ref|XP_009106912.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Brassica 
rapa]
 ref|XP_009107080.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Brassica 
rapa]
 emb|CDY08224.1| BnaA05g13950D [Brassica napus]
Length=115

 Score =   136 bits (342),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 76/107 (71%), Gaps = 3/107 (3%)
 Frame = -3

Query  501  PTAFDPFXEAKEXGA---PGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKE  331
            PTAFDPF +A    A    G KEY H R+QQR G+KSLTTVQG++KE S+ KILKDLKKE
Sbjct  9    PTAFDPFADANAEDAGAGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSYTKILKDLKKE  68

Query  330  FXCNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            F CNG  VQD E G+  Q QGDQ KN S FLV  G  KKD IKIHGF
Sbjct  69   FCCNGTVVQDSELGQVIQLQGDQRKNVSTFLVQAGLVKKDNIKIHGF  115



>sp|Q9SQF4.1|SUI1_BRAOL RecName: Full=Protein translation factor SUI1 homolog; AltName: 
Full=Translation initiation factor nps45 [Brassica oleracea]
 gb|AAF04624.1|AF098672_1 translation initiation factor nps45 [Brassica oleracea]
Length=113

 Score =   136 bits (342),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 76/105 (72%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PTAFDPF +A  E    G KEY H R+QQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  9    PTAFDPFADANAEDSGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSYTKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV  G  KKD I+IHGF
Sbjct  69   CNGTVVQDSELGQVIQLQGDQRKNVSTFLVQAGLVKKDDIQIHGF  113



>emb|CDY46663.1| BnaA03g48450D [Brassica napus]
Length=196

 Score =   139 bits (349),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 76/105 (72%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PTAFDPF +A  E    G KEY H R+QQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  92   PTAFDPFADANAEDSGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSYSKILKDLKKEFC  151

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV  G  KKD IKIHGF
Sbjct  152  CNGTVVQDSELGQVIQLQGDQRKNVSTFLVQAGLVKKDNIKIHGF  196



>ref|XP_006284787.1| hypothetical protein CARUB_v10006056mg [Capsella rubella]
 gb|EOA17685.1| hypothetical protein CARUB_v10006056mg [Capsella rubella]
Length=113

 Score =   136 bits (342),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 75/105 (71%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PTAFDPF +A  E    G KEY H R+QQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  9    PTAFDPFADANVEDSGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSYTKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV     KKD IKIHGF
Sbjct  69   CNGTVVQDSELGQVIQLQGDQRKNVSTFLVQASLVKKDNIKIHGF  113



>gb|AFK35113.1| unknown [Lotus japonicus]
 gb|AFK48780.1| unknown [Lotus japonicus]
Length=114

 Score =   136 bits (342),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 78/106 (74%), Gaps = 2/106 (2%)
 Frame = -3

Query  501  PTAFDPFXEA--KEXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEF  328
            PTAFDPF EA  ++ GA   KEY H RIQQR G+KSLTTVQG++KE S+ KILKDLKKEF
Sbjct  9    PTAFDPFAEANAEDSGAGSSKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEF  68

Query  327  XCNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
             CNG  VQD E G+  Q QGDQ KN S FLV  G  KK+ IKIHGF
Sbjct  69   CCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  114



>ref|XP_002281872.1| PREDICTED: protein translation factor SUI1 homolog [Vitis vinifera]
 emb|CBI23936.3| unnamed protein product [Vitis vinifera]
Length=113

 Score =   135 bits (341),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/105 (67%), Positives = 76/105 (72%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PTAFDPF EA  E    G K+Y H RIQQR G+KSLTTVQG+RKE S+ KILKDLKKEF 
Sbjct  9    PTAFDPFAEANAEDSGAGSKDYVHIRIQQRNGRKSLTTVQGLRKEFSYNKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV  G  KK+ IKIHGF
Sbjct  69   CNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEDIKIHGF  113



>ref|XP_009109147.1| PREDICTED: protein translation factor SUI1 homolog 1-like [Brassica 
rapa]
Length=113

 Score =   135 bits (341),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 76/105 (72%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PTAFDPF +A  E    G KEY H R+QQR G+KSLTTVQG++K+ S+ KILKDLKKEF 
Sbjct  9    PTAFDPFADANAEDSGAGKKEYVHIRVQQRNGRKSLTTVQGLKKDYSYTKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV  G  KKD IKIHGF
Sbjct  69   CNGTVVQDSELGQVIQLQGDQRKNVSTFLVQAGLVKKDNIKIHGF  113



>ref|NP_001055949.1| Os05g0498400 [Oryza sativa Japonica Group]
 ref|XP_006654596.1| PREDICTED: protein translation factor SUI1 homolog [Oryza brachyantha]
 gb|AAT44286.1| putative protein translation factor Sui1 [Oryza sativa Japonica 
Group]
 dbj|BAF17863.1| Os05g0498400 [Oryza sativa Japonica Group]
 dbj|BAG91879.1| unnamed protein product [Oryza sativa Japonica Group]
Length=115

 Score =   135 bits (341),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 80/107 (75%), Gaps = 3/107 (3%)
 Frame = -3

Query  501  PTAFDPFXEA--KEXGA-PGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKE  331
            P+AFDPF EA  ++ GA PG K+Y H RIQQR G+KSLTTVQG++KE S+ KILKDLKKE
Sbjct  9    PSAFDPFAEANAEDSGAGPGAKDYVHVRIQQRNGRKSLTTVQGLKKEYSYNKILKDLKKE  68

Query  330  FXCNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            F CNG  VQD E G+  Q QGDQ KN + FLV  G  KKD IKIHGF
Sbjct  69   FCCNGTVVQDPELGQVIQLQGDQRKNVATFLVQAGIAKKDNIKIHGF  115



>ref|XP_004294347.1| PREDICTED: protein translation factor SUI1 homolog [Fragaria 
vesca subsp. vesca]
Length=113

 Score =   135 bits (341),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 76/105 (72%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PTAFDPF EA  E    G KEY H R+QQR G+KSLTTVQG++K+ S+ KILKDLKKEF 
Sbjct  9    PTAFDPFAEANAEDSGAGTKEYVHIRVQQRNGRKSLTTVQGLKKDFSYNKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV  G  KKD IKIHGF
Sbjct  69   CNGTVVQDPELGQVIQLQGDQRKNVSSFLVQAGIVKKDNIKIHGF  113



>gb|ABQ42057.1| putative translation factor [Sonneratia alba]
 gb|ABQ42059.1| putative translation factor [Sonneratia ovata]
 gb|ABQ42060.1| putative translation factor [Sonneratia apetala]
Length=114

 Score =   135 bits (341),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 77/105 (73%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PTAFDPF +A  E    G KEY H R+QQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  10   PTAFDPFADANAEDSGAGAKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFC  69

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV  G  KKD+IKIHGF
Sbjct  70   CNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKDRIKIHGF  114



>gb|EYU27827.1| hypothetical protein MIMGU_mgv1a016640mg [Erythranthe guttata]
Length=113

 Score =   135 bits (341),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 70/105 (67%), Positives = 76/105 (72%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            P+ FDPF EAK E    G KEY H RIQQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  9    PSPFDPFAEAKAEDSGVGSKEYVHIRIQQRNGRKSLTTVQGLKKEFSYTKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV  G  KKD IKIHGF
Sbjct  69   CNGTVVQDSELGQVIQLQGDQRKNVSTFLVQAGIVKKDHIKIHGF  113



>ref|XP_008341842.1| PREDICTED: protein translation factor SUI1 homolog [Malus domestica]
 ref|XP_009371031.1| PREDICTED: protein translation factor SUI1 homolog [Pyrus x bretschneideri]
 ref|XP_009373712.1| PREDICTED: protein translation factor SUI1 homolog [Pyrus x bretschneideri]
Length=113

 Score =   135 bits (340),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 76/105 (72%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PTAFDPF EA  E    G K+Y H R+QQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  9    PTAFDPFAEANAEDSGAGTKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV  G  KKD IKIHGF
Sbjct  69   CNGTVVQDPEQGQVIQLQGDQRKNVSAFLVQAGIVKKDHIKIHGF  113



>ref|XP_009137639.1| PREDICTED: protein translation factor SUI1 homolog 1-like [Brassica 
rapa]
Length=113

 Score =   135 bits (340),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 76/105 (72%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PTAFDPF +A  E    G KEY H R+QQR G+KSLTTV+G++KE S+ KILKDLKKEF 
Sbjct  9    PTAFDPFADANAEDSGAGKKEYVHIRVQQRNGRKSLTTVKGLKKEYSYSKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV  G  KKD IKIHGF
Sbjct  69   CNGTVVQDSELGQVIQLQGDQRKNVSTFLVQAGLVKKDNIKIHGF  113



>ref|NP_001239651.1| uncharacterized protein LOC100784390 [Glycine max]
 ref|XP_006591863.1| PREDICTED: uncharacterized protein LOC100784390 isoform X1 [Glycine 
max]
 gb|ACU18971.1| unknown [Glycine max]
 gb|KHN22844.1| Protein translation factor SUI1 like [Glycine soja]
Length=113

 Score =   135 bits (339),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 76/105 (72%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PTAFDPF EA  E    G KEY H R+QQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  9    PTAFDPFAEANAEDSGAGTKEYVHVRVQQRNGRKSLTTVQGLKKEYSYSKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV  G  KK+ IK+HGF
Sbjct  69   CNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKLHGF  113



>gb|KJB13596.1| hypothetical protein B456_002G083300 [Gossypium raimondii]
Length=113

 Score =   135 bits (339),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 76/105 (72%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PTAFDPF +A  E    G KEY H RIQQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  9    PTAFDPFADANAEDSGAGAKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  V+D E G+  Q QGDQ KN S FLV  G  KKD IKIHGF
Sbjct  69   CNGTVVEDPELGQVIQLQGDQRKNVSTFLVQAGIVKKDNIKIHGF  113



>ref|XP_010539284.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Tarenaya 
hassleriana]
 ref|XP_010539285.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Tarenaya 
hassleriana]
Length=113

 Score =   135 bits (339),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 75/105 (71%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PT FDPF +A  E    G KEY H R+QQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  9    PTTFDPFADANAEDSGAGSKEYVHIRVQQRNGRKSLTTVQGLKKEYSYSKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV  G  KKD IKIHGF
Sbjct  69   CNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGLVKKDNIKIHGF  113



>emb|CDX92777.1| BnaC07g40350D [Brassica napus]
Length=203

 Score =   137 bits (346),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 76/105 (72%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PTAFDPF +A  E    G KEY H R+QQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  99   PTAFDPFADANAEDSGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSYSKILKDLKKEFC  158

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV  G  KKD IKIHGF
Sbjct  159  CNGTVVQDSELGQVIQLQGDQRKNVSTFLVQAGLVKKDNIKIHGF  203



>ref|XP_011096112.1| PREDICTED: protein translation factor SUI1 homolog [Sesamum indicum]
 ref|XP_011096113.1| PREDICTED: protein translation factor SUI1 homolog [Sesamum indicum]
Length=113

 Score =   135 bits (339),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 77/105 (73%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            P+AFDPF EAK E    G KEY H R+QQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  9    PSAFDPFAEAKAEDSGAGAKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV  G  KK+ IKIHGF
Sbjct  69   CNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  113



>ref|XP_010545205.1| PREDICTED: protein translation factor SUI1 homolog 1-like [Tarenaya 
hassleriana]
 ref|XP_010545206.1| PREDICTED: protein translation factor SUI1 homolog 1-like [Tarenaya 
hassleriana]
Length=113

 Score =   135 bits (339),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 75/105 (71%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PT FDPF +A  E    G KEY H R+QQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  9    PTTFDPFADANAEDSGAGSKEYVHIRVQQRNGRKSLTTVQGLKKEYSYSKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV  G  KKD IKIHGF
Sbjct  69   CNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGLVKKDNIKIHGF  113



>ref|XP_010542418.1| PREDICTED: protein translation factor SUI1 homolog 1 [Tarenaya 
hassleriana]
Length=113

 Score =   135 bits (339),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 75/105 (71%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PT FDPF +A  E    G KEY H R+QQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  9    PTTFDPFADANAEDSGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSYSKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV  G  KKD IKIHGF
Sbjct  69   CNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGLVKKDNIKIHGF  113



>gb|KHG06773.1| hypothetical protein F383_09794 [Gossypium arboreum]
Length=113

 Score =   135 bits (339),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 76/105 (72%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PTAF+PF +A  E    G KEY H RIQQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  9    PTAFNPFADANAEDSGAGAKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV  G  KKD IKIHGF
Sbjct  69   CNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKDNIKIHGF  113



>ref|XP_003596650.1| Translation factor Sui1-like protein [Medicago truncatula]
 gb|AES66901.1| eukaryotic translation initiation factor SUI1 [Medicago truncatula]
 gb|AFK43860.1| unknown [Medicago truncatula]
Length=114

 Score =   134 bits (338),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 69/106 (65%), Positives = 78/106 (74%), Gaps = 2/106 (2%)
 Frame = -3

Query  501  PTAFDPFXEA--KEXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEF  328
            PTA+DPF EA  ++ GA   KEY H RIQQR G+KSLTTVQG++KE S+ KILKDLKKEF
Sbjct  9    PTAYDPFAEANAEDAGAGSSKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEF  68

Query  327  XCNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
             CNG  VQD E G+  Q QGDQ KN S FLV  G  KK+ IKIHGF
Sbjct  69   CCNGTVVQDPEQGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  114



>gb|KHG23747.1| hypothetical protein F383_10557 [Gossypium arboreum]
 gb|KJB45588.1| hypothetical protein B456_007G314200 [Gossypium raimondii]
 gb|KJB45589.1| hypothetical protein B456_007G314200 [Gossypium raimondii]
 gb|KJB45590.1| hypothetical protein B456_007G314200 [Gossypium raimondii]
 gb|KJB78391.1| hypothetical protein B456_013G163400 [Gossypium raimondii]
Length=113

 Score =   134 bits (338),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 76/105 (72%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PTAFDPF +A  E    G KEY H RIQQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  9    PTAFDPFADANAEDSGAGAKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV  G  KK+ IKIHGF
Sbjct  69   CNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKENIKIHGF  113



>ref|XP_002310460.1| hypothetical protein POPTR_0007s02520g [Populus trichocarpa]
 ref|XP_006380311.1| SUI1 family protein [Populus trichocarpa]
 ref|XP_006380312.1| hypothetical protein POPTR_0007s02520g [Populus trichocarpa]
 ref|XP_011026342.1| PREDICTED: protein translation factor SUI1 homolog [Populus euphratica]
 ref|XP_011026343.1| PREDICTED: protein translation factor SUI1 homolog [Populus euphratica]
 gb|ABK95531.1| unknown [Populus trichocarpa]
 gb|EEE90910.1| hypothetical protein POPTR_0007s02520g [Populus trichocarpa]
 gb|ERP58108.1| SUI1 family protein [Populus trichocarpa]
 gb|ERP58109.1| hypothetical protein POPTR_0007s02520g [Populus trichocarpa]
Length=113

 Score =   134 bits (338),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 76/105 (72%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PTAFDPF EA  E    G K+Y H R+QQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  9    PTAFDPFAEANAEDSGAGTKDYVHVRVQQRNGRKSLTTVQGLKKEYSYNKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV  G  KK+ IKIHGF
Sbjct  69   CNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKENIKIHGF  113



>gb|AFK48465.1| unknown [Lotus japonicus]
Length=116

 Score =   134 bits (338),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 71/108 (66%), Positives = 78/108 (72%), Gaps = 4/108 (4%)
 Frame = -3

Query  501  PTAFDPFXEAK--EXGA--PGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKK  334
            PTAFDPF EA   E GA   G K+Y H R+QQR G+KSLTTVQG++KE S+ KILKDLKK
Sbjct  9    PTAFDPFAEANVDESGAGGAGTKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDLKK  68

Query  333  EFXCNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            EF CNG  VQD E G+  Q QGDQ KN S FLV  G  KKD IKIHGF
Sbjct  69   EFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKDNIKIHGF  116



>ref|XP_002310461.1| SUI1 family protein [Populus trichocarpa]
 gb|EEE90911.1| SUI1 family protein [Populus trichocarpa]
Length=113

 Score =   134 bits (337),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 76/105 (72%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PTAFDPF EA  E    G K+Y H R+QQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  9    PTAFDPFAEANAEDSGAGTKDYVHVRVQQRNGRKSLTTVQGLKKEYSYNKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV  G  KK+ IKIHGF
Sbjct  69   CNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKESIKIHGF  113



>ref|XP_004304159.1| PREDICTED: protein translation factor SUI1 homolog [Fragaria 
vesca subsp. vesca]
Length=113

 Score =   134 bits (337),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 76/105 (72%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PTAFDPF EA  E    G K+Y H RIQQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  9    PTAFDPFAEANAEDSGAGTKDYVHIRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV  G  KK+ IKIHGF
Sbjct  69   CNGTVVQDPEQGQVIQLQGDQRKNVSAFLVQAGIVKKENIKIHGF  113



>ref|XP_006413104.1| hypothetical protein EUTSA_v10026037mg [Eutrema salsugineum]
 gb|ESQ54557.1| hypothetical protein EUTSA_v10026037mg [Eutrema salsugineum]
Length=256

 Score =   138 bits (348),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 76/105 (72%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PTAFDPF +A  E    G KEY H R+QQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  152  PTAFDPFADANAEDSGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSYSKILKDLKKEFC  211

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV  G  KKD IKIHGF
Sbjct  212  CNGTVVQDSELGQVIQLQGDQRKNVSTFLVQAGLVKKDNIKIHGF  256



>gb|ACG24808.1| protein translation factor SUI1 [Zea mays]
Length=115

 Score =   134 bits (337),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 76/107 (71%), Gaps = 3/107 (3%)
 Frame = -3

Query  501  PTAFDPFXEAK---EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKE  331
            PTAFDPF EA       A G K+Y H RIQQR G+KSLTTVQG++KE S+ KILKDLKKE
Sbjct  9    PTAFDPFAEANAGDSGAAAGSKDYVHVRIQQRNGRKSLTTVQGLKKEFSYSKILKDLKKE  68

Query  330  FXCNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            F CNG  VQD E G+  Q QGDQ KN S FLV  G  KK+ IKIHGF
Sbjct  69   FYCNGTVVQDPELGQVIQLQGDQRKNVSNFLVQAGIVKKEHIKIHGF  115



>gb|AFC01199.1| eukaryotic translation initiation factor [Ammopiptanthus mongolicus]
Length=113

 Score =   134 bits (337),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 75/105 (71%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PT FDPF EA  E    G KEY H R+QQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  9    PTTFDPFAEANAEDSGAGTKEYVHVRVQQRNGRKSLTTVQGLKKEYSYTKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV  G  KK+ IKIHGF
Sbjct  69   CNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKENIKIHGF  113



>gb|EPS65463.1| hypothetical protein M569_09315 [Genlisea aurea]
Length=113

 Score =   134 bits (337),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 76/105 (72%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            P +FDPF +A  E   PG K+Y H R+QQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  9    PISFDPFADANAENSGPGSKDYIHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV  G  KKD IKIHGF
Sbjct  69   CNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKDNIKIHGF  113



>ref|XP_010240920.1| PREDICTED: protein translation factor SUI1 homolog [Nelumbo nucifera]
Length=113

 Score =   134 bits (337),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 75/105 (71%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PT FDPF EA  E    G KEY H RIQQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  9    PTTFDPFAEANAEDSGAGSKEYVHVRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV  G  KK+ IKIHGF
Sbjct  69   CNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  113



>ref|XP_009417250.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Musa 
acuminata subsp. malaccensis]
Length=113

 Score =   134 bits (337),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 76/105 (72%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PTAFDPF +A  E    G KEY H RIQQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  9    PTAFDPFADANAEDSGAGAKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV  G  KK+ IKIHGF
Sbjct  69   CNGTVVQDPELGQVIQLQGDQRKNVSSFLVQAGIIKKEHIKIHGF  113



>emb|CAC84489.1| putative translation factor [Pinus pinaster]
 gb|ABK20970.1| unknown [Picea sitchensis]
 gb|ABK22220.1| unknown [Picea sitchensis]
 gb|ABK23355.1| unknown [Picea sitchensis]
 gb|ABK26752.1| unknown [Picea sitchensis]
 gb|ABR16497.1| unknown [Picea sitchensis]
 gb|ABR18467.1| unknown [Picea sitchensis]
 gb|ACN39759.1| unknown [Picea sitchensis]
 gb|ACN40001.1| unknown [Picea sitchensis]
 gb|ACN40379.1| unknown [Picea sitchensis]
 gb|ACN40927.1| unknown [Picea sitchensis]
Length=113

 Score =   134 bits (337),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 75/105 (71%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            P A+DPF +A  E    G KEY H RIQQR G+KSLTTVQG+RKE S+ KILKDLKKEF 
Sbjct  9    PGAYDPFADANAEDSGAGSKEYVHVRIQQRNGRKSLTTVQGLRKEFSYNKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV  G  KKD IKIHGF
Sbjct  69   CNGTVVQDPELGQVIQLQGDQRKNVSNFLVQAGIVKKDNIKIHGF  113



>gb|AFK48865.1| unknown [Lotus japonicus]
Length=116

 Score =   134 bits (337),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 71/108 (66%), Positives = 78/108 (72%), Gaps = 4/108 (4%)
 Frame = -3

Query  501  PTAFDPFXEAK--EXGA--PGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKK  334
            PTAFDPF EA   E GA   G K+Y H R+QQR G+KSLTTVQG++KE S+ KILKDLKK
Sbjct  9    PTAFDPFAEANVDESGAGGAGIKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDLKK  68

Query  333  EFXCNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            EF CNG  VQD E G+  Q QGDQ KN S FLV  G  KKD IKIHGF
Sbjct  69   EFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKDNIKIHGF  116



>ref|XP_007021029.1| Translation initiation factor SUI1 family protein [Theobroma 
cacao]
 gb|EOY12554.1| Translation initiation factor SUI1 family protein [Theobroma 
cacao]
Length=113

 Score =   134 bits (337),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 75/105 (71%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PTAFDPF +A  E    G KEY H RIQQR G+KSLTTVQG++KE S+ KILKDLKK F 
Sbjct  9    PTAFDPFADANAEDSGAGAKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKVFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV  G  KKD IKIHGF
Sbjct  69   CNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKDNIKIHGF  113



>gb|ACN30624.1| unknown [Zea mays]
Length=110

 Score =   134 bits (336),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 76/107 (71%), Gaps = 3/107 (3%)
 Frame = -3

Query  501  PTAFDPFXEAK---EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKE  331
            PTAFDPF EA       A G K+Y H RIQQR G+KSLTTVQG++KE S+ KILKDLKKE
Sbjct  4    PTAFDPFAEANAGDSGAAAGSKDYVHVRIQQRNGRKSLTTVQGLKKEFSYSKILKDLKKE  63

Query  330  FXCNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            F CNG  VQD E G+  Q QGDQ KN S FLV  G  KK+ IKIHGF
Sbjct  64   FCCNGTVVQDPELGQVIQLQGDQRKNVSNFLVQAGIVKKEHIKIHGF  110



>gb|ABQ42058.1| putative translation factor [Sonneratia caseolaris]
Length=114

 Score =   134 bits (336),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 77/105 (73%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PTAFDPF +A  E    G KEY H R+QQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  10   PTAFDPFADANAEDSGAGAKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFC  69

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV  G  KK++IKIHGF
Sbjct  70   CNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKERIKIHGF  114



>ref|XP_004957905.1| PREDICTED: protein translation factor SUI1 homolog isoform X1 
[Setaria italica]
 ref|XP_004957906.1| PREDICTED: protein translation factor SUI1 homolog isoform X2 
[Setaria italica]
Length=115

 Score =   134 bits (336),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 76/107 (71%), Gaps = 3/107 (3%)
 Frame = -3

Query  501  PTAFDPFXEAK---EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKE  331
            PTAFDPF EA       A G K+Y H RIQQR G+KSLTTVQG++KE S+ KILKDLKKE
Sbjct  9    PTAFDPFAEANAGDSGAAAGSKDYVHVRIQQRNGRKSLTTVQGLKKEFSYSKILKDLKKE  68

Query  330  FXCNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            F CNG  VQD E G+  Q QGDQ KN S FLV  G  KK+ IKIHGF
Sbjct  69   FCCNGTVVQDPELGQVIQLQGDQRKNVSNFLVQAGIVKKEHIKIHGF  115



>gb|KHG30632.1| hypothetical protein F383_00215 [Gossypium arboreum]
Length=113

 Score =   134 bits (336),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 76/105 (72%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PTAFDPF +A  E    G KEY H R+QQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  9    PTAFDPFADANAEDSGAGAKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV  G  KK+ IKIHGF
Sbjct  69   CNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKENIKIHGF  113



>ref|XP_006363526.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Solanum 
tuberosum]
Length=113

 Score =   134 bits (336),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 75/105 (71%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            P AFDPF EA  E    G K+Y H RIQQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  9    PNAFDPFAEANAENSGAGTKDYVHIRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV  G  KK+ IKIHGF
Sbjct  69   CNGTVVQDSELGQVIQLQGDQRKNVSTFLVQAGVVKKEHIKIHGF  113



>ref|NP_001104887.1| protein translation factor SUI1 homolog [Zea mays]
 ref|XP_006657782.1| PREDICTED: protein translation factor SUI1 homolog [Oryza brachyantha]
 ref|XP_006659299.1| PREDICTED: protein translation factor SUI1 homolog [Oryza brachyantha]
 sp|P56330.1|SUI1_MAIZE RecName: Full=Protein translation factor SUI1 homolog; AltName: 
Full=Protein GOS2 [Zea mays]
 gb|AAB88615.1| translation initiation factor [Zea mays]
 gb|ACF80856.1| unknown [Zea mays]
 gb|ACG27240.1| protein translation factor SUI1 [Zea mays]
 gb|ACG28108.1| protein translation factor SUI1 [Zea mays]
 gb|ACG30000.1| protein translation factor SUI1 [Zea mays]
 gb|ACG30907.1| protein translation factor SUI1 [Zea mays]
 gb|ACG37835.1| protein translation factor SUI1 [Zea mays]
 tpg|DAA62967.1| TPA: translation initiation factor1 [Zea mays]
Length=115

 Score =   134 bits (336),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 76/107 (71%), Gaps = 3/107 (3%)
 Frame = -3

Query  501  PTAFDPFXEAK---EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKE  331
            PTAFDPF EA       A G K+Y H RIQQR G+KSLTTVQG++KE S+ KILKDLKKE
Sbjct  9    PTAFDPFAEANAGDSGAAAGSKDYVHVRIQQRNGRKSLTTVQGLKKEFSYSKILKDLKKE  68

Query  330  FXCNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            F CNG  VQD E G+  Q QGDQ KN S FLV  G  KK+ IKIHGF
Sbjct  69   FCCNGTVVQDPELGQVIQLQGDQRKNVSNFLVQAGIVKKEHIKIHGF  115



>ref|XP_010923943.1| PREDICTED: protein translation factor SUI1 homolog [Elaeis guineensis]
Length=113

 Score =   134 bits (336),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 76/105 (72%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PTA+DPF EA  E    G KEY H RIQQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  9    PTAYDPFAEANAEDSGAGAKEYVHVRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN + FLV  G  KK+ IKIHGF
Sbjct  69   CNGTVVQDPELGQVIQLQGDQRKNVATFLVQAGIVKKEHIKIHGF  113



>ref|XP_007132567.1| hypothetical protein PHAVU_011G105700g [Phaseolus vulgaris]
 gb|ESW04561.1| hypothetical protein PHAVU_011G105700g [Phaseolus vulgaris]
Length=113

 Score =   134 bits (336),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 76/105 (72%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            P+AFDPF EA  E    G KEY H R+QQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  9    PSAFDPFAEANAEDSGAGTKEYVHVRVQQRNGRKSLTTVQGLKKEYSYSKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV  G  KK+ IK+HGF
Sbjct  69   CNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKLHGF  113



>ref|XP_010035571.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Eucalyptus 
grandis]
 ref|XP_010035572.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Eucalyptus 
grandis]
 gb|KCW46998.1| hypothetical protein EUGRSUZ_K00804 [Eucalyptus grandis]
Length=113

 Score =   134 bits (336),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 77/105 (73%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PT FDPF +AK E    G KEY H R+QQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  9    PTTFDPFADAKAEDSGAGSKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV  G  KK++IKIHGF
Sbjct  69   CNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKERIKIHGF  113



>ref|XP_010062975.1| PREDICTED: protein translation factor SUI1 homolog 2 [Eucalyptus 
grandis]
Length=113

 Score =   134 bits (336),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 76/105 (72%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PTAFDPF +A  E    G KEY H R+QQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  9    PTAFDPFADANAEDSGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV  G  KK+ IKIHGF
Sbjct  69   CNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  113



>ref|NP_001059843.1| Os07g0529800 [Oryza sativa Japonica Group]
 sp|Q0D5W6.1|SUI1_ORYSJ RecName: Full=Protein translation factor SUI1 homolog; AltName: 
Full=Protein GOS2; AltName: Full=Protein eIF1; AltName: Full=Translation 
initiation factor 1 [Oryza sativa Japonica Group]
 sp|A6MZM2.1|SUI1_ORYSI RecName: Full=Protein translation factor SUI1 homolog; AltName: 
Full=Protein GOS2; AltName: Full=Protein eIF1; AltName: Full=Translation 
initiation factor 1 [Oryza sativa Indica Group]
 gb|AAK56324.1|AF380357_1 translational initiation factor eIF1 [Oryza coarctata]
 emb|CAA36190.1| GOS2 [Oryza sativa Indica Group]
 gb|AAC67556.1| translation initiation factor [Oryza sativa Japonica Group]
 dbj|BAC45143.1| translational initiation factor eIF1 [Oryza sativa Japonica Group]
 dbj|BAF21757.1| Os07g0529800 [Oryza sativa Japonica Group]
 gb|ABR25442.1| putative protein translation factor sui1 [Oryza sativa Indica 
Group]
 gb|ABR26117.1| protein translation factor sui1 [Oryza sativa Indica Group]
 gb|ACJ09228.1| translation initiation factor eIF1 [Oryza sativa Indica Group]
 dbj|BAH00131.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AFI71284.1| protein translation factor SUI 1 [Oryza sativa Japonica Group]
Length=115

 Score =   134 bits (336),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 76/107 (71%), Gaps = 3/107 (3%)
 Frame = -3

Query  501  PTAFDPFXEAK---EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKE  331
            PTAFDPF EA       A G K+Y H RIQQR G+KSLTTVQG++KE S+ KILKDLKKE
Sbjct  9    PTAFDPFAEANAGDSGAAAGSKDYVHVRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKE  68

Query  330  FXCNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            F CNG  VQD E G+  Q QGDQ KN S FLV  G  KK+ IKIHGF
Sbjct  69   FCCNGTVVQDPELGQVIQLQGDQRKNVSNFLVQAGIVKKEHIKIHGF  115



>sp|Q9SM41.1|SUI1_SPOST RecName: Full=Protein translation factor SUI1 homolog [Sporobolus 
stapfianus]
 emb|CAB61837.1| putative translation initiation factor eIF-1 [Sporobolus stapfianus]
Length=115

 Score =   134 bits (336),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 76/107 (71%), Gaps = 3/107 (3%)
 Frame = -3

Query  501  PTAFDPFXEAK---EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKE  331
            PTAFDPF EA       A G K+Y H RIQQR G+KSLTTVQG++KE S+ KILKDLKKE
Sbjct  9    PTAFDPFSEANAGDSGAAAGSKDYVHVRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKE  68

Query  330  FXCNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            F CNG  VQD E G+  Q QGDQ KN S FLV  G  KK+ IKIHGF
Sbjct  69   FCCNGTVVQDPELGQVIQLQGDQRKNVSNFLVQAGIVKKEHIKIHGF  115



>ref|XP_011097918.1| PREDICTED: protein translation factor SUI1 homolog [Sesamum indicum]
Length=113

 Score =   133 bits (335),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 76/105 (72%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PTAFDPF +A  E    G K+Y H RIQQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  9    PTAFDPFADANAENSGAGAKDYVHIRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV  G  KK+ IKIHGF
Sbjct  69   CNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  113



>ref|XP_004487600.1| PREDICTED: protein translation factor SUI1 homolog 1-like isoform 
X2 [Cicer arietinum]
Length=113

 Score =   133 bits (335),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 75/105 (71%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PT FDPF EA  E    G KEY H RIQQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  9    PTTFDPFAEANAEDSGAGTKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FL+  G  KK+ IKIHGF
Sbjct  69   CNGTVVQDPEQGQVIQLQGDQRKNVSTFLIQAGIVKKEHIKIHGF  113



>ref|XP_010930963.1| PREDICTED: protein translation factor SUI1 homolog [Elaeis guineensis]
Length=113

 Score =   133 bits (335),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 76/105 (72%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PTAFDPF EA  +    G KEY H RIQQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  9    PTAFDPFAEANADDSGAGAKEYVHVRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN + FLV  G  KK+ IKIHGF
Sbjct  69   CNGTVVQDPELGQVIQLQGDQRKNVATFLVQAGIVKKEHIKIHGF  113



>gb|EEC79466.1| hypothetical protein OsI_20483 [Oryza sativa Indica Group]
 gb|EEE64240.1| hypothetical protein OsJ_19073 [Oryza sativa Japonica Group]
Length=213

 Score =   136 bits (343),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 80/107 (75%), Gaps = 3/107 (3%)
 Frame = -3

Query  501  PTAFDPFXEA--KEXGA-PGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKE  331
            P+AFDPF EA  ++ GA PG K+Y H RIQQR G+KSLTTVQG++KE S+ KILKDLKKE
Sbjct  107  PSAFDPFAEANAEDSGAGPGAKDYVHVRIQQRNGRKSLTTVQGLKKEYSYNKILKDLKKE  166

Query  330  FXCNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            F CNG  VQD E G+  Q QGDQ KN + FLV  G  KKD IKIHGF
Sbjct  167  FCCNGTVVQDPELGQVIQLQGDQRKNVATFLVQAGIAKKDNIKIHGF  213



>ref|XP_004244151.1| PREDICTED: protein translation factor SUI1 homolog [Solanum lycopersicum]
 ref|XP_004244152.1| PREDICTED: protein translation factor SUI1 homolog [Solanum lycopersicum]
Length=113

 Score =   133 bits (335),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 76/105 (72%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PTAFDPF EA  +    G K+Y H RIQQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  9    PTAFDPFAEANADNSGAGSKDYVHIRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV  G  KK+ IKIHGF
Sbjct  69   CNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  113



>ref|NP_001152681.1| LOC100286322 [Zea mays]
 ref|XP_002440017.1| hypothetical protein SORBIDRAFT_09g024530 [Sorghum bicolor]
 ref|XP_004961618.1| PREDICTED: protein translation factor SUI1 homolog isoform X2 
[Setaria italica]
 ref|XP_008647991.1| PREDICTED: LOC100286322 isoform X1 [Zea mays]
 gb|ACF83099.1| unknown [Zea mays]
 gb|ACG26980.1| protein translation factor SUI1 [Zea mays]
 gb|ACG32428.1| protein translation factor SUI1 [Zea mays]
 gb|ACG47286.1| protein translation factor SUI1 [Zea mays]
 gb|ACG48899.1| protein translation factor SUI1 [Zea mays]
 gb|ACN35402.1| unknown [Zea mays]
 gb|EES18447.1| hypothetical protein SORBIDRAFT_09g024530 [Sorghum bicolor]
 gb|AFW78549.1| protein translation factor SUI1 [Zea mays]
Length=115

 Score =   133 bits (335),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 80/107 (75%), Gaps = 3/107 (3%)
 Frame = -3

Query  501  PTAFDPFXEA--KEXGA-PGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKE  331
            P+AFDPF EA  ++ GA PG K+Y H RIQQR G+KSLTTVQG++KE S+ KILKDLKKE
Sbjct  9    PSAFDPFAEANAEDSGAGPGTKDYVHVRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKE  68

Query  330  FXCNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            F CNG  VQD E G+  Q QGDQ KN + FLV  G  KK+ IKIHGF
Sbjct  69   FCCNGTVVQDPELGQVIQLQGDQRKNVATFLVQAGIAKKENIKIHGF  115



>ref|XP_003568176.1| PREDICTED: protein translation factor SUI1 homolog [Brachypodium 
distachyon]
Length=115

 Score =   133 bits (335),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 77/107 (72%), Gaps = 3/107 (3%)
 Frame = -3

Query  501  PTAFDPFXEAKEXGA---PGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKE  331
            P+AFDPF EA    A   PG K+Y H RIQQR G+KSLTTVQG++KE S+ KILKDLKKE
Sbjct  9    PSAFDPFAEANAEDAGAGPGAKDYVHVRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKE  68

Query  330  FXCNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            F CNG  VQD E G+  Q QGDQ KN + FLV  G  KK+ IKIHGF
Sbjct  69   FCCNGTVVQDPELGQVIQLQGDQRKNVATFLVQAGIAKKELIKIHGF  115



>ref|XP_008803218.1| PREDICTED: protein translation factor SUI1 homolog [Phoenix dactylifera]
Length=113

 Score =   133 bits (335),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 75/105 (71%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PT FDPF EA  E    G KEY H RIQQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  9    PTTFDPFAEANAEDSGAGAKEYVHVRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN + FLV  G  KK+ IKIHGF
Sbjct  69   CNGTVVQDPELGQVIQLQGDQRKNVATFLVQAGIVKKEHIKIHGF  113



>ref|XP_004144489.1| PREDICTED: protein translation factor SUI1 homolog 2-like isoform 
1 [Cucumis sativus]
 ref|XP_004144490.1| PREDICTED: protein translation factor SUI1 homolog 2-like isoform 
2 [Cucumis sativus]
 ref|XP_008455418.1| PREDICTED: protein translation factor SUI1 homolog [Cucumis melo]
 ref|XP_008455419.1| PREDICTED: protein translation factor SUI1 homolog [Cucumis melo]
 ref|XP_008455420.1| PREDICTED: protein translation factor SUI1 homolog [Cucumis melo]
 gb|KGN43535.1| hypothetical protein Csa_7G044260 [Cucumis sativus]
Length=113

 Score =   133 bits (334),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 76/105 (72%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            P+AFDPF +A  E    G KEY H RIQQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  9    PSAFDPFADANAEDSGAGAKEYVHVRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV  G  KK+ IKIHGF
Sbjct  69   CNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKENIKIHGF  113



>ref|XP_002280157.1| PREDICTED: protein translation factor SUI1 homolog 1 [Vitis vinifera]
 ref|XP_003633291.1| PREDICTED: protein translation factor SUI1 homolog 1 [Vitis vinifera]
 emb|CBI28951.3| unnamed protein product [Vitis vinifera]
Length=113

 Score =   133 bits (334),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 75/105 (71%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PT FDPF +A  E    G KEY H RIQQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  9    PTTFDPFADANAEDSGAGTKEYVHVRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV  G  KK+ IKIHGF
Sbjct  69   CNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKENIKIHGF  113



>sp|O48650.1|SUI1_SALBA RecName: Full=Protein translation factor SUI1 homolog [Salix 
bakko]
 dbj|BAA24697.1| SUI1 homolog [Salix bakko]
Length=113

 Score =   133 bits (334),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 76/105 (72%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PTAFDPF EA  E    G K+Y H R+QQR G+KSLTTVQG++K+ S+ KILKDLKKEF 
Sbjct  9    PTAFDPFAEANAEDSGAGTKDYVHVRVQQRNGRKSLTTVQGLKKDYSYNKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV  G  KK+ IKIHGF
Sbjct  69   CNGTVVQDPELGQVIQLQGDQRKNVSSFLVQAGIVKKENIKIHGF  113



>ref|XP_009397784.1| PREDICTED: protein translation factor SUI1 homolog 2 [Musa acuminata 
subsp. malaccensis]
Length=113

 Score =   133 bits (334),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 76/105 (72%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PTAFDPF +A  E    G K+Y H RIQQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  9    PTAFDPFADANAEDSGAGTKDYVHIRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV  G  KK+ IKIHGF
Sbjct  69   CNGTVVQDPELGQVIQLQGDQRKNVSSFLVQAGIVKKEHIKIHGF  113



>ref|XP_008784556.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Phoenix 
dactylifera]
Length=113

 Score =   133 bits (334),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 75/105 (71%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PT FDPF EA  E    G KEY H R QQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  9    PTTFDPFAEANAEDSGAGAKEYVHVRTQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN + FLV  G  KK+QIKIHGF
Sbjct  69   CNGTVVQDPELGQVIQLQGDQRKNVATFLVQAGIVKKEQIKIHGF  113



>ref|XP_010267759.1| PREDICTED: protein translation factor SUI1 homolog [Nelumbo nucifera]
Length=113

 Score =   133 bits (334),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 74/105 (70%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PT FDPF EA  E    G KEY H RIQQR G+KSLTTVQG+RKE S+ KILKDLKKEF 
Sbjct  9    PTTFDPFAEANAEDSGAGSKEYVHVRIQQRNGRKSLTTVQGLRKEFSYNKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV     KK+ IKIHGF
Sbjct  69   CNGTVVQDPELGQVIQLQGDQRKNVSTFLVQARIVKKEHIKIHGF  113



>gb|KJB62619.1| hypothetical protein B456_009G426400 [Gossypium raimondii]
Length=213

 Score =   136 bits (342),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 76/105 (72%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PTAFDPF +A  E    G KEY H R+QQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  109  PTAFDPFADANAEDSGAGAKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFC  168

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV  G  KK+ IKIHGF
Sbjct  169  CNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKENIKIHGF  213



>ref|NP_001150984.1| GOS2 homolog [Zea mays]
 gb|ACG41169.1| protein translation factor SUI1 [Zea mays]
 gb|ACG48501.1| protein translation factor SUI1 [Zea mays]
 tpg|DAA57283.1| TPA: protein translation factor SUI1 isoform 1 [Zea mays]
 tpg|DAA57284.1| TPA: protein translation factor SUI1 isoform 2 [Zea mays]
Length=115

 Score =   133 bits (334),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 75/107 (70%), Gaps = 3/107 (3%)
 Frame = -3

Query  501  PTAFDPFXEAK---EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKE  331
            P+AFDPF EA         G K+Y H RIQQR G+KSLTTVQG++KE S+ KILKDLKKE
Sbjct  9    PSAFDPFAEANAEDSSAGAGSKDYVHVRIQQRNGRKSLTTVQGLKKEYSYNKILKDLKKE  68

Query  330  FXCNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            F CNG  VQD E G+  Q QGDQ KN + FLV  G  KKD IKIHGF
Sbjct  69   FCCNGTVVQDPELGQVIQLQGDQRKNVATFLVQAGIVKKDSIKIHGF  115



>ref|NP_001236633.1| uncharacterized protein LOC100499833 [Glycine max]
 gb|ACU13849.1| unknown [Glycine max]
Length=113

 Score =   133 bits (334),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 76/105 (72%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PTAFDPF +A  +    G KEY H R+QQR G+KSLTTVQG++KE S+ KILKD+KKEF 
Sbjct  9    PTAFDPFADANADDSGAGSKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDVKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV  G  KKD IKIHGF
Sbjct  69   CNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKDHIKIHGF  113



>emb|CDP20340.1| unnamed protein product [Coffea canephora]
Length=113

 Score =   133 bits (334),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 75/105 (71%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PT FDPF +A  +    G KEY H R+QQR G+KSLTTVQG+RKE S+ KILKDLKK+F 
Sbjct  9    PTTFDPFADATADDSGAGAKEYVHVRVQQRNGRKSLTTVQGLRKEYSYNKILKDLKKDFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E GK  Q QGDQ KN S FLV  G  KK+ IKIHGF
Sbjct  69   CNGTVVQDPELGKVIQLQGDQRKNVSAFLVQAGIVKKENIKIHGF  113



>sp|O82569.1|SUI1_PIMBR RecName: Full=Protein translation factor SUI1 homolog [Spuriopimpinella 
brachycarpa]
 gb|AAC61599.1| protein translation factor SUI1 homolog [Spuriopimpinella brachycarpa]
Length=113

 Score =   133 bits (334),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 75/105 (71%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAKEXGAPG-XKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PT+FDPF EA+   A G  KEY H RIQQR G+KSLTTVQG++KE S+ KILKDLKK   
Sbjct  9    PTSFDPFAEAEITDATGSTKEYVHIRIQQRNGRKSLTTVQGLKKELSYDKILKDLKKALC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  V DKE GK  Q QGDQ KN S F+V  G  KKDQIK+H F
Sbjct  69   CNGTVVNDKELGKVIQLQGDQRKNVSTFIVQAGIVKKDQIKVHNF  113



>gb|KDP39065.1| hypothetical protein JCGZ_00822 [Jatropha curcas]
Length=113

 Score =   133 bits (334),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 75/105 (71%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PT FDPF +A  E    G KEY H RIQQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  9    PTTFDPFADANAEDSGAGAKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV  G  KK+ IKIHGF
Sbjct  69   CNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKENIKIHGF  113



>gb|ADV04053.1| eukaryotic translation initiation factor 2 [Hevea brasiliensis]
Length=113

 Score =   133 bits (334),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 75/105 (71%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PT FDPF +A  E    G KEY H RIQQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  9    PTTFDPFADANAEDSGAGAKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV  G  KK+ IKIHGF
Sbjct  69   CNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKENIKIHGF  113



>gb|KHN46541.1| Protein translation factor SUI1 like 1 [Glycine soja]
Length=155

 Score =   134 bits (337),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 76/105 (72%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PTAFDPF +A  +    G KEY H R+QQR G+KSLTTVQG++KE S+ KILKD+KKEF 
Sbjct  51   PTAFDPFADANADDSGAGSKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDVKKEFC  110

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV  G  KKD IKIHGF
Sbjct  111  CNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKDHIKIHGF  155



>ref|XP_006370639.1| hypothetical protein POPTR_0001s44450g [Populus trichocarpa]
 ref|XP_006370640.1| Protein translation factor SUI1 1 family protein [Populus trichocarpa]
 gb|ABK94414.1| unknown [Populus trichocarpa]
 gb|ERP67208.1| hypothetical protein POPTR_0001s44450g [Populus trichocarpa]
 gb|ERP67209.1| Protein translation factor SUI1 1 family protein [Populus trichocarpa]
Length=113

 Score =   132 bits (333),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 75/105 (71%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PTAFDPF +A  E    G KEY H R QQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  9    PTAFDPFADANAEDSGAGAKEYVHIRTQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV  G  KK+ IKIHGF
Sbjct  69   CNGTVVQDLELGQVIQLQGDQRKNVSTFLVQAGIVKKENIKIHGF  113



>ref|XP_003527319.1| PREDICTED: protein translation factor SUI1 homolog 1 [Glycine 
max]
 gb|KHN46542.1| Protein translation factor SUI1 like 1 [Glycine soja]
Length=113

 Score =   132 bits (333),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 76/105 (72%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PTAFDPF +A  +    G KEY H R+QQR G+KSLTTVQG++KE S+ KILKD+KKEF 
Sbjct  9    PTAFDPFADANADDSGAGSKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDVKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV  G  KKD IKIHGF
Sbjct  69   CNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKDHIKIHGF  113



>ref|XP_011048301.1| PREDICTED: protein translation factor SUI1 homolog 2 [Populus 
euphratica]
Length=113

 Score =   132 bits (333),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 75/105 (71%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PTAFDPF +A  E    G KEY H R QQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  9    PTAFDPFADANAEDSGAGAKEYVHIRTQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV  G  KK+ IKIHGF
Sbjct  69   CNGTVVQDLELGQVIQLQGDQRKNVSTFLVQAGIVKKENIKIHGF  113



>ref|XP_004234488.1| PREDICTED: protein translation factor SUI1 homolog 1 [Solanum 
lycopersicum]
 ref|XP_006343300.1| PREDICTED: protein translation factor SUI1 homolog 1-like [Solanum 
tuberosum]
Length=113

 Score =   132 bits (333),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 66/105 (63%), Positives = 75/105 (71%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PT FDPF +A  +    G KEY H R+QQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  9    PTTFDPFADANAQNSGAGAKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FL+  G  KKD IKIHGF
Sbjct  69   CNGTVVQDPELGQVIQLQGDQRKNVSTFLIQAGIVKKDNIKIHGF  113



>ref|XP_010909791.1| PREDICTED: protein translation factor SUI1 homolog [Elaeis guineensis]
Length=113

 Score =   132 bits (333),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 75/105 (71%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PTAFD F EA  E    G KEY H RIQQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  9    PTAFDSFAEANAEDSGAGAKEYVHVRIQQRNGRKSLTTVQGLKKEFSYSKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN + FLV  G  KK+ IKIHGF
Sbjct  69   CNGTVVQDPELGQVIQLQGDQRKNVATFLVQAGIVKKEHIKIHGF  113



>gb|KHG06771.1| hypothetical protein F383_09792 [Gossypium arboreum]
 gb|KJB11988.1| hypothetical protein B456_002G083600 [Gossypium raimondii]
Length=113

 Score =   132 bits (333),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 76/105 (72%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PTAFDPF +A  E    G K+Y H R+QQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  9    PTAFDPFADANAEDSGAGAKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV  G  KK+ IKIHGF
Sbjct  69   CNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKENIKIHGF  113



>ref|XP_007132953.1| hypothetical protein PHAVU_011G139000g [Phaseolus vulgaris]
 gb|ESW04947.1| hypothetical protein PHAVU_011G139000g [Phaseolus vulgaris]
Length=113

 Score =   132 bits (333),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 76/105 (72%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PTAFDPF EA  +    G KEY H R+QQR G+KSLTTVQG++KE S+ KILKD+KKEF 
Sbjct  9    PTAFDPFAEANADDSGAGSKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDVKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV  G  KK+ IKIHGF
Sbjct  69   CNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  113



>ref|XP_007132952.1| hypothetical protein PHAVU_011G138900g [Phaseolus vulgaris]
 gb|ESW04946.1| hypothetical protein PHAVU_011G138900g [Phaseolus vulgaris]
Length=113

 Score =   132 bits (333),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 76/105 (72%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PTAFDPF EA  +    G KEY H R+QQR G+KSLTTVQG++KE S+ KILKD+KKEF 
Sbjct  9    PTAFDPFAEANADDSGAGSKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDVKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV  G  KK+ IKIHGF
Sbjct  69   CNGTVVQDPELGQVIQLQGDQRKNVSAFLVQAGIVKKEHIKIHGF  113



>ref|XP_009774027.1| PREDICTED: protein translation factor SUI1 homolog [Nicotiana 
sylvestris]
 ref|XP_009774028.1| PREDICTED: protein translation factor SUI1 homolog [Nicotiana 
sylvestris]
Length=113

 Score =   132 bits (332),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 76/105 (72%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PTAFDPF EA  +    G K+Y H RIQQR G+KSLTTVQG++KE S+ KILKDLKK+F 
Sbjct  9    PTAFDPFAEANADNSGAGSKDYVHIRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKDFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV  G  KK+ IKIHGF
Sbjct  69   CNGTVVQDPELGQVIQLQGDQRKNVSAFLVQAGIVKKEHIKIHGF  113



>gb|KJB81730.1| hypothetical protein B456_013G159400 [Gossypium raimondii]
 gb|KJB81731.1| hypothetical protein B456_013G159400 [Gossypium raimondii]
Length=112

 Score =   132 bits (332),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 76/104 (73%), Gaps = 0/104 (0%)
 Frame = -3

Query  501  PTAFDPFXEAKEXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFXC  322
            PT FDPF EA+E G+ G K+Y H RIQQR G+KSLTTV+G+++E S  KILK LKKEF C
Sbjct  9    PTTFDPFAEAEEFGSTGTKDYVHIRIQQRNGRKSLTTVEGLKQELSSDKILKSLKKEFCC  68

Query  321  NGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            NG  V DKE GK  Q QGDQ K  + FLV  G  KK+QIKIHGF
Sbjct  69   NGNVVHDKELGKIIQLQGDQRKKVAHFLVNAGIVKKEQIKIHGF  112



>ref|XP_009594373.1| PREDICTED: protein translation factor SUI1 homolog [Nicotiana 
tomentosiformis]
 ref|XP_009594374.1| PREDICTED: protein translation factor SUI1 homolog [Nicotiana 
tomentosiformis]
Length=113

 Score =   132 bits (332),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 76/105 (72%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PTAFDPF EA  +    G K+Y H RIQQR G+KSLTTVQG++KE S+ KILKDLKK+F 
Sbjct  9    PTAFDPFAEANADNSGAGSKDYVHIRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKDFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV  G  KK+ IKIHGF
Sbjct  69   CNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  113



>ref|XP_009342251.1| PREDICTED: protein translation factor SUI1 homolog [Pyrus x bretschneideri]
Length=113

 Score =   132 bits (332),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 66/105 (63%), Positives = 76/105 (72%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            P+AFDPF +A  E    G KEY H R+QQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  9    PSAFDPFTDANAENSGAGTKEYVHVRVQQRNGRKSLTTVQGLKKEYSYNKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  V+D E G+  Q QGDQ KN S FLV  G  KK+ IKIHGF
Sbjct  69   CNGTVVEDPELGQVIQLQGDQRKNVSSFLVQAGIVKKEHIKIHGF  113



>ref|XP_008341979.1| PREDICTED: protein translation factor SUI1 homolog [Malus domestica]
Length=113

 Score =   132 bits (331),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 66/105 (63%), Positives = 76/105 (72%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            P+AFDPF +A  E    G KEY H R+QQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  9    PSAFDPFADANAENSGAGTKEYVHVRVQQRNGRKSLTTVQGLKKEYSYNKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  V+D E G+  Q QGDQ KN S FLV  G  KK+ IKIHGF
Sbjct  69   CNGTVVEDPELGQVIQLQGDQRKNVSSFLVQAGIVKKEHIKIHGF  113



>ref|XP_003527483.1| PREDICTED: protein translation factor SUI1 homolog isoform 1 
[Glycine max]
 ref|XP_003527484.1| PREDICTED: protein translation factor SUI1 homolog isoform 2 
[Glycine max]
Length=113

 Score =   132 bits (331),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 66/105 (63%), Positives = 76/105 (72%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PTAFDPF +A  E    G KEY H R+QQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  9    PTAFDPFADANAEDSGAGTKEYVHVRVQQRNGRKSLTTVQGLKKEYSYSKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FL+  G  KK+ IK+HGF
Sbjct  69   CNGTVVQDPELGQVIQLQGDQRKNVSTFLMQAGIVKKEYIKLHGF  113



>ref|XP_006475205.1| PREDICTED: protein translation factor SUI1 homolog 2-like isoform 
X2 [Citrus sinensis]
 gb|KDO52967.1| hypothetical protein CISIN_1g033711mg [Citrus sinensis]
Length=113

 Score =   132 bits (331),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 76/105 (72%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            P AFDPF +AK E    G KEY H R+QQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  9    PAAFDPFADAKAEDSGAGSKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV  G  KK+ IK+HGF
Sbjct  69   CNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKMHGF  113



>ref|XP_010931827.1| PREDICTED: protein translation factor SUI1 homolog [Elaeis guineensis]
Length=113

 Score =   132 bits (331),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 75/105 (71%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PT FDPF EA  +    G KEY H RIQQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  9    PTTFDPFAEANADDSGAGAKEYVHVRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN + FLV  G  KK+ IKIHGF
Sbjct  69   CNGTVVQDPELGQVIQLQGDQRKNVATFLVQAGIVKKEHIKIHGF  113



>ref|XP_008809850.1| PREDICTED: protein translation factor SUI1 homolog [Phoenix dactylifera]
Length=113

 Score =   132 bits (331),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 69/106 (65%), Positives = 78/106 (74%), Gaps = 3/106 (3%)
 Frame = -3

Query  501  PTAFDPFXEAK--EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEF  328
            PTA+DPF EA   + GA G KEY H RIQQR G+KSLTTVQG++KE S+ KILKDLKKEF
Sbjct  9    PTAYDPFAEANAGDSGA-GSKEYVHVRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEF  67

Query  327  XCNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
             CNG  VQD E G+  Q QGDQ KN + FLV  G  KK+ IKIHGF
Sbjct  68   CCNGTVVQDPELGQVIQLQGDQRKNVATFLVQAGIVKKEHIKIHGF  113



>ref|XP_011030847.1| PREDICTED: protein translation factor SUI1 homolog [Populus euphratica]
Length=113

 Score =   132 bits (331),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 76/105 (72%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PTA+DPF +A  E    G K+Y H RIQQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  9    PTAYDPFADANAEDSGAGTKDYVHIRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV  G  KK+ IKIHGF
Sbjct  69   CNGTVVQDPELGQVIQLQGDQRKNVSTFLVQVGIVKKESIKIHGF  113



>ref|XP_003564393.1| PREDICTED: protein translation factor SUI1 homolog isoform X2 
[Brachypodium distachyon]
Length=115

 Score =   132 bits (331),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 75/107 (70%), Gaps = 3/107 (3%)
 Frame = -3

Query  501  PTAFDPFXEAK---EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKE  331
            P+AFDPF EA         G K+Y H R+QQR G+KSLTTVQG++KE S+ KILKDLKKE
Sbjct  9    PSAFDPFAEANAEDSSAGAGSKDYVHVRVQQRNGRKSLTTVQGLKKEYSYNKILKDLKKE  68

Query  330  FXCNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            F CNG  VQD E G+  Q QGDQ KN + FLV  G  KK+ IKIHGF
Sbjct  69   FCCNGTVVQDSELGQVIQLQGDQRKNVATFLVQAGLAKKESIKIHGF  115



>ref|XP_009401666.1| PREDICTED: protein translation factor SUI1 homolog [Musa acuminata 
subsp. malaccensis]
Length=113

 Score =   131 bits (330),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 75/105 (71%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PTAFDPF EA  +    G KEY H R+QQR G+K LTTVQG++KE S+ KILKDLKKEF 
Sbjct  9    PTAFDPFAEANADDSGVGAKEYVHVRVQQRNGRKCLTTVQGLKKEFSYNKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV  G  KK+ IKIHGF
Sbjct  69   CNGTVVQDPELGQVIQLQGDQRKNVSSFLVQAGIVKKEHIKIHGF  113



>ref|XP_002316065.1| hypothetical protein POPTR_0010s16160g [Populus trichocarpa]
 gb|ABK94563.1| unknown [Populus trichocarpa]
 gb|EEF02236.1| hypothetical protein POPTR_0010s16160g [Populus trichocarpa]
Length=108

 Score =   131 bits (330),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 75/104 (72%), Gaps = 3/104 (3%)
 Frame = -3

Query  501  PTAFDPFXEAKEXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFXC  322
            P+AFDPF +AK+ G    KEY H RIQQR GKKSLTTVQG+ KE S+ KILK LKK+F C
Sbjct  8    PSAFDPFADAKQSGT---KEYVHIRIQQRNGKKSLTTVQGLPKELSYEKILKTLKKDFCC  64

Query  321  NGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            NG  VQDKE GK  Q QGDQ KN   FLV     KKDQIKIHGF
Sbjct  65   NGNVVQDKELGKVIQLQGDQRKNVQNFLVNQNIVKKDQIKIHGF  108



>ref|XP_004248369.1| PREDICTED: protein translation factor SUI1 homolog [Solanum lycopersicum]
Length=113

 Score =   131 bits (330),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 75/105 (71%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            P AFDPF EA  +    G K+Y H RIQQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  9    PAAFDPFAEANADNSGAGTKDYVHIRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV  G  KK+ IKIHGF
Sbjct  69   CNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  113



>gb|ADV04054.1| eukaryotic translation initiation factor 3 [Hevea brasiliensis]
Length=113

 Score =   131 bits (330),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 76/105 (72%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            P+ FDPF +A  E    G KEY H RIQQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  9    PSTFDPFADANAEDSGAGAKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV  G  KK++IKIHGF
Sbjct  69   CNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEKIKIHGF  113



>ref|XP_009624679.1| PREDICTED: protein translation factor SUI1 homolog isoform X1 
[Nicotiana tomentosiformis]
Length=113

 Score =   131 bits (330),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 75/105 (71%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            P AFDPF EA  +    G K+Y H RIQQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  9    PNAFDPFAEANADNSGAGTKDYVHIRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV  G  KK+ IKIHGF
Sbjct  69   CNGTVVQDPELGQVIQLQGDQRKNVSTFLVQVGIVKKEHIKIHGF  113



>emb|CDY10602.1| BnaC03g70120D [Brassica napus]
 emb|CDY02466.1| BnaA08g00730D [Brassica napus]
Length=116

 Score =   131 bits (330),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 76/108 (70%), Gaps = 4/108 (4%)
 Frame = -3

Query  501  PTAFDPFXEAKEXGA---PGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKE  331
            PTAFDPF +A    A    G KEY H R+QQR G+KSLTTVQG++KE S+ KILKDLKKE
Sbjct  9    PTAFDPFADANAEDAGAGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSYTKILKDLKKE  68

Query  330  FXCNGXXVQDKEXGKXXQXQGDQXKNXSXFLV-XXGXXKKDQIKIHGF  190
            F CNG  VQD E G+  Q QGDQ KN S FLV   G  KKD IKIHGF
Sbjct  69   FCCNGTVVQDSELGQVIQLQGDQRKNVSTFLVQQAGLVKKDNIKIHGF  116



>gb|AFW78548.1| LOW QUALITY PROTEIN: protein translation factor SUI1 [Zea mays]
Length=185

 Score =   133 bits (335),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 80/107 (75%), Gaps = 3/107 (3%)
 Frame = -3

Query  501  PTAFDPFXEA--KEXGA-PGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKE  331
            P+AFDPF EA  ++ GA PG K+Y H RIQQR G+KSLTTVQG++KE S+ KILKDLKKE
Sbjct  79   PSAFDPFAEANAEDSGAGPGTKDYVHVRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKE  138

Query  330  FXCNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            F CNG  VQD E G+  Q QGDQ KN + FLV  G  KK+ IKIHGF
Sbjct  139  FCCNGTVVQDPELGQVIQLQGDQRKNVATFLVQAGIAKKENIKIHGF  185



>ref|XP_009771770.1| PREDICTED: protein translation factor SUI1 homolog [Nicotiana 
sylvestris]
 ref|XP_009771771.1| PREDICTED: protein translation factor SUI1 homolog [Nicotiana 
sylvestris]
Length=113

 Score =   131 bits (329),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 75/105 (71%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            P AFDPF EA  +    G K+Y H RIQQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  9    PNAFDPFAEANADNSGAGTKDYVHIRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV  G  KK+ IKIHGF
Sbjct  69   CNGTVVQDPELGQVIQLQGDQRKNVSTFLVQVGIVKKEHIKIHGF  113



>ref|XP_006352492.1| PREDICTED: protein translation factor SUI1 homolog [Solanum tuberosum]
Length=113

 Score =   131 bits (329),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 75/105 (71%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            P AFDPF EA  +    G K+Y H RIQQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  9    PAAFDPFAEANADNSGAGTKDYVHIRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV  G  KK+ IKIHGF
Sbjct  69   CNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEYIKIHGF  113



>ref|NP_001238017.1| uncharacterized protein LOC100306129 [Glycine max]
 gb|ACU14161.1| unknown [Glycine max]
 gb|KHN47859.1| Protein translation factor SUI1 like 1 [Glycine soja]
Length=113

 Score =   131 bits (329),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/105 (63%), Positives = 76/105 (72%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PTAFDPF +A  +    G KEY H R+QQR G+KSLTTVQG++KE S+ KILKD+KKEF 
Sbjct  9    PTAFDPFADANADDSGAGSKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDVKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV  G  KK+ IKIHGF
Sbjct  69   CNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  113



>gb|EYU33614.1| hypothetical protein MIMGU_mgv1a016641mg [Erythranthe guttata]
Length=113

 Score =   131 bits (329),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/105 (63%), Positives = 75/105 (71%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PT FDPF +A  E    G K+Y H R+QQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  9    PTTFDPFADANAENSGAGTKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV  G  KK+ IKIHGF
Sbjct  69   CNGTVVQDPELGQVIQLQGDQRKNVSSFLVQAGIVKKEHIKIHGF  113



>ref|XP_002458630.1| hypothetical protein SORBIDRAFT_03g036990 [Sorghum bicolor]
 gb|EES03750.1| hypothetical protein SORBIDRAFT_03g036990 [Sorghum bicolor]
Length=115

 Score =   131 bits (329),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/107 (62%), Positives = 75/107 (70%), Gaps = 3/107 (3%)
 Frame = -3

Query  501  PTAFDPFXEAK---EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKE  331
            P+AFDPF EA         G K+Y H RIQQR G+KSLTTVQG++KE S+ KILKDLKKE
Sbjct  9    PSAFDPFAEANAEDSSAGAGSKDYVHVRIQQRNGRKSLTTVQGLKKEYSYNKILKDLKKE  68

Query  330  FXCNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            F CNG  VQD E G+  Q QGDQ KN + FLV  G  KK+ IKIHGF
Sbjct  69   FCCNGTVVQDPELGQVIQLQGDQRKNVATFLVEAGIVKKESIKIHGF  115



>emb|CDP05794.1| unnamed protein product [Coffea canephora]
Length=113

 Score =   131 bits (329),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 74/105 (70%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            P AFDPF EA  +    G K+Y H RIQQR G+KSLTTVQG+ KE S+ KILKDLKKEF 
Sbjct  9    PAAFDPFAEANADNSGAGSKDYVHIRIQQRNGRKSLTTVQGLNKEFSYNKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV  G  KK+ IKIHGF
Sbjct  69   CNGTVVQDPELGQVIQLQGDQRKNVSSFLVQAGIVKKEHIKIHGF  113



>ref|XP_002960838.1| hypothetical protein SELMODRAFT_437304 [Selaginella moellendorffii]
 ref|XP_002983834.1| hypothetical protein SELMODRAFT_268797 [Selaginella moellendorffii]
 gb|EFJ14846.1| hypothetical protein SELMODRAFT_268797 [Selaginella moellendorffii]
 gb|EFJ38377.1| hypothetical protein SELMODRAFT_437304 [Selaginella moellendorffii]
Length=114

 Score =   131 bits (329),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 75/106 (71%), Gaps = 2/106 (2%)
 Frame = -3

Query  501  PTAFDPFXEA--KEXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEF  328
            P A+DPF EA  +E G  G  EY H R+QQR G+KSLTTVQG+RKE ++ KILKD KKEF
Sbjct  9    PGAYDPFAEANAEESGGVGSAEYVHVRVQQRNGRKSLTTVQGLRKEFNYNKILKDFKKEF  68

Query  327  XCNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
             CNG  VQD E G+  Q QGDQ KN S FLV  G  KKD IKIHGF
Sbjct  69   CCNGTVVQDPELGQVIQLQGDQRKNVSQFLVQAGVVKKDLIKIHGF  114



>gb|KHN41202.1| Protein translation factor SUI1 like [Glycine soja]
Length=113

 Score =   130 bits (328),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/105 (63%), Positives = 76/105 (72%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PTAFDPF +A  E    G KEY H R+QQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  9    PTAFDPFADANAEDSGAGTKEYVHVRVQQRNGRKSLTTVQGLKKEYSYSKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FL+  G  KK+ IK+HGF
Sbjct  69   CNGTVVQDPELGQVIQLQGDQRKNVSTFLMQAGIVKKEFIKLHGF  113



>ref|XP_010232448.1| PREDICTED: protein translation factor SUI1 homolog 2-like isoform 
X1 [Brachypodium distachyon]
Length=143

 Score =   132 bits (331),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 75/107 (70%), Gaps = 3/107 (3%)
 Frame = -3

Query  501  PTAFDPFXEAK---EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKE  331
            P+AFDPF EA         G K+Y H R+QQR G+KSLTTVQG++KE S+ KILKDLKKE
Sbjct  37   PSAFDPFAEANAEDSSAGAGSKDYVHVRVQQRNGRKSLTTVQGLKKEYSYNKILKDLKKE  96

Query  330  FXCNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            F CNG  VQD E G+  Q QGDQ KN + FLV  G  KK+ IKIHGF
Sbjct  97   FCCNGTVVQDSELGQVIQLQGDQRKNVATFLVQAGLAKKESIKIHGF  143



>ref|XP_009412007.1| PREDICTED: protein translation factor SUI1 homolog [Musa acuminata 
subsp. malaccensis]
 ref|XP_009412008.1| PREDICTED: protein translation factor SUI1 homolog [Musa acuminata 
subsp. malaccensis]
Length=113

 Score =   130 bits (328),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 75/105 (71%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PTAFDPF EA  +    G KEY H R+QQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  9    PTAFDPFAEANADDSGAGAKEYVHVRVQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FL   G  KK+ IKIHGF
Sbjct  69   CNGTVVQDPELGQVIQLQGDQRKNVSNFLSQTGIVKKEYIKIHGF  113



>emb|CAD58628.1| SUI1 protein [Coffea arabica]
Length=113

 Score =   130 bits (328),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 75/105 (71%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            P AFDPF EA  +    G K+Y H RIQQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  9    PAAFDPFAEANADNSGDGSKDYVHIRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV  G  KK+ IKIHGF
Sbjct  69   CNGTVVQDPELGQVIQLQGDQRKNVSSFLVQAGIVKKEHIKIHGF  113



>gb|EEE67305.1| hypothetical protein OsJ_24532 [Oryza sativa Japonica Group]
Length=230

 Score =   134 bits (337),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 76/107 (71%), Gaps = 3/107 (3%)
 Frame = -3

Query  501  PTAFDPFXEAK---EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKE  331
            PTAFDPF EA       A G K+Y H RIQQR G+KSLTTVQG++KE S+ KILKDLKKE
Sbjct  124  PTAFDPFAEANAGDSGAAAGSKDYVHVRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKE  183

Query  330  FXCNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            F CNG  VQD E G+  Q QGDQ KN S FLV  G  KK+ IKIHGF
Sbjct  184  FCCNGTVVQDPELGQVIQLQGDQRKNVSNFLVQAGIVKKEHIKIHGF  230



>ref|XP_009388867.1| PREDICTED: protein translation factor SUI1 homolog [Musa acuminata 
subsp. malaccensis]
Length=113

 Score =   130 bits (328),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/105 (63%), Positives = 76/105 (72%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PT FDPF +A  +    G KEY H RIQQR G+KSLTTVQG++KE S+ KILKDLK+EF 
Sbjct  9    PTTFDPFADANADDSGAGAKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKREFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV  G  KK++IKIHGF
Sbjct  69   CNGTVVQDPELGQVIQLQGDQRKNVSNFLVQAGIVKKERIKIHGF  113



>ref|XP_004515084.1| PREDICTED: protein translation factor SUI1 homolog isoform X2 
[Cicer arietinum]
Length=113

 Score =   130 bits (328),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/105 (62%), Positives = 75/105 (71%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            P+ FDPF EA  E    G KEY H R+QQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  9    PSTFDPFAEANAEDSGAGTKEYVHVRVQQRNGRKSLTTVQGLKKEYSYSKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  V+D E G+  Q QGDQ KN S FLV  G  KK+ IK+HGF
Sbjct  69   CNGTVVEDPELGQVIQLQGDQRKNVSTFLVQAGIVKKENIKLHGF  113



>gb|EYU19220.1| hypothetical protein MIMGU_mgv1a016636mg [Erythranthe guttata]
Length=113

 Score =   130 bits (328),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/105 (62%), Positives = 76/105 (72%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            P+A+DPF +A  E    G K+Y H R+QQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  9    PSAYDPFADANAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV  G  KK+ IKIHGF
Sbjct  69   CNGTVVQDPELGQVIQLQGDQRKNVSSFLVQAGIVKKEHIKIHGF  113



>ref|XP_004287929.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Fragaria 
vesca subsp. vesca]
Length=113

 Score =   130 bits (328),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/105 (62%), Positives = 75/105 (71%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            P+ FDPF +A  E    G KEY H R+QQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  9    PSTFDPFADANAEDSGAGTKEYVHVRVQQRNGRKSLTTVQGLKKEYSYNKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV  G  KK+ IK+HGF
Sbjct  69   CNGTVVQDPELGQVIQLQGDQRKNVSSFLVQAGIVKKENIKLHGF  113



>ref|XP_006447521.1| hypothetical protein CICLE_v10017243mg [Citrus clementina]
 ref|XP_006469705.1| PREDICTED: protein translation factor SUI1 homolog [Citrus sinensis]
 gb|ESR60761.1| hypothetical protein CICLE_v10017243mg [Citrus clementina]
 gb|KDO59835.1| hypothetical protein CISIN_1g039810mg [Citrus sinensis]
Length=113

 Score =   130 bits (328),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 76/105 (72%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            P+AFDPF EA  E    G K+Y H R+QQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  9    PSAFDPFAEANAEDSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV  G  KK+ IKIHGF
Sbjct  69   CNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEFIKIHGF  113



>ref|XP_002316980.1| hypothetical protein POPTR_0011s13810g [Populus trichocarpa]
 ref|XP_006377838.1| hypothetical protein POPTR_0011s13810g [Populus trichocarpa]
 gb|ABK93182.1| unknown [Populus trichocarpa]
 gb|ABK93949.1| unknown [Populus trichocarpa]
 gb|EEE97592.1| hypothetical protein POPTR_0011s13810g [Populus trichocarpa]
 gb|ERP55635.1| hypothetical protein POPTR_0011s13810g [Populus trichocarpa]
Length=113

 Score =   130 bits (328),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/105 (63%), Positives = 76/105 (72%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            P+A+DPF +A  E    G K+Y H RIQQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  9    PSAYDPFADANAEDSGAGTKDYVHIRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV  G  KK+ IKIHGF
Sbjct  69   CNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKESIKIHGF  113



>ref|XP_009611793.1| PREDICTED: protein translation factor SUI1 homolog [Nicotiana 
tomentosiformis]
 ref|XP_009792850.1| PREDICTED: protein translation factor SUI1 homolog [Nicotiana 
sylvestris]
 ref|XP_009792852.1| PREDICTED: protein translation factor SUI1 homolog [Nicotiana 
sylvestris]
Length=113

 Score =   130 bits (327),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 75/105 (71%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PTAFDPF EA  +    G K+Y H RIQQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  9    PTAFDPFAEANADNSGAGSKDYVHIRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV     KK+ IKIHGF
Sbjct  69   CNGTVVQDPELGQVIQLQGDQRKNVSAFLVQAEIVKKEHIKIHGF  113



>gb|KEH29652.1| eukaryotic translation initiation factor SUI1 [Medicago truncatula]
Length=113

 Score =   130 bits (327),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/105 (62%), Positives = 76/105 (72%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PT +DPF EA  E    G KEY H R+QQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  9    PTTYDPFAEANAEDSGAGTKEYVHVRVQQRNGRKSLTTVQGLKKEFSYSKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  V+D E G+  Q QGDQ KN S FLV  G  KK++IK+HGF
Sbjct  69   CNGTVVEDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEKIKLHGF  113



>ref|XP_009603077.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Nicotiana 
tomentosiformis]
Length=113

 Score =   130 bits (327),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/105 (62%), Positives = 75/105 (71%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PT FDPF +A  +    G KEY H R+QQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  9    PTTFDPFADANAQNSGAGAKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FL+  G  KK+ IKIHGF
Sbjct  69   CNGTVVQDPELGQVIQLQGDQRKNVSAFLIQAGIVKKENIKIHGF  113



>ref|XP_009408662.1| PREDICTED: protein translation factor SUI1 homolog [Musa acuminata 
subsp. malaccensis]
 ref|XP_009408663.1| PREDICTED: protein translation factor SUI1 homolog [Musa acuminata 
subsp. malaccensis]
Length=113

 Score =   130 bits (327),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 66/105 (63%), Positives = 76/105 (72%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            P+AFDPF +A  +    G K+Y H RIQQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  9    PSAFDPFADANADDSGAGTKDYVHIRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV  G  KK+ IKIHGF
Sbjct  69   CNGTVVQDPELGQVIQLQGDQRKNASNFLVQAGIVKKEHIKIHGF  113



>ref|XP_008230087.1| PREDICTED: protein translation factor SUI1 homolog [Prunus mume]
 ref|XP_008230088.1| PREDICTED: protein translation factor SUI1 homolog [Prunus mume]
Length=113

 Score =   130 bits (327),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 65/105 (62%), Positives = 76/105 (72%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            P+AFDPF +A  E    G KEY H R+QQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  9    PSAFDPFADANAEDSGAGTKEYVHVRVQQRNGRKSLTTVQGLKKEYSYNKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  V+D E G+  Q QGDQ KN S FLV  G  KK+ IK+HGF
Sbjct  69   CNGTVVEDPELGQVIQLQGDQRKNVSSFLVQAGIVKKEDIKLHGF  113



>ref|NP_001044504.2| Os01g0794500 [Oryza sativa Japonica Group]
 dbj|BAD53005.1| putative translation initiation factor [Oryza sativa Japonica 
Group]
 gb|EEC71629.1| hypothetical protein OsI_04056 [Oryza sativa Indica Group]
 dbj|BAF06418.2| Os01g0794500 [Oryza sativa Japonica Group]
Length=115

 Score =   130 bits (327),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 66/107 (62%), Positives = 76/107 (71%), Gaps = 3/107 (3%)
 Frame = -3

Query  501  PTAFDPFXEAKEXGA---PGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKE  331
            P+AFDPF EA    +    G K+Y H RIQQR G+KSLTTVQG++KE S+ KILKDLKKE
Sbjct  9    PSAFDPFAEANAEDSSVGAGSKDYVHVRIQQRNGRKSLTTVQGLKKEYSYNKILKDLKKE  68

Query  330  FXCNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            F CNG  VQD E G+  Q QGDQ KN + FLV  G  KK+ IKIHGF
Sbjct  69   FCCNGTVVQDPELGQVIQLQGDQRKNVATFLVQAGIVKKESIKIHGF  115



>gb|ABO15891.1| translation initiation factor eIF1 [synthetic construct]
 gb|ABX61094.1| putative translation initiation factor [Triticum aestivum]
 gb|ADD62702.1| eukaryotic translation initiation factor 1 [Leymus chinensis]
 emb|CDM84532.1| unnamed protein product [Triticum aestivum]
Length=115

 Score =   130 bits (327),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 78/107 (73%), Gaps = 3/107 (3%)
 Frame = -3

Query  501  PTAFDPFXEA--KEXGA-PGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKE  331
            PTAFDPF EA  ++ GA  G K Y H R+QQR G+KSLTTVQG++K+ S+ KILKDLKKE
Sbjct  9    PTAFDPFAEANAEDSGAGAGSKNYVHVRVQQRNGRKSLTTVQGLKKDYSYNKILKDLKKE  68

Query  330  FXCNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            F CNG  VQD E G+  Q QGDQ KN + FLV  G  KK+ IKIHGF
Sbjct  69   FCCNGTVVQDPELGQVIQLQGDQRKNVATFLVQAGLAKKESIKIHGF  115



>ref|XP_010694233.1| PREDICTED: protein translation factor SUI1 homolog [Beta vulgaris 
subsp. vulgaris]
Length=113

 Score =   130 bits (326),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 65/105 (62%), Positives = 75/105 (71%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            P A+DPF +A  E    G K+Y H R+QQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  9    PAAYDPFADANAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV  G  KK+ IKIHGF
Sbjct  69   CNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  113



>ref|XP_004970238.1| PREDICTED: protein translation factor SUI1 homolog isoform X2 
[Setaria italica]
Length=115

 Score =   130 bits (327),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 74/107 (69%), Gaps = 3/107 (3%)
 Frame = -3

Query  501  PTAFDPFXEAK---EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKE  331
            P+AFDPF EA         G KEY H R+QQR G+KSLTTVQG++KE S+ KILKDLKKE
Sbjct  9    PSAFDPFAEANAEDSSAGAGSKEYVHVRVQQRNGRKSLTTVQGLKKEYSYNKILKDLKKE  68

Query  330  FXCNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            F CNG  VQD E G+  Q QGDQ KN + FL   G  KK+ IKIHGF
Sbjct  69   FCCNGTVVQDPELGQVIQLQGDQRKNVATFLTQAGIAKKETIKIHGF  115



>gb|AGT16828.1| protein translation factor SUI1 [Saccharum hybrid cultivar R570]
Length=116

 Score =   130 bits (326),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 66/107 (62%), Positives = 74/107 (69%), Gaps = 3/107 (3%)
 Frame = -3

Query  501  PTAFDPFXEAK---EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKE  331
            P+AFDPF EA         G K+Y H R QQR G+KSLTTVQG++KE S+ KILKDLKKE
Sbjct  10   PSAFDPFAEANAEDSSAGAGSKDYVHVRSQQRNGRKSLTTVQGLKKEYSYNKILKDLKKE  69

Query  330  FXCNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            F CNG  VQD E G+  Q QGDQ KN + FLV  G  KKD IKIHGF
Sbjct  70   FCCNGTVVQDPELGQVIQLQGDQRKNVATFLVQAGIVKKDSIKIHGF  116



>emb|CDO99708.1| unnamed protein product [Coffea canephora]
Length=113

 Score =   130 bits (326),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 64/105 (61%), Positives = 76/105 (72%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PT FDPF +A  +  + G KEY H RIQQR G+KSLTTVQG++KE S+ KILKDLKK+F 
Sbjct  9    PTTFDPFADANADNSSAGSKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKDFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FL+  G  KK+ IK+HGF
Sbjct  69   CNGTVVQDPELGQVIQLQGDQRKNVSTFLIQAGIVKKENIKLHGF  113



>gb|AFK43238.1| unknown [Medicago truncatula]
Length=113

 Score =   130 bits (326),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 64/105 (61%), Positives = 76/105 (72%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PT +DPF EA  E    G KEY H R+QQR G++SLTTVQG++KE S+ KILKDLKKEF 
Sbjct  9    PTTYDPFAEANAEDSGAGTKEYVHVRVQQRNGRRSLTTVQGLKKEFSYSKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  V+D E G+  Q QGDQ KN S FLV  G  KK++IK+HGF
Sbjct  69   CNGTVVEDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEKIKLHGF  113



>gb|KHG17081.1| Protein translation factor SUI1 [Gossypium arboreum]
Length=164

 Score =   131 bits (330),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 75/104 (72%), Gaps = 0/104 (0%)
 Frame = -3

Query  501  PTAFDPFXEAKEXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFXC  322
            PT FDPF EA+E G  G K+Y H RIQQR G+KSLTTV+G+++E S  KILK LKKEF C
Sbjct  61   PTTFDPFAEAEEFGRTGTKDYVHIRIQQRNGRKSLTTVEGLKQELSSDKILKSLKKEFCC  120

Query  321  NGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            NG  V DKE GK  Q QGDQ K  + FLV  G  KK+QIKIHGF
Sbjct  121  NGNVVHDKELGKIIQLQGDQRKKVAHFLVNAGIVKKEQIKIHGF  164



>ref|XP_002522857.1| translation factor sui1, putative [Ricinus communis]
 gb|EEF39555.1| translation factor sui1, putative [Ricinus communis]
Length=138

 Score =   130 bits (328),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 74/105 (70%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PT FDPF +A  E    G KEY H RIQQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  34   PTTFDPFADANAEDSGAGAKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFC  93

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FL   G  KK+ IKIHGF
Sbjct  94   CNGTVVQDPELGQVIQLQGDQRKNVSSFLTGAGIVKKENIKIHGF  138



>gb|ABI48954.1| putative protein translation factor Sui1 [Viola baoshanensis]
Length=113

 Score =   130 bits (326),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 66/105 (63%), Positives = 75/105 (71%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            P+AFDPF +A  E    G K+Y H RIQQR G+KSLTTVQG++K+ S+ KILKD KKEF 
Sbjct  9    PSAFDPFADASTEDSGAGTKDYVHIRIQQRNGRKSLTTVQGLKKDFSYNKILKDXKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV  G  KKD IKIHGF
Sbjct  69   CNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKDNIKIHGF  113



>gb|EPS74118.1| hypothetical protein M569_00639 [Genlisea aurea]
Length=113

 Score =   129 bits (325),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 65/105 (62%), Positives = 75/105 (71%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PT FDPF +A  E    G K+Y H R+QQR G+KSLTTVQG++KE S+ KILKDLKK+F 
Sbjct  9    PTTFDPFADANAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDLKKDFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV  G  KK+ IKIHGF
Sbjct  69   CNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  113



>ref|XP_009800522.1| PREDICTED: protein translation factor SUI1 homolog 2 [Nicotiana 
sylvestris]
Length=113

 Score =   129 bits (325),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 64/105 (61%), Positives = 75/105 (71%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PT FDPF +A  +    G KEY H R+QQR G+KSLTTVQG+++E S+ KILKDLKKEF 
Sbjct  9    PTNFDPFADANAQNSGAGAKEYVHIRVQQRNGRKSLTTVQGLKREFSYNKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FL+  G  KK+ IKIHGF
Sbjct  69   CNGTVVQDPELGQVIQLQGDQRKNVSTFLIQAGIVKKENIKIHGF  113



>gb|EEE55519.1| hypothetical protein OsJ_03741 [Oryza sativa Japonica Group]
Length=165

 Score =   130 bits (328),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 66/107 (62%), Positives = 76/107 (71%), Gaps = 3/107 (3%)
 Frame = -3

Query  501  PTAFDPFXEAKEXGA---PGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKE  331
            P+AFDPF EA    +    G K+Y H RIQQR G+KSLTTVQG++KE S+ KILKDLKKE
Sbjct  59   PSAFDPFAEANAEDSSVGAGSKDYVHVRIQQRNGRKSLTTVQGLKKEYSYNKILKDLKKE  118

Query  330  FXCNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            F CNG  VQD E G+  Q QGDQ KN + FLV  G  KK+ IKIHGF
Sbjct  119  FCCNGTVVQDPELGQVIQLQGDQRKNVATFLVQAGIVKKESIKIHGF  165



>ref|XP_007216425.1| hypothetical protein PRUPE_ppa022105mg, partial [Prunus persica]
 gb|EMJ17624.1| hypothetical protein PRUPE_ppa022105mg, partial [Prunus persica]
Length=170

 Score =   131 bits (329),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 65/105 (62%), Positives = 76/105 (72%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            P+AFDPF +A  E    G KEY H R+QQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  66   PSAFDPFADANAEDSGAGTKEYVHVRVQQRNGRKSLTTVQGLKKEYSYNKILKDLKKEFC  125

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  V+D E G+  Q QGDQ KN S FLV  G  KK+ IK+HGF
Sbjct  126  CNGTVVEDPELGQVIQLQGDQRKNVSSFLVQAGIVKKEDIKLHGF  170



>gb|KCW46999.1| hypothetical protein EUGRSUZ_K00804 [Eucalyptus grandis]
Length=114

 Score =   129 bits (323),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 77/106 (73%), Gaps = 2/106 (2%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PT FDPF +AK E    G KEY H R+QQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  9    PTTFDPFADAKAEDSGAGSKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLV-XXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV   G  KK++IKIHGF
Sbjct  69   CNGTVVQDPELGQVIQLQGDQRKNVSTFLVQQAGIVKKERIKIHGF  114



>gb|KEH38844.1| eukaryotic translation initiation factor SUI1 [Medicago truncatula]
Length=116

 Score =   129 bits (324),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 75/106 (71%), Gaps = 2/106 (2%)
 Frame = -3

Query  501  PTAFDPFXEA--KEXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEF  328
             T  DPF EA  ++ GA   KEY H RIQQR G+KSLTTVQG++KE S+ KILKDLKKEF
Sbjct  11   ATILDPFAEANAEDAGAGSSKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEF  70

Query  327  XCNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
             CNG  VQD E G+  Q QGDQ KN S FLV  G  KK+ IKIHGF
Sbjct  71   CCNGTVVQDPEQGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  116



>emb|CAD58629.1| SUI1 protein [Coffea arabica]
Length=113

 Score =   129 bits (323),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 73/104 (70%), Gaps = 1/104 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            P AFDPF EA  +    G K+Y H RIQQR G+KSLTTVQG+ KE S+ KILKDLKKEF 
Sbjct  9    PAAFDPFAEANADNSGAGSKDYVHIRIQQRNGRKSLTTVQGLNKEFSYNKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHG  193
            CNG  VQD E G+  Q QGDQ KN S FLV  G  KK+ IKIHG
Sbjct  69   CNGTVVQDPELGQVIQLQGDQRKNVSSFLVQAGIVKKEHIKIHG  112



>ref|XP_002532561.1| translation factor sui1, putative [Ricinus communis]
 gb|EEF29822.1| translation factor sui1, putative [Ricinus communis]
Length=109

 Score =   128 bits (321),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 73/104 (70%), Gaps = 3/104 (3%)
 Frame = -3

Query  501  PTAFDPFXEAKEXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFXC  322
            PTAFDPF EAK+ GA   K+Y H RI QR GKK+LTTVQG+ KE S  KILK LKKEF C
Sbjct  9    PTAFDPFSEAKDSGA---KDYVHIRIYQRNGKKNLTTVQGLPKEYSLEKILKSLKKEFCC  65

Query  321  NGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            NG  VQDK+ GK  Q QGDQ KN   FLV     +KD IKIHGF
Sbjct  66   NGNVVQDKDLGKIIQLQGDQRKNVQSFLVSANLVRKDLIKIHGF  109



>gb|ABY75806.1| SUI1 A protein [Opuntia streptacantha]
Length=113

 Score =   128 bits (321),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 74/105 (70%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            P A+DPF +A  E    G K+Y H R+QQR G+KSLTTVQG+ K+ S+ KILKDLKKEF 
Sbjct  9    PAAYDPFADANAENSGAGAKDYVHIRVQQRNGRKSLTTVQGLNKQFSYNKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  V+D E G+  Q QGDQ KN S FLV  G  KK+ IKIHGF
Sbjct  69   CNGTVVZDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  113



>ref|XP_010272070.1| PREDICTED: protein translation factor SUI1 homolog [Nelumbo nucifera]
 ref|XP_010272071.1| PREDICTED: protein translation factor SUI1 homolog [Nelumbo nucifera]
 ref|XP_010272072.1| PREDICTED: protein translation factor SUI1 homolog [Nelumbo nucifera]
Length=112

 Score =   128 bits (321),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 73/105 (70%), Gaps = 2/105 (2%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PTAFDPF EA  E    G KEY H RIQQR G+KSLTTVQG+ KE S+ KILKDLK E  
Sbjct  9    PTAFDPFAEANAEDSGAGSKEYVHVRIQQRNGRKSLTTVQGLTKEFSYTKILKDLK-ELC  67

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV  G  KK+ IKIHGF
Sbjct  68   CNGTVVQDPELGQVVQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  112



>ref|XP_004159225.1| PREDICTED: protein translation factor SUI1 homolog [Cucumis sativus]
Length=177

 Score =   130 bits (326),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 75/105 (71%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            P+AFDPF +A  E    G KEY H RIQQR G+KS TTVQG++KE S+ KILKDLKKEF 
Sbjct  73   PSAFDPFADANAEDSGAGAKEYVHVRIQQRNGRKSPTTVQGLKKEFSYNKILKDLKKEFC  132

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV  G  KK+ IKIHGF
Sbjct  133  CNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKENIKIHGF  177



>ref|XP_008810164.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Phoenix 
dactylifera]
Length=180

 Score =   130 bits (326),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 74/105 (70%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PT+FDPF EA  E    G KEY H RIQQR G+K LTTVQG++KE S  KILKDLKKEF 
Sbjct  9    PTSFDPFAEANAEDSDAGAKEYVHVRIQQRNGRKCLTTVQGLKKEFSCNKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN + FLV  G  KK+ IKIHGF
Sbjct  69   CNGTVVQDPELGQVIQLQGDQRKNVATFLVQAGIVKKEHIKIHGF  113



>ref|XP_002985789.1| hypothetical protein SELMODRAFT_234882 [Selaginella moellendorffii]
 gb|EFJ12966.1| hypothetical protein SELMODRAFT_234882 [Selaginella moellendorffii]
Length=113

 Score =   127 bits (320),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 65/105 (62%), Positives = 74/105 (70%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            P AFDPF EA  +    G KEY H RIQQR G+KSLTTVQG++KE ++ +ILKD K+EF 
Sbjct  9    PGAFDPFAEANVDDQGAGSKEYVHVRIQQRNGRKSLTTVQGLKKEFNYNRILKDFKREFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  V D E G+  Q QGDQ KN S FLV  G  KKDQIKIHGF
Sbjct  69   CNGTVVDDTELGQVIQLQGDQRKNVSQFLVQAGVAKKDQIKIHGF  113



>gb|KDP20792.1| hypothetical protein JCGZ_21263 [Jatropha curcas]
Length=113

 Score =   127 bits (320),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 65/105 (62%), Positives = 73/105 (70%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAKEXGA-PGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PTAFDP  EA    +  G KEY H R+QQR G+KSLTTVQG++KE S+  ILKDLKKEF 
Sbjct  9    PTAFDPLAEANAADSGAGAKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNMILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV     KK+ IKIHGF
Sbjct  69   CNGTVVQDPELGQVIQLQGDQRKNVSTFLVQARIVKKEHIKIHGF  113



>ref|XP_009398183.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Musa 
acuminata subsp. malaccensis]
Length=113

 Score =   127 bits (319),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 76/105 (72%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAKEXGAP-GXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PTAFDPF +A    +  G KEY H RIQQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  9    PTAFDPFADANADDSDAGTKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FLV  G  KK+ IKIHGF
Sbjct  69   CNGTVVQDPELGQVIQLQGDQRKNVSNFLVQAGIVKKENIKIHGF  113



>ref|XP_006644837.1| PREDICTED: protein translation factor SUI1 homolog [Oryza brachyantha]
Length=115

 Score =   127 bits (318),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 75/107 (70%), Gaps = 3/107 (3%)
 Frame = -3

Query  501  PTAFDPFXEAKEXGAP---GXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKE  331
            P+AFDPF EA    +    G K+Y H RIQQR G+KSLTTVQG++KE S+ KILKDLKKE
Sbjct  9    PSAFDPFAEANAEDSSVGTGSKDYVHVRIQQRNGRKSLTTVQGLKKEYSYNKILKDLKKE  68

Query  330  FXCNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            F CNG  VQD E G+  Q QGDQ KN + FL   G  KK+ IKIHGF
Sbjct  69   FCCNGTVVQDPELGQVIQLQGDQRKNVATFLDKAGIAKKESIKIHGF  115



>ref|XP_008647990.1| PREDICTED: LOC100286322 isoform X2 [Zea mays]
Length=120

 Score =   127 bits (318),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 77/106 (73%), Gaps = 3/106 (3%)
 Frame = -3

Query  498  TAFDPFXEA--KEXGA-PGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEF  328
            +  DPF EA  ++ GA PG K+Y H RIQQR G+KSLTTVQG++KE S+ KILKDLKKEF
Sbjct  15   SLIDPFAEANAEDSGAGPGTKDYVHVRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEF  74

Query  327  XCNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
             CNG  VQD E G+  Q QGDQ KN + FLV  G  KK+ IKIHGF
Sbjct  75   CCNGTVVQDPELGQVIQLQGDQRKNVATFLVQAGIAKKENIKIHGF  120



>ref|NP_001274850.1| uncharacterized protein LOC102577437 [Solanum tuberosum]
 gb|ABB02649.1| unknown [Solanum tuberosum]
Length=113

 Score =   126 bits (317),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 73/104 (70%), Gaps = 1/104 (1%)
 Frame = -3

Query  498  TAFDPFXEAKEXG-APGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFXC  322
            TAFDPF EA       G K+Y H RIQQR G+KSLTTVQG++KE S+ KILKDLKKEF C
Sbjct  10   TAFDPFAEANADNFGAGSKDYVHIRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCC  69

Query  321  NGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            NG  VQD E G+  Q Q DQ KN S FLV  G  KK+ IKIHGF
Sbjct  70   NGTVVQDPELGQVIQLQDDQRKNVSTFLVQAGIVKKEHIKIHGF  113



>ref|XP_006827315.1| hypothetical protein AMTR_s00010p00266770 [Amborella trichopoda]
 gb|ERM94552.1| hypothetical protein AMTR_s00010p00266770 [Amborella trichopoda]
Length=177

 Score =   127 bits (320),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/105 (62%), Positives = 73/105 (70%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            P  FDPF +A  E    G K+Y H R+QQR G+K LTTVQGV+KE ++ KILKD KKEF 
Sbjct  73   PGVFDPFADALGEDSGAGTKDYVHVRVQQRNGRKCLTTVQGVKKEFNYNKILKDFKKEFC  132

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQDKE G+  Q QGDQ KN S FLV  G  KKD IKIHGF
Sbjct  133  CNGTVVQDKELGQVIQLQGDQRKNVSNFLVQAGIVKKDNIKIHGF  177



>ref|XP_006352509.1| PREDICTED: protein translation factor SUI1 homolog [Solanum tuberosum]
Length=132

 Score =   125 bits (315),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 76/105 (72%), Gaps = 1/105 (1%)
 Frame = -3

Query  501  PTAFDPFXEAKEXGAPGXK-EYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            P +FDPF E+K+ GA G K EY H R+QQR GKKS T ++G++K+ S+ KILKDLKKE+ 
Sbjct  28   PRSFDPFAESKDLGARGTKKEYVHIRVQQRNGKKSWTMIEGLKKDFSYEKILKDLKKEYC  87

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  +QDKE GK  Q QGDQ  N S FLV     KK+QIK+HGF
Sbjct  88   CNGTIIQDKELGKVIQLQGDQRNNVSKFLVKADIVKKEQIKVHGF  132



>gb|EMT21575.1| Protein translation factor SUI1-like protein [Aegilops tauschii]
Length=124

 Score =   125 bits (314),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 73/103 (71%), Gaps = 3/103 (3%)
 Frame = -3

Query  489  DPFXEAKEXGA---PGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFXCN  319
            DPF EA    A   PG K+Y H RIQQR G+KSLTTVQG++KE S+ KILKDLKKEF CN
Sbjct  22   DPFAEANAEDAGAGPGAKDYVHVRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCN  81

Query  318  GXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            G  VQD E G+  Q QGDQ KN + FLV  G  KK+ IKIHGF
Sbjct  82   GTVVQDPELGQVIQLQGDQRKNVATFLVQAGIAKKELIKIHGF  124



>ref|XP_006833020.1| hypothetical protein AMTR_s00094p00033760, partial [Amborella 
trichopoda]
 gb|ERM98298.1| hypothetical protein AMTR_s00094p00033760, partial [Amborella 
trichopoda]
Length=100

 Score =   124 bits (311),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 71/100 (71%), Gaps = 1/100 (1%)
 Frame = -3

Query  486  PFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFXCNGXX  310
            PF EA  E    G KEY H RIQQR G+KSLTTVQG++KE S+ KILKDLKKEF CNG  
Sbjct  1    PFAEANAEDSGAGSKEYVHVRIQQRNGRKSLTTVQGLKKEFSYSKILKDLKKEFCCNGTV  60

Query  309  VQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            VQD E G+  Q QGDQ KN S FLV  G  KK+ IKIHGF
Sbjct  61   VQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  100



>gb|EEC82174.1| hypothetical protein OsI_26284 [Oryza sativa Indica Group]
Length=843

 Score =   134 bits (337),  Expect = 7e-33, Method: Composition-based stats.
 Identities = 69/107 (64%), Positives = 76/107 (71%), Gaps = 3/107 (3%)
 Frame = -3

Query  501  PTAFDPFXEAK---EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKE  331
            PTAFDPF EA       A G K+Y H RIQQR G+KSLTTVQG++KE S+ KILKDLKKE
Sbjct  737  PTAFDPFAEANAGDSGAAAGSKDYVHVRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKE  796

Query  330  FXCNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            F CNG  VQD E G+  Q QGDQ KN S FLV  G  KK+ IKIHGF
Sbjct  797  FCCNGTVVQDPELGQVIQLQGDQRKNVSNFLVQAGIVKKEHIKIHGF  843



>gb|AAM34279.1|AF508969_1 translation initiation factor [Triticum aestivum]
Length=115

 Score =   124 bits (311),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 75/107 (70%), Gaps = 3/107 (3%)
 Frame = -3

Query  501  PTAFDPFXEAKEXGAPG---XKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKE  331
            PTAFDPF EA    A      K+Y H RIQQR G+KSLTTVQG++KE S+ KILKDLKKE
Sbjct  9    PTAFDPFAEANAGDAGAAAGSKDYVHVRIQQRNGRKSLTTVQGLKKEFSYSKILKDLKKE  68

Query  330  FXCNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            F CNG  VQD E G+  Q QGDQ KN S FLV  G  KK+ IKIHGF
Sbjct  69   FCCNGTVVQDTELGQVIQLQGDQRKNVSNFLVQAGIVKKEHIKIHGF  115



>gb|ABK24036.1| unknown [Picea sitchensis]
Length=112

 Score =   124 bits (310),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 76/105 (72%), Gaps = 2/105 (2%)
 Frame = -3

Query  501  PTAFDPFXEAKEXGA-PGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PT FDPF +++   A PG K+Y H RIQQR G+K LTT+QG+RK+ ++ KILKD KKEF 
Sbjct  9    PT-FDPFKDSEADDAGPGTKDYVHVRIQQRNGRKCLTTIQGLRKDYNYNKILKDFKKEFC  67

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ KN S FL+  G  KKD+IKIHGF
Sbjct  68   CNGTVVQDLELGQIIQLQGDQRKNVSQFLINAGLVKKDKIKIHGF  112



>ref|XP_002976303.1| hypothetical protein SELMODRAFT_232756 [Selaginella moellendorffii]
 gb|EFJ22563.1| hypothetical protein SELMODRAFT_232756 [Selaginella moellendorffii]
Length=114

 Score =   124 bits (310),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 74/106 (70%), Gaps = 2/106 (2%)
 Frame = -3

Query  501  PTAF-DPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEF  328
            P AF DPF EA  +    G KEY H RIQQR G+KSLTTVQG++KE ++ KILKD K+EF
Sbjct  9    PGAFADPFAEANVDDQGAGSKEYVHVRIQQRNGRKSLTTVQGLKKEFNYNKILKDFKREF  68

Query  327  XCNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
             CNG  V D E G+  Q QGDQ KN S FLV  G  KKDQIKIHGF
Sbjct  69   CCNGTVVDDTELGQVIQLQGDQRKNVSQFLVQAGVAKKDQIKIHGF  114



>ref|XP_001756581.1| predicted protein [Physcomitrella patens]
 ref|XP_001781716.1| predicted protein [Physcomitrella patens]
 gb|EDQ53445.1| predicted protein [Physcomitrella patens]
 gb|EDQ78535.1| predicted protein [Physcomitrella patens]
Length=116

 Score =   123 bits (309),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 66/107 (62%), Positives = 74/107 (69%), Gaps = 3/107 (3%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKE--YXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKE  331
            P +FDPF EA  E    G K   Y H R+QQR G+KSLTTVQG++KE ++ KILKDLKKE
Sbjct  10   PASFDPFAEANVEDSGVGSKGSGYVHVRVQQRNGRKSLTTVQGLKKEFNYNKILKDLKKE  69

Query  330  FXCNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            F CNG  VQD E G+  Q QGDQ KN S FLV  G  KKD IKIHGF
Sbjct  70   FCCNGVVVQDPELGQVIQLQGDQRKNVSNFLVQAGIVKKDLIKIHGF  116



>gb|KJB39023.1| hypothetical protein B456_007G314400 [Gossypium raimondii]
 gb|KJB39024.1| hypothetical protein B456_007G314400 [Gossypium raimondii]
 gb|KJB39026.1| hypothetical protein B456_007G314400 [Gossypium raimondii]
 gb|KJB39027.1| hypothetical protein B456_007G314400 [Gossypium raimondii]
Length=111

 Score =   123 bits (308),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 73/105 (70%), Gaps = 3/105 (3%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PTAFDPF +A  E    G KEY H RIQQR G+KSLTTVQG++KE S+ KILKDL KEF 
Sbjct  9    PTAFDPFADANAEDSGAGTKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKILKDL-KEFC  67

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            CNG  VQD E G+  Q QGDQ  N S FLV  G   KD IKIHGF
Sbjct  68   CNGTVVQDPELGQVIQLQGDQRNNVSTFLVQAGIV-KDNIKIHGF  111



>ref|XP_008351221.1| PREDICTED: protein translation factor SUI1 homolog 2-like, partial 
[Malus domestica]
Length=124

 Score =   123 bits (309),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/99 (65%), Positives = 70/99 (71%), Gaps = 1/99 (1%)
 Frame = -3

Query  489  DPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFXCNGX  313
            DPF EA  E    G KEY H R+QQR G+KSLTTVQG++KE S+ KILKDLKKEF CNG 
Sbjct  7    DPFAEATAEDSGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCNGT  66

Query  312  XVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIH  196
             VQD E G+  Q QGDQ KN S FLV  G  KKD IKIH
Sbjct  67   VVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKDNIKIH  105



>ref|XP_003562997.1| PREDICTED: protein translation factor SUI1 homolog [Brachypodium 
distachyon]
Length=115

 Score =   123 bits (308),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 75/107 (70%), Gaps = 3/107 (3%)
 Frame = -3

Query  501  PTAFDPFXEAKEXGAPG---XKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKE  331
            PTAFDPF EA    A      K+Y H RIQQR G+KSLTTVQG++KE S+ KILKDLKKE
Sbjct  9    PTAFDPFAEANAGEAGAAAGSKDYVHVRIQQRNGRKSLTTVQGLKKEFSYSKILKDLKKE  68

Query  330  FXCNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            F CNG  VQD E G+  Q QGDQ KN S FLV  G  KK+ IKIHGF
Sbjct  69   FCCNGTVVQDPELGQVIQLQGDQRKNVSNFLVQAGIVKKEHIKIHGF  115



>gb|ADJ67213.1| hypothetical protein [Jatropha curcas]
Length=100

 Score =   122 bits (306),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 71/100 (71%), Gaps = 1/100 (1%)
 Frame = -3

Query  486  PFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFXCNGXX  310
            PF +A  E    G KEY H RIQQR G+KSLTTVQG++KE S+ KILKDLKKEF CNG  
Sbjct  1    PFADANAEDSGAGAKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCNGTV  60

Query  309  VQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            VQD E G+  Q QGDQ KN S FLV  G  KK+ IKIHGF
Sbjct  61   VQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKENIKIHGF  100



>gb|EMS51805.1| Protein translation factor SUI1-like protein [Triticum urartu]
Length=163

 Score =   124 bits (310),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 75/107 (70%), Gaps = 3/107 (3%)
 Frame = -3

Query  501  PTAFDPFXEAKEXGAPG---XKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKE  331
            PTAFDPF EA    A      K+Y H RIQQR G+KSLTTVQG++KE S+ KILKDLKKE
Sbjct  57   PTAFDPFAEANAGDAGAAAGSKDYVHVRIQQRNGRKSLTTVQGLKKEFSYSKILKDLKKE  116

Query  330  FXCNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            F CNG  VQD E G+  Q QGDQ KN S FLV  G  KK+ IKIHGF
Sbjct  117  FCCNGTVVQDTELGQVIQLQGDQRKNVSNFLVQAGIVKKEHIKIHGF  163



>gb|EMS63057.1| Protein translation factor SUI1-like protein [Triticum urartu]
Length=119

 Score =   122 bits (306),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 64/107 (60%), Positives = 75/107 (70%), Gaps = 3/107 (3%)
 Frame = -3

Query  501  PTAFDPFXEA--KEXGA-PGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKE  331
            P   DPF EA  ++ GA  G K Y H R+QQR G+KSLTTVQG++K+ S+ KILKDLKKE
Sbjct  13   PRGTDPFAEANAEDSGAGAGSKNYVHVRVQQRNGRKSLTTVQGLKKDYSYNKILKDLKKE  72

Query  330  FXCNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            F CNG  VQD E G+  Q QGDQ KN + FLV  G  KK+ IKIHGF
Sbjct  73   FCCNGTVVQDPELGQVIQLQGDQRKNVATFLVQAGLAKKESIKIHGF  119



>ref|XP_006452372.1| hypothetical protein CICLE_v10009975mg [Citrus clementina]
 ref|XP_006452373.1| hypothetical protein CICLE_v10009975mg [Citrus clementina]
 ref|XP_006475068.1| PREDICTED: protein translation factor SUI1 homolog 1-like isoform 
X1 [Citrus sinensis]
 ref|XP_006475069.1| PREDICTED: protein translation factor SUI1 homolog 1-like isoform 
X2 [Citrus sinensis]
 gb|ESR65612.1| hypothetical protein CICLE_v10009975mg [Citrus clementina]
 gb|ESR65613.1| hypothetical protein CICLE_v10009975mg [Citrus clementina]
 gb|KDO62726.1| hypothetical protein CISIN_1g033744mg [Citrus sinensis]
Length=112

 Score =   122 bits (305),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 71/104 (68%), Gaps = 0/104 (0%)
 Frame = -3

Query  501  PTAFDPFXEAKEXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFXC  322
            PT++DPF + K+  APG K Y H R+QQR GKK LTTVQG++++  + KILKDLKKEF C
Sbjct  9    PTSYDPFADIKDSLAPGDKGYVHLRVQQRNGKKCLTTVQGLKEDFGYQKILKDLKKEFCC  68

Query  321  NGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            NG  V DK  GK  Q QGD  KN   FLV      KD+IKIHGF
Sbjct  69   NGNVVNDKVLGKVIQLQGDHRKNVMIFLVKSKIVDKDRIKIHGF  112



>gb|ACS68685.1| putative translation factor [Sonneratia alba]
 gb|ACS68756.1| putative translation factor, partial [Sonneratia alba]
Length=102

 Score =   121 bits (304),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 63/99 (64%), Positives = 70/99 (71%), Gaps = 1/99 (1%)
 Frame = -3

Query  501  PTAFDPFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            PTAFDPF +A  E    G KEY H RIQQR G+KSLTTVQG++KE S+ KILKDLKKEF 
Sbjct  4    PTAFDPFADANAEDSGAGAKEYVHIRIQQRNGRKSLTTVQGLKKEFSYSKILKDLKKEFC  63

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQ  208
            CNG  VQD E G+  Q QGDQ KN S FLV  G  KK+ 
Sbjct  64   CNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEH  102



>gb|KCW70138.1| hypothetical protein EUGRSUZ_F03432 [Eucalyptus grandis]
Length=180

 Score =   122 bits (307),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 71/100 (71%), Gaps = 1/100 (1%)
 Frame = -3

Query  486  PFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFXCNGXX  310
            PF +A  E    G KEY H R+QQR G+KSLTTVQG++KE S+ KILKDLKKEF CNG  
Sbjct  81   PFADANAEDSGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCNGTV  140

Query  309  VQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            VQD E G+  Q QGDQ KN S FLV  G  KK+ IKIHGF
Sbjct  141  VQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  180



>gb|ADU56181.1| hypothetical protein [Jatropha curcas]
Length=100

 Score =   119 bits (299),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 63/95 (66%), Positives = 71/95 (75%), Gaps = 1/95 (1%)
 Frame = -3

Query  474  AKEXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFXCNGXXVQDKE  295
            A++ GA G KEY H RIQQR G+KSLTTVQG++KE S+ KILKDLKKEF CNG  VQD E
Sbjct  7    AEDSGA-GAKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCNGTVVQDPE  65

Query  294  XGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
             G+  Q QGDQ KN S FLV  G  KK+ IKIHGF
Sbjct  66   LGQVIQLQGDQRKNVSTFLVQAGIVKKENIKIHGF  100



>gb|EMT13356.1| Protein translation factor SUI1-like protein [Aegilops tauschii]
Length=120

 Score =   120 bits (301),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 63/103 (61%), Positives = 74/103 (72%), Gaps = 3/103 (3%)
 Frame = -3

Query  489  DPFXEA--KEXGA-PGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFXCN  319
            DPF EA  ++ GA  G K Y H R+QQR G+KSLTTVQG++K+ S+ KILKDLKKEF CN
Sbjct  18   DPFAEANAEDSGAGAGSKNYVHVRVQQRNGRKSLTTVQGLKKDYSYNKILKDLKKEFCCN  77

Query  318  GXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            G  VQD E G+  Q QGDQ KN + FLV  G  KK+ IKIHGF
Sbjct  78   GTVVQDPELGQVIQLQGDQRKNVATFLVQAGLAKKESIKIHGF  120



>ref|XP_010109526.1| Protein translation factor SUI1-1-like protein [Morus notabilis]
 gb|EXC23130.1| Protein translation factor SUI1-1-like protein [Morus notabilis]
Length=149

 Score =   120 bits (302),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 63/103 (61%), Positives = 74/103 (72%), Gaps = 1/103 (1%)
 Frame = -3

Query  501  PTAFDPFXEAKEXGAP-GXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFX  325
            P+AFDPF +A    +  G KEY H R+QQR G+KSLTTVQG++K+ S+ KILKDLKKEF 
Sbjct  9    PSAFDPFADASADDSSAGGKEYVHVRVQQRNGRKSLTTVQGLKKQYSYSKILKDLKKEFC  68

Query  324  CNGXXVQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIH  196
            CNG  VQD E G+  Q QGDQ KN S FLV  G  KK+ IKIH
Sbjct  69   CNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKENIKIH  111



>gb|ADJ67174.1| hypothetical protein [Jatropha curcas]
Length=100

 Score =   119 bits (298),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 71/100 (71%), Gaps = 1/100 (1%)
 Frame = -3

Query  486  PFXEAK-EXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFXCNGXX  310
            PF +A  E    G KEY H RIQQR G+KSLTTVQG++KE S+ KILKDLKKEF CNG  
Sbjct  1    PFADANAEDSGAGAKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCNGTV  60

Query  309  VQDKEXGKXXQXQGDQXKNXSXFLVXXGXXKKDQIKIHGF  190
            VQD E G+  Q QGDQ K  S FLV  G  KK++IKIHGF
Sbjct  61   VQDPELGQVIQLQGDQRKKVSTFLVQAGIVKKEKIKIHGF  100



>gb|KHN02839.1| Protein translation factor SUI1 like 2 [Glycine soja]
Length=141

 Score =   120 bits (301),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = -3

Query  501  PTAFDPFXEAKEXGAPGXKEYXHXRIQQRXGKKSLTTVQGVRKEXSFXKILKDLKKEFXC  322
            PT FDPF EA+E  APG KEY H RIQQR GKKSLTTVQG++KE S+ KILKDLKKEF C
Sbjct  9    PTPFDPFAEARESDAPGAKEYVHIRIQQRNGKKSLTTVQGLKKEFSYEKILKDLKKEFCC  68

Query  321  NGXXVQDKEXGKXXQXQGDQ  262
            NG  VQDKE GK  Q QGDQ
Sbjct  69   NGTVVQDKELGKIIQLQGDQ  88



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 564814758300