BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF026N08

Length=779
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_008384431.1|  PREDICTED: tubulin alpha-3 chain-like              342   2e-114   
ref|XP_010420792.1|  PREDICTED: tubulin alpha-3 chain-like              337   9e-114   Camelina sativa [gold-of-pleasure]
emb|CAD20821.1|  alpha tubulin                                          339   2e-113   Zea mays [maize]
dbj|BAH20267.1|  AT5G19780                                              339   3e-113   Arabidopsis thaliana [mouse-ear cress]
gb|ABR25510.1|  tubulin alpha-1 chain                                   338   3e-113   Oryza sativa Indica Group [Indian rice]
dbj|BAD94893.1|  tubulin alpha-5 chain-like protein                     335   3e-113   Arabidopsis thaliana [mouse-ear cress]
emb|CAL35827.1|  alpha-2 tubulin                                        337   4e-113   Plantago major [cart-track plant]
ref|XP_001777110.1|  predicted protein                                  341   4e-113   
emb|CAD20820.1|  alpha tubulin                                          335   5e-113   Zea mays [maize]
ref|XP_009353129.1|  PREDICTED: tubulin alpha-3 chain-like              344   8e-113   Pyrus x bretschneideri [bai li]
ref|XP_008386829.1|  PREDICTED: tubulin alpha-3 chain-like              344   9e-113   Malus domestica [apple tree]
gb|KDP39691.1|  hypothetical protein JCGZ_02711                         343   1e-112   Jatropha curcas
gb|KJB83378.1|  hypothetical protein B456_013G244600                    342   2e-112   Gossypium raimondii
ref|XP_009366459.1|  PREDICTED: tubulin alpha-3 chain                   343   2e-112   
ref|XP_002525416.1|  tubulin alpha chain, putative                      343   2e-112   Ricinus communis
gb|AGG37288.1|  alpha-tubulin 6                                         343   2e-112   Salix arbutifolia
ref|XP_004295008.1|  PREDICTED: tubulin alpha-3 chain isoform X1        343   2e-112   Fragaria vesca subsp. vesca
ref|XP_011034391.1|  PREDICTED: tubulin alpha-3 chain                   343   2e-112   Populus euphratica
ref|XP_008349406.1|  PREDICTED: tubulin alpha-3 chain                   342   3e-112   Malus domestica [apple tree]
ref|XP_009375870.1|  PREDICTED: tubulin alpha-3 chain                   342   3e-112   Pyrus x bretschneideri [bai li]
ref|XP_008351479.1|  PREDICTED: tubulin alpha-3 chain                   342   3e-112   Malus domestica [apple tree]
ref|XP_011089722.1|  PREDICTED: tubulin alpha-3 chain                   342   4e-112   Sesamum indicum [beniseed]
ref|XP_007030078.1|  Tubulin alpha-5                                    343   4e-112   
sp|P33624.1|TBA2_ANEPH  RecName: Full=Tubulin alpha-2 chain             339   5e-112   Anemia phyllitidis
emb|CDP17586.1|  unnamed protein product                                342   5e-112   Coffea canephora [robusta coffee]
ref|XP_002325422.1|  Tubulin alpha-1 chain family protein               342   6e-112   Populus trichocarpa [western balsam poplar]
gb|AGG37290.1|  alpha-tubulin 8                                         342   6e-112   Salix arbutifolia
ref|XP_011021469.1|  PREDICTED: tubulin alpha-3 chain-like              342   6e-112   Populus euphratica
ref|XP_006858944.1|  hypothetical protein AMTR_s00068p00090790          342   6e-112   Amborella trichopoda
tpg|DAA41189.1|  TPA: alpha tubulin5                                    337   7e-112   
tpg|DAA63280.1|  TPA: alpha tubulin6                                    337   7e-112   
ref|XP_009413318.1|  PREDICTED: tubulin alpha-3 chain-like              342   7e-112   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG26159.1|  Tubulin alpha-6 chain                                   341   7e-112   Gossypium arboreum [tree cotton]
gb|EYU23006.1|  hypothetical protein MIMGU_mgv1a006283mg                341   8e-112   Erythranthe guttata [common monkey flower]
gb|EYU31677.1|  hypothetical protein MIMGU_mgv1a006281mg                341   9e-112   Erythranthe guttata [common monkey flower]
ref|XP_002319688.1|  Tubulin alpha-1 chain family protein               341   9e-112   Populus trichocarpa [western balsam poplar]
gb|AHJ80821.1|  Tua3                                                    340   9e-112   Eragrostis tef [tef]
gb|KJB44614.1|  hypothetical protein B456_007G261000                    341   1e-111   Gossypium raimondii
ref|XP_006286664.1|  hypothetical protein CARUB_v10002583mg             341   1e-111   Capsella rubella
gb|KCW87067.1|  hypothetical protein EUGRSUZ_B03604                     338   1e-111   Eucalyptus grandis [rose gum]
gb|KHG06160.1|  Tubulin alpha-3/alpha-5 chain -like protein             341   1e-111   Gossypium arboreum [tree cotton]
ref|XP_011075054.1|  PREDICTED: tubulin alpha-3 chain-like              341   1e-111   Sesamum indicum [beniseed]
gb|ACN40824.1|  unknown                                                 341   1e-111   Picea sitchensis
ref|XP_007204346.1|  hypothetical protein PRUPE_ppa005649mg             341   1e-111   Prunus persica
ref|XP_008240533.1|  PREDICTED: tubulin alpha-3 chain isoform X1        340   1e-111   Prunus mume [ume]
emb|CDY44941.1|  BnaA02g04460D                                          340   2e-111   Brassica napus [oilseed rape]
gb|AHZ58481.1|  alpha-tubulin                                           332   2e-111   Syntrichia caninervis
ref|XP_009406530.1|  PREDICTED: tubulin alpha-3 chain-like              340   2e-111   Musa acuminata subsp. malaccensis [pisang utan]
gb|AEG74028.1|  alpha-tubulin                                           340   2e-111   Apopellia endiviifolia (species B)
gb|KHN06388.1|  Tubulin alpha-3 chain                                   339   2e-111   Glycine soja [wild soybean]
gb|KJB83375.1|  hypothetical protein B456_013G244600                    340   2e-111   Gossypium raimondii
ref|XP_011025144.1|  PREDICTED: tubulin alpha-3 chain                   340   2e-111   Populus euphratica
ref|XP_002285721.1|  PREDICTED: tubulin alpha-3 chain                   340   2e-111   Vitis vinifera
ref|XP_007205189.1|  hypothetical protein PRUPE_ppa005642mg             340   2e-111   Prunus persica
ref|XP_006445597.1|  hypothetical protein CICLE_v10015224mg             340   2e-111   Citrus clementina [clementine]
ref|XP_002303998.1|  alpha-tubulin 2 family protein                     340   2e-111   Populus trichocarpa [western balsam poplar]
ref|XP_008223650.1|  PREDICTED: tubulin alpha-3 chain-like              340   2e-111   Prunus mume [ume]
ref|XP_010112637.1|  Tubulin alpha-3 chain                              340   2e-111   Morus notabilis
gb|ABO47735.1|  alpha-tubulin                                           340   2e-111   Gossypium hirsutum [American cotton]
ref|XP_001777081.1|  predicted protein                                  340   2e-111   
emb|CAD26887.1|  alpha-tubulin                                          340   2e-111   Miscanthus sinensis
ref|XP_010257632.1|  PREDICTED: tubulin alpha-3 chain                   340   2e-111   Nelumbo nucifera [Indian lotus]
gb|ABO47741.1|  alpha-tubulin                                           340   2e-111   Gossypium hirsutum [American cotton]
ref|XP_001782790.1|  predicted protein                                  340   2e-111   
ref|XP_010673470.1|  PREDICTED: tubulin alpha-3 chain                   340   3e-111   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009400845.1|  PREDICTED: tubulin alpha-3 chain                   340   3e-111   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009408459.1|  PREDICTED: tubulin alpha-3 chain-like              340   3e-111   Musa acuminata subsp. malaccensis [pisang utan]
gb|AGG37284.1|  alpha-tubulin 2                                         340   3e-111   Salix arbutifolia
ref|XP_008813089.1|  PREDICTED: tubulin alpha-3 chain                   340   3e-111   Phoenix dactylifera
gb|AHJ80820.1|  Tua3                                                    338   3e-111   Eragrostis tef [tef]
ref|XP_010454260.1|  PREDICTED: tubulin alpha-3 chain-like              340   3e-111   Camelina sativa [gold-of-pleasure]
emb|CDY42294.1|  BnaC02g09000D                                          340   3e-111   Brassica napus [oilseed rape]
ref|XP_006286795.1|  hypothetical protein CARUB_v10003470mg             340   3e-111   Capsella rubella
ref|XP_008804327.1|  PREDICTED: tubulin alpha-1 chain-like              340   3e-111   Phoenix dactylifera
ref|XP_010535933.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    340   3e-111   Tarenaya hassleriana [spider flower]
ref|XP_010531152.1|  PREDICTED: tubulin alpha-3 chain                   340   3e-111   Tarenaya hassleriana [spider flower]
ref|XP_006443441.1|  hypothetical protein CICLE_v10020128mg             340   3e-111   Citrus clementina [clementine]
ref|NP_197478.1|  tubulin alpha-3                                       340   4e-111   Arabidopsis thaliana [mouse-ear cress]
gb|KHG06861.1|  Tubulin alpha-6 chain                                   340   4e-111   Gossypium arboreum [tree cotton]
gb|KHN47983.1|  Tubulin alpha-3 chain                                   338   4e-111   Glycine soja [wild soybean]
ref|XP_010934670.1|  PREDICTED: tubulin alpha-3 chain-like              340   4e-111   Elaeis guineensis
emb|CDX88875.1|  BnaA03g07740D                                          340   4e-111   
gb|AGD80034.1|  alpha-tubulin 1                                         340   4e-111   Hevea brasiliensis [jebe]
ref|XP_009126389.1|  PREDICTED: tubulin alpha-3 chain-like              340   4e-111   Brassica rapa
ref|XP_009126391.1|  PREDICTED: tubulin alpha-3 chain-like              339   4e-111   Brassica rapa
gb|ABB16994.1|  unknown                                                 340   5e-111   Solanum tuberosum [potatoes]
ref|NP_001242878.1|  uncharacterized protein LOC100806907               339   5e-111   Glycine max [soybeans]
ref|XP_009120857.1|  PREDICTED: tubulin alpha-3 chain                   339   5e-111   Brassica rapa
ref|XP_010044940.1|  PREDICTED: tubulin alpha-3 chain                   339   5e-111   Eucalyptus grandis [rose gum]
ref|NP_001237301.1|  tubulin A                                          339   6e-111   
emb|CAD26886.1|  alpha-tubulin                                          339   6e-111   Miscanthus sinensis
ref|XP_010923361.1|  PREDICTED: tubulin alpha-3 chain                   339   6e-111   Elaeis guineensis
ref|XP_004958110.1|  PREDICTED: tubulin alpha-3 chain-like              339   6e-111   Setaria italica
ref|XP_006579487.1|  PREDICTED: tubulin A isoform X1                    339   6e-111   
gb|AGY80453.1|  tubulin                                                 339   6e-111   Dendrocalamus latiflorus [sweet bamboo]
gb|ABD92942.1|  alpha tubulin-1D                                        339   6e-111   Triticum aestivum [Canadian hard winter wheat]
emb|CAD24765.1|  alpha-tubulin                                          339   6e-111   Miscanthus sinensis
ref|XP_003562846.1|  PREDICTED: tubulin alpha-1 chain                   339   6e-111   Brachypodium distachyon [annual false brome]
ref|XP_004149645.1|  PREDICTED: tubulin alpha-3 chain-like              339   7e-111   Cucumis sativus [cucumbers]
dbj|BAJ06363.1|  alpha-tubulin                                          339   7e-111   Alopecurus aequalis
ref|NP_001105324.1|  tubulin alpha-5 chain                              339   7e-111   Zea mays [maize]
ref|NP_001060075.1|  Os07g0574800                                       339   7e-111   
ref|XP_008449885.1|  PREDICTED: tubulin alpha-3 chain isoform X1        339   7e-111   Cucumis melo [Oriental melon]
sp|Q43473.1|TBA1_HORVU  RecName: Full=Tubulin alpha-1 chain             339   7e-111   Hordeum vulgare [barley]
emb|CAD26891.1|  alpha-tubulin                                          339   7e-111   Miscanthus floridulus
ref|XP_002532068.1|  tubulin alpha chain, putative                      339   7e-111   Ricinus communis
ref|XP_007159433.1|  hypothetical protein PHAVU_002G237400g             339   7e-111   Phaseolus vulgaris [French bean]
ref|NP_001105588.1|  tubulin alpha-6 chain                              339   7e-111   Zea mays [maize]
ref|XP_006657877.1|  PREDICTED: tubulin alpha-3 chain-like              339   7e-111   Oryza brachyantha
sp|O22349.1|TBA3_ELEIN  RecName: Full=Tubulin alpha-3 chain; AltN...    339   7e-111   Eleusine indica [crabgrass]
ref|XP_009389058.1|  PREDICTED: tubulin alpha-3 chain-like              339   8e-111   Musa acuminata subsp. malaccensis [pisang utan]
gb|AGG37286.1|  alpha-tubulin 4                                         339   8e-111   Salix arbutifolia
ref|XP_011048194.1|  PREDICTED: tubulin alpha-6 chain-like              339   8e-111   Populus euphratica
gb|ABR67425.1|  alpha-tubulin 4                                         338   9e-111   Populus tremuloides
ref|XP_009622332.1|  PREDICTED: tubulin alpha-3 chain                   338   1e-110   Nicotiana tomentosiformis
emb|CAD24767.1|  alpha-tubulin                                          338   1e-110   Miscanthus floridulus
gb|ABV55994.1|  alpha-tubulin 6                                         338   1e-110   Populus tremuloides
gb|KCW87065.1|  hypothetical protein EUGRSUZ_B03604                     339   1e-110   Eucalyptus grandis [rose gum]
gb|KJB80786.1|  hypothetical protein B456_013G115100                    338   1e-110   Gossypium raimondii
ref|XP_002297631.1|  alpha-tubulin 2 family protein                     338   1e-110   Populus trichocarpa [western balsam poplar]
ref|XP_004504311.1|  PREDICTED: tubulin alpha-3 chain-like              338   1e-110   Cicer arietinum [garbanzo]
ref|XP_003629736.1|  Alpha-tubulin                                      338   1e-110   Medicago truncatula
ref|XP_010276368.1|  PREDICTED: tubulin alpha-3 chain-like              338   1e-110   Nelumbo nucifera [Indian lotus]
gb|AFR42026.1|  alpha-tubulin                                           329   1e-110   Populus trichocarpa [western balsam poplar]
emb|CAD24768.1|  alpha-tubulin                                          338   1e-110   Miscanthus floridulus
gb|AFR42020.1|  alpha-tubulin                                           329   2e-110   Populus trichocarpa [western balsam poplar]
gb|AFR42049.1|  alpha-tubulin                                           328   2e-110   Populus fremontii
ref|XP_010528739.1|  PREDICTED: tubulin alpha-6 chain-like              338   2e-110   Tarenaya hassleriana [spider flower]
emb|CAD26890.1|  alpha-tubulin                                          338   2e-110   Miscanthus sinensis subsp. condensatus
gb|AFR42035.1|  alpha-tubulin                                           328   2e-110   Populus alba [abele]
gb|AFR42036.1|  alpha-tubulin                                           328   3e-110   Populus alba [abele]
gb|KJB58759.1|  hypothetical protein B456_009G224800                    333   3e-110   Gossypium raimondii
gb|AFR42054.1|  alpha-tubulin                                           328   3e-110   Populus fremontii
gb|AFR42042.1|  alpha-tubulin                                           328   3e-110   Populus fremontii
ref|XP_010054663.1|  PREDICTED: tubulin alpha-3 chain-like              337   3e-110   Eucalyptus grandis [rose gum]
emb|CAD26893.1|  alpha-tubulin                                          337   3e-110   Miscanthus floridulus
gb|AAO63773.2|  alpha-tubulin 2                                         337   3e-110   Populus tremuloides
ref|XP_006433708.1|  hypothetical protein CICLE_v100015522mg            329   4e-110   
gb|AFR42047.1|  alpha-tubulin                                           328   4e-110   Populus fremontii
gb|AIC33057.1|  tubulin alpha-1 chain                                   337   4e-110   Panax ginseng [Asiatic ginseng]
gb|ABO47738.1|  alpha-tubulin                                           337   5e-110   Gossypium hirsutum [American cotton]
emb|CAD24766.1|  alpha-tubulin                                          337   5e-110   Miscanthus sinensis
gb|AGV54500.1|  tubulin A                                               337   5e-110   Phaseolus vulgaris [French bean]
gb|EYU34085.1|  hypothetical protein MIMGU_mgv1a0196712mg               328   8e-110   Erythranthe guttata [common monkey flower]
emb|CDP14299.1|  unnamed protein product                                336   8e-110   Coffea canephora [robusta coffee]
ref|XP_010693818.1|  PREDICTED: tubulin alpha-3 chain-like              336   9e-110   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007014666.1|  Tubulin alpha-5                                    336   1e-109   Theobroma cacao [chocolate]
ref|XP_010414865.1|  PREDICTED: tubulin alpha-1 chain                   336   1e-109   Camelina sativa [gold-of-pleasure]
emb|CAB76917.1|  alpha-tubulin 4                                        330   1e-109   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KIY91712.1|  Tubulin alpha chain                                     328   1e-109   Monoraphidium neglectum
emb|CAJ38386.1|  alpha tubulin                                          329   1e-109   Plantago major [cart-track plant]
gb|AAW57309.1|  alpha-tubulin                                           329   1e-109   Ceratopteris richardii
gb|AAW57310.1|  alpha-tubulin                                           329   1e-109   Ceratopteris richardii
gb|KJB32211.1|  hypothetical protein B456_005G229600                    332   1e-109   Gossypium raimondii
gb|KDP42087.1|  hypothetical protein JCGZ_01875                         335   1e-109   Jatropha curcas
gb|AGI78243.1|  alpha tubulin 5                                         328   2e-109   Caragana korshinskii
gb|ADD84794.1|  tubulin-like protein                                    325   2e-109   Cenchrus ciliaris [African foxtail grass]
gb|KHG19627.1|  Tubulin alpha-3/alpha-5 chain -like protein             335   3e-109   Gossypium arboreum [tree cotton]
gb|AGV54721.1|  tubulin alpha-3 chain-like protein                      335   3e-109   Phaseolus vulgaris [French bean]
ref|XP_007161955.1|  hypothetical protein PHAVU_001G111700g             335   3e-109   Phaseolus vulgaris [French bean]
ref|XP_003624633.1|  Alpha-tubulin                                      335   4e-109   Medicago truncatula
ref|XP_004252814.1|  PREDICTED: tubulin alpha-2 chain-like              327   4e-109   Solanum lycopersicum
ref|XP_008464962.1|  PREDICTED: tubulin alpha-3 chain-like              334   4e-109   Cucumis melo [Oriental melon]
ref|XP_004141134.1|  PREDICTED: tubulin alpha-3 chain-like              334   4e-109   Cucumis sativus [cucumbers]
ref|XP_004493170.1|  PREDICTED: tubulin alpha-3 chain-like              334   4e-109   
gb|AHJ80819.1|  Tua1                                                    327   5e-109   Eragrostis tef [tef]
gb|ABD92943.1|  alpha tubulin-1B                                        334   5e-109   Triticum aestivum [Canadian hard winter wheat]
gb|KHN46768.1|  Tubulin alpha-3 chain                                   334   5e-109   Glycine soja [wild soybean]
gb|AHM93474.1|  alpha-tubulin                                           330   5e-109   Camellia chekiangoleosa
gb|ABE01246.1|  alpha tubulin                                           334   7e-109   Camellia sinensis [black tea]
ref|XP_006301274.1|  hypothetical protein CARUB_v10021674mg             334   7e-109   Capsella rubella
dbj|BAH19954.1|  AT1G50010                                              327   8e-109   Arabidopsis thaliana [mouse-ear cress]
gb|KJB29387.1|  hypothetical protein B456_005G097800                    333   9e-109   Gossypium raimondii
gb|KDO81349.1|  hypothetical protein CISIN_1g013037mg                   330   1e-108   Citrus sinensis [apfelsine]
emb|CAD26892.1|  alpha-tubulin                                          333   1e-108   Miscanthus floridulus
gb|AGV54497.1|  tubulin alpha-3 chain-like protein                      333   1e-108   Phaseolus vulgaris [French bean]
ref|XP_011078787.1|  PREDICTED: tubulin alpha-1 chain-like              333   1e-108   Sesamum indicum [beniseed]
emb|CAD26888.1|  alpha-tubulin                                          333   1e-108   Miscanthus transmorrisonensis
dbj|BAF01952.1|  putative tubulin alpha-2/alpha-4 chain                 324   1e-108   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003554022.1|  PREDICTED: tubulin alpha-6 chain-like              333   1e-108   Glycine max [soybeans]
ref|XP_008621874.1|  tubulin alpha                                      327   2e-108   Saprolegnia diclina VS20
gb|EKF29047.1|  epsilon tubulin, putative                               325   2e-108   Trypanosoma cruzi marinkellei
gb|KGN48654.1|  hypothetical protein Csa_6G497050                       332   2e-108   Cucumis sativus [cucumbers]
gb|KJB58756.1|  hypothetical protein B456_009G224800                    332   2e-108   Gossypium raimondii
gb|EKF28172.1|  epsilon tubulin, putative                               325   2e-108   Trypanosoma cruzi marinkellei
ref|XP_002677064.1|  alpha-tubulin                                      323   2e-108   Naegleria gruberi strain NEG-M
emb|CCD11782.1|  unnamed protein product                                326   2e-108   Trypanosoma congolense IL3000
emb|CAA52158.1|  alpha tubulin                                          325   3e-108   Zea mays [maize]
gb|KDO25258.1|  hypothetical protein SPRG_09506                         323   3e-108   Saprolegnia parasitica CBS 223.65
gb|KHG20487.1|  Tubulin alpha chain                                     332   3e-108   Gossypium arboreum [tree cotton]
emb|CBH08953.1|  alpha tubulin, (fragment)                              323   3e-108   Trypanosoma brucei gambiense DAL972
gb|EYU20672.1|  hypothetical protein MIMGU_mgv1a004180mg                335   3e-108   Erythranthe guttata [common monkey flower]
gb|ABR26150.1|  tubulin alpha-3 chain                                   323   3e-108   Oryza sativa Indica Group [Indian rice]
gb|AAW57306.1|  alpha-tubulin                                           325   3e-108   Ceratopteris richardii
emb|CBH08958.1|  alpha tubulin, (fragment)                              327   4e-108   Trypanosoma brucei gambiense DAL972
ref|XP_002959708.1|  alpha tubulin                                      324   7e-108   Volvox carteri f. nagariensis
ref|XP_009131752.1|  PREDICTED: tubulin alpha-3 chain-like              331   7e-108   Brassica rapa
gb|AAW57305.1|  alpha-tubulin                                           326   7e-108   Ceratopteris richardii
ref|NP_176654.1|  tubulin alpha-1 chain                                 331   7e-108   Arabidopsis thaliana [mouse-ear cress]
gb|EPS62716.1|  alpha-tubulin                                           330   8e-108   Genlisea aurea
gb|ABR25378.1|  tubulin alpha 3 chain                                   322   8e-108   Oryza sativa Indica Group [Indian rice]
gb|AAO46127.1|  alpha-tubulin                                           324   9e-108   Streblomastix strix
gb|KDO49533.1|  hypothetical protein CISIN_1g013062mg                   330   9e-108   Citrus sinensis [apfelsine]
ref|XP_007515802.1|  alpha-tubulin                                      330   1e-107   Bathycoccus prasinos
gb|AAX96763.1|  Tubulin/FtsZ family, GTPase domain, putative            327   1e-107   Oryza sativa Japonica Group [Japonica rice]
gb|KJB33191.1|  hypothetical protein B456_006G002500                    321   1e-107   Gossypium raimondii
gb|AIX10773.1|  alpha tubulin                                           331   1e-107   Panax notoginseng [san-qi]
ref|XP_002779346.1|  alpha-tubulin, putative                            321   1e-107   Perkinsus marinus ATCC 50983
gb|ADW83724.1|  alpha-tubulin                                           330   1e-107   Musa acuminata AAA Group [Cavendish banana]
gb|EYU37544.1|  hypothetical protein MIMGU_mgv1a007145mg                330   1e-107   Erythranthe guttata [common monkey flower]
gb|ABO47737.1|  alpha-tubulin                                           331   1e-107   Gossypium hirsutum [American cotton]
ref|XP_010093625.1|  Tubulin alpha chain                                330   1e-107   Morus notabilis
emb|CAN62392.1|  hypothetical protein VITISV_016172                     330   1e-107   Vitis vinifera
ref|XP_003608582.1|  Tubulin alpha-5 chain                              330   1e-107   Medicago truncatula
ref|XP_002886753.1|  alpha-1 tubulin                                    330   1e-107   Arabidopsis lyrata subsp. lyrata
ref|XP_002298794.2|  TUBULIN ALPHA CHAIN family protein                 330   1e-107   Populus trichocarpa [western balsam poplar]
gb|ABK92520.1|  unknown                                                 330   1e-107   Populus trichocarpa [western balsam poplar]
gb|ABQ59633.1|  alpha-tubulin 3                                         330   1e-107   Populus tremuloides
gb|AGG37285.1|  alpha-tubulin 3                                         330   1e-107   Salix arbutifolia
gb|KDP32140.1|  hypothetical protein JCGZ_12601                         330   1e-107   Jatropha curcas
sp|Q6VAF9.1|TBA4_GOSHI  RecName: Full=Tubulin alpha-4 chain; AltN...    330   1e-107   Gossypium hirsutum [American cotton]
ref|XP_011030289.1|  PREDICTED: tubulin alpha-4 chain                   330   2e-107   Populus euphratica
ref|NP_001289660.1|  tubulin alpha chain-like                           330   2e-107   Eucalyptus grandis [rose gum]
ref|XP_008787760.1|  PREDICTED: tubulin alpha chain-like                330   2e-107   Phoenix dactylifera
ref|XP_010099392.1|  Tubulin alpha chain                                331   2e-107   
ref|XP_010943272.1|  PREDICTED: tubulin alpha chain-like                330   2e-107   Elaeis guineensis
ref|XP_002510010.1|  tubulin alpha chain, putative                      330   2e-107   Ricinus communis
gb|ABX57816.1|  alpha tubulin                                           330   2e-107   Picea wilsonii
gb|AAV92352.1|  alpha tubulin 1                                         330   2e-107   Pseudotsuga menziesii var. menziesii
ref|XP_002522104.1|  tubulin alpha chain, putative                      330   2e-107   Ricinus communis
ref|XP_011457777.1|  PREDICTED: tubulin alpha chain                     330   2e-107   Fragaria vesca subsp. vesca
ref|XP_009335354.1|  PREDICTED: tubulin alpha chain                     330   2e-107   Pyrus x bretschneideri [bai li]
ref|XP_006422747.1|  hypothetical protein CICLE_v10028426mg             330   2e-107   Citrus clementina [clementine]
ref|XP_007032501.1|  Tubulin alpha-2 chain                              330   2e-107   
gb|ABL61201.1|  alpha-tubulin                                           325   2e-107   Oxymonadida environmental sample
ref|XP_008455054.1|  PREDICTED: tubulin alpha-4 chain isoform X1        330   2e-107   Cucumis melo [Oriental melon]
ref|XP_007018369.1|  Tubulin alpha-2 chain                              330   2e-107   Theobroma cacao [chocolate]
ref|XP_001764722.1|  predicted protein                                  330   2e-107   
ref|XP_010065856.1|  PREDICTED: tubulin alpha chain                     330   2e-107   Eucalyptus grandis [rose gum]
ref|XP_010245599.1|  PREDICTED: tubulin alpha chain-like                330   2e-107   Nelumbo nucifera [Indian lotus]
gb|AIX10966.1|  tubulin                                                 330   2e-107   Ornithogalum longebracteatum [sea-onion]
ref|XP_006466394.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    330   2e-107   Citrus sinensis [apfelsine]
ref|XP_006426173.1|  hypothetical protein CICLE_v10025588mg             330   2e-107   Citrus clementina [clementine]
ref|XP_002981542.1|  hypothetical protein SELMODRAFT_178975             330   2e-107   Selaginella moellendorffii
gb|ABO47740.1|  alpha-tubulin                                           330   2e-107   Gossypium hirsutum [American cotton]
ref|XP_010256937.1|  PREDICTED: tubulin alpha chain-like                330   2e-107   Nelumbo nucifera [Indian lotus]
gb|ABO47736.1|  alpha-tubulin                                           330   2e-107   Gossypium hirsutum [American cotton]
ref|XP_008804464.1|  PREDICTED: tubulin alpha chain-like                330   2e-107   Phoenix dactylifera
ref|XP_008372961.1|  PREDICTED: tubulin alpha chain isoform X1          330   2e-107   Malus domestica [apple tree]
gb|KDP44552.1|  hypothetical protein JCGZ_16385                         330   2e-107   Jatropha curcas
gb|ACJ60905.1|  alpha tubulin                                           330   2e-107   Betula pendula [white birch]
gb|ABO47739.1|  alpha-tubulin                                           330   2e-107   Gossypium hirsutum [American cotton]
ref|XP_003635553.2|  PREDICTED: tubulin alpha chain-like                330   2e-107   Vitis vinifera
ref|XP_011014531.1|  PREDICTED: tubulin alpha-4 chain-like              330   2e-107   Populus euphratica
gb|KHN08201.1|  Tubulin alpha chain                                     330   2e-107   Glycine soja [wild soybean]
ref|XP_003522731.1|  PREDICTED: tubulin alpha-4 chain isoform X1        330   2e-107   Glycine max [soybeans]
ref|XP_010242419.1|  PREDICTED: tubulin alpha-1 chain                   330   2e-107   Nelumbo nucifera [Indian lotus]
ref|XP_004136930.1|  PREDICTED: tubulin alpha-4 chain-like              330   2e-107   Cucumis sativus [cucumbers]
ref|XP_007137281.1|  hypothetical protein PHAVU_009G114100g             330   2e-107   Phaseolus vulgaris [French bean]
ref|XP_004288297.1|  PREDICTED: tubulin alpha-3 chain                   330   2e-107   Fragaria vesca subsp. vesca
gb|ACN40181.1|  unknown                                                 330   2e-107   Picea sitchensis
ref|XP_002283198.1|  PREDICTED: tubulin alpha chain                     330   2e-107   Vitis vinifera
gb|KHG18997.1|  Tubulin alpha chain                                     330   2e-107   Gossypium arboreum [tree cotton]
ref|XP_010266793.1|  PREDICTED: tubulin alpha chain                     330   2e-107   Nelumbo nucifera [Indian lotus]
ref|XP_008787237.1|  PREDICTED: tubulin alpha chain                     330   2e-107   Phoenix dactylifera
ref|XP_007199840.1|  hypothetical protein PRUPE_ppa005633mg             330   2e-107   Prunus persica
gb|ABO47742.1|  alpha-tubulin                                           330   2e-107   Gossypium hirsutum [American cotton]
gb|AGG37283.1|  alpha-tubulin 1                                         330   2e-107   Salix arbutifolia
sp|P33629.1|TBA_PRUDU  RecName: Full=Tubulin alpha chain                330   2e-107   Prunus dulcis [sweet almond]
ref|XP_007042689.1|  Tubulin alpha-2 chain                              330   2e-107   Theobroma cacao [chocolate]
ref|XP_010936237.1|  PREDICTED: tubulin alpha chain-like                330   2e-107   Elaeis guineensis
ref|XP_004501073.1|  PREDICTED: tubulin alpha chain-like                330   2e-107   Cicer arietinum [garbanzo]
ref|XP_003603670.1|  Tubulin alpha-7 chain                              330   2e-107   Medicago truncatula
ref|XP_010531321.1|  PREDICTED: tubulin alpha chain isoform X1          330   2e-107   Tarenaya hassleriana [spider flower]
ref|XP_009335355.1|  PREDICTED: tubulin alpha chain-like                330   2e-107   Pyrus x bretschneideri [bai li]
sp|P46259.1|TBA1_PEA  RecName: Full=Tubulin alpha-1 chain               330   2e-107   Pisum sativum [garden pea]
ref|XP_008440459.1|  PREDICTED: tubulin alpha chain-like isoform X1     330   2e-107   Cucumis melo [Oriental melon]
ref|XP_004143417.1|  PREDICTED: tubulin alpha chain-like                330   2e-107   Cucumis sativus [cucumbers]
ref|XP_010939312.1|  PREDICTED: tubulin alpha chain-like                330   2e-107   Elaeis guineensis
ref|XP_002517492.1|  tubulin alpha chain, putative                      330   2e-107   
gb|KDP41548.1|  hypothetical protein JCGZ_15955                         330   2e-107   
ref|XP_002301128.1|  hypothetical protein POPTR_0002s11250g             330   2e-107   
ref|XP_011398411.1|  Tubulin alpha chain                                328   2e-107   
ref|XP_010526692.1|  PREDICTED: tubulin alpha chain-like                330   2e-107   
ref|XP_010555432.1|  PREDICTED: tubulin alpha chain-like                330   2e-107   
gb|AID52921.1|  tubulin alpha chain                                     330   2e-107   
ref|XP_006581474.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    330   3e-107   
gb|AAK37831.1|AF182309_1  alpha-tubulin                                 330   3e-107   
gb|AFW67749.1|  alpha tubulin4                                          325   3e-107   
ref|XP_002275973.1|  PREDICTED: tubulin alpha chain                     330   3e-107   
gb|AAB36609.1|  alpha-tubulin                                           327   3e-107   
ref|XP_007205183.1|  hypothetical protein PRUPE_ppa005613mg             330   3e-107   
gb|AAD11425.1|  alpha tubulin                                           327   3e-107   
ref|XP_006404742.1|  hypothetical protein EUTSA_v10000161mg             330   3e-107   
gb|ACK76232.1|  alpha-tubulin                                           330   3e-107   
sp|P33625.1|TBA_EUGGR  RecName: Full=Tubulin alpha chain                330   3e-107   
gb|ABL61216.1|  alpha-tubulin                                           325   3e-107   
gb|AEQ75493.1|  alpha-tubulin                                           329   3e-107   
gb|ABL61212.1|  alpha-tubulin                                           325   4e-107   
gb|ABL61224.1|  alpha-tubulin                                           325   4e-107   
gb|AEW46684.1|  beta-tubulin                                            329   4e-107   
gb|ABL61215.1|  alpha-tubulin                                           325   4e-107   
ref|XP_010680774.1|  PREDICTED: tubulin alpha-2 chain                   329   4e-107   
gb|AGG37289.1|  alpha-tubulin 7                                         329   4e-107   
ref|XP_011008936.1|  PREDICTED: tubulin alpha chain                     329   4e-107   
ref|XP_007215369.1|  hypothetical protein PRUPE_ppa005626mg             329   4e-107   
emb|CAM58978.1|  alpha tubulin 5                                        322   4e-107   
gb|AFW67748.1|  alpha tubulin4                                          326   4e-107   
gb|ADJ00012.1|  tubulin alpha chain                                     322   5e-107   
gb|KDO81348.1|  hypothetical protein CISIN_1g013037mg                   329   5e-107   
gb|AAO46130.1|  alpha-tubulin                                           322   5e-107   
gb|AEE98361.1|  alpha-tubulin                                           322   5e-107   
gb|ABD92937.1|  alpha tubulin-4A                                        329   5e-107   
gb|ABD92936.1|  alpha tubulin-4D                                        329   5e-107   
ref|XP_005851144.1|  alpha-tubulin                                      329   5e-107   
ref|XP_002324047.2|  hypothetical protein POPTR_0017s11740g             329   5e-107   
ref|XP_004299843.1|  PREDICTED: tubulin alpha chain-like                329   5e-107   
ref|XP_007223365.1|  hypothetical protein PRUPE_ppa005617mg             329   5e-107   
dbj|BAJ06364.1|  alpha-tubulin                                          329   5e-107   
ref|XP_003558668.1|  PREDICTED: tubulin alpha-2 chain-like              329   5e-107   
ref|XP_007047652.1|  Tubulin alpha-2 chain                              331   5e-107   
ref|XP_004304311.1|  PREDICTED: tubulin alpha-2 chain-like              329   5e-107   
ref|XP_010664458.1|  PREDICTED: tubulin alpha-4 chain                   329   5e-107   
ref|XP_010104543.1|  Tubulin alpha chain                                329   6e-107   
sp|P33623.1|TBA1_ANEPH  RecName: Full=Tubulin alpha-1 chain             329   6e-107   
ref|XP_009409992.1|  PREDICTED: tubulin alpha chain-like                329   6e-107   
ref|XP_009388502.1|  PREDICTED: tubulin alpha-2 chain isoform X1        329   6e-107   
gb|KDO81347.1|  hypothetical protein CISIN_1g013037mg                   329   6e-107   
ref|XP_006472372.1|  PREDICTED: tubulin alpha chain isoform X1          329   6e-107   
ref|XP_008379344.1|  PREDICTED: tubulin alpha-2 chain                   329   6e-107   
gb|KHN42598.1|  Tubulin alpha-2 chain                                   329   6e-107   
ref|XP_003539228.1|  PREDICTED: tubulin alpha-2 chain-like              329   6e-107   
ref|XP_003517369.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    329   6e-107   
ref|XP_002962630.1|  hypothetical protein SELMODRAFT_230143             329   6e-107   
emb|CAB77671.1|  alpha-tubulin                                          329   7e-107   
ref|XP_009402887.1|  PREDICTED: tubulin alpha chain                     329   7e-107   
sp|Q38771.1|TBA_AVESA  RecName: Full=Tubulin alpha chain                328   7e-107   
gb|AAG28536.1|AF199019_1  alpha tubulin                                 320   8e-107   
gb|EYU34660.1|  hypothetical protein MIMGU_mgv1a006269mg                328   8e-107   
ref|XP_003556001.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    328   8e-107   
ref|XP_003536570.1|  PREDICTED: tubulin alpha chain-like isoform X1     328   8e-107   
gb|KEH43997.1|  tubulin beta-1 chain                                    328   8e-107   
ref|XP_004496862.1|  PREDICTED: tubulin alpha chain-like                328   8e-107   
ref|XP_002964078.1|  hypothetical protein SELMODRAFT_405729             328   8e-107   
sp|Q6VAG0.1|TBA2_GOSHI  RecName: Full=Tubulin alpha-2 chain; AltN...    328   8e-107   
gb|KIZ03400.1|  Tubulin alpha chain                                     328   9e-107   
ref|XP_007156677.1|  hypothetical protein PHAVU_002G007900g             328   9e-107   
emb|CAB76918.1|  alpha-tubulin 5                                        319   9e-107   
sp|Q6VAG1.1|TBA1_GOSHI  RecName: Full=Tubulin alpha-1 chain; AltN...    328   1e-106   
ref|XP_002972670.1|  hypothetical protein SELMODRAFT_231979             328   1e-106   
gb|ABC59068.2|  alpha tubulin 1                                         328   1e-106   
prf||1503274A  alpha1 tubulin                                           328   1e-106
gb|AAO46128.1|  alpha-tubulin                                           321   1e-106   
gb|ABL61202.1|  alpha-tubulin                                           323   1e-106   
gb|ETM52928.1|  tubulin alpha chain                                     327   1e-106   
ref|XP_011088040.1|  PREDICTED: tubulin alpha chain                     328   1e-106   
ref|XP_007143142.1|  hypothetical protein PHAVU_007G047300g             328   1e-106   
dbj|BAG99724.1|  unnamed protein product                                327   1e-106   
ref|WP_039310890.1|  hypothetical protein                               328   1e-106   
emb|CDP02221.1|  unnamed protein product                                328   1e-106   
gb|ABL61219.1|  alpha-tubulin                                           323   1e-106   
gb|ETM53002.1|  tubulin alpha chain                                     318   1e-106   
gb|EPY40479.1|  tubulin alpha                                           321   1e-106   
ref|XP_005651460.1|  tubulin alpha chain                                328   1e-106   
gb|KDD76276.1|  tubulin/FtsZ GTPase                                     328   1e-106   
gb|ABF98641.1|  Tubulin alpha-1 chain, putative, expressed              327   1e-106   
ref|NP_001291325.1|  tubulin alpha chain-like                           328   1e-106   
emb|CDO97305.1|  unnamed protein product                                328   1e-106   
gb|KIZ01406.1|  Tubulin alpha-1 chain                                   328   2e-106   
ref|XP_002976230.1|  hypothetical protein SELMODRAFT_105136             328   2e-106   
emb|CAB66336.1|  alpha-tubulin                                          328   2e-106   
ref|XP_006307493.1|  hypothetical protein CARUB_v10009117mg             328   2e-106   
gb|KJB34154.1|  hypothetical protein B456_006G050600                    320   2e-106   
ref|XP_002508010.1|  alpha tubulin 2                                    328   2e-106   
ref|XP_011098608.1|  PREDICTED: tubulin alpha chain                     328   2e-106   
ref|XP_002989731.1|  hypothetical protein SELMODRAFT_130285             328   2e-106   
gb|AHJ80823.1|  Tua1                                                    328   2e-106   
gb|ABL61204.1|  alpha-tubulin                                           322   2e-106   
dbj|BAC24800.1|  alpha tubulin                                          328   2e-106   
ref|XP_005643073.1|  tubulin alpha chain                                328   2e-106   
gb|AAU10519.1|  alpha tubulin                                           320   2e-106   
gb|ABL61217.1|  alpha-tubulin                                           323   2e-106   
ref|XP_004232226.1|  PREDICTED: tubulin alpha chain-like                327   2e-106   
gb|EPY33355.1|  tubulin alpha                                           323   2e-106   
gb|EPY39349.1|  tubulin alpha                                           322   2e-106   
gb|ABL61203.1|  alpha-tubulin                                           322   2e-106   
ref|XP_009626810.1|  PREDICTED: tubulin alpha chain-like                327   2e-106   
gb|ABL61213.1|  alpha-tubulin                                           323   2e-106   
gb|ABL61227.1|  alpha-tubulin                                           323   2e-106   
ref|XP_010096739.1|  Tubulin alpha chain                                327   2e-106   
ref|XP_008665337.1|  PREDICTED: tubulin alpha-1 chain-like              327   2e-106   
ref|XP_008665339.1|  PREDICTED: tubulin alpha-2 chain                   327   2e-106   
dbj|BAP59012.1|  alpha tubulin                                          327   2e-106   
gb|ABQ59634.1|  alpha-tubulin 5                                         327   3e-106   
gb|AHJ80815.1|  Tua1                                                    327   3e-106   
ref|XP_006362511.1|  PREDICTED: tubulin alpha-1 chain-like              327   3e-106   
ref|XP_003058621.1|  alpha tubulin                                      327   3e-106   
ref|NP_001167663.1|  tubulin alpha-3 chain                              327   3e-106   
sp|O22347.1|TBA1_ELEIN  RecName: Full=Tubulin alpha-1 chain; AltN...    327   3e-106   
gb|AFC88832.1|  putative tubulin alpha-3 chain                          327   3e-106   
ref|XP_009407690.1|  PREDICTED: tubulin alpha chain-like                327   3e-106   
ref|XP_010060142.1|  PREDICTED: tubulin alpha chain-like                327   3e-106   
dbj|BAJ06362.1|  alpha-tubulin                                          327   3e-106   
ref|XP_003560377.1|  PREDICTED: tubulin alpha-1 chain                   327   3e-106   
ref|XP_004981922.1|  PREDICTED: tubulin alpha-1 chain-like              327   3e-106   
gb|AAB86649.1|  alpha-tubulin                                           327   3e-106   
gb|ABB02631.1|  unknown                                                 327   3e-106   
ref|XP_004238046.1|  PREDICTED: tubulin alpha chain                     327   3e-106   
emb|CAD13176.1|  alpha-tubulin                                          327   3e-106   
ref|XP_009790136.1|  PREDICTED: tubulin alpha chain                     327   3e-106   
gb|ACH68563.1|  alpha-tubulin                                           327   3e-106   
ref|XP_010507910.1|  PREDICTED: tubulin alpha-2 chain-like              327   3e-106   
gb|AAB86648.1|  alpha-tubulin                                           327   3e-106   
ref|XP_009605705.1|  PREDICTED: tubulin alpha-2 chain-like              327   3e-106   
emb|CDY29334.1|  BnaA05g16010D                                          327   3e-106   
gb|AHJ80817.1|  Tua1                                                    327   3e-106   
ref|XP_002313194.1|  hypothetical protein POPTR_0009s08850g             327   3e-106   
gb|KFK32793.1|  hypothetical protein AALP_AA6G289100                    327   3e-106   
ref|XP_004244533.1|  PREDICTED: tubulin alpha-3 chain-like              327   3e-106   
gb|AAX63396.1|  alpha-tubulin                                           327   3e-106   
gb|ETW27380.1|  tubulin alpha chain                                     322   3e-106   
ref|NP_001275271.1|  alpha-tubulin-like protein                         327   3e-106   
tpg|DAA51109.1|  TPA: alpha tubulin                                     327   3e-106   
sp|Q9ZRR5.1|TBA3_HORVU  RecName: Full=Tubulin alpha-3 chain             327   3e-106   
ref|XP_002466535.1|  hypothetical protein SORBIDRAFT_01g009570          327   3e-106   
emb|CAA06619.1|  alpha-tubulin 1                                        327   3e-106   
ref|XP_009620798.1|  PREDICTED: tubulin alpha chain                     327   3e-106   
emb|CDW82295.1|  alpha tubulin                                          327   3e-106   
sp|P28287.1|TBA_OXYGR  RecName: Full=Tubulin alpha chain                327   3e-106   
ref|XP_006356798.1|  PREDICTED: tubulin alpha chain-like                327   3e-106   
gb|EJY81124.1|  Alpha tubulin,putative                                  327   3e-106   
gb|AAO46126.1|  alpha-tubulin                                           320   3e-106   
ref|XP_006662856.1|  PREDICTED: tubulin alpha-3 chain-like              327   3e-106   
gb|AGG37287.1|  alpha-tubulin 5                                         327   3e-106   
ref|XP_009614122.1|  PREDICTED: tubulin alpha-3 chain                   327   4e-106   
emb|CCI45804.1|  unnamed protein product                                327   4e-106   
gb|ABP65320.1|  alpha tubulin                                           327   4e-106   
emb|CCA20146.1|  alpha tubulin 1 putative                               327   4e-106   
gb|ABL61214.1|  alpha-tubulin                                           322   4e-106   
emb|CEG01594.1|  Tubulin/FtsZ, 2-layer sandwich domain                  327   4e-106   
ref|XP_006650518.1|  PREDICTED: tubulin alpha-1 chain-like              327   4e-106   
emb|CDY66630.1|  BnaCnng51680D                                          326   4e-106   
ref|XP_011002356.1|  PREDICTED: tubulin alpha chain-like                327   4e-106   
gb|ABU93324.1|  tubulin alpha subunit                                   327   5e-106   
gb|AFK33477.1|  unknown                                                 323   5e-106   
ref|XP_002989721.1|  hypothetical protein SELMODRAFT_235864             327   5e-106   
ref|XP_007512064.1|  alpha-tubulin                                      327   5e-106   
ref|XP_006650524.1|  PREDICTED: tubulin alpha-1 chain-like              327   5e-106   
gb|AAT09063.1|  alpha tubulin 1                                         327   5e-106   
ref|XP_003080933.1|  TBA_CHLVU Tubulin alpha chain (ISS)                327   5e-106   
gb|ABV55999.1|  alpha-tubulin 7                                         327   5e-106   
ref|XP_002782100.1|  Tubulin alpha chain, putative                      322   5e-106   
dbj|BAE99023.1|  tubulin alpha-2/alpha-4 chain                          327   5e-106   
gb|ABL61226.1|  alpha-tubulin                                           322   5e-106   
ref|NP_171974.1|  tubulin alpha-4 chain                                 327   5e-106   
gb|KHG14074.1|  Tubulin alpha-2 chain                                   324   6e-106   
gb|ABU93323.1|  tubulin alpha subunit                                   327   6e-106   
ref|XP_001419217.1|  predicted protein                                  326   6e-106   
gb|ETM53018.1|  tubulin alpha chain                                     319   6e-106   
gb|AIA82433.1|  alpha-tubulin-like protein 01                           326   6e-106   
ref|XP_009147859.1|  PREDICTED: tubulin alpha-6 chain                   326   7e-106   
gb|AIA82435.1|  alpha-tubulin-like protein 03                           326   7e-106   
ref|XP_008877307.1|  tubulin alpha chain                                323   7e-106   
emb|CAA62916.1|  alpha-tubulin                                          326   7e-106   
gb|ABL61218.1|  alpha-tubulin                                           321   7e-106   
ref|XP_001770881.1|  predicted protein                                  326   7e-106   
gb|AAL16174.1|AF428406_1  AT4g14960/dl3520c                             326   8e-106   
gb|EWC76931.1|  tubulin alpha chain                                     321   8e-106   
ref|XP_002962209.1|  hypothetical protein SELMODRAFT_230058             326   8e-106   
ref|XP_009537046.1|  hypothetical protein PHYSODRAFT_340566             322   8e-106   
emb|CDJ60085.1|  tubulin alpha chain, putative                          325   8e-106   
gb|AAB08791.1|  alpha tubulin                                           326   8e-106   
ref|XP_010500555.1|  PREDICTED: tubulin alpha-6 chain isoform X1        326   8e-106   
ref|NP_193232.1|  tubulin alpha-6 chain                                 326   8e-106   
gb|ACU20294.1|  unknown                                                 322   9e-106   
ref|XP_002963093.1|  hypothetical protein SELMODRAFT_404672             326   9e-106   
ref|XP_007015700.1|  Tubulin alpha-5, putative                          330   9e-106   
gb|EPR58771.1|  alpha tubulin TUBA1                                     325   9e-106   
ref|XP_009124556.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    326   9e-106   
ref|XP_004489692.1|  PREDICTED: tubulin alpha-3 chain-like              326   9e-106   
ref|NP_001051132.1|  Os03g0726100                                       326   1e-105   
sp|Q9ZRB7.1|TBA_WHEAT  RecName: Full=Tubulin alpha chain                326   1e-105   
sp|Q96460.1|TBA2_HORVU  RecName: Full=Tubulin alpha-2 chain             326   1e-105   
gb|ABD92930.1|  alpha tubulin-2A                                        326   1e-105   
ref|XP_006431130.1|  hypothetical protein CICLE_v10011709mg             326   1e-105   
gb|AEF79970.1|  alpha-tubulin protein                                   326   1e-105   
ref|XP_002980240.1|  hypothetical protein SELMODRAFT_419896             325   1e-105   
gb|ETM30643.1|  tubulin alpha chain                                     325   1e-105   
ref|XP_004150268.1|  PREDICTED: tubulin alpha chain-like                325   1e-105   
sp|Q25563.1|TBA13_NAEGR  RecName: Full=Tubulin alpha-13 chain           325   1e-105   
ref|XP_002675196.1|  alpha-tubulin                                      325   1e-105   
ref|XP_010557535.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    325   1e-105   
gb|ETP23198.1|  tubulin alpha chain                                     322   2e-105   
emb|CCI41153.1|  unnamed protein product                                325   2e-105   
ref|XP_008900864.1|  tubulin alpha chain                                325   2e-105   
gb|ETO82054.1|  tubulin alpha chain                                     325   2e-105   
ref|XP_008872990.1|  tubulin alpha chain                                325   2e-105   
gb|ABK92552.1|  unknown                                                 325   2e-105   
ref|XP_008341563.1|  PREDICTED: tubulin alpha-2 chain-like              325   2e-105   
gb|ABP65323.1|  alpha tubulin                                           325   2e-105   



>ref|XP_008384431.1| PREDICTED: tubulin alpha-3 chain-like [Malus domestica]
Length=282

 Score =   342 bits (877),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 159/163 (98%), Positives = 163/163 (100%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISAAKAYHEQ+S+PEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  103  SSYAPVISAAKAYHEQISIPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  162

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  163  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFS  222

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  223  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  265



>ref|XP_010420792.1| PREDICTED: tubulin alpha-3 chain-like [Camelina sativa]
Length=183

 Score =   337 bits (863),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 158/163 (97%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISAAKAYHEQLSVPEIT+AVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  3    SSYAPVISAAKAYHEQLSVPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVN  62

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAV TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  63   AAVGTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFS  122

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  123  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  165



>emb|CAD20821.1| alpha tubulin [Zea mays]
Length=274

 Score =   339 bits (869),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 158/163 (97%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  94   SSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  153

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  154  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFS  213

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  214  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  256



>dbj|BAH20267.1| AT5G19780 [Arabidopsis thaliana]
Length=284

 Score =   339 bits (870),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 158/163 (97%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISAAKAYHEQLSVPEIT+AVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  104  SSYAPVISAAKAYHEQLSVPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVN  163

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAV TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  164  AAVGTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFS  223

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  224  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  266



>gb|ABR25510.1| tubulin alpha-1 chain [Oryza sativa Indica Group]
Length=255

 Score =   338 bits (867),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 158/163 (97%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  75   SSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  134

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  135  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFS  194

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  195  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  237



>dbj|BAD94893.1| tubulin alpha-5 chain-like protein [Arabidopsis thaliana]
Length=183

 Score =   335 bits (860),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 157/163 (96%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISAAKAYHEQLSVPEIT+AVFEP+SMMAKCDP+HGKYMACCLMYRGDVVPKDVN
Sbjct  3    SSYAPVISAAKAYHEQLSVPEITNAVFEPASMMAKCDPKHGKYMACCLMYRGDVVPKDVN  62

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAV TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  63   AAVGTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFS  122

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  123  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  165



>emb|CAL35827.1| alpha-2 tubulin [Plantago major]
Length=249

 Score =   337 bits (865),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 157/163 (96%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLS+PEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  69   SSYAPVISAEKAYHEQLSIPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  128

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAV TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  129  AAVGTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFS  188

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  189  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  231



>ref|XP_001777110.1| predicted protein [Physcomitrella patens]
 gb|EDQ58103.1| predicted protein [Physcomitrella patens]
Length=344

 Score =   341 bits (874),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 159/163 (98%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  165  SSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  224

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  225  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFS  284

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  285  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  327



>emb|CAD20820.1| alpha tubulin [Zea mays]
Length=200

 Score =   335 bits (860),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 158/163 (97%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  20   SSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  79

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  80   AAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFS  139

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  140  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  182



>ref|XP_009353129.1| PREDICTED: tubulin alpha-3 chain-like [Pyrus x bretschneideri]
Length=449

 Score =   344 bits (882),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 161/163 (99%), Positives = 163/163 (100%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISAAKAYHEQLSVPEITS+VFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAAKAYHEQLSVPEITSSVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_008386829.1| PREDICTED: tubulin alpha-3 chain-like [Malus domestica]
Length=449

 Score =   344 bits (882),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 161/163 (99%), Positives = 163/163 (100%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISAAKA+HEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAAKAFHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|KDP39691.1| hypothetical protein JCGZ_02711 [Jatropha curcas]
Length=449

 Score =   343 bits (881),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 161/163 (99%), Positives = 163/163 (100%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|KJB83378.1| hypothetical protein B456_013G244600 [Gossypium raimondii]
Length=404

 Score =   342 bits (876),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 158/163 (97%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLS+PEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  225  SSYAPVISAEKAYHEQLSIPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  284

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVF+
Sbjct  285  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFA  344

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  345  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  387



>ref|XP_009366459.1| PREDICTED: tubulin alpha-3 chain [Pyrus x bretschneideri]
Length=449

 Score =   343 bits (880),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 160/163 (98%), Positives = 163/163 (100%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISAAKA+HEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAAKAFHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKT+RTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVATIKTRRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002525416.1| tubulin alpha chain, putative [Ricinus communis]
 gb|EEF36906.1| tubulin alpha chain, putative [Ricinus communis]
Length=449

 Score =   343 bits (879),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 160/163 (98%), Positives = 163/163 (100%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISAAKA+HEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAAKAFHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AGG37288.1| alpha-tubulin 6 [Salix arbutifolia]
Length=449

 Score =   343 bits (879),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 160/163 (98%), Positives = 163/163 (100%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            ++VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  SSVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_004295008.1| PREDICTED: tubulin alpha-3 chain isoform X1 [Fragaria vesca subsp. 
vesca]
Length=450

 Score =   343 bits (879),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 160/163 (98%), Positives = 163/163 (100%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISAAKAYHEQ+SVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAAKAYHEQISVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_011034391.1| PREDICTED: tubulin alpha-3 chain [Populus euphratica]
Length=449

 Score =   343 bits (879),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 160/163 (98%), Positives = 163/163 (100%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            +AV+TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  SAVSTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_008349406.1| PREDICTED: tubulin alpha-3 chain [Malus domestica]
 ref|XP_008366135.1| PREDICTED: tubulin alpha-3 chain [Malus domestica]
 ref|XP_009339175.1| PREDICTED: tubulin alpha-3 chain-like [Pyrus x bretschneideri]
Length=449

 Score =   342 bits (878),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 159/163 (98%), Positives = 163/163 (100%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISAAKAYHEQ+S+PEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAAKAYHEQISIPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_009375870.1| PREDICTED: tubulin alpha-3 chain [Pyrus x bretschneideri]
Length=449

 Score =   342 bits (878),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 159/163 (98%), Positives = 163/163 (100%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISAAKAYHEQ+S+PEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAAKAYHEQISIPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_008351479.1| PREDICTED: tubulin alpha-3 chain [Malus domestica]
Length=449

 Score =   342 bits (878),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 159/163 (98%), Positives = 163/163 (100%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISAAKAYHEQ+S+PEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAAKAYHEQISIPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_011089722.1| PREDICTED: tubulin alpha-3 chain [Sesamum indicum]
Length=449

 Score =   342 bits (877),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 160/163 (98%), Positives = 163/163 (100%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISAAKAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAAKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_007030078.1| Tubulin alpha-5 [Theobroma cacao]
 gb|EOY10580.1| Tubulin alpha-5 [Theobroma cacao]
Length=482

 Score =   343 bits (880),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 160/163 (98%), Positives = 163/163 (100%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVIS+AKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  303  SSYAPVISSAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  362

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  363  AAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFS  422

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  423  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  465



>sp|P33624.1|TBA2_ANEPH RecName: Full=Tubulin alpha-2 chain, partial [Anemia phyllitidis]
 emb|CAA48928.1| alpha tubulin 2, partial [Anemia phyllitidis]
Length=364

 Score =   339 bits (869),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 158/163 (97%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISAAKAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  186  SSYAPVISAAKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  245

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  246  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFS  305

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+K AFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  306  RIDHKFDLMYAKLAFVHWYVGEGMEEGEFSEAREDLAALEKDY  348



>emb|CDP17586.1| unnamed protein product [Coffea canephora]
Length=449

 Score =   342 bits (877),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 160/163 (98%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002325422.1| Tubulin alpha-1 chain family protein [Populus trichocarpa]
 gb|EEE99803.1| Tubulin alpha-1 chain family protein [Populus trichocarpa]
Length=449

 Score =   342 bits (876),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 159/163 (98%), Positives = 163/163 (100%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISAAKAYHEQ+SVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAAKAYHEQISVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            +AV+TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  SAVSTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AGG37290.1| alpha-tubulin 8 [Salix arbutifolia]
Length=449

 Score =   342 bits (876),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 159/163 (98%), Positives = 163/163 (100%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISAAKAYHEQ+SVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAAKAYHEQISVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            +AV+TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  SAVSTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_011021469.1| PREDICTED: tubulin alpha-3 chain-like [Populus euphratica]
Length=449

 Score =   342 bits (876),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 159/163 (98%), Positives = 163/163 (100%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISAAKAYHEQ+SVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAAKAYHEQISVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            +AV+TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  SAVSTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_006858944.1| hypothetical protein AMTR_s00068p00090790 [Amborella trichopoda]
 gb|ERN20411.1| hypothetical protein AMTR_s00068p00090790 [Amborella trichopoda]
Length=449

 Score =   342 bits (876),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 160/163 (98%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>tpg|DAA41189.1| TPA: alpha tubulin5 [Zea mays]
Length=320

 Score =   337 bits (864),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 158/163 (97%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  140  SSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  199

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  200  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFS  259

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  260  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  302



>tpg|DAA63280.1| TPA: alpha tubulin6 [Zea mays]
Length=320

 Score =   337 bits (864),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 158/163 (97%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  140  SSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  199

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  200  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFS  259

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  260  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  302



>ref|XP_009413318.1| PREDICTED: tubulin alpha-3 chain-like [Musa acuminata subsp. 
malaccensis]
Length=449

 Score =   342 bits (876),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 160/163 (98%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLARVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|KHG26159.1| Tubulin alpha-6 chain [Gossypium arboreum]
Length=449

 Score =   341 bits (875),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 160/163 (98%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA VQRAVCMISNNT+VAEVFS
Sbjct  330  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLARVQRAVCMISNNTSVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|EYU23006.1| hypothetical protein MIMGU_mgv1a006283mg [Erythranthe guttata]
Length=449

 Score =   341 bits (875),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 160/163 (98%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|EYU31677.1| hypothetical protein MIMGU_mgv1a006281mg [Erythranthe guttata]
Length=449

 Score =   341 bits (875),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 159/163 (98%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISAAKAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAAKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAV TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVGTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002319688.1| Tubulin alpha-1 chain family protein [Populus trichocarpa]
 gb|EEE95611.1| Tubulin alpha-1 chain family protein [Populus trichocarpa]
Length=449

 Score =   341 bits (875),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 160/163 (98%), Positives = 163/163 (100%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            +AVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  SAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RID+KFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDYKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AHJ80821.1| Tua3, partial [Eragrostis tef]
Length=401

 Score =   340 bits (871),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 158/163 (97%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  221  SSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  280

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  281  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFS  340

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  341  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  383



>gb|KJB44614.1| hypothetical protein B456_007G261000 [Gossypium raimondii]
Length=449

 Score =   341 bits (874),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 159/163 (98%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGD+VPKDVN
Sbjct  270  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDIVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA VQRAVCMISNNT+VAEVFS
Sbjct  330  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLARVQRAVCMISNNTSVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_006286664.1| hypothetical protein CARUB_v10002583mg [Capsella rubella]
 ref|XP_010493056.1| PREDICTED: tubulin alpha-3 chain-like [Camelina sativa]
 ref|XP_010493058.1| PREDICTED: tubulin alpha-3 chain-like [Camelina sativa]
 gb|EOA19562.1| hypothetical protein CARUB_v10002583mg [Capsella rubella]
Length=450

 Score =   341 bits (874),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 159/163 (98%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISAAKAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAAKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAV TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVGTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|KCW87067.1| hypothetical protein EUGRSUZ_B03604 [Eucalyptus grandis]
Length=381

 Score =   338 bits (868),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 158/163 (97%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  202  SSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  261

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINY+PPTVVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  262  AAVATIKTKRTVQFVDWCPTGFKCGINYEPPTVVPGGDLAKVQRAVCMISNNTAVAEVFS  321

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  322  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  364



>gb|KHG06160.1| Tubulin alpha-3/alpha-5 chain -like protein [Gossypium arboreum]
Length=449

 Score =   341 bits (874),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 159/163 (98%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVF+
Sbjct  330  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFA  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_011075054.1| PREDICTED: tubulin alpha-3 chain-like [Sesamum indicum]
Length=449

 Score =   341 bits (874),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 159/163 (98%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISAAKAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAAKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVA+IKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVASIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLARVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ACN40824.1| unknown [Picea sitchensis]
Length=449

 Score =   341 bits (874),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 159/163 (98%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_007204346.1| hypothetical protein PRUPE_ppa005649mg [Prunus persica]
 gb|EMJ05545.1| hypothetical protein PRUPE_ppa005649mg [Prunus persica]
Length=449

 Score =   341 bits (874),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 159/163 (98%), Positives = 163/163 (100%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            A+VATIKTKRTVQFVDWCPTGFKCGINY+PP+VVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  ASVATIKTKRTVQFVDWCPTGFKCGINYEPPSVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_008240533.1| PREDICTED: tubulin alpha-3 chain isoform X1 [Prunus mume]
Length=449

 Score =   340 bits (873),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 159/163 (98%), Positives = 163/163 (100%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            A+VATIKTKRTVQFVDWCPTGFKCGINY+PP+VVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  ASVATIKTKRTVQFVDWCPTGFKCGINYEPPSVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>emb|CDY44941.1| BnaA02g04460D [Brassica napus]
 emb|CDY44942.1| BnaA02g04470D [Brassica napus]
Length=450

 Score =   340 bits (873),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 158/163 (97%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISAAKAYHEQLS+PEIT+AVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAAKAYHEQLSIPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAV TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVGTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AHZ58481.1| alpha-tubulin, partial [Syntrichia caninervis]
Length=200

 Score =   332 bits (850),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 155/163 (95%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  21   SSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  80

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  81   AAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFS  140

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  141  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  183



>ref|XP_009406530.1| PREDICTED: tubulin alpha-3 chain-like [Musa acuminata subsp. 
malaccensis]
Length=449

 Score =   340 bits (873),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 159/163 (98%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AEG74028.1| alpha-tubulin [Pellia endiviifolia (species B)]
 gb|AEG74032.1| alpha-tubulin [Pellia endiviifolia (species B)]
Length=448

 Score =   340 bits (873),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 159/163 (98%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|KHN06388.1| Tubulin alpha-3 chain [Glycine soja]
Length=421

 Score =   339 bits (870),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 158/163 (97%), Positives = 163/163 (100%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISAAKAYHEQLSVPEIT+AVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  242  SSYAPVISAAKAYHEQLSVPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVN  301

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  302  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFS  361

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  362  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  404



>gb|KJB83375.1| hypothetical protein B456_013G244600 [Gossypium raimondii]
Length=449

 Score =   340 bits (873),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 158/163 (97%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLS+PEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSIPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVF+
Sbjct  330  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFA  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_011025144.1| PREDICTED: tubulin alpha-3 chain [Populus euphratica]
Length=450

 Score =   340 bits (873),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 159/163 (98%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSVPEIT+AVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSVPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002285721.1| PREDICTED: tubulin alpha-3 chain [Vitis vinifera]
Length=449

 Score =   340 bits (873),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 159/163 (98%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_007205189.1| hypothetical protein PRUPE_ppa005642mg [Prunus persica]
 gb|EMJ06388.1| hypothetical protein PRUPE_ppa005642mg [Prunus persica]
Length=450

 Score =   340 bits (873),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 158/163 (97%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQ+S+PEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQISIPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_006445597.1| hypothetical protein CICLE_v10015224mg [Citrus clementina]
 ref|XP_006488930.1| PREDICTED: tubulin alpha-1 chain-like isoform X1 [Citrus sinensis]
 gb|ESR58837.1| hypothetical protein CICLE_v10015224mg [Citrus clementina]
 gb|KDO54446.1| hypothetical protein CISIN_1g013113mg [Citrus sinensis]
Length=449

 Score =   340 bits (872),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 159/163 (98%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002303998.1| alpha-tubulin 2 family protein [Populus trichocarpa]
 gb|EEE78977.1| alpha-tubulin 2 family protein [Populus trichocarpa]
Length=450

 Score =   340 bits (872),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 159/163 (98%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSVPEIT+AVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSVPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_008223650.1| PREDICTED: tubulin alpha-3 chain-like [Prunus mume]
Length=450

 Score =   340 bits (872),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 158/163 (97%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQ+S+PEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQISIPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010112637.1| Tubulin alpha-3 chain [Morus notabilis]
 gb|EXC34492.1| Tubulin alpha-3 chain [Morus notabilis]
Length=449

 Score =   340 bits (872),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 159/163 (98%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAV TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVGTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABO47735.1| alpha-tubulin [Gossypium hirsutum]
 gb|KHG06862.1| Tubulin alpha-6 chain [Gossypium arboreum]
 gb|KJB66054.1| hypothetical protein B456_010G125700 [Gossypium raimondii]
 gb|KJB66055.1| hypothetical protein B456_010G125700 [Gossypium raimondii]
Length=449

 Score =   340 bits (872),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 159/163 (98%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVF+
Sbjct  330  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFA  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_001777081.1| predicted protein [Physcomitrella patens]
 gb|EDQ58074.1| predicted protein [Physcomitrella patens]
Length=449

 Score =   340 bits (872),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 159/163 (98%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>emb|CAD26887.1| alpha-tubulin [Miscanthus sinensis]
Length=450

 Score =   340 bits (872),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 159/163 (98%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010257632.1| PREDICTED: tubulin alpha-3 chain [Nelumbo nucifera]
Length=449

 Score =   340 bits (872),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 159/163 (98%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLARVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABO47741.1| alpha-tubulin [Gossypium hirsutum]
Length=449

 Score =   340 bits (872),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 159/163 (98%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVF+
Sbjct  330  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFA  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_001782790.1| predicted protein [Physcomitrella patens]
 ref|XP_001782813.1| predicted protein [Physcomitrella patens]
 dbj|BAC24799.1| alpha tubulin [Physcomitrella patens]
 gb|EDQ52367.1| predicted protein [Physcomitrella patens]
 gb|EDQ52390.1| predicted protein [Physcomitrella patens]
Length=449

 Score =   340 bits (872),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 159/163 (98%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010673470.1| PREDICTED: tubulin alpha-3 chain [Beta vulgaris subsp. vulgaris]
Length=449

 Score =   340 bits (872),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 158/163 (97%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLS+PEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSIPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_009400845.1| PREDICTED: tubulin alpha-3 chain [Musa acuminata subsp. malaccensis]
Length=450

 Score =   340 bits (872),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 159/163 (98%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_009408459.1| PREDICTED: tubulin alpha-3 chain-like [Musa acuminata subsp. 
malaccensis]
Length=450

 Score =   340 bits (872),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 159/163 (98%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AGG37284.1| alpha-tubulin 2 [Salix arbutifolia]
Length=450

 Score =   340 bits (872),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 158/163 (97%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLS+PEIT+AVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSIPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_008813089.1| PREDICTED: tubulin alpha-3 chain [Phoenix dactylifera]
Length=450

 Score =   340 bits (872),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 159/163 (98%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLARVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AHJ80820.1| Tua3, partial [Eragrostis tef]
Length=400

 Score =   338 bits (867),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 156/163 (96%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSVPE+T+AVFEPSSMMAKCDPRHGKYMACCLMYRGDV+PKDVN
Sbjct  220  SSYAPVISAEKAYHEQLSVPEVTNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVIPKDVN  279

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  280  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFS  339

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  340  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  382



>ref|XP_010454260.1| PREDICTED: tubulin alpha-3 chain-like [Camelina sativa]
 ref|XP_010454262.1| PREDICTED: tubulin alpha-3 chain-like [Camelina sativa]
Length=450

 Score =   340 bits (871),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 158/163 (97%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISAAKAYHEQLSVPEIT+AVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAAKAYHEQLSVPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAV TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVGTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>emb|CDY42294.1| BnaC02g09000D [Brassica napus]
 emb|CDY42295.1| BnaC02g09010D [Brassica napus]
Length=450

 Score =   340 bits (871),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 158/163 (97%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISAAKAYHEQLSVPEIT+AVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAAKAYHEQLSVPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAV TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVGTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_006286795.1| hypothetical protein CARUB_v10003470mg [Capsella rubella]
 gb|EOA19693.1| hypothetical protein CARUB_v10003470mg [Capsella rubella]
Length=450

 Score =   340 bits (871),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 157/163 (96%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISAAKAYHEQLS+PEITSAVFEP SMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAAKAYHEQLSIPEITSAVFEPGSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAV TIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVGTIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_008804327.1| PREDICTED: tubulin alpha-1 chain-like [Phoenix dactylifera]
Length=450

 Score =   340 bits (871),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 158/163 (97%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010535933.1| PREDICTED: tubulin alpha-3 chain-like isoform X1 [Tarenaya hassleriana]
Length=449

 Score =   340 bits (871),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 158/163 (97%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISAAKAYHEQLSVPEIT+AVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAAKAYHEQLSVPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAV TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVGTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010531152.1| PREDICTED: tubulin alpha-3 chain [Tarenaya hassleriana]
Length=449

 Score =   340 bits (871),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 158/163 (97%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISAAKAYHEQLSVPEIT+AVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAAKAYHEQLSVPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAV TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVGTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_006443441.1| hypothetical protein CICLE_v10020128mg [Citrus clementina]
 ref|XP_006479124.1| PREDICTED: tubulin alpha-3 chain-like [Citrus sinensis]
 gb|ESR56681.1| hypothetical protein CICLE_v10020128mg [Citrus clementina]
Length=449

 Score =   340 bits (871),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 159/163 (98%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISAAKAYHEQ+SVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAAKAYHEQISVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
             AVATIKTKR VQFVDWCPTGFKCGINYQPPTVVPGGDLA VQRAVCMISNNTAVAEVFS
Sbjct  330  TAVATIKTKRAVQFVDWCPTGFKCGINYQPPTVVPGGDLARVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|NP_197478.1| tubulin alpha-3 [Arabidopsis thaliana]
 ref|NP_197479.1| tubulin alpha-5 [Arabidopsis thaliana]
 ref|XP_002871906.1| tubulin alpha-3 [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002873963.1| tubulin alpha-3 [Arabidopsis lyrata subsp. lyrata]
 ref|XP_006400538.1| hypothetical protein EUTSA_v10013521mg [Eutrema salsugineum]
 ref|XP_006400540.1| hypothetical protein EUTSA_v10013523mg [Eutrema salsugineum]
 ref|XP_010420793.1| PREDICTED: tubulin alpha-3 chain [Camelina sativa]
 sp|Q56WH1.2|TBA3_ARATH RecName: Full=Tubulin alpha-3 chain [Arabidopsis thaliana]
 sp|B9DHQ0.2|TBA5_ARATH RecName: Full=Tubulin alpha-5 chain [Arabidopsis thaliana]
 gb|AAK32888.1|AF367301_1 AT5g19770/T29J13_190 [Arabidopsis thaliana]
 gb|AAA32888.1| alpha-tubulin [Arabidopsis thaliana]
 gb|AAA32891.1| alpha-5 tubulin [Arabidopsis thaliana]
 gb|AAK64169.1| putative tubulin alpha-5 chain [Arabidopsis thaliana]
 gb|AAL38340.1| unknown protein [Arabidopsis thaliana]
 gb|AAL85097.1| putative tubulin alpha-5 chain [Arabidopsis thaliana]
 gb|AAN31860.1| putative tubulin alpha-5 chain [Arabidopsis thaliana]
 gb|AAN31861.1| putative tubulin alpha-5 chain [Arabidopsis thaliana]
 gb|AAN28834.1| At5g19770/T29J13_190 [Arabidopsis thaliana]
 gb|AAN65084.1| unknown protein [Arabidopsis thaliana]
 gb|EFH48165.1| tubulin alpha-3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50222.1| tubulin alpha-3 [Arabidopsis lyrata subsp. lyrata]
 gb|AED92747.1| tubulin alpha-3 [Arabidopsis thaliana]
 gb|AED92748.1| tubulin alpha-5 [Arabidopsis thaliana]
 gb|ESQ41991.1| hypothetical protein EUTSA_v10013521mg [Eutrema salsugineum]
 gb|ESQ41993.1| hypothetical protein EUTSA_v10013523mg [Eutrema salsugineum]
 gb|KFK26213.1| tubulin alpha-3 alpha-5 chain [Arabis alpina]
 gb|KFK26214.1| hypothetical protein AALP_AA8G217400 [Arabis alpina]
Length=450

 Score =   340 bits (871),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 158/163 (97%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISAAKAYHEQLSVPEIT+AVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAAKAYHEQLSVPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAV TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVGTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|KHG06861.1| Tubulin alpha-6 chain [Gossypium arboreum]
Length=460

 Score =   340 bits (872),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 159/163 (98%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  281  SSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  340

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVF+
Sbjct  341  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFA  400

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  443



>gb|KHN47983.1| Tubulin alpha-3 chain [Glycine soja]
Length=423

 Score =   338 bits (868),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 158/163 (97%), Positives = 163/163 (100%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISAAKAYHEQLSVPEIT+AVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  243  SSYAPVISAAKAYHEQLSVPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVN  302

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  303  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFS  362

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  363  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  405



>ref|XP_010934670.1| PREDICTED: tubulin alpha-3 chain-like [Elaeis guineensis]
Length=450

 Score =   340 bits (871),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 159/163 (98%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLARVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>emb|CDX88875.1| BnaA03g07740D [Brassica napus]
 emb|CDX70890.1| BnaC03g09740D [Brassica napus]
Length=450

 Score =   340 bits (871),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 158/163 (97%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISAAKAYHEQLSVPEIT+AVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAAKAYHEQLSVPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAV TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVGTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AGD80034.1| alpha-tubulin 1 [Hevea brasiliensis]
Length=449

 Score =   340 bits (871),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 159/163 (98%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLARVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_009126389.1| PREDICTED: tubulin alpha-3 chain-like [Brassica rapa]
Length=450

 Score =   340 bits (871),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 157/163 (96%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISAAKAYHEQLS+PEIT+AVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAAKAYHEQLSIPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAV TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVGTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_009126391.1| PREDICTED: tubulin alpha-3 chain-like [Brassica rapa]
Length=450

 Score =   339 bits (870),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 157/163 (96%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISAAKAYHEQLS+PEIT+AVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAAKAYHEQLSIPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAV TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVGTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABB16994.1| unknown [Solanum tuberosum]
Length=467

 Score =   340 bits (872),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 159/163 (98%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  288  SSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  347

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  348  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFS  407

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  408  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  450



>ref|NP_001242878.1| uncharacterized protein LOC100806907 [Glycine max]
 gb|ACU18050.1| unknown [Glycine max]
Length=450

 Score =   339 bits (870),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 158/163 (97%), Positives = 163/163 (100%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISAAKAYHEQLSVPEIT+AVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAAKAYHEQLSVPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_009120857.1| PREDICTED: tubulin alpha-3 chain [Brassica rapa]
 emb|CDX92501.1| BnaA10g15400D [Brassica napus]
 emb|CDX92502.1| BnaA10g15410D [Brassica napus]
Length=450

 Score =   339 bits (870),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 157/163 (96%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISAAKAYHEQLS+PEIT+AVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAAKAYHEQLSIPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAV TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVGTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010044940.1| PREDICTED: tubulin alpha-3 chain [Eucalyptus grandis]
 gb|KCW87066.1| hypothetical protein EUGRSUZ_B03604 [Eucalyptus grandis]
Length=449

 Score =   339 bits (870),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 158/163 (97%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINY+PPTVVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVATIKTKRTVQFVDWCPTGFKCGINYEPPTVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|NP_001237301.1| tubulin A [Glycine max]
 gb|AAX86047.1| tubulin A [Glycine max]
Length=450

 Score =   339 bits (870),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 158/163 (97%), Positives = 163/163 (100%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISAAKAYHEQLSVPEIT+AVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAAKAYHEQLSVPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>emb|CAD26886.1| alpha-tubulin [Miscanthus sinensis]
Length=450

 Score =   339 bits (870),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 158/163 (97%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010923361.1| PREDICTED: tubulin alpha-3 chain [Elaeis guineensis]
Length=450

 Score =   339 bits (870),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 158/163 (97%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_004958110.1| PREDICTED: tubulin alpha-3 chain-like [Setaria italica]
Length=450

 Score =   339 bits (870),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 158/163 (97%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_006579487.1| PREDICTED: tubulin A isoform X1 [Glycine max]
Length=449

 Score =   339 bits (870),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 158/163 (97%), Positives = 163/163 (100%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISAAKAYHEQLSVPEIT+AVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAAKAYHEQLSVPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AGY80453.1| tubulin [Dendrocalamus latiflorus]
Length=450

 Score =   339 bits (869),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 158/163 (97%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABD92942.1| alpha tubulin-1D [Triticum aestivum]
 gb|ABD92944.1| alpha tubulin-1A [Triticum aestivum]
 gb|EMS54563.1| Tubulin alpha-1 chain [Triticum urartu]
 gb|EMT26472.1| Tubulin alpha-1 chain [Aegilops tauschii]
Length=450

 Score =   339 bits (869),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 158/163 (97%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>emb|CAD24765.1| alpha-tubulin [Miscanthus sinensis]
Length=450

 Score =   339 bits (869),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 158/163 (97%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_003562846.1| PREDICTED: tubulin alpha-1 chain [Brachypodium distachyon]
Length=450

 Score =   339 bits (869),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 158/163 (97%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_004149645.1| PREDICTED: tubulin alpha-3 chain-like [Cucumis sativus]
 ref|XP_004164931.1| PREDICTED: tubulin alpha-3 chain-like [Cucumis sativus]
 gb|KGN54025.1| hypothetical protein Csa_4G268090 [Cucumis sativus]
Length=449

 Score =   339 bits (869),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 159/163 (98%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLALVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>dbj|BAJ06363.1| alpha-tubulin [Alopecurus aequalis]
Length=450

 Score =   339 bits (869),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 158/163 (97%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|NP_001105324.1| tubulin alpha-5 chain [Zea mays]
 sp|Q02245.1|TBA5_MAIZE RecName: Full=Tubulin alpha-5 chain; AltName: Full=Alpha-5-tubulin 
[Zea mays]
 emb|CAA44862.1| alpha-tubulin #5 [Zea mays]
 gb|AAA33437.1| alpha-tubulin [Zea mays]
 gb|AAA16225.1| alpha-tubulin [Zea mays]
 emb|CAD20822.1| alpha tubulin [Zea mays]
 tpg|DAA41190.1| TPA: alpha tubulin5 [Zea mays]
Length=450

 Score =   339 bits (869),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 158/163 (97%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|NP_001060075.1| Os07g0574800 [Oryza sativa Japonica Group]
 sp|P28752.1|TBA1_ORYSJ RecName: Full=Tubulin alpha-1 chain [Oryza sativa Japonica Group]
 emb|CAA77988.1| alpha 1 tubulin [Oryza sativa Japonica Group]
 emb|CAA62918.1| alfa-tubulin [Oryza sativa Japonica Group]
 dbj|BAC83168.1| Tubulin alpha-1 chain [Oryza sativa Japonica Group]
 dbj|BAD30236.1| Tubulin alpha-1 chain [Oryza sativa Japonica Group]
 gb|ABG78594.1| alpha-tubulin [Oryza sativa Japonica Group]
 dbj|BAF21989.1| Os07g0574800 [Oryza sativa Japonica Group]
 gb|EAZ04436.1| hypothetical protein OsI_26583 [Oryza sativa Indica Group]
 gb|EAZ40391.1| hypothetical protein OsJ_24840 [Oryza sativa Japonica Group]
 dbj|BAG90561.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG91280.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97017.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AGH17548.1| alpha tubulin [Oryza sativa]
Length=450

 Score =   339 bits (869),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 158/163 (97%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_008449885.1| PREDICTED: tubulin alpha-3 chain isoform X1 [Cucumis melo]
Length=449

 Score =   339 bits (869),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 159/163 (98%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLALVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>sp|Q43473.1|TBA1_HORVU RecName: Full=Tubulin alpha-1 chain [Hordeum vulgare]
 emb|CAA67942.1| alpha-tubulin 1 [Hordeum vulgare subsp. vulgare]
Length=450

 Score =   339 bits (869),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 158/163 (97%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>emb|CAD26891.1| alpha-tubulin [Miscanthus floridulus]
Length=450

 Score =   339 bits (869),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 158/163 (97%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002532068.1| tubulin alpha chain, putative [Ricinus communis]
 gb|EEF30323.1| tubulin alpha chain, putative [Ricinus communis]
Length=449

 Score =   339 bits (869),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 158/163 (97%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_007159433.1| hypothetical protein PHAVU_002G237400g [Phaseolus vulgaris]
 gb|ESW31427.1| hypothetical protein PHAVU_002G237400g [Phaseolus vulgaris]
Length=449

 Score =   339 bits (869),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 158/163 (97%), Positives = 163/163 (100%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISAAKAYHEQLSVPEIT+AVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAAKAYHEQLSVPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|NP_001105588.1| tubulin alpha-6 chain [Zea mays]
 sp|P33627.1|TBA6_MAIZE RecName: Full=Tubulin alpha-6 chain; AltName: Full=Alpha-6-tubulin 
[Zea mays]
 emb|CAA44863.1| alpha-tubulin #6 [Zea mays]
 gb|ACN35801.1| unknown [Zea mays]
 gb|AFE82989.1| tubulin alpha-5 [Saccharum hybrid cultivar]
 tpg|DAA63282.1| TPA: alpha tubulin6 [Zea mays]
Length=450

 Score =   339 bits (869),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 158/163 (97%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_006657877.1| PREDICTED: tubulin alpha-3 chain-like [Oryza brachyantha]
Length=450

 Score =   339 bits (869),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 158/163 (97%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>sp|O22349.1|TBA3_ELEIN RecName: Full=Tubulin alpha-3 chain; AltName: Full=Alpha-3-tubulin 
[Eleusine indica]
 gb|AAC05719.1| alpha-tubulin 3 [Eleusine indica]
Length=450

 Score =   339 bits (869),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 158/163 (97%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_009389058.1| PREDICTED: tubulin alpha-3 chain-like [Musa acuminata subsp. 
malaccensis]
Length=450

 Score =   339 bits (869),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 158/163 (97%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AGG37286.1| alpha-tubulin 4 [Salix arbutifolia]
Length=450

 Score =   339 bits (869),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 157/163 (96%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLS+PEIT+AVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSIPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIK+KRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVATIKSKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_011048194.1| PREDICTED: tubulin alpha-6 chain-like [Populus euphratica]
Length=450

 Score =   339 bits (869),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 157/163 (96%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLS+PEIT+AVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSIPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIK+KRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVATIKSKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABR67425.1| alpha-tubulin 4 [Populus tremuloides]
Length=450

 Score =   338 bits (868),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 157/163 (96%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLS+PEIT+AVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSIPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIK+KRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVATIKSKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_009622332.1| PREDICTED: tubulin alpha-3 chain [Nicotiana tomentosiformis]
 ref|XP_009766182.1| PREDICTED: tubulin alpha-3 chain [Nicotiana sylvestris]
Length=449

 Score =   338 bits (868),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 158/163 (97%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KA+HEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAFHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>emb|CAD24767.1| alpha-tubulin [Miscanthus floridulus]
Length=450

 Score =   338 bits (868),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 158/163 (97%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRG+VVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGNVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABV55994.1| alpha-tubulin 6 [Populus tremuloides]
Length=449

 Score =   338 bits (868),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 159/163 (98%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISAAKAYHEQLS PEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAAKAYHEQLSGPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            +AVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  SAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RID+KFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDYKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|KCW87065.1| hypothetical protein EUGRSUZ_B03604 [Eucalyptus grandis]
Length=458

 Score =   339 bits (869),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 158/163 (97%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  279  SSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  338

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINY+PPTVVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  339  AAVATIKTKRTVQFVDWCPTGFKCGINYEPPTVVPGGDLAKVQRAVCMISNNTAVAEVFS  398

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  399  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  441



>gb|KJB80786.1| hypothetical protein B456_013G115100 [Gossypium raimondii]
Length=449

 Score =   338 bits (868),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 158/163 (97%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISAAKAYHEQ+SVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAAKAYHEQISVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKR VQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVF+
Sbjct  330  AAVATIKTKRAVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFA  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002297631.1| alpha-tubulin 2 family protein [Populus trichocarpa]
 gb|ABK92439.1| unknown [Populus trichocarpa]
 gb|EEE82436.1| alpha-tubulin 2 family protein [Populus trichocarpa]
Length=450

 Score =   338 bits (868),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 157/163 (96%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLS+PEIT+AVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSIPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIK+KRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVATIKSKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_004504311.1| PREDICTED: tubulin alpha-3 chain-like [Cicer arietinum]
Length=449

 Score =   338 bits (868),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 157/163 (96%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISAAKAYHEQLSVPEIT+AVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAAKAYHEQLSVPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAV TIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVGTIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_003629736.1| Alpha-tubulin [Medicago truncatula]
 gb|AET04212.1| tubulin beta-1 chain [Medicago truncatula]
Length=449

 Score =   338 bits (868),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 157/163 (96%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISAAKAYHEQLSVPEIT+AVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAAKAYHEQLSVPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAV TIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVGTIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010276368.1| PREDICTED: tubulin alpha-3 chain-like [Nelumbo nucifera]
Length=450

 Score =   338 bits (868),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 157/163 (96%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSY+PVIS+ KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYSPVISSEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLARVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AFR42026.1| alpha-tubulin, partial [Populus trichocarpa]
Length=196

 Score =   329 bits (843),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  31   SSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  90

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISN+T+VAEVFS
Sbjct  91   AAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFS  150

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  151  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  193



>emb|CAD24768.1| alpha-tubulin [Miscanthus floridulus]
Length=450

 Score =   338 bits (867),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 157/163 (96%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHG+YMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGRYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AFR42020.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42021.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42022.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42023.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42024.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42025.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42027.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42028.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42029.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42030.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42031.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42032.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42033.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42034.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42037.1| alpha-tubulin, partial [Populus alba]
 gb|AFR42038.1| alpha-tubulin, partial [Populus alba]
 gb|AFR42039.1| alpha-tubulin, partial [Populus alba]
 gb|AFR42041.1| alpha-tubulin, partial [Populus alba]
 gb|AFR42045.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42046.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42048.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42056.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42057.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42058.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42059.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42060.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42061.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42062.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42063.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42064.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42065.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42066.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42067.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42068.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42069.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42070.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42071.1| alpha-tubulin, partial [Populus nigra]
Length=197

 Score =   329 bits (843),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  31   SSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  90

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISN+T+VAEVFS
Sbjct  91   AAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFS  150

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  151  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  193



>gb|AFR42049.1| alpha-tubulin, partial [Populus fremontii]
Length=197

 Score =   328 bits (842),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  31   SSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  90

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISN+T+VAEVFS
Sbjct  91   AAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFS  150

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  151  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  193



>ref|XP_010528739.1| PREDICTED: tubulin alpha-6 chain-like [Tarenaya hassleriana]
Length=450

 Score =   338 bits (866),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 156/163 (96%), Positives = 163/163 (100%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISAAKA+HEQLSVPEIT++VFEPS+MMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAAKAFHEQLSVPEITTSVFEPSNMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVA+IKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVASIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>emb|CAD26890.1| alpha-tubulin [Miscanthus sinensis subsp. condensatus]
Length=450

 Score =   338 bits (866),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 158/163 (97%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVI A KAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVIPAEKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AFR42035.1| alpha-tubulin, partial [Populus alba]
 gb|AFR42040.1| alpha-tubulin, partial [Populus alba]
 gb|AFR42044.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42052.1| alpha-tubulin, partial [Populus fremontii]
Length=196

 Score =   328 bits (842),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  30   SSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  89

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISN+T+VAEVFS
Sbjct  90   AAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFS  149

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  150  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  192



>gb|AFR42036.1| alpha-tubulin, partial [Populus alba]
Length=195

 Score =   328 bits (841),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  29   SSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  88

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISN+T+VAEVFS
Sbjct  89   AAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFS  148

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  149  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  191



>gb|KJB58759.1| hypothetical protein B456_009G224800 [Gossypium raimondii]
Length=340

 Score =   333 bits (855),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  160  SSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  219

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISN+T+VAEVFS
Sbjct  220  AAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFS  279

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  280  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  322



>gb|AFR42054.1| alpha-tubulin, partial [Populus fremontii]
Length=196

 Score =   328 bits (841),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  30   SSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  89

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISN+T+VAEVFS
Sbjct  90   AAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFS  149

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  150  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  192



>gb|AFR42042.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42043.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42050.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42051.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42053.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42055.1| alpha-tubulin, partial [Populus fremontii]
Length=194

 Score =   328 bits (841),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  28   SSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  87

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISN+T+VAEVFS
Sbjct  88   AAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFS  147

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  148  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  190



>ref|XP_010054663.1| PREDICTED: tubulin alpha-3 chain-like [Eucalyptus grandis]
 gb|KCW89881.1| hypothetical protein EUGRSUZ_A02108 [Eucalyptus grandis]
Length=450

 Score =   337 bits (865),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 157/163 (96%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISAAKAYHEQLSVPEITSAVFEPS+MMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAAKAYHEQLSVPEITSAVFEPSNMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVP GDLA+VQRAVCMISNNTAV EVFS
Sbjct  330  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPSGDLAKVQRAVCMISNNTAVVEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>emb|CAD26893.1| alpha-tubulin [Miscanthus floridulus]
Length=450

 Score =   337 bits (864),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 158/163 (97%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAA EKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAAHEKDY  432



>gb|AAO63773.2| alpha-tubulin 2 [Populus tremuloides]
Length=450

 Score =   337 bits (864),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 158/163 (97%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAY EQLSVPEIT+AVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYREQLSVPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_006433708.1| hypothetical protein CICLE_v100015522mg, partial [Citrus clementina]
 gb|ESR46948.1| hypothetical protein CICLE_v100015522mg, partial [Citrus clementina]
Length=218

 Score =   329 bits (843),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 152/163 (93%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KA+HEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  37   SSYAPVISAEKAFHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  96

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISN+T+VAEVFS
Sbjct  97   AAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFS  156

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  157  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  199



>gb|AFR42047.1| alpha-tubulin, partial [Populus fremontii]
Length=194

 Score =   328 bits (840),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  28   SSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  87

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISN+T+VAEVFS
Sbjct  88   AAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFS  147

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  148  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  190



>gb|AIC33057.1| tubulin alpha-1 chain [Panax ginseng]
Length=449

 Score =   337 bits (864),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 158/163 (97%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINYQ PTVVPGGDLA+VQRAVCMISNNTAV EVFS
Sbjct  330  AAVATIKTKRTVQFVDWCPTGFKCGINYQAPTVVPGGDLAKVQRAVCMISNNTAVVEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABO47738.1| alpha-tubulin [Gossypium hirsutum]
 gb|KJB40985.1| hypothetical protein B456_007G086400 [Gossypium raimondii]
Length=449

 Score =   337 bits (863),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 157/163 (96%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQ+SVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQISVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINYQPP VVPGGDLA+VQRAVCMISNNTAVAEVF+
Sbjct  330  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPAVVPGGDLAKVQRAVCMISNNTAVAEVFA  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>emb|CAD24766.1| alpha-tubulin [Miscanthus sinensis]
Length=450

 Score =   337 bits (863),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 157/163 (96%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIK KRTVQFVDWCPTGFKCGINYQPP+VVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVATIKAKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AGV54500.1| tubulin A [Phaseolus vulgaris]
Length=449

 Score =   337 bits (863),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 158/163 (97%), Positives = 163/163 (100%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISAAKAYHEQLSVPEIT+AVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAAKAYHEQLSVPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|EYU34085.1| hypothetical protein MIMGU_mgv1a0196712mg, partial [Erythranthe 
guttata]
Length=217

 Score =   328 bits (840),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 152/163 (93%), Positives = 158/163 (97%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSV EIT+  FEPSSMM KCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  37   SSYAPVISAEKAYHEQLSVSEITNTAFEPSSMMVKCDPRHGKYMACCLMYRGDVVPKDVN  96

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISN+T+VAEVFS
Sbjct  97   AAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFS  156

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  157  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  199



>emb|CDP14299.1| unnamed protein product [Coffea canephora]
Length=450

 Score =   336 bits (862),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 157/163 (96%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVIS+AKAYHEQLSVPEIT++VFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISSAKAYHEQLSVPEITNSVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVA+IKTKRTVQFVDWCPTGFKCGINYQPPTVVP GDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVASIKTKRTVQFVDWCPTGFKCGINYQPPTVVPCGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010693818.1| PREDICTED: tubulin alpha-3 chain-like [Beta vulgaris subsp. vulgaris]
Length=450

 Score =   336 bits (862),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 157/163 (96%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMA CLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSVPEITTAVFEPSSMMAKCDPRHGKYMASCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAV TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVGTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_007014666.1| Tubulin alpha-5 [Theobroma cacao]
 gb|EOY32285.1| Tubulin alpha-5 [Theobroma cacao]
Length=449

 Score =   336 bits (861),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 156/163 (96%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KA+HEQLSVPEIT+AVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAFHEQLSVPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAV+TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVSTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010414865.1| PREDICTED: tubulin alpha-1 chain [Camelina sativa]
Length=450

 Score =   336 bits (861),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 154/163 (94%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVIS+AKAYHEQ SVPEIT++VFEPS+MMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISSAKAYHEQFSVPEITTSVFEPSNMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
             AVATIKTKRT+QFVDWCPTGFKCGINYQPP+VVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  TAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>emb|CAB76917.1| alpha-tubulin 4 [Hordeum vulgare subsp. vulgare]
Length=289

 Score =   330 bits (846),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 152/163 (93%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  108  SSYAPVISAEKAYHEQLSVSEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  167

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISN+T+V EVFS
Sbjct  168  AAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVVEVFS  227

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  228  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270



>gb|KIY91712.1| Tubulin alpha chain [Monoraphidium neglectum]
Length=249

 Score =   328 bits (842),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 151/163 (93%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSV EIT++ FEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  68   SSYAPVISAEKAYHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVN  127

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            A+VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISN+TAVAEVFS
Sbjct  128  ASVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAVAEVFS  187

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            R+DHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  188  RLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  230



>emb|CAJ38386.1| alpha tubulin [Plantago major]
Length=270

 Score =   329 bits (844),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 152/163 (93%), Positives = 158/163 (97%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSV EIT+  FEPSSMM KCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  90   SSYAPVISAEKAYHEQLSVAEITNTAFEPSSMMVKCDPRHGKYMACCLMYRGDVVPKDVN  149

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISN+T+VAEVFS
Sbjct  150  AAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFS  209

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  210  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  252



>gb|AAW57309.1| alpha-tubulin, partial [Ceratopteris richardii]
Length=266

 Score =   329 bits (844),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 152/163 (93%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  85   SSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  144

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISN+T+VAEVFS
Sbjct  145  AAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFS  204

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RID+KFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  205  RIDYKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  247



>gb|AAW57310.1| alpha-tubulin, partial [Ceratopteris richardii]
 gb|AAW57311.1| alpha-tubulin, partial [Ceratopteris richardii]
 gb|AAW57313.1| alpha-tubulin, partial [Ceratopteris richardii]
Length=267

 Score =   329 bits (844),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 152/163 (93%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  86   SSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  145

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISN+T+VAEVFS
Sbjct  146  AAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFS  205

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RID+KFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  206  RIDYKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  248



>gb|KJB32211.1| hypothetical protein B456_005G229600 [Gossypium raimondii]
Length=361

 Score =   332 bits (852),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  181  SSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  240

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISN+T+VAEVFS
Sbjct  241  AAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFS  300

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  301  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  343



>gb|KDP42087.1| hypothetical protein JCGZ_01875 [Jatropha curcas]
Length=450

 Score =   335 bits (860),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 154/163 (94%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQ+S+PEIT+AVFEPS+MMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAQKAYHEQISIPEITNAVFEPSNMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRT+QFVDWCPTGFKCGINYQPP+VVPGGDLA VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLARVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AGI78243.1| alpha tubulin 5, partial [Caragana korshinskii]
Length=240

 Score =   328 bits (840),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 152/161 (94%), Positives = 157/161 (98%), Gaps = 0/161 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQ+S+PEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  80   SSYAPVISAEKAYHEQISIPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  139

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAV+ IKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+V RAVCMISNNTAVAEVFS
Sbjct  140  AAVSNIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVMRAVCMISNNTAVAEVFS  199

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  296
            RID KFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  200  RIDQKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  240



>gb|ADD84794.1| tubulin-like protein [Cenchrus ciliaris]
Length=184

 Score =   325 bits (834),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 151/163 (93%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  3    SSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  62

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRT+QFVDWCPTGFKCGINYQPP+VVPGGDLA+VQRAVCMISN+T+V EVFS
Sbjct  63   AAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFS  122

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  123  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  165



>gb|KHG19627.1| Tubulin alpha-3/alpha-5 chain -like protein [Gossypium arboreum]
Length=449

 Score =   335 bits (858),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 156/163 (96%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISAAKAYHE +SVPEITS VFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAAKAYHEHISVPEITSVVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKR VQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVF+
Sbjct  330  AAVATIKTKRAVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFA  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AGV54721.1| tubulin alpha-3 chain-like protein [Phaseolus vulgaris]
Length=448

 Score =   335 bits (858),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 156/163 (96%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            A+V+ IK KRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  ASVSNIKAKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RID+KFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDYKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_007161955.1| hypothetical protein PHAVU_001G111700g [Phaseolus vulgaris]
 gb|ESW33949.1| hypothetical protein PHAVU_001G111700g [Phaseolus vulgaris]
Length=448

 Score =   335 bits (858),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 156/163 (96%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            A+V+ IK KRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  ASVSNIKAKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RID+KFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDYKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_003624633.1| Alpha-tubulin [Medicago truncatula]
 gb|ABK28851.1| alpha-tubulin [Medicago truncatula]
 gb|ABN08980.1| Tubulin/FtsZ, C-terminal [Medicago truncatula]
 gb|AES80851.1| tubulin beta-1 chain [Medicago truncatula]
Length=451

 Score =   335 bits (858),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 155/163 (95%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVIS+AKAYHEQ+SVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISSAKAYHEQISVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAV+ IKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+V RAVCMISNNTAVAEVFS
Sbjct  330  AAVSNIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVMRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_004252814.1| PREDICTED: tubulin alpha-2 chain-like [Solanum lycopersicum]
Length=227

 Score =   327 bits (837),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 150/163 (92%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSV EIT++ FEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVN
Sbjct  46   SSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVN  105

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQ+AVCMISN+T+VAEVFS
Sbjct  106  AAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQKAVCMISNSTSVAEVFS  165

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  166  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  208



>ref|XP_008464962.1| PREDICTED: tubulin alpha-3 chain-like [Cucumis melo]
Length=449

 Score =   334 bits (857),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 155/163 (95%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVIS+AKAYHEQLSVPEIT+AVF+PSSMM KCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISSAKAYHEQLSVPEITNAVFDPSSMMVKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLA+VQRAVCMISN+TAVAEVFS
Sbjct  330  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_004141134.1| PREDICTED: tubulin alpha-3 chain-like [Cucumis sativus]
 gb|KGN59749.1| Tubulin alpha-3 chain [Cucumis sativus]
Length=449

 Score =   334 bits (857),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 155/163 (95%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVIS+AKAYHEQLSVPEIT+AVF+PSSMM KCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISSAKAYHEQLSVPEITNAVFDPSSMMVKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLA+VQRAVCMISN+TAVAEVFS
Sbjct  330  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_004493170.1| PREDICTED: tubulin alpha-3 chain-like [Cicer arietinum]
Length=450

 Score =   334 bits (857),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 154/163 (94%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVIS+AKAYHEQ+SVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISSAKAYHEQISVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAV+ IKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLA+V RAVCMISNNTAVAEVFS
Sbjct  330  AAVSNIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVMRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AHJ80819.1| Tua1, partial [Eragrostis tef]
Length=243

 Score =   327 bits (838),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 151/163 (93%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  62   SSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  121

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRT+QFVDWCPTGFKCGINYQPP+VVPGGDLA+VQRAVCMISN+T+V EVFS
Sbjct  122  AAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFS  181

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  182  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  224



>gb|ABD92943.1| alpha tubulin-1B [Triticum aestivum]
Length=450

 Score =   334 bits (857),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 156/163 (96%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGI YQPP+VVPGGDLA+VQRAVCMISNNTAVAEVF 
Sbjct  330  AAVATIKTKRTVQFVDWCPTGFKCGIKYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFL  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|KHN46768.1| Tubulin alpha-3 chain [Glycine soja]
Length=443

 Score =   334 bits (856),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 156/163 (96%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAV+ IKTKRTVQFVDWCPTGFKCGINYQPPTVVP GDLA+VQRAVCMISNNTAVAEVF+
Sbjct  330  AAVSNIKTKRTVQFVDWCPTGFKCGINYQPPTVVPAGDLAKVQRAVCMISNNTAVAEVFA  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RID+KFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDYKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AHM93474.1| alpha-tubulin, partial [Camellia chekiangoleosa]
Length=327

 Score =   330 bits (845),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 152/163 (93%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSV EIT++ FEPSSMM KCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  147  SSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMYRGDVVPKDVN  206

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISN+T+VAEVFS
Sbjct  207  AAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFS  266

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  267  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  309



>gb|ABE01246.1| alpha tubulin [Camellia sinensis]
Length=449

 Score =   334 bits (856),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 155/163 (95%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISAAKAYHEQLSVPEIT++VFEPS+MMAKCDPRHGKYMACCLMYRGDVVPK VN
Sbjct  270  SSYAPVISAAKAYHEQLSVPEITNSVFEPSNMMAKCDPRHGKYMACCLMYRGDVVPKGVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAV TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNT VAEVFS
Sbjct  330  AAVGTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTLVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_006301274.1| hypothetical protein CARUB_v10021674mg [Capsella rubella]
 gb|EOA34172.1| hypothetical protein CARUB_v10021674mg [Capsella rubella]
Length=450

 Score =   334 bits (856),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVIS+AKAYHEQ SVPEIT++VFEPS+MMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISSAKAYHEQFSVPEITTSVFEPSNMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
             AVA IKTKRT+QFVDWCPTGFKCGINYQPP+VVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  TAVANIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>dbj|BAH19954.1| AT1G50010 [Arabidopsis thaliana]
Length=248

 Score =   327 bits (837),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 150/163 (92%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KA+HEQLSV EIT++ FEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  68   SSYAPVISAEKAFHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVN  127

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAV TIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISN+T+VAEVFS
Sbjct  128  AAVGTIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFS  187

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  188  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  230



>gb|KJB29387.1| hypothetical protein B456_005G097800 [Gossypium raimondii]
Length=451

 Score =   333 bits (855),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 155/163 (95%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISAAKAYHEQLSV EIT+  FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAAKAYHEQLSVAEITNTAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISN+T+VAEVFS
Sbjct  330  AAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNSTSVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|KDO81349.1| hypothetical protein CISIN_1g013037mg [Citrus sinensis]
Length=355

 Score =   330 bits (846),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 152/163 (93%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KA+HEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  174  SSYAPVISAEKAFHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  233

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISN+T+VAEVFS
Sbjct  234  AAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFS  293

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  294  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  336



>emb|CAD26892.1| alpha-tubulin [Miscanthus floridulus]
Length=450

 Score =   333 bits (855),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 156/163 (96%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVI A KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKD N
Sbjct  270  SSYAPVICAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDDN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AGV54497.1| tubulin alpha-3 chain-like protein [Phaseolus vulgaris]
Length=449

 Score =   333 bits (854),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 156/163 (96%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  271  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  330

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            A+V+ IK KRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  331  ASVSNIKAKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFS  390

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RID+KFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  391  RIDYKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  433



>ref|XP_011078787.1| PREDICTED: tubulin alpha-1 chain-like [Sesamum indicum]
Length=451

 Score =   333 bits (854),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 155/163 (95%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISAAKAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDV PKDVN
Sbjct  270  SSYAPVISAAKAYHEQLSVPEITTAVFEPSSMMAKCDPRHGKYMACCLMYRGDVAPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
             AVATIKTKR VQFVDWCPTGFKCGINYQPPTVVPGGDLA V+RAVCMISNNTAVAEVFS
Sbjct  330  TAVATIKTKRAVQFVDWCPTGFKCGINYQPPTVVPGGDLARVKRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFD+MY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDVMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>emb|CAD26888.1| alpha-tubulin [Miscanthus transmorrisonensis]
Length=450

 Score =   333 bits (854),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 156/163 (96%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCL+YRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLIYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRTVQFVDW PTGFKCGINYQPP+VVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVATIKTKRTVQFVDWRPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>dbj|BAF01952.1| putative tubulin alpha-2/alpha-4 chain [Arabidopsis thaliana]
Length=202

 Score =   324 bits (831),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 150/163 (92%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KA+HEQLSV EIT++ FEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  22   SSYAPVISAEKAFHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVN  81

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAV TIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISN+T+VAEVFS
Sbjct  82   AAVGTIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFS  141

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  142  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  184



>ref|XP_003554022.1| PREDICTED: tubulin alpha-6 chain-like [Glycine max]
 gb|KHN34688.1| Tubulin alpha-3 chain [Glycine soja]
Length=451

 Score =   333 bits (854),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 156/163 (96%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAV+ IK KRTVQFVDWCPTGFKCGINYQPPTVVP GDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVSNIKAKRTVQFVDWCPTGFKCGINYQPPTVVPAGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RID+KFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDYKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_008621874.1| tubulin alpha, partial [Saprolegnia diclina VS20]
 gb|EQC24696.1| tubulin alpha, partial [Saprolegnia diclina VS20]
Length=273

 Score =   327 bits (837),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 150/163 (92%), Positives = 157/163 (96%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSV EIT++ FEP+SMMAKCDPRHGKYMA CLMYRGDVVPKDVN
Sbjct  90   SSYAPVISAEKAYHEQLSVAEITNSAFEPASMMAKCDPRHGKYMAACLMYRGDVVPKDVN  149

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLA VQRAVCMISN +A+AEVFS
Sbjct  150  AAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLARVQRAVCMISNTSAIAEVFS  209

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  210  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  252



>gb|EKF29047.1| epsilon tubulin, putative, partial [Trypanosoma cruzi marinkellei]
Length=240

 Score =   325 bits (834),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 149/163 (91%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            +SYAPVISA KAYHEQLSV EI++AVFEP+SMM KCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  59   TSYAPVISAEKAYHEQLSVSEISNAVFEPASMMTKCDPRHGKYMACCLMYRGDVVPKDVN  118

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRT+QFVDW PTGFKCGINYQPPTVVPGGDLA+VQRAVCMI+N+TA+AEVF+
Sbjct  119  AAVATIKTKRTIQFVDWSPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIANSTAIAEVFA  178

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  179  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  221



>gb|KGN48654.1| hypothetical protein Csa_6G497050 [Cucumis sativus]
Length=415

 Score =   332 bits (850),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  235  SSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  294

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISN+T+VAEVFS
Sbjct  295  AAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFS  354

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  355  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  397



>gb|KJB58756.1| hypothetical protein B456_009G224800 [Gossypium raimondii]
Length=415

 Score =   332 bits (850),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  235  SSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  294

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISN+T+VAEVFS
Sbjct  295  AAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFS  354

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  355  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  397



>gb|EKF28172.1| epsilon tubulin, putative [Trypanosoma cruzi marinkellei]
Length=249

 Score =   325 bits (834),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 149/163 (91%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            +SYAPVISA KAYHEQLSV EI++AVFEP+SMM KCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  68   TSYAPVISAEKAYHEQLSVSEISNAVFEPASMMTKCDPRHGKYMACCLMYRGDVVPKDVN  127

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRT+QFVDW PTGFKCGINYQPPTVVPGGDLA+VQRAVCMI+N+TA+AEVF+
Sbjct  128  AAVATIKTKRTIQFVDWSPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIANSTAIAEVFA  187

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  188  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  230



>ref|XP_002677064.1| alpha-tubulin [Naegleria gruberi]
 gb|EFC44320.1| alpha-tubulin [Naegleria gruberi]
Length=195

 Score =   323 bits (829),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 150/162 (93%), Positives = 158/162 (98%), Gaps = 0/162 (0%)
 Frame = -2

Query  775  SYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNA  596
            SYAPVISA KAYHEQLSV EIT++ FEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVNA
Sbjct  13   SYAPVISAEKAYHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNA  72

Query  595  AVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFSR  416
            AVATIKTKRT+QFVDW PTGFKCGINYQPPTVVPGGDLA+VQRAVCMISN+TA+AEVFSR
Sbjct  73   AVATIKTKRTIQFVDWSPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVFSR  132

Query  415  IDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            IDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  133  IDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  174



>emb|CCD11782.1| unnamed protein product [Trypanosoma congolense IL3000]
Length=257

 Score =   326 bits (835),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 149/163 (91%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            +SYAPVISA KAYHEQLSV EI++AVFEP+SMM KCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  76   TSYAPVISAEKAYHEQLSVSEISNAVFEPASMMTKCDPRHGKYMACCLMYRGDVVPKDVN  135

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRT+QFVDW PTGFKCGINYQPPTVVPGGDLA+VQRAVCMI+N+TA+AEVF+
Sbjct  136  AAVATIKTKRTIQFVDWSPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIANSTAIAEVFA  195

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  196  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  238



>emb|CAA52158.1| alpha tubulin [Zea mays]
Length=256

 Score =   325 bits (834),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 150/163 (92%), Positives = 158/163 (97%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  75   SSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  134

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRT+QFVDWCPTGFKCGINYQPP+VVPGGDLA+VQRAVCMISN+T+V EVFS
Sbjct  135  AAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFS  194

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDL ALEKDY
Sbjct  195  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLRALEKDY  237



>gb|KDO25258.1| hypothetical protein SPRG_09506 [Saprolegnia parasitica CBS 223.65]
Length=186

 Score =   323 bits (827),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 149/163 (91%), Positives = 156/163 (96%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSV EIT++ FEP+SMMAKCDPRHGKYMA CLMYRGDVVPKDVN
Sbjct  3    SSYAPVISAEKAYHEQLSVAEITNSAFEPASMMAKCDPRHGKYMAACLMYRGDVVPKDVN  62

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLA VQRAVCMISN +A+AEVFS
Sbjct  63   AAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLARVQRAVCMISNTSAIAEVFS  122

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAF HWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  123  RIDHKFDLMYAKRAFAHWYVGEGMEEGEFSEAREDLAALEKDY  165



>gb|KHG20487.1| Tubulin alpha chain [Gossypium arboreum]
Length=451

 Score =   332 bits (852),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 154/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISAAKAYHEQLSV EIT+  FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAAKAYHEQLSVAEITNTAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISN+T+VAEVFS
Sbjct  330  AAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>emb|CBH08953.1| alpha tubulin, (fragment), partial [Trypanosoma brucei gambiense 
DAL972]
Length=190

 Score =   323 bits (827),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 149/163 (91%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            +SYAPVISA KAYHEQLSV EI++AVFEP+SMM KCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  9    TSYAPVISAEKAYHEQLSVSEISNAVFEPASMMTKCDPRHGKYMACCLMYRGDVVPKDVN  68

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRT+QFVDW PTGFKCGINYQPPTVVPGGDLA+VQRAVCMI+N+TA+AEVF+
Sbjct  69   AAVATIKTKRTIQFVDWSPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIANSTAIAEVFA  128

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  129  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  171



>gb|EYU20672.1| hypothetical protein MIMGU_mgv1a004180mg [Erythranthe guttata]
Length=540

 Score =   335 bits (859),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 156/163 (96%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISAAKA+HEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  361  SSYAPVISAAKAFHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  420

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLA VQRAVCMISNNTAV EVFS
Sbjct  421  AAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLARVQRAVCMISNNTAVVEVFS  480

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RI+HKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  481  RINHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  523



>gb|ABR26150.1| tubulin alpha-3 chain [Oryza sativa Indica Group]
Length=186

 Score =   323 bits (827),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 151/163 (93%), Positives = 158/163 (97%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  5    SSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  64

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRT+QFVDWCPTGFKCGINYQPP+VVPGGDLA+VQRAVCMISN+T+V EVFS
Sbjct  65   AAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFS  124

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RID KFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  125  RIDIKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  167



>gb|AAW57306.1| alpha-tubulin, partial [Ceratopteris richardii]
 gb|AAW57308.1| alpha-tubulin, partial [Ceratopteris richardii]
Length=257

 Score =   325 bits (833),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 147/163 (90%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSV EIT++ FEP+SMMAKCDPRHGKYMACC+MYRGDVVPKDVN
Sbjct  76   SSYAPVISAEKAYHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCMMYRGDVVPKDVN  135

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            A+VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISN+T++AEVFS
Sbjct  136  ASVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSIAEVFS  195

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            R+DHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKD+
Sbjct  196  RLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDF  238



>emb|CBH08958.1| alpha tubulin, (fragment) [Trypanosoma brucei gambiense DAL972]
Length=303

 Score =   327 bits (838),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 149/163 (91%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            +SYAPVISA KAYHEQLSV EI++AVFEP+SMM KCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  122  TSYAPVISAEKAYHEQLSVSEISNAVFEPASMMTKCDPRHGKYMACCLMYRGDVVPKDVN  181

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRT+QFVDW PTGFKCGINYQPPTVVPGGDLA+VQRAVCMI+N+TA+AEVF+
Sbjct  182  AAVATIKTKRTIQFVDWSPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIANSTAIAEVFA  241

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  242  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  284



>ref|XP_002959708.1| alpha tubulin [Volvox carteri f. nagariensis]
 gb|EFJ39226.1| alpha tubulin [Volvox carteri f. nagariensis]
Length=255

 Score =   324 bits (831),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 147/163 (90%), Positives = 158/163 (97%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAP+ISA KAYHEQLSV EIT+A FEP+SMM KCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  74   SSYAPIISAEKAYHEQLSVAEITNAAFEPASMMVKCDPRHGKYMACCLMYRGDVVPKDVN  133

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISN+TA+ E+FS
Sbjct  134  AAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAIGEIFS  193

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            R+DHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKD+
Sbjct  194  RLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDF  236



>ref|XP_009131752.1| PREDICTED: tubulin alpha-3 chain-like [Brassica rapa]
Length=450

 Score =   331 bits (849),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 154/163 (94%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISAAKAYHEQLSVPEIT+AVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAAKAYHEQLSVPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAV   + KRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  AAVGLSRLKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AAW57305.1| alpha-tubulin, partial [Ceratopteris richardii]
Length=306

 Score =   326 bits (836),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 151/163 (93%), Positives = 158/163 (97%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  126  SSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  185

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRA+CMISN+T+VAEVFS
Sbjct  186  AAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAICMISNSTSVAEVFS  245

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RID KFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  246  RIDFKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  288



>ref|NP_176654.1| tubulin alpha-1 chain [Arabidopsis thaliana]
 sp|P11139.1|TBA1_ARATH RecName: Full=Tubulin alpha-1 chain [Arabidopsis thaliana]
 gb|AAD38249.1|AC006193_5 alpha1 tubulin [Arabidopsis thaliana]
 gb|AAA32880.1| alpha-1-tubulin [Arabidopsis thaliana]
 gb|AAL24085.1| putative alpha-tubulin protein [Arabidopsis thaliana]
 gb|AAM14311.1| putative alpha-tubulin protein [Arabidopsis thaliana]
 gb|AEE34279.1| tubulin alpha-1 chain [Arabidopsis thaliana]
Length=450

 Score =   331 bits (849),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 152/163 (93%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVIS+AKAYHEQ SVPEIT++VFEPS+MMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISSAKAYHEQFSVPEITTSVFEPSNMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
             AVA IK KRT+QFVDWCPTGFKCGINYQPP+VVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  TAVAAIKAKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|EPS62716.1| alpha-tubulin, partial [Genlisea aurea]
Length=404

 Score =   330 bits (845),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 152/163 (93%), Positives = 158/163 (97%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSV EIT+  FEPSSMM KCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  224  SSYAPVISAEKAYHEQLSVAEITNTAFEPSSMMVKCDPRHGKYMACCLMYRGDVVPKDVN  283

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISN+T+VAEVFS
Sbjct  284  AAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFS  343

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  344  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  386



>gb|ABR25378.1| tubulin alpha 3 chain [Oryza sativa Indica Group]
Length=207

 Score =   322 bits (826),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 151/163 (93%), Positives = 158/163 (97%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  26   SSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  85

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRT+QFVDWCPTGFKCGINYQPP+VVPGGDLA+VQRAVCMISN+T+V EVFS
Sbjct  86   AAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFS  145

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RID KFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  146  RIDIKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  188



>gb|AAO46127.1| alpha-tubulin [Streblomastix strix]
 gb|AAO46129.1| alpha-tubulin [Streblomastix strix]
Length=249

 Score =   324 bits (830),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 149/163 (91%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSV EIT++ FEP++MMAKCDPRHGKYMACC+MYRGDVVPKDVN
Sbjct  69   SSYAPVISAEKAYHEQLSVAEITNSSFEPANMMAKCDPRHGKYMACCMMYRGDVVPKDVN  128

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRT+QFVDWCPTGFK GINYQPPTVVPGGDLA+VQRAVCMISN+TA+AEVFS
Sbjct  129  AAVATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVFS  188

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  189  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  231



>gb|KDO49533.1| hypothetical protein CISIN_1g013062mg [Citrus sinensis]
Length=431

 Score =   330 bits (847),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  251  SSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  310

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISN+T+VAEVFS
Sbjct  311  AAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFS  370

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  371  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  413



>ref|XP_007515802.1| alpha-tubulin [Bathycoccus prasinos]
 emb|CCO14681.1| alpha-tubulin [Bathycoccus prasinos]
Length=415

 Score =   330 bits (845),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 151/163 (93%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  235  SSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  294

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVA+IKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISN+TA+AEVFS
Sbjct  295  AAVASIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVFS  354

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            R+DHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  355  RLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  397



>gb|AAX96763.1| Tubulin/FtsZ family, GTPase domain, putative [Oryza sativa Japonica 
Group]
 gb|ABA92354.1| Tubulin alpha-3 chain, putative, expressed [Oryza sativa Japonica 
Group]
Length=346

 Score =   327 bits (839),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 151/163 (93%), Positives = 158/163 (97%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  165  SSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  224

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRT+QFVDWCPTGFKCGINYQPP+VVPGGDLA+VQRAVCMISN+T+V EVFS
Sbjct  225  AAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFS  284

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RID KFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  285  RIDIKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  327



>gb|KJB33191.1| hypothetical protein B456_006G002500 [Gossypium raimondii]
Length=183

 Score =   321 bits (823),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 150/163 (92%), Positives = 157/163 (96%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSV EITS+ FEP+SMMAKCDPRHGKYM CCLMYRGDVV KDVN
Sbjct  3    SSYAPVISAEKAYHEQLSVAEITSSAFEPASMMAKCDPRHGKYMDCCLMYRGDVVRKDVN  62

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISN+T+VAEVFS
Sbjct  63   AAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFS  122

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYV EGMEEGEFSEAREDLAALEKDY
Sbjct  123  RIDHKFDLMYAKRAFVHWYVSEGMEEGEFSEAREDLAALEKDY  165



>gb|AIX10773.1| alpha tubulin [Panax notoginseng]
Length=451

 Score =   331 bits (848),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 154/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISN+T+VAEVFS
Sbjct  330  AAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002779346.1| alpha-tubulin, putative [Perkinsus marinus ATCC 50983]
 gb|EER11141.1| alpha-tubulin, putative [Perkinsus marinus ATCC 50983]
Length=186

 Score =   321 bits (823),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 149/163 (91%), Positives = 158/163 (97%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            +SYAPVISA KAYHEQLSV EIT++VFEP+SMM KCDPRHGKYMACC+MYRGDVVPKDVN
Sbjct  3    TSYAPVISAEKAYHEQLSVAEITNSVFEPASMMVKCDPRHGKYMACCMMYRGDVVPKDVN  62

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRT+QFVDW PTGFKCGINYQPPTVVPGGDLA+V RAVCMISN+TAVAEVFS
Sbjct  63   AAVATIKTKRTIQFVDWSPTGFKCGINYQPPTVVPGGDLAKVMRAVCMISNSTAVAEVFS  122

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  123  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  165



>gb|ADW83724.1| alpha-tubulin [Musa acuminata AAA Group]
Length=423

 Score =   330 bits (845),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 152/163 (93%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  242  SSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  301

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRT+QFVDWCPTGFKCGINYQPP+VVPGGDLA+VQRAVCMISN+T+VAEVFS
Sbjct  302  AAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVAEVFS  361

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  362  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  404



>gb|EYU37544.1| hypothetical protein MIMGU_mgv1a007145mg [Erythranthe guttata]
Length=417

 Score =   330 bits (845),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  236  SSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  295

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISN+T+VAEVFS
Sbjct  296  AAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFS  355

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  356  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  398



>gb|ABO47737.1| alpha-tubulin [Gossypium hirsutum]
Length=451

 Score =   331 bits (848),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 154/163 (94%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISAAKAYHEQLSV EIT+  FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAAKAYHEQLSVAEITNTAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISN+T+VAEV S
Sbjct  330  AAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNSTSVAEVVS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010093625.1| Tubulin alpha chain [Morus notabilis]
 gb|EXB54386.1| Tubulin alpha chain [Morus notabilis]
Length=451

 Score =   330 bits (847),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISN+T+VAEVFS
Sbjct  330  AAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>emb|CAN62392.1| hypothetical protein VITISV_016172 [Vitis vinifera]
Length=435

 Score =   330 bits (846),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  255  SSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  314

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISN+T+VAEVFS
Sbjct  315  AAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFS  374

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  375  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  417



>ref|XP_003608582.1| Tubulin alpha-5 chain [Medicago truncatula]
 gb|AES90779.1| tubulin beta-1 chain [Medicago truncatula]
Length=451

 Score =   330 bits (847),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISN+T+VAEVFS
Sbjct  330  AAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002886753.1| alpha-1 tubulin [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63012.1| alpha-1 tubulin [Arabidopsis lyrata subsp. lyrata]
Length=450

 Score =   330 bits (847),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 152/163 (93%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVIS+AKAYHEQ SV EIT++VFEPS+MMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISSAKAYHEQFSVSEITTSVFEPSNMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
             AVA IKTKRT+QFVDWCPTGFKCGINYQPP+VVPGGDLA+VQRAVCMISNNTAVAEVFS
Sbjct  330  TAVAAIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002298794.2| TUBULIN ALPHA CHAIN family protein [Populus trichocarpa]
 gb|EEE83599.2| TUBULIN ALPHA CHAIN family protein [Populus trichocarpa]
Length=451

 Score =   330 bits (847),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSV EIT++ FEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISN+T+VAEVFS
Sbjct  330  AAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABK92520.1| unknown [Populus trichocarpa]
Length=451

 Score =   330 bits (847),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSV EIT++ FEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISN+T+VAEVFS
Sbjct  330  AAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABQ59633.1| alpha-tubulin 3 [Populus tremuloides]
Length=451

 Score =   330 bits (847),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSV EIT++ FEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISN+T+VAEVFS
Sbjct  330  AAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AGG37285.1| alpha-tubulin 3 [Salix arbutifolia]
Length=451

 Score =   330 bits (847),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSV EIT++ FEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISN+T+VAEVFS
Sbjct  330  AAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|KDP32140.1| hypothetical protein JCGZ_12601 [Jatropha curcas]
Length=450

 Score =   330 bits (847),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISN+T+VAEVFS
Sbjct  330  AAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>sp|Q6VAF9.1|TBA4_GOSHI RecName: Full=Tubulin alpha-4 chain; AltName: Full=Alpha-4-tubulin 
[Gossypium hirsutum]
 gb|AAQ92663.1| alpha-tubulin 4 [Gossypium hirsutum]
Length=450

 Score =   330 bits (847),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISN+T+VAEVFS
Sbjct  330  AAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYTKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_011030289.1| PREDICTED: tubulin alpha-4 chain [Populus euphratica]
Length=451

 Score =   330 bits (847),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSV EIT++ FEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISN+T+VAEVFS
Sbjct  330  AAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|NP_001289660.1| tubulin alpha chain-like [Eucalyptus grandis]
 gb|ABS50670.1| alpha-tubulin [Eucalyptus grandis]
Length=451

 Score =   330 bits (847),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISN+T+VAEVFS
Sbjct  330  AAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_008787760.1| PREDICTED: tubulin alpha chain-like [Phoenix dactylifera]
Length=451

 Score =   330 bits (847),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSVSEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISN+T+VAEVFS
Sbjct  330  AAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010099392.1| Tubulin alpha chain [Morus notabilis]
 ref|XP_010105098.1| Tubulin alpha chain [Morus notabilis]
 gb|EXB78237.1| Tubulin alpha chain [Morus notabilis]
 gb|EXC03883.1| Tubulin alpha chain [Morus notabilis]
Length=467

 Score =   331 bits (848),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  286  SSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  345

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISN+T+VAEVFS
Sbjct  346  AAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFS  405

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  406  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  448



>ref|XP_010943272.1| PREDICTED: tubulin alpha chain-like [Elaeis guineensis]
Length=451

 Score =   330 bits (847),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISN+T+VAEVFS
Sbjct  330  AAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002510010.1| tubulin alpha chain, putative [Ricinus communis]
 ref|XP_006852746.1| hypothetical protein AMTR_s00033p00112490 [Amborella trichopoda]
 gb|EEF52197.1| tubulin alpha chain, putative [Ricinus communis]
 gb|ERN14213.1| hypothetical protein AMTR_s00033p00112490 [Amborella trichopoda]
Length=451

 Score =   330 bits (847),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISN+T+VAEVFS
Sbjct  330  AAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABX57816.1| alpha tubulin [Picea wilsonii]
Length=451

 Score =   330 bits (847),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISN+T+VAEVFS
Sbjct  330  AAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AAV92352.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92353.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92354.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92355.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92356.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92357.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92358.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92359.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92360.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92361.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92362.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92363.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92364.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92365.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92366.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92367.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92368.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92369.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92370.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92371.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92372.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92373.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92374.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92375.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92376.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92377.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92378.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92379.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|ACN40661.1| unknown [Picea sitchensis]
 gb|ACN40854.1| unknown [Picea sitchensis]
 gb|ACN40972.1| unknown [Picea sitchensis]
 gb|ACN41102.1| unknown [Picea sitchensis]
 gb|AIZ74331.1| alpha-tubulin [Pinus massoniana]
Length=451

 Score =   330 bits (847),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISN+T+VAEVFS
Sbjct  330  AAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002522104.1| tubulin alpha chain, putative [Ricinus communis]
 gb|EEF40304.1| tubulin alpha chain, putative [Ricinus communis]
Length=450

 Score =   330 bits (847),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISN+T+VAEVFS
Sbjct  330  AAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_011457777.1| PREDICTED: tubulin alpha chain [Fragaria vesca subsp. vesca]
Length=450

 Score =   330 bits (847),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISN+T+VAEVFS
Sbjct  330  AAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_009335354.1| PREDICTED: tubulin alpha chain [Pyrus x bretschneideri]
Length=450

 Score =   330 bits (847),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISN+T+VAEVFS
Sbjct  330  AAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_006422747.1| hypothetical protein CICLE_v10028426mg [Citrus clementina]
 ref|XP_006486878.1| PREDICTED: tubulin alpha chain-like isoform X1 [Citrus sinensis]
 gb|ESR35987.1| hypothetical protein CICLE_v10028426mg [Citrus clementina]
 gb|KDO49534.1| hypothetical protein CISIN_1g013062mg [Citrus sinensis]
Length=450

 Score =   330 bits (847),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISN+T+VAEVFS
Sbjct  330  AAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_007032501.1| Tubulin alpha-2 chain [Theobroma cacao]
 gb|EOY03427.1| Tubulin alpha-2 chain [Theobroma cacao]
Length=450

 Score =   330 bits (847),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISN+T+VAEVFS
Sbjct  330  AAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABL61201.1| alpha-tubulin [Oxymonadida environmental sample]
Length=299

 Score =   325 bits (833),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 149/163 (91%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSV EIT++ FEP++MMAKCDPRHGKYMACC+MYRGDVVPKDVN
Sbjct  118  SSYAPVISAEKAYHEQLSVAEITNSSFEPANMMAKCDPRHGKYMACCMMYRGDVVPKDVN  177

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISN+TA+AEVFS
Sbjct  178  AAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVFS  237

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RID KFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  238  RIDRKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  280



>ref|XP_008455054.1| PREDICTED: tubulin alpha-4 chain isoform X1 [Cucumis melo]
Length=451

 Score =   330 bits (847),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISN+T+VAEVFS
Sbjct  330  AAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_007018369.1| Tubulin alpha-2 chain [Theobroma cacao]
 gb|EOY15594.1| Tubulin alpha-2 chain [Theobroma cacao]
Length=451

 Score =   330 bits (847),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISN+T+VAEVFS
Sbjct  330  AAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_001764722.1| predicted protein [Physcomitrella patens]
 gb|EDQ70421.1| predicted protein [Physcomitrella patens]
Length=451

 Score =   330 bits (847),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISN+T+VAEVFS
Sbjct  330  AAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010065856.1| PREDICTED: tubulin alpha chain [Eucalyptus grandis]
 gb|KCW63554.1| hypothetical protein EUGRSUZ_G01186 [Eucalyptus grandis]
Length=450

 Score =   330 bits (847),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISN+T+VAEVFS
Sbjct  330  AAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010245599.1| PREDICTED: tubulin alpha chain-like [Nelumbo nucifera]
Length=451

 Score =   330 bits (847),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISN+T+VAEVFS
Sbjct  330  AAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AIX10966.1| tubulin [Ornithogalum saundersiae]
Length=451

 Score =   330 bits (846),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISN+T+VAEVFS
Sbjct  330  AAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_006466394.1| PREDICTED: tubulin alpha-3 chain-like isoform X1 [Citrus sinensis]
Length=451

 Score =   330 bits (846),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISN+T+VAEVFS
Sbjct  330  AAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_006426173.1| hypothetical protein CICLE_v10025588mg [Citrus clementina]
 gb|ESR39413.1| hypothetical protein CICLE_v10025588mg [Citrus clementina]
Length=451

 Score =   330 bits (846),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISN+T+VAEVFS
Sbjct  330  AAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002981542.1| hypothetical protein SELMODRAFT_178975 [Selaginella moellendorffii]
 gb|EFJ17357.1| hypothetical protein SELMODRAFT_178975 [Selaginella moellendorffii]
Length=449

 Score =   330 bits (846),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISN+T+VAEVFS
Sbjct  330  AAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABO47740.1| alpha-tubulin [Gossypium hirsutum]
 gb|ACM89777.1| alpha-tubulin 10 [Gossypium hirsutum]
 gb|KHG24734.1| Tubulin alpha chain [Gossypium arboreum]
 gb|KJB58758.1| hypothetical protein B456_009G224800 [Gossypium raimondii]
Length=450

 Score =   330 bits (846),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISN+T+VAEVFS
Sbjct  330  AAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010256937.1| PREDICTED: tubulin alpha chain-like [Nelumbo nucifera]
Length=450

 Score =   330 bits (846),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISN+T+VAEVFS
Sbjct  330  AAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABO47736.1| alpha-tubulin [Gossypium hirsutum]
 gb|ACM89778.1| alpha-tubulin 6 [Gossypium hirsutum]
Length=450

 Score =   330 bits (846),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISN+T+VAEVFS
Sbjct  330  AAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_008804464.1| PREDICTED: tubulin alpha chain-like [Phoenix dactylifera]
Length=450

 Score =   330 bits (846),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISN+T+VAEVFS
Sbjct  330  AAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_008372961.1| PREDICTED: tubulin alpha chain isoform X1 [Malus domestica]
Length=450

 Score =   330 bits (846),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISN+T+VAEVFS
Sbjct  330  AAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|KDP44552.1| hypothetical protein JCGZ_16385 [Jatropha curcas]
Length=450

 Score =   330 bits (846),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  SSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  599
            SSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN
Sbjct  270  SSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN  329

Query  598  AAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNNTAVAEVFS  419
            AAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISN+T+VAEVFS
Sbjct  330  AAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFS  389

Query  418  RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  RIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1507754616730