BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF026M10

Length=669
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|EYU36436.1|  hypothetical protein MIMGU_mgv1a014341mg                221   6e-69   Erythranthe guttata [common monkey flower]
ref|XP_008229748.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    226   9e-69   Prunus mume [ume]
ref|XP_007215619.1|  hypothetical protein PRUPE_ppa007922mg             226   9e-69   Prunus persica
gb|KDO64247.1|  hypothetical protein CISIN_1g022650mg                   219   3e-68   Citrus sinensis [apfelsine]
ref|XP_006429689.1|  hypothetical protein CICLE_v10012850mg             219   4e-68   
ref|XP_002522591.1|  Endoplasmic reticulum-Golgi intermediate com...    218   8e-68   
ref|XP_010112882.1|  hypothetical protein L484_017718                   223   1e-67   Morus notabilis
gb|KDO37536.1|  hypothetical protein CISIN_1g041965mg                   216   4e-67   Citrus sinensis [apfelsine]
gb|KDO64243.1|  hypothetical protein CISIN_1g022650mg                   220   5e-67   Citrus sinensis [apfelsine]
ref|XP_011074286.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    221   5e-67   Sesamum indicum [beniseed]
ref|XP_009591169.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    221   9e-67   Nicotiana tomentosiformis
ref|XP_009771009.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    221   1e-66   Nicotiana sylvestris
ref|XP_007048889.1|  Endoplasmic reticulum vesicle transporter pr...    221   1e-66   
ref|XP_007048888.1|  Endoplasmic reticulum vesicle transporter pr...    221   1e-66   Theobroma cacao [chocolate]
ref|XP_006481288.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    221   1e-66   Citrus sinensis [apfelsine]
ref|XP_004243621.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    219   3e-66   Solanum lycopersicum
ref|XP_002307923.1|  hypothetical protein POPTR_0006s02470g             219   6e-66   Populus trichocarpa [western balsam poplar]
ref|XP_008342279.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    218   1e-65   
ref|XP_011040642.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    218   1e-65   Populus euphratica
ref|XP_011467640.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    217   3e-65   Fragaria vesca subsp. vesca
ref|XP_004303918.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    217   3e-65   Fragaria vesca subsp. vesca
ref|XP_010656946.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    216   5e-65   Vitis vinifera
ref|XP_009377930.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    216   5e-65   Pyrus x bretschneideri [bai li]
ref|XP_010036056.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    216   8e-65   Eucalyptus grandis [rose gum]
ref|XP_009787019.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    215   1e-64   Nicotiana sylvestris
ref|XP_008380042.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    216   1e-64   
ref|XP_004502082.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    214   3e-64   Cicer arietinum [garbanzo]
ref|XP_007145973.1|  hypothetical protein PHAVU_006G002400g             214   4e-64   Phaseolus vulgaris [French bean]
ref|XP_010313686.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    213   7e-64   Solanum lycopersicum
ref|XP_010314961.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    213   7e-64   Solanum lycopersicum
gb|AFK38705.1|  unknown                                                 207   8e-64   Medicago truncatula
gb|KDP30124.1|  hypothetical protein JCGZ_18119                         213   1e-63   Jatropha curcas
ref|XP_003542168.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    212   2e-63   Glycine max [soybeans]
ref|XP_006605681.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    211   8e-63   Glycine max [soybeans]
ref|XP_011010108.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    211   9e-63   Populus euphratica
ref|XP_011008533.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    211   9e-63   Populus euphratica
ref|XP_009408557.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    211   1e-62   
ref|XP_002322569.2|  hypothetical protein POPTR_0016s02310g             210   2e-62   
gb|KHG20152.1|  Endoplasmic reticulum-Golgi intermediate compartm...    204   2e-62   Gossypium arboreum [tree cotton]
ref|XP_010525179.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    210   2e-62   Tarenaya hassleriana [spider flower]
ref|XP_010525178.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    210   2e-62   Tarenaya hassleriana [spider flower]
ref|XP_010245571.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    209   2e-62   Nelumbo nucifera [Indian lotus]
gb|KJB75348.1|  hypothetical protein B456_012G039800                    207   2e-62   Gossypium raimondii
ref|XP_006351995.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    209   2e-62   Solanum tuberosum [potatoes]
gb|ACU19028.1|  unknown                                                 209   3e-62   Glycine max [soybeans]
ref|XP_010923699.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    209   4e-62   Elaeis guineensis
gb|KJB75345.1|  hypothetical protein B456_012G039800                    208   4e-62   Gossypium raimondii
ref|XP_010923701.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    209   4e-62   Elaeis guineensis
gb|KEH35189.1|  endoplasmic reticulum vesicle transporter               209   4e-62   Medicago truncatula
emb|CDP16085.1|  unnamed protein product                                209   5e-62   Coffea canephora [robusta coffee]
gb|KJB75343.1|  hypothetical protein B456_012G039800                    208   6e-62   Gossypium raimondii
ref|XP_010245563.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    209   6e-62   Nelumbo nucifera [Indian lotus]
ref|XP_006858296.1|  hypothetical protein AMTR_s00064p00067290          208   7e-62   Amborella trichopoda
gb|KJB40581.1|  hypothetical protein B456_007G069900                    208   1e-61   Gossypium raimondii
ref|XP_008794432.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    207   1e-61   Phoenix dactylifera
ref|XP_010688789.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    208   1e-61   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB75344.1|  hypothetical protein B456_012G039800                    208   2e-61   Gossypium raimondii
ref|XP_009145393.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    205   1e-60   Brassica rapa
ref|XP_008463181.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    204   2e-60   Cucumis melo [Oriental melon]
ref|XP_002458688.1|  hypothetical protein SORBIDRAFT_03g038260          204   3e-60   Sorghum bicolor [broomcorn]
ref|XP_004155757.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    200   9e-60   
ref|XP_003558212.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    202   1e-59   Brachypodium distachyon [annual false brome]
gb|KGN51067.1|  hypothetical protein Csa_5G426440                       201   4e-59   Cucumis sativus [cucumbers]
ref|NP_001131002.1|  DUF1692 domain, endoplasmic reticulum vescic...    199   5e-59   Zea mays [maize]
ref|XP_009135799.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    201   7e-59   Brassica rapa
ref|XP_006650685.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    200   9e-59   Oryza brachyantha
ref|NP_001051473.1|  Os03g0784400                                       200   1e-58   
ref|XP_008654279.1|  PREDICTED: DUF1692 domain, endoplasmic retic...    200   1e-58   Zea mays [maize]
gb|EEC76283.1|  hypothetical protein OsI_13786                          199   1e-58   Oryza sativa Indica Group [Indian rice]
ref|XP_006406186.1|  hypothetical protein EUTSA_v10021173mg             198   2e-58   
ref|XP_010532527.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    199   2e-58   Tarenaya hassleriana [spider flower]
ref|XP_006406187.1|  hypothetical protein EUTSA_v10021173mg             198   2e-58   
emb|CDY24301.1|  BnaC03g42740D                                          199   2e-58   Brassica napus [oilseed rape]
ref|XP_004982677.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    199   2e-58   Setaria italica
ref|XP_002883352.1|  hypothetical protein ARALYDRAFT_479742             199   2e-58   
emb|CDY37404.1|  BnaC05g30260D                                          199   3e-58   Brassica napus [oilseed rape]
gb|EPS71314.1|  hypothetical protein M569_03444                         199   3e-58   Genlisea aurea
dbj|BAJ84787.1|  predicted protein                                      199   3e-58   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009407709.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    199   3e-58   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004140296.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    199   5e-58   
ref|XP_010466507.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    198   5e-58   Camelina sativa [gold-of-pleasure]
gb|EMT22267.1|  hypothetical protein F775_30192                         199   7e-58   
ref|XP_006298011.1|  hypothetical protein CARUB_v10014056mg             198   7e-58   Capsella rubella
ref|XP_010511216.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    197   1e-57   Camelina sativa [gold-of-pleasure]
gb|KJB75346.1|  hypothetical protein B456_012G039800                    197   1e-57   Gossypium raimondii
ref|NP_188868.2|  Endoplasmic reticulum vesicle transporter protein     197   2e-57   Arabidopsis thaliana [mouse-ear cress]
gb|KJB75349.1|  hypothetical protein B456_012G039800                    197   4e-57   Gossypium raimondii
gb|KJB75347.1|  hypothetical protein B456_012G039800                    196   6e-57   Gossypium raimondii
gb|EMS49840.1|  hypothetical protein TRIUR3_11686                       199   1e-56   Triticum urartu
ref|XP_008348329.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    180   5e-52   
ref|XP_001754824.1|  predicted protein                                  174   1e-48   
dbj|BAB17274.1|  unnamed protein product                                172   3e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002993277.1|  hypothetical protein SELMODRAFT_431378             170   2e-47   
ref|XP_005651581.1|  DUF1692-domain-containing protein                  137   5e-35   Coccomyxa subellipsoidea C-169
tpg|DAA57059.1|  TPA: hypothetical protein ZEAMMB73_408305              128   3e-34   
gb|AFW82389.1|  putative DUF1692 domain containing protein              140   3e-34   
gb|AFW85973.1|  putative DUF1692 domain containing protein              140   3e-34   
gb|AFW83755.1|  hypothetical protein ZEAMMB73_317062                    140   5e-34   
ref|XP_005839166.1|  hypothetical protein GUITHDRAFT_65491              110   1e-24   Guillardia theta CCMP2712
ref|XP_005826990.1|  hypothetical protein GUITHDRAFT_154283             109   1e-24   Guillardia theta CCMP2712
ref|XP_004355625.1|  endoplasmic reticulum-golgi intermediate com...    108   2e-24   Cavenderia fasciculata
ref|XP_002285801.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    109   2e-24   
gb|EMS52396.1|  hypothetical protein TRIUR3_27593                       107   8e-24   Triticum urartu
dbj|GAM20914.1|  hypothetical protein SAMD00019534_040890               106   2e-23   Acytostelium subglobosum LB1
dbj|BAK05850.1|  predicted protein                                      106   2e-23   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009578622.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    102   3e-23   Fulmarus glacialis
ref|XP_010239982.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    105   3e-23   
dbj|BAJ87561.1|  predicted protein                                      105   4e-23   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EEE61111.1|  hypothetical protein OsJ_15023                          105   5e-23   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003568216.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    105   5e-23   Brachypodium distachyon [annual false brome]
ref|NP_001148795.1|  LOC100282412                                       105   5e-23   Zea mays [maize]
ref|XP_005232398.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    104   5e-23   
gb|EYU18489.1|  hypothetical protein MIMGU_mgv1a008051mg                105   6e-23   Erythranthe guttata [common monkey flower]
ref|XP_010934993.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    105   6e-23   Elaeis guineensis
ref|XP_003579883.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    105   6e-23   Brachypodium distachyon [annual false brome]
gb|ACN35132.1|  unknown                                                 105   6e-23   Zea mays [maize]
gb|KFK42194.1|  hypothetical protein AALP_AA2G223600                    105   6e-23   Arabis alpina [alpine rockcress]
ref|XP_002447951.1|  hypothetical protein SORBIDRAFT_06g018670          104   6e-23   Sorghum bicolor [broomcorn]
ref|XP_005438238.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    104   7e-23   
ref|XP_005774403.1|  hypothetical protein EMIHUDRAFT_430522             105   7e-23   Emiliania huxleyi CCMP1516
emb|CAE02574.2|  OSJNBa0006M15.17                                       104   7e-23   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009917276.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    101   8e-23   Haliaeetus albicilla
gb|KFO97972.1|  Endoplasmic reticulum-Golgi intermediate compartm...    103   1e-22   Calypte anna
ref|XP_001764962.1|  predicted protein                                  104   1e-22   
ref|XP_008504578.1|  PREDICTED: LOW QUALITY PROTEIN: endoplasmic ...    104   1e-22   Calypte anna
ref|XP_002439992.1|  hypothetical protein SORBIDRAFT_09g023960          103   1e-22   Sorghum bicolor [broomcorn]
gb|EPS71395.1|  hypothetical protein M569_03362                         103   2e-22   Genlisea aurea
ref|XP_001754958.1|  predicted protein                                  103   2e-22   
ref|XP_005534205.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    103   2e-22   Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_005534206.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    103   2e-22   
ref|XP_002264644.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    103   2e-22   Vitis vinifera
ref|XP_008804335.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    103   2e-22   
ref|XP_008804334.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    103   2e-22   Phoenix dactylifera
ref|XP_006033884.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    103   2e-22   
ref|XP_002191084.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    103   2e-22   Taeniopygia guttata
ref|XP_004237893.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    103   2e-22   Solanum lycopersicum
ref|XP_006266817.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    103   2e-22   Alligator mississippiensis
ref|XP_002302286.1|  hypothetical protein POPTR_0002s09500g             103   2e-22   
ref|XP_008378547.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    103   2e-22   Malus domestica [apple tree]
ref|XP_009373163.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    103   3e-22   Pyrus x bretschneideri [bai li]
ref|XP_009369662.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    103   3e-22   Pyrus x bretschneideri [bai li]
ref|XP_007018816.1|  Endoplasmic reticulum vesicle transporter pr...    103   3e-22   
ref|XP_009708266.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    100   3e-22   Cariama cristata
ref|XP_011013540.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    103   3e-22   Populus euphratica
gb|KFO76211.1|  Endoplasmic reticulum-Golgi intermediate compartm...    102   3e-22   Cuculus canorus
ref|XP_008802686.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    102   3e-22   
ref|XP_009559309.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    102   3e-22   Cuculus canorus
ref|XP_008802685.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    102   3e-22   Phoenix dactylifera
ref|XP_011464591.1|  PREDICTED: LOW QUALITY PROTEIN: endoplasmic ...    102   4e-22   Fragaria vesca subsp. vesca
ref|XP_002306582.1|  hypothetical protein POPTR_0005s16700g             102   4e-22   Populus trichocarpa [western balsam poplar]
emb|CDP01031.1|  unnamed protein product                                102   4e-22   Coffea canephora [robusta coffee]
gb|KFQ65052.1|  Endoplasmic reticulum-Golgi intermediate compartm...    102   5e-22   Pelecanus crispus
ref|XP_009488027.1|  PREDICTED: LOW QUALITY PROTEIN: endoplasmic ...    102   5e-22   Pelecanus crispus
ref|XP_010411485.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    102   6e-22   
gb|KFW74284.1|  Endoplasmic reticulum-Golgi intermediate compartm...    102   6e-22   Manacus vitellinus
ref|XP_008627777.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    102   6e-22   
gb|KFO52827.1|  Endoplasmic reticulum-Golgi intermediate compartm...    101   6e-22   Corvus brachyrhynchos
ref|XP_008932726.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    101   6e-22   
ref|XP_009931564.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    101   6e-22   Opisthocomus hoazin [hoatzin]
ref|XP_005428461.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    101   7e-22   
ref|XP_010261264.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    102   7e-22   Nelumbo nucifera [Indian lotus]
ref|NP_001132255.1|  DUF1692 domain, endoplasmic reticulum vescic...    102   7e-22   Zea mays [maize]
gb|AFW78473.1|  DUF1692 domain, endoplasmic reticulum vescicle tr...    101   7e-22   
ref|XP_006652356.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    102   7e-22   Oryza brachyantha
gb|EMS61746.1|  hypothetical protein TRIUR3_13518                       101   7e-22   Triticum urartu
ref|XP_008219664.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    101   8e-22   Prunus mume [ume]
ref|XP_007227487.1|  hypothetical protein PRUPE_ppa007001mg             101   8e-22   Prunus persica
ref|XP_009097046.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    101   8e-22   
ref|XP_009390586.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    101   8e-22   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFV71275.1|  Endoplasmic reticulum-Golgi intermediate compartm...    101   8e-22   Picoides pubescens
gb|KDO80920.1|  hypothetical protein CISIN_1g016587mg                   100   8e-22   Citrus sinensis [apfelsine]
ref|XP_009097047.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    101   8e-22   Serinus canaria [canary]
ref|XP_010198765.1|  PREDICTED: LOW QUALITY PROTEIN: endoplasmic ...    101   8e-22   Colius striatus
ref|XP_004975824.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    101   9e-22   Setaria italica
gb|KFP23539.1|  Endoplasmic reticulum-Golgi intermediate compartm...    101   9e-22   Colius striatus
gb|KFR09655.1|  Endoplasmic reticulum-Golgi intermediate compartm...    101   9e-22   Opisthocomus hoazin [hoatzin]
ref|XP_010019924.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    101   9e-22   Nestor notabilis
gb|KFQ56065.1|  Endoplasmic reticulum-Golgi intermediate compartm...    101   9e-22   Nestor notabilis
ref|XP_005496545.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    101   9e-22   Zonotrichia albicollis
ref|XP_002513896.1|  Endoplasmic reticulum-Golgi intermediate com...    101   1e-21   Ricinus communis
ref|XP_010060169.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    101   1e-21   Eucalyptus grandis [rose gum]
gb|KCW66744.1|  hypothetical protein EUGRSUZ_F00498                     101   1e-21   Eucalyptus grandis [rose gum]
ref|XP_009509474.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  98.2    1e-21   Phalacrocorax carbo [common cormorant]
ref|XP_005496546.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    101   1e-21   
ref|XP_010105897.1|  hypothetical protein L484_021555                   101   1e-21   Morus notabilis
ref|XP_004961675.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    101   1e-21   Setaria italica
ref|XP_006472628.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    101   1e-21   Citrus sinensis [apfelsine]
ref|XP_005147587.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    101   1e-21   Melopsittacus undulatus
gb|ETE61956.1|  Endoplasmic reticulum-Golgi intermediate compartm...    100   1e-21   Ophiophagus hannah
ref|NP_001141198.1|  uncharacterized protein LOC100273285               101   1e-21   Zea mays [maize]
ref|XP_005147588.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    101   1e-21   Melopsittacus undulatus
ref|XP_010939627.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    100   1e-21   Elaeis guineensis
ref|XP_001759631.1|  predicted protein                                  100   2e-21   
ref|XP_009904016.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    101   2e-21   Picoides pubescens
gb|KGL94343.1|  Endoplasmic reticulum-Golgi intermediate compartm...    100   2e-21   Charadrius vociferus
ref|XP_009884638.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    100   2e-21   Charadrius vociferus
ref|XP_006654573.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    100   2e-21   Oryza brachyantha
ref|XP_009327626.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  98.6    2e-21   Pygoscelis adeliae
ref|XP_010294012.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    100   2e-21   Phaethon lepturus
ref|XP_010562891.1|  PREDICTED: LOW QUALITY PROTEIN: endoplasmic ...    100   2e-21   Haliaeetus leucocephalus
ref|XP_009946915.1|  PREDICTED: LOW QUALITY PROTEIN: endoplasmic ...    100   2e-21   Leptosomus discolor
ref|XP_006354000.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    100   2e-21   Solanum tuberosum [potatoes]
ref|XP_010676904.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    100   2e-21   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_005514697.1|  PREDICTED: LOW QUALITY PROTEIN: endoplasmic ...    100   2e-21   
gb|EMC76893.1|  Endoplasmic reticulum-Golgi intermediate compartm...    100   2e-21   
gb|KFR06735.1|  Endoplasmic reticulum-Golgi intermediate compartm...    100   2e-21   Nipponia nippon
ref|XP_009471655.1|  PREDICTED: LOW QUALITY PROTEIN: endoplasmic ...    100   2e-21   Nipponia nippon
ref|XP_008568949.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    100   2e-21   Galeopterus variegatus [Malayan flying lemur]
ref|XP_004142610.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    100   2e-21   Cucumis sativus [cucumbers]
ref|XP_002977139.1|  hypothetical protein SELMODRAFT_271242             100   2e-21   Selaginella moellendorffii
ref|XP_008568816.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    100   2e-21   Galeopterus variegatus [Malayan flying lemur]
ref|NP_001087591.1|  endoplasmic reticulum-Golgi intermediate com...    100   2e-21   Xenopus laevis [clawed frog]
ref|XP_008568883.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    100   2e-21   Galeopterus variegatus [Malayan flying lemur]
ref|XP_005986794.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    100   3e-21   Latimeria chalumnae
ref|XP_005986793.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    100   3e-21   Latimeria chalumnae
ref|XP_009419975.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    100   3e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_005057037.1|  PREDICTED: uncharacterized protein LOC101821551    102   3e-21   
gb|ERZ99514.1|  hypothetical protein GLOINDRAFT_339028                99.4    3e-21   
ref|XP_003615024.1|  Endoplasmic reticulum-Golgi intermediate com...    100   3e-21   Medicago truncatula
ref|XP_008445347.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    100   3e-21   Cucumis melo [Oriental melon]
ref|XP_009595173.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    100   3e-21   Nicotiana tomentosiformis
ref|XP_011087876.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    100   3e-21   Sesamum indicum [beniseed]
ref|XP_004340798.1|  golgi family protein, putative                   99.8    3e-21   Acanthamoeba castellanii str. Neff
ref|XP_010080198.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  99.8    4e-21   Pterocles gutturalis
ref|XP_009595172.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  99.8    4e-21   Nicotiana tomentosiformis
ref|XP_004514266.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  99.8    4e-21   Cicer arietinum [garbanzo]
gb|KJB59935.1|  hypothetical protein B456_009G281900                  99.0    4e-21   Gossypium raimondii
ref|XP_007429095.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  99.8    4e-21   Python bivittatus
ref|XP_007141162.1|  hypothetical protein PHAVU_008G172300g           99.8    4e-21   Phaseolus vulgaris [French bean]
gb|KFV43899.1|  Endoplasmic reticulum-Golgi intermediate compartm...  99.4    4e-21   Tyto alba [Schleiereule]
dbj|BAJ86415.1|  predicted protein                                    99.8    4e-21   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009812641.1|  PREDICTED: LOW QUALITY PROTEIN: endoplasmic ...  99.4    4e-21   Gavia stellata
gb|KFP09370.1|  Endoplasmic reticulum-Golgi intermediate compartm...  99.4    4e-21   Egretta garzetta
ref|XP_009636179.1|  PREDICTED: LOW QUALITY PROTEIN: endoplasmic ...  99.4    4e-21   Egretta garzetta
ref|XP_008444108.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  99.8    4e-21   Cucumis melo [Oriental melon]
ref|XP_009973938.1|  PREDICTED: LOW QUALITY PROTEIN: endoplasmic ...  99.4    4e-21   Tyto alba [Schleiereule]
gb|KFV55314.1|  Endoplasmic reticulum-Golgi intermediate compartm...  99.4    4e-21   Gavia stellata
ref|XP_010133714.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  99.4    5e-21   Buceros rhinoceros silvestris
ref|NP_001091124.1|  ERGIC and golgi 3                                99.4    5e-21   Xenopus laevis [clawed frog]
ref|XP_007429094.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  99.4    5e-21   Python bivittatus
ref|NP_001055898.1|  Os05g0490200                                     99.4    5e-21   
ref|XP_008173907.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  99.4    5e-21   
ref|XP_010269218.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  99.4    5e-21   Nelumbo nucifera [Indian lotus]
ref|XP_006126746.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  99.4    5e-21   Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_010269216.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  99.4    5e-21   Nelumbo nucifera [Indian lotus]
gb|EAW76200.1|  ERGIC and golgi 3, isoform CRA_b                      97.8    5e-21   Homo sapiens [man]
gb|KHN26081.1|  Endoplasmic reticulum-Golgi intermediate compartm...  99.4    6e-21   Glycine soja [wild soybean]
ref|XP_009386733.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  99.4    6e-21   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACA64886.1|  endoplasmic reticulum-Golgi intermediate compartm...  97.8    6e-21   Plecturocebus moloch [Dusky titi]
ref|XP_007042992.1|  Endoplasmic reticulum vesicle transporter pr...  99.4    6e-21   
ref|XP_006351793.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  99.4    6e-21   Solanum tuberosum [potatoes]
ref|XP_003542443.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  99.4    6e-21   Glycine max [soybeans]
ref|XP_005294107.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  99.4    6e-21   Chrysemys picta bellii
ref|XP_006188640.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  99.4    6e-21   Camelus ferus
ref|XP_007969802.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  98.2    6e-21   Chlorocebus sabaeus
ref|XP_005294106.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  99.0    6e-21   Chrysemys picta bellii
ref|XP_006188641.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  99.0    6e-21   Camelus ferus
ref|XP_003544786.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  99.0    7e-21   Glycine max [soybeans]
ref|XP_006202670.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  99.0    7e-21   Vicugna pacos
ref|XP_006202669.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  99.0    7e-21   Vicugna pacos
emb|CDQ64042.1|  unnamed protein product                              99.0    7e-21   Oncorhynchus mykiss
ref|XP_004687302.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  99.0    7e-21   Condylura cristata
gb|KHG13361.1|  Endoplasmic reticulum-Golgi intermediate compartm...  99.0    7e-21   Gossypium arboreum [tree cotton]
ref|XP_004687301.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  99.0    7e-21   Condylura cristata
ref|XP_001843851.1|  endoplasmic reticulum-Golgi intermediate com...  99.0    7e-21   Culex quinquefasciatus
gb|EPY78282.1|  endoplasmic reticulum-Golgi intermediate compartm...  99.0    7e-21   Camelus ferus
ref|XP_008790817.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  98.6    8e-21   
ref|XP_006434016.1|  hypothetical protein CICLE_v10001505mg           99.0    8e-21   
gb|KJB59936.1|  hypothetical protein B456_009G281900                  99.0    8e-21   Gossypium raimondii
ref|XP_005018101.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  98.6    9e-21   
ref|XP_008808176.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  98.6    9e-21   Phoenix dactylifera
ref|XP_004163672.1|  PREDICTED: LOW QUALITY PROTEIN: endoplasmic ...  98.6    9e-21   
ref|XP_009677582.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  98.2    1e-20   Struthio camelus australis
ref|XP_008790816.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  98.6    1e-20   Phoenix dactylifera
ref|NP_001001226.1|  endoplasmic reticulum-Golgi intermediate com...  98.6    1e-20   Xenopus tropicalis [western clawed frog]
gb|KGL78646.1|  Endoplasmic reticulum-Golgi intermediate compartm...  98.2    1e-20   Tinamus guttatus
gb|EDL06163.1|  ERGIC and golgi 3, isoform CRA_c                      97.4    1e-20   Mus musculus [mouse]
ref|XP_004150658.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  98.6    1e-20   Cucumis sativus [cucumbers]
gb|KFV83582.1|  Endoplasmic reticulum-Golgi intermediate compartm...  98.2    1e-20   Struthio camelus australis
gb|EXX73752.1|  Erv46p                                                98.6    1e-20   
ref|XP_010215006.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  98.2    1e-20   
emb|CDX87479.1|  BnaA07g33940D                                        98.6    1e-20   
ref|XP_004946986.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  98.2    1e-20   
emb|CDX88415.1|  BnaC06g38590D                                        98.2    1e-20   
ref|XP_010720552.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  98.2    1e-20   
ref|XP_009106456.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  98.2    1e-20   
ref|XP_006921817.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  98.2    1e-20   
gb|EFA85803.1|  endoplasmic reticulum-golgi intermediate compartm...  98.2    1e-20   
ref|XP_005846152.1|  hypothetical protein CHLNCDRAFT_136126           97.8    1e-20   
ref|XP_003642492.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  98.2    1e-20   
ref|XP_011376631.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  98.2    1e-20   
ref|XP_008319388.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  98.2    1e-20   
ref|XP_003642491.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  98.2    1e-20   
gb|ACC68956.1|  serologically defined breast cancer antigen 84 is...  98.2    1e-20   
ref|XP_002424735.1|  Endoplasmic reticulum-golgi intermediate com...  98.2    1e-20   
ref|XP_004230558.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  98.2    2e-20   
ref|XP_006826951.1|  hypothetical protein AMTR_s00010p00188050        98.2    2e-20   
ref|XP_006750457.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.1    2e-20   
ref|XP_004946984.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  98.2    2e-20   
ref|XP_001098982.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.8    2e-20   
ref|XP_008319387.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  98.2    2e-20   
ref|XP_004946985.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  98.2    2e-20   
ref|XP_008373201.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.8    2e-20   
ref|XP_001098885.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.8    2e-20   
ref|XP_010901817.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.8    2e-20   
ref|NP_001158869.1|  Endoplasmic reticulum-Golgi intermediate com...  97.8    2e-20   
ref|XP_010901818.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.8    2e-20   
ref|XP_001371602.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.8    2e-20   
ref|XP_001634898.1|  predicted protein                                97.8    2e-20   
ref|XP_001371575.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.8    2e-20   
ref|XP_004482494.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.4    2e-20   
ref|XP_007053985.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.4    2e-20   
ref|XP_004548890.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.4    2e-20   
ref|XP_007258563.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.4    2e-20   
ref|XP_004548891.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.4    2e-20   
ref|XP_004062113.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.4    2e-20   
ref|NP_001270982.1|  endoplasmic reticulum-Golgi intermediate com...  97.4    2e-20   
ref|XP_011219561.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.1    2e-20   
ref|XP_005329943.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.4    2e-20   
ref|XP_007258561.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.4    2e-20   
ref|XP_007258562.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.4    2e-20   
ref|XP_008696377.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.1    2e-20   
ref|XP_008053667.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.4    3e-20   
gb|AAX46646.1|  serologically defined breast cancer antigen 84 is...  97.1    3e-20   
ref|XP_011012659.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.4    3e-20   
ref|XP_004668176.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.4    3e-20   
ref|XP_005084715.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.4    3e-20   
ref|XP_004272824.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.4    3e-20   
ref|XP_005384848.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.4    3e-20   
ref|XP_010638253.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.4    3e-20   
ref|XP_006500064.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.4    3e-20   
ref|XP_004585820.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.4    3e-20   
ref|XP_002747286.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.4    3e-20   
ref|XP_005329944.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.4    3e-20   
emb|CAI42843.1|  ERGIC and golgi 3                                    97.4    3e-20   
ref|XP_006988325.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.4    3e-20   
ref|XP_001653244.1|  AAEL008391-PA                                    97.4    3e-20   
ref|XP_003501188.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.4    3e-20   
ref|XP_003788180.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.4    3e-20   
ref|XP_004888661.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.4    3e-20   
ref|XP_002747285.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.4    3e-20   
ref|XP_004585821.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.4    3e-20   
ref|XP_010638254.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.4    3e-20   
ref|XP_008053668.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.4    3e-20   
ref|XP_006144123.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.4    3e-20   
ref|XP_004668177.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.4    3e-20   
ref|NP_057050.1|  endoplasmic reticulum-Golgi intermediate compar...  97.4    3e-20   
ref|XP_003273622.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.4    3e-20   
ref|XP_011238033.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.4    3e-20   
ref|XP_008838971.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.4    3e-20   
ref|NP_001029525.2|  endoplasmic reticulum-Golgi intermediate com...  97.4    3e-20   
ref|XP_004888660.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.4    3e-20   
ref|XP_004630919.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.4    3e-20   
ref|XP_004630918.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.4    3e-20   
ref|NP_938408.1|  endoplasmic reticulum-Golgi intermediate compar...  97.4    3e-20   
ref|XP_008838972.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.4    3e-20   
ref|XP_003788179.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.4    3e-20   
ref|XP_007447834.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.4    3e-20   
dbj|BAC11054.1|  unnamed protein product                              97.4    3e-20   
ref|XP_004272825.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.1    3e-20   
ref|NP_001126130.1|  endoplasmic reticulum-Golgi intermediate com...  97.1    3e-20   
ref|XP_864582.3|  PREDICTED: endoplasmic reticulum-Golgi intermed...  97.1    3e-20   
ref|NP_001100003.1|  endoplasmic reticulum-Golgi intermediate com...  97.1    3e-20   
ref|XP_006144122.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.4    3e-20   
ref|XP_851879.3|  PREDICTED: endoplasmic reticulum-Golgi intermed...  97.4    3e-20   
ref|NP_001164802.1|  endoplasmic reticulum-Golgi intermediate com...  97.1    3e-20   
ref|NP_079792.1|  endoplasmic reticulum-Golgi intermediate compar...  97.1    3e-20   
gb|EHH19745.1|  Serologically defined breast cancer antigen NY-BR-84  97.4    3e-20   
ref|XP_007447835.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.1    3e-20   
ref|XP_005384847.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.4    3e-20   
ref|XP_003467839.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.1    3e-20   
gb|ABF57320.1|  serologically defined breast cancer antigen 84        97.1    3e-20   
ref|XP_006390025.1|  hypothetical protein EUTSA_v10018695mg           97.1    3e-20   
ref|XP_009349444.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.1    3e-20   
ref|XP_008237176.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.1    3e-20   
emb|CDQ62107.1|  unnamed protein product                              93.2    3e-20   
ref|XP_004014575.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.1    3e-20   
ref|XP_005900090.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.1    3e-20   
ref|XP_004014574.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.1    3e-20   
ref|XP_007193280.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.1    3e-20   
gb|ABF57305.1|  serologically defined breast cancer antigen 84        97.1    3e-20   
ref|XP_006881541.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.1    3e-20   
ref|XP_004612591.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.1    3e-20   
ref|XP_008838973.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.1    3e-20   
ref|XP_006881542.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.1    3e-20   
ref|XP_009009462.1|  hypothetical protein HELRODRAFT_105492           97.1    3e-20   
ref|XP_007932792.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.1    3e-20   
gb|EHB05461.1|  Endoplasmic reticulum-Golgi intermediate compartm...  97.1    3e-20   
ref|XP_004612590.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.1    3e-20   
ref|XP_004430532.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.1    3e-20   
ref|XP_005002790.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.1    3e-20   
ref|XP_007073687.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.1    3e-20   
ref|XP_004370458.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.1    3e-20   
ref|XP_003220520.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.1    3e-20   
ref|XP_003411726.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.1    4e-20   
ref|XP_004746602.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.1    4e-20   
gb|ACQ63006.1|  serologically defined breast cancer antigen 84 is...  97.1    4e-20   
ref|XP_005604807.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  96.7    4e-20   
ref|XP_003983624.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.1    4e-20   
ref|XP_004090166.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.1    4e-20   
ref|XP_007932793.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.1    4e-20   
ref|XP_007101787.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  96.7    4e-20   
ref|XP_004430531.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.1    4e-20   
ref|XP_004393167.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.1    4e-20   
ref|XP_004370457.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.1    4e-20   
gb|EFB21643.1|  hypothetical protein PANDA_004535                     97.1    4e-20   
ref|XP_002916455.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.1    4e-20   
dbj|BAM19583.1|  ptx1 protein                                         96.3    4e-20   
ref|XP_004393168.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.1    4e-20   
gb|ELW69597.1|  Endoplasmic reticulum-Golgi intermediate compartm...  97.1    4e-20   
ref|XP_003220521.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.1    4e-20   
ref|XP_009337894.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.1    4e-20   
gb|KEH31232.1|  endoplasmic reticulum vesicle transporter             96.3    4e-20   
ref|XP_010589943.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  96.7    4e-20   
ref|XP_003759313.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  96.7    4e-20   
gb|ELR53293.1|  Endoplasmic reticulum-Golgi intermediate compartm...  97.1    4e-20   
ref|XP_011219560.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  96.7    4e-20   
gb|EPQ16115.1|  Endoplasmic reticulum-Golgi intermediate compartm...  96.7    4e-20   
ref|XP_008696376.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  96.7    4e-20   
ref|XP_006639727.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  96.7    4e-20   
ref|XP_009860519.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  96.7    4e-20   
ref|XP_007522702.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  96.7    4e-20   
gb|KFM75670.1|  Endoplasmic reticulum-Golgi intermediate compartm...  95.5    5e-20   
ref|XP_006639728.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  96.7    5e-20   
ref|XP_006089521.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  96.7    5e-20   
ref|XP_007522703.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  96.7    5e-20   
ref|XP_006089522.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  96.7    5e-20   
gb|ELK29631.1|  Endoplasmic reticulum-Golgi intermediate compartm...  96.7    5e-20   
ref|XP_792057.3|  PREDICTED: endoplasmic reticulum-Golgi intermed...  96.7    6e-20   
emb|CDO97460.1|  unnamed protein product                              96.3    6e-20   
gb|KDR18365.1|  Endoplasmic reticulum-Golgi intermediate compartm...  96.3    6e-20   
ref|XP_006235376.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  97.1    6e-20   
gb|KEH31231.1|  endoplasmic reticulum vesicle transporter             96.3    6e-20   
ref|XP_003448415.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  96.3    6e-20   
ref|XP_010065587.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  96.3    7e-20   
gb|KHG11605.1|  Endoplasmic reticulum-Golgi intermediate compartm...  96.3    7e-20   
ref|XP_003448416.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  96.3    7e-20   
ref|XP_001929458.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  96.3    7e-20   
ref|XP_005879911.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  96.3    7e-20   
ref|XP_004698301.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  96.3    7e-20   
ref|XP_001929457.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  95.9    7e-20   
gb|KJB79682.1|  hypothetical protein B456_013G061900                  96.3    8e-20   
ref|XP_006305055.1|  hypothetical protein CARUB_v10009420mg           95.9    8e-20   
ref|XP_004364824.1|  Ergic3 protein                                   96.3    8e-20   
ref|XP_002958233.1|  hypothetical protein VOLCADRAFT_69193            95.9    8e-20   
ref|XP_006875766.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  95.9    8e-20   
ref|XP_009767797.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  95.9    9e-20   
ref|XP_006875767.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  95.9    9e-20   
gb|KJE90687.1|  Ergic3 protein                                        95.9    9e-20   
ref|XP_004504780.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  95.9    9e-20   
ref|XP_001693564.1|  predicted protein                                95.9    9e-20   
emb|CAI42845.1|  ERGIC and golgi 3                                    92.0    1e-19   
ref|XP_005650551.1|  DUF1692-domain-containing protein                95.9    1e-19   
gb|KHN39214.1|  Endoplasmic reticulum-Golgi intermediate compartm...  95.5    1e-19   
ref|XP_009107911.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  95.5    1e-19   
ref|XP_004746600.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  96.3    1e-19   
emb|CDY41876.1|  BnaA08g06230D                                        95.5    1e-19   
ref|XP_010498683.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  95.5    1e-19   
dbj|GAM26503.1|  hypothetical protein SAMD00019534_096780             95.5    1e-19   
ref|XP_003524744.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  95.9    1e-19   
ref|XP_009419691.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  95.5    1e-19   
ref|XP_002602383.1|  hypothetical protein BRAFLDRAFT_63528            95.5    1e-19   
ref|NP_001242045.1|  uncharacterized protein LOC100781612             95.1    1e-19   
ref|NP_564162.1|  Endoplasmic reticulum vesicle transporter protein   95.1    2e-19   
ref|XP_005810880.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  95.1    2e-19   
gb|EMP41337.1|  hypothetical protein UY3_01439                        98.6    2e-19   
ref|XP_008406425.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  95.1    2e-19   
ref|XP_010477480.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  95.1    2e-19   
ref|XP_007544069.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  95.1    2e-19   
ref|XP_002893216.1|  hypothetical protein ARALYDRAFT_472456           95.1    2e-19   
gb|ACJ84247.1|  unknown                                               95.1    2e-19   
ref|XP_007544071.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  95.1    2e-19   
ref|XP_010753438.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  90.9    2e-19   
ref|XP_008406424.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  95.1    2e-19   
ref|XP_003283473.1|  hypothetical protein DICPUDRAFT_52316            95.1    2e-19   
ref|XP_005810881.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  95.1    2e-19   
ref|XP_007159091.1|  hypothetical protein PHAVU_002G207900g           94.7    2e-19   
emb|CDX91897.1|  BnaC03g31990D                                        94.4    2e-19   
ref|XP_007513569.1|  predicted protein                                95.1    2e-19   
gb|AFK34666.1|  unknown                                               90.5    2e-19   
ref|XP_008382039.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  94.7    3e-19   
ref|NP_001028277.1|  endoplasmic reticulum-Golgi intermediate com...  94.7    3e-19   
ref|XP_011434519.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  94.7    3e-19   
ref|XP_006403044.1|  hypothetical protein EUTSA_v10003455mg           94.4    3e-19   
ref|NP_957309.1|  endoplasmic reticulum-Golgi intermediate compar...  94.4    3e-19   
gb|KFK44311.1|  hypothetical protein AALP_AA1G241700                  94.4    3e-19   
gb|EKC31342.1|  Endoplasmic reticulum-Golgi intermediate compartm...  94.4    3e-19   
gb|KFK24003.1|  hypothetical protein AALP_AAs67745U000100             94.4    3e-19   
ref|XP_001690702.1|  hypothetical protein CHLREDRAFT_180779           96.3    3e-19   
gb|KJB59090.1|  hypothetical protein B456_009G238700                  94.4    3e-19   
ref|XP_009621173.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  95.1    4e-19   
gb|EYU23218.1|  hypothetical protein MIMGU_mgv1a007992mg              94.0    4e-19   
ref|XP_010690474.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  94.0    4e-19   
ref|XP_011299088.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  94.0    4e-19   
ref|XP_010530623.1|  PREDICTED: endoplasmic reticulum-Golgi inter...  94.0    4e-19   
emb|CDY38236.1|  BnaC05g17530D                                        94.0    4e-19   
gb|KHG05263.1|  Endoplasmic reticulum-Golgi intermediate compartm...  94.0    5e-19   
ref|NP_001154394.1|  Endoplasmic reticulum vesicle transporter pr...  94.0    5e-19   
ref|XP_002891208.1|  hypothetical protein ARALYDRAFT_891247           94.0    5e-19   
gb|EPS57229.1|  hypothetical protein M569_17591                       89.7    5e-19   



>gb|EYU36436.1| hypothetical protein MIMGU_mgv1a014341mg [Erythranthe guttata]
Length=193

 Score =   221 bits (564),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 104/120 (87%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LD T RIL   SGTFKYYIKIVPTEY+Y+SKEVLPTNQFSV+EY+S IHEFDR WPAVYF
Sbjct  74   LDETSRILRGASGTFKYYIKIVPTEYKYISKEVLPTNQFSVTEYFSPIHEFDRNWPAVYF  133

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            LYDLSPITVTI+EERRSFLHFITRLCAVLGGTFALTGMLDRWMYR +E+ TKPNARSTVR
Sbjct  134  LYDLSPITVTIREERRSFLHFITRLCAVLGGTFALTGMLDRWMYRFIESFTKPNARSTVR  193



>ref|XP_008229748.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Prunus mume]
Length=351

 Score =   226 bits (576),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 105/120 (88%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDGTERILH  SGTFKYYIK+VPTEYRY+SKEVLPTNQFSV+EY+S + +FDR WPAVYF
Sbjct  232  LDGTERILHDTSGTFKYYIKVVPTEYRYISKEVLPTNQFSVTEYFSPMKQFDRTWPAVYF  291

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYR +EAVTKPNARS +R
Sbjct  292  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRFLEAVTKPNARSVLR  351



>ref|XP_007215619.1| hypothetical protein PRUPE_ppa007922mg [Prunus persica]
 gb|EMJ16818.1| hypothetical protein PRUPE_ppa007922mg [Prunus persica]
Length=351

 Score =   226 bits (576),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 105/120 (88%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDGTERILH  SGTFKYYIK+VPTEYRY+SKEVLPTNQFSV+EY+S + +FDR WPAVYF
Sbjct  232  LDGTERILHDTSGTFKYYIKVVPTEYRYISKEVLPTNQFSVTEYFSPMKQFDRTWPAVYF  291

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYR +EAVTKPNARS +R
Sbjct  292  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRFLEAVTKPNARSVLR  351



>gb|KDO64247.1| hypothetical protein CISIN_1g022650mg [Citrus sinensis]
Length=179

 Score =   219 bits (558),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 103/120 (86%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDGT R+LH  SGTFKYYIKIVPTEYRY+SK+VLPTNQFSV+EY+S I+EFDR WPAVYF
Sbjct  60   LDGTVRMLHDTSGTFKYYIKIVPTEYRYISKDVLPTNQFSVTEYFSTINEFDRTWPAVYF  119

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            LYDLSPITVTIKEERRSFLH ITRLCAVLGGTFALTGMLDRWMYRL+EA+TKP+ARS +R
Sbjct  120  LYDLSPITVTIKEERRSFLHLITRLCAVLGGTFALTGMLDRWMYRLLEALTKPSARSVLR  179



>ref|XP_006429689.1| hypothetical protein CICLE_v10012850mg [Citrus clementina]
 gb|ESR42929.1| hypothetical protein CICLE_v10012850mg [Citrus clementina]
 gb|KDO64246.1| hypothetical protein CISIN_1g022650mg [Citrus sinensis]
Length=193

 Score =   219 bits (558),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 103/120 (86%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDGT R+LH  SGTFKYYIKIVPTEYRY+SK+VLPTNQFSV+EY+S I+EFDR WPAVYF
Sbjct  74   LDGTVRMLHDTSGTFKYYIKIVPTEYRYISKDVLPTNQFSVTEYFSTINEFDRTWPAVYF  133

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            LYDLSPITVTIKEERRSFLH ITRLCAVLGGTFALTGMLDRWMYRL+EA+TKP+ARS +R
Sbjct  134  LYDLSPITVTIKEERRSFLHLITRLCAVLGGTFALTGMLDRWMYRLLEALTKPSARSVLR  193



>ref|XP_002522591.1| Endoplasmic reticulum-Golgi intermediate compartment protein, 
putative [Ricinus communis]
 gb|EEF39792.1| Endoplasmic reticulum-Golgi intermediate compartment protein, 
putative [Ricinus communis]
Length=191

 Score =   218 bits (556),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 103/116 (89%), Positives = 109/116 (94%), Gaps = 0/116 (0%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDGT RILH  SGTFKYYIKIVPTEYRY+SKEVLPTNQFSV+EY+S + E+DR WPAVYF
Sbjct  74   LDGTARILHDASGTFKYYIKIVPTEYRYISKEVLPTNQFSVTEYFSPMSEYDRTWPAVYF  133

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNAR  320
            LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRL+EAVTKPN R
Sbjct  134  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLLEAVTKPNTR  189



>ref|XP_010112882.1| hypothetical protein L484_017718 [Morus notabilis]
 gb|EXC35017.1| hypothetical protein L484_017718 [Morus notabilis]
Length=348

 Score =   223 bits (568),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 105/120 (88%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDGTERILH  SG FKYYIKIVPTEYRY+ KEVLPTNQFSV+EY+S + +FDR+WPAVYF
Sbjct  229  LDGTERILHDTSGVFKYYIKIVPTEYRYIWKEVLPTNQFSVTEYFSPMKDFDRSWPAVYF  288

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRL+EAVTKPNARS +R
Sbjct  289  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLLEAVTKPNARSVLR  348



>gb|KDO37536.1| hypothetical protein CISIN_1g041965mg [Citrus sinensis]
Length=166

 Score =   216 bits (549),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 102/120 (85%), Positives = 112/120 (93%), Gaps = 0/120 (0%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDGT R+LH  SGTFKYYIKIVPTEYRY+SK+VLPTNQFSV+EY+S  +EFDR WPAVYF
Sbjct  47   LDGTVRMLHDTSGTFKYYIKIVPTEYRYISKDVLPTNQFSVTEYFSTFNEFDRTWPAVYF  106

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            LYDLSPITVTIKEERRSFLH ITRLCAVLGGTFALTGMLDRWMYRL+EA+TKP+ARS +R
Sbjct  107  LYDLSPITVTIKEERRSFLHLITRLCAVLGGTFALTGMLDRWMYRLLEALTKPSARSVLR  166



>gb|KDO64243.1| hypothetical protein CISIN_1g022650mg [Citrus sinensis]
Length=294

 Score =   220 bits (560),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 103/120 (86%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDGT R+LH  SGTFKYYIKIVPTEYRY+SK+VLPTNQFSV+EY+S I+EFDR WPAVYF
Sbjct  175  LDGTVRMLHDTSGTFKYYIKIVPTEYRYISKDVLPTNQFSVTEYFSTINEFDRTWPAVYF  234

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            LYDLSPITVTIKEERRSFLH ITRLCAVLGGTFALTGMLDRWMYRL+EA+TKP+ARS +R
Sbjct  235  LYDLSPITVTIKEERRSFLHLITRLCAVLGGTFALTGMLDRWMYRLLEALTKPSARSVLR  294



>ref|XP_011074286.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Sesamum indicum]
 ref|XP_011074287.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Sesamum indicum]
Length=351

 Score =   221 bits (564),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 104/120 (87%), Positives = 112/120 (93%), Gaps = 0/120 (0%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LD T RIL   SGTFKYYIKIVPTEY+Y+SKEVLPTNQFSV+EY+S I EFDRAWPAVYF
Sbjct  232  LDDTVRILRGASGTFKYYIKIVPTEYKYISKEVLPTNQFSVTEYFSPISEFDRAWPAVYF  291

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            LYDLSPITVTI+EERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEA+TKPN+RS +R
Sbjct  292  LYDLSPITVTIREERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEALTKPNSRSIIR  351



>ref|XP_009591169.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Nicotiana tomentosiformis]
 ref|XP_009591170.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Nicotiana tomentosiformis]
Length=348

 Score =   221 bits (563),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 104/120 (87%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDGTERIL   SGTFKYYIKIVPTEYRYLSKEVLPTNQFSV+EY+S I+EFDR WPAVYF
Sbjct  229  LDGTERILRGASGTFKYYIKIVPTEYRYLSKEVLPTNQFSVTEYFSPINEFDRTWPAVYF  288

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            LYDLSPITVTI+EERRSFLHFITRLCAVLGGTFALTGMLD+WMYR +EAV K N+RS VR
Sbjct  289  LYDLSPITVTIREERRSFLHFITRLCAVLGGTFALTGMLDKWMYRFLEAVMKKNSRSLVR  348



>ref|XP_009771009.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Nicotiana sylvestris]
 ref|XP_009771010.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Nicotiana sylvestris]
Length=348

 Score =   221 bits (562),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 104/120 (87%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDGTERIL   SGTFKYYIKIVPTEYRYLSKEVLPTNQFSV+EY+S I+EFDR WPAVYF
Sbjct  229  LDGTERILRGASGTFKYYIKIVPTEYRYLSKEVLPTNQFSVTEYFSPINEFDRTWPAVYF  288

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            LYDLSPITVTI+EERRSFLHFITRLCAVLGGTFALTGMLD+WMYR +EAV K N+RS VR
Sbjct  289  LYDLSPITVTIREERRSFLHFITRLCAVLGGTFALTGMLDKWMYRFLEAVMKKNSRSLVR  348



>ref|XP_007048889.1| Endoplasmic reticulum vesicle transporter protein isoform 2 [Theobroma 
cacao]
 gb|EOX93046.1| Endoplasmic reticulum vesicle transporter protein isoform 2 [Theobroma 
cacao]
Length=352

 Score =   221 bits (562),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 102/120 (85%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDGT RILH  SGTFKYYIKIVPTEYRY+SKEVLPTNQFSVSEY+S +HEFDR WPAVYF
Sbjct  233  LDGTVRILHDTSGTFKYYIKIVPTEYRYISKEVLPTNQFSVSEYFSPMHEFDRTWPAVYF  292

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWM+RL+E +TKP+ +  +R
Sbjct  293  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMFRLIEGLTKPSHKGVLR  352



>ref|XP_007048888.1| Endoplasmic reticulum vesicle transporter protein isoform 1 [Theobroma 
cacao]
 gb|EOX93045.1| Endoplasmic reticulum vesicle transporter protein isoform 1 [Theobroma 
cacao]
Length=351

 Score =   221 bits (562),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 102/120 (85%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDGT RILH  SGTFKYYIKIVPTEYRY+SKEVLPTNQFSVSEY+S +HEFDR WPAVYF
Sbjct  232  LDGTVRILHDTSGTFKYYIKIVPTEYRYISKEVLPTNQFSVSEYFSPMHEFDRTWPAVYF  291

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWM+RL+E +TKP+ +  +R
Sbjct  292  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMFRLIEGLTKPSHKGVLR  351



>ref|XP_006481288.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X1 [Citrus sinensis]
 ref|XP_006481289.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X2 [Citrus sinensis]
Length=351

 Score =   221 bits (562),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 103/120 (86%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDGT R+LH  SGTFKYYIKIVPTEYRY+SK+VLPTNQFSV+EY+S I+EFDR WPAVYF
Sbjct  232  LDGTVRMLHDTSGTFKYYIKIVPTEYRYISKDVLPTNQFSVTEYFSTINEFDRTWPAVYF  291

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            LYDLSPITVTIKEERRSFLH ITRLCAVLGGTFALTGMLDRWMYRL+EA+TKP+ARS +R
Sbjct  292  LYDLSPITVTIKEERRSFLHLITRLCAVLGGTFALTGMLDRWMYRLLEALTKPSARSVLR  351



>ref|XP_004243621.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Solanum lycopersicum]
Length=348

 Score =   219 bits (559),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 103/120 (86%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDGTERIL   SGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEY+S I+EFDR WPAVYF
Sbjct  229  LDGTERILRGASGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYFSPINEFDRTWPAVYF  288

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            LYDLSPITVTI+EERR+FLHFITRLCAVLGGTFALTGMLD+WM+R +EAV K N+RS VR
Sbjct  289  LYDLSPITVTIREERRNFLHFITRLCAVLGGTFALTGMLDKWMFRFLEAVMKKNSRSLVR  348



>ref|XP_002307923.1| hypothetical protein POPTR_0006s02470g [Populus trichocarpa]
 gb|EEE91446.1| hypothetical protein POPTR_0006s02470g [Populus trichocarpa]
Length=351

 Score =   219 bits (557),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 103/120 (86%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDGT RILH  SGTFKYYIKIVPTEYRY+SKEVLPTNQFSV+EY+S + +FDR WPAVYF
Sbjct  232  LDGTTRILHETSGTFKYYIKIVPTEYRYISKEVLPTNQFSVTEYFSPMTDFDRTWPAVYF  291

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWM RL+EA+TKPN RS +R
Sbjct  292  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMCRLLEALTKPNPRSVLR  351



>ref|XP_008342279.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Malus domestica]
Length=352

 Score =   218 bits (556),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 113/121 (93%), Gaps = 1/121 (1%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDGT+RILH  SGTFKYYIKIVPTEYRY+SKEVLPTNQFSV+EY+S + +FDR WPAVYF
Sbjct  232  LDGTDRILHDTSGTFKYYIKIVPTEYRYISKEVLPTNQFSVTEYFSPMKQFDRTWPAVYF  291

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVT-KPNARSTV  311
            LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYR VEA+T KP+ARS +
Sbjct  292  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRFVEALTAKPHARSVL  351

Query  310  R  308
            R
Sbjct  352  R  352



>ref|XP_011040642.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Populus euphratica]
 ref|XP_011004481.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Populus euphratica]
Length=351

 Score =   218 bits (554),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 102/120 (85%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDGT RILH  SGTFKYYIKIVPTEYRY+SKEVLPTNQFSV+EY+S + +FD+ WPAVYF
Sbjct  232  LDGTTRILHETSGTFKYYIKIVPTEYRYISKEVLPTNQFSVTEYFSPMTDFDKTWPAVYF  291

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWM RL+EA+TKPN RS +R
Sbjct  292  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMCRLLEALTKPNPRSVLR  351



>ref|XP_011467640.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 isoform X1 [Fragaria vesca subsp. vesca]
Length=348

 Score =   217 bits (552),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 99/120 (83%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDGTERILH  SG FKYYIK+VPTEYRY+SK+VLPTNQFSV+EYYS + ++DR+WP VYF
Sbjct  229  LDGTERILHDTSGIFKYYIKVVPTEYRYISKQVLPTNQFSVTEYYSPMKQYDRSWPGVYF  288

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            LYDLSPITVTIKEERR FLHFITRLCAVLGGTFALTGMLDRWM+R VEA+TKP+ARS +R
Sbjct  289  LYDLSPITVTIKEERRKFLHFITRLCAVLGGTFALTGMLDRWMFRFVEALTKPSARSVLR  348



>ref|XP_004303918.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 isoform X2 [Fragaria vesca subsp. vesca]
Length=347

 Score =   217 bits (552),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 99/120 (83%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDGTERILH  SG FKYYIK+VPTEYRY+SK+VLPTNQFSV+EYYS + ++DR+WP VYF
Sbjct  228  LDGTERILHDTSGIFKYYIKVVPTEYRYISKQVLPTNQFSVTEYYSPMKQYDRSWPGVYF  287

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            LYDLSPITVTIKEERR FLHFITRLCAVLGGTFALTGMLDRWM+R VEA+TKP+ARS +R
Sbjct  288  LYDLSPITVTIKEERRKFLHFITRLCAVLGGTFALTGMLDRWMFRFVEALTKPSARSVLR  347



>ref|XP_010656946.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Vitis vinifera]
 emb|CBI31774.3| unnamed protein product [Vitis vinifera]
Length=351

 Score =   216 bits (551),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 101/120 (84%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDGT RIL   SGTFKYYIKIVPTEYRY+SKEVLPTNQFSV EY+S ++EFDR WPAVYF
Sbjct  232  LDGTVRILRGASGTFKYYIKIVPTEYRYISKEVLPTNQFSVMEYFSPMNEFDRTWPAVYF  291

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            LYDLSP+TVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYR +E +TKPNA+S  R
Sbjct  292  LYDLSPVTVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRFLEMLTKPNAKSVYR  351



>ref|XP_009377930.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Pyrus x bretschneideri]
Length=355

 Score =   216 bits (551),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 113/121 (93%), Gaps = 1/121 (1%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDGT+RILH  SGTFKYYIKIVPTEYRY+SKEVLPTNQFSV+EY+S + +FDR WPAVYF
Sbjct  235  LDGTDRILHDTSGTFKYYIKIVPTEYRYISKEVLPTNQFSVTEYFSPMKQFDRTWPAVYF  294

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVT-KPNARSTV  311
            LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTG+LDRWMYR VEA+T KP+ARS +
Sbjct  295  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGLLDRWMYRFVEALTAKPHARSVL  354

Query  310  R  308
            R
Sbjct  355  R  355



>ref|XP_010036056.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Eucalyptus grandis]
 gb|KCW47581.1| hypothetical protein EUGRSUZ_K01330 [Eucalyptus grandis]
 gb|KCW47582.1| hypothetical protein EUGRSUZ_K01330 [Eucalyptus grandis]
Length=355

 Score =   216 bits (550),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 100/120 (83%), Positives = 110/120 (92%), Gaps = 0/120 (0%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LD T RIL   SGTFKYYIKIVPTEYRY+SKEVLPTNQFSV+EY+S ++E+DR WPA+YF
Sbjct  236  LDETARILQGASGTFKYYIKIVPTEYRYISKEVLPTNQFSVTEYFSPMNEYDRTWPAIYF  295

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRL+EA++KPN RS  R
Sbjct  296  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLLEALSKPNPRSVFR  355



>ref|XP_009787019.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Nicotiana sylvestris]
Length=350

 Score =   215 bits (548),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 99/120 (83%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDGT RIL   SGTFKY+IK+VPTEYRY+SKEVLPTNQFSV+EY+S I+EFDR WPAVYF
Sbjct  231  LDGTSRILRGASGTFKYFIKVVPTEYRYISKEVLPTNQFSVTEYFSPINEFDRTWPAVYF  290

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            LYDLSPITVTI+EERRSFLH ITRLCAVLGGTFALTGMLDRWMY+L+EAVT+ N+R+ VR
Sbjct  291  LYDLSPITVTIREERRSFLHLITRLCAVLGGTFALTGMLDRWMYKLLEAVTEKNSRTIVR  350



>ref|XP_008380042.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Malus domestica]
Length=371

 Score =   216 bits (549),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 112/121 (93%), Gaps = 1/121 (1%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDGT+RILH  SGTFKYYIKIVPTEYRY+SKEVL TNQFSV+EY+S + +FDR+WPAVYF
Sbjct  251  LDGTDRILHDTSGTFKYYIKIVPTEYRYISKEVLXTNQFSVTEYFSPMKQFDRSWPAVYF  310

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVT-KPNARSTV  311
            LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYR VEA+T KP ARS +
Sbjct  311  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRFVEALTAKPKARSVL  370

Query  310  R  308
            R
Sbjct  371  R  371



>ref|XP_004502082.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Cicer arietinum]
Length=351

 Score =   214 bits (546),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 102/117 (87%), Positives = 109/117 (93%), Gaps = 1/117 (1%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLI-HEFDRAWPAVY  491
            LDGT RILH  SGTFKYYIK+VPTEYRY+SKEVLPTNQFSV+EY+S I  +FDR WPAVY
Sbjct  234  LDGTTRILHDASGTFKYYIKVVPTEYRYISKEVLPTNQFSVTEYFSPITSQFDRTWPAVY  293

Query  490  FLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNAR  320
            FLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFA+TGMLDRWMYRLVEAVTKP A+
Sbjct  294  FLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFAVTGMLDRWMYRLVEAVTKPKAK  350



>ref|XP_007145973.1| hypothetical protein PHAVU_006G002400g [Phaseolus vulgaris]
 gb|ESW17967.1| hypothetical protein PHAVU_006G002400g [Phaseolus vulgaris]
Length=348

 Score =   214 bits (545),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 108/116 (93%), Gaps = 0/116 (0%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LD T RILH  SGTFKYYIK+VPTEYRY+SKEVLPTNQFSVSEYYS I++FDR WPAVYF
Sbjct  232  LDDTNRILHDTSGTFKYYIKVVPTEYRYISKEVLPTNQFSVSEYYSPINQFDRTWPAVYF  291

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNAR  320
            LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFA+TGMLDRWMYRL+EA+TK  ++
Sbjct  292  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFAVTGMLDRWMYRLIEALTKSKSK  347



>ref|XP_010313686.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Solanum lycopersicum]
Length=350

 Score =   213 bits (543),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 98/120 (82%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDGT RIL   SGTFKYYIK+VPTEYRY+SKEVLPTNQFSV+EY+S IH+F+R WPAVYF
Sbjct  231  LDGTSRILRGTSGTFKYYIKVVPTEYRYISKEVLPTNQFSVTEYFSPIHDFERTWPAVYF  290

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            LYDLSPITVTI+EERRSFLHFITRLCAVLGGTFALTGMLD WMY+++E+VTK N+R+ VR
Sbjct  291  LYDLSPITVTIREERRSFLHFITRLCAVLGGTFALTGMLDGWMYKILESVTKKNSRTIVR  350



>ref|XP_010314961.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Solanum lycopersicum]
Length=350

 Score =   213 bits (543),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 98/120 (82%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDGT RIL   SGTFKYYIK+VPTEYRY+SKEVLPTNQFSV+EY+S IH+F+R WPAVYF
Sbjct  231  LDGTSRILRGTSGTFKYYIKVVPTEYRYISKEVLPTNQFSVTEYFSPIHDFERTWPAVYF  290

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            LYDLSPITVTI+EERRSFLHFITRLCAVLGGTFALTGMLD WMY+++E+VTK N+R+ VR
Sbjct  291  LYDLSPITVTIREERRSFLHFITRLCAVLGGTFALTGMLDGWMYKILESVTKKNSRTIVR  350



>gb|AFK38705.1| unknown [Medicago truncatula]
Length=148

 Score =   207 bits (526),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 100/117 (85%), Positives = 106/117 (91%), Gaps = 1/117 (1%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLI-HEFDRAWPAVY  491
            LD T RILH  SGTFKYYIKIVPTEYRY+SKEVLPTNQFSV+EY+S I  +FDR WPAVY
Sbjct  31   LDETSRILHDASGTFKYYIKIVPTEYRYISKEVLPTNQFSVTEYFSPITSQFDRTWPAVY  90

Query  490  FLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNAR  320
            FLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFA+TGMLDRWMYRLVEA TKP  +
Sbjct  91   FLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFAVTGMLDRWMYRLVEAATKPKNK  147



>gb|KDP30124.1| hypothetical protein JCGZ_18119 [Jatropha curcas]
Length=348

 Score =   213 bits (541),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 100/116 (86%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDGT RILH  SGTFKYYIKIVPTEYRY+SKEVLPTNQFSV+EY+S +  FDR WPAVYF
Sbjct  232  LDGTTRILHDASGTFKYYIKIVPTEYRYISKEVLPTNQFSVTEYFSPMDGFDRTWPAVYF  291

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNAR  320
            LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRL+E +TK N R
Sbjct  292  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLLEVLTKQNTR  347



>ref|XP_003542168.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Glycine max]
 gb|KHN19824.1| Endoplasmic reticulum-Golgi intermediate compartment protein 
3 [Glycine soja]
Length=351

 Score =   212 bits (540),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 108/116 (93%), Gaps = 0/116 (0%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LD T RILH  SGTFKYYIK+VPTEYRY+SKEVLPTNQFSVSEYYS I++FDR WPAVYF
Sbjct  235  LDDTTRILHDTSGTFKYYIKVVPTEYRYISKEVLPTNQFSVSEYYSPINQFDRTWPAVYF  294

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNAR  320
            LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFA+TGMLDRWMYRL+EA+TK  ++
Sbjct  295  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFAVTGMLDRWMYRLLEALTKSKSK  350



>ref|XP_006605681.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X1 [Glycine max]
 ref|XP_006605682.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X2 [Glycine max]
 gb|KHN48838.1| Endoplasmic reticulum-Golgi intermediate compartment protein 
3 [Glycine soja]
Length=347

 Score =   211 bits (536),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LD T RILH  SGTFKYYIK+VPTEYRY+SKEVLPTNQFSVSEYYS I++FDR WPAVYF
Sbjct  231  LDDTTRILHDTSGTFKYYIKVVPTEYRYISKEVLPTNQFSVSEYYSPINQFDRTWPAVYF  290

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNAR  320
            LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFA+TGMLDRWMYRL+E +TK  ++
Sbjct  291  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFAVTGMLDRWMYRLLETLTKSKSK  346



>ref|XP_011010108.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Populus euphratica]
Length=351

 Score =   211 bits (536),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 99/117 (85%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDGT RILH  SGTFKYYIKIVPTEYRY+SK+VL TNQFSV+EY+S I +F+R WPAVYF
Sbjct  232  LDGTARILHETSGTFKYYIKIVPTEYRYISKDVLSTNQFSVTEYFSPITDFERTWPAVYF  291

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARS  317
            LYDLSPITVTIKEERRSFLHFITRLCA+LGGTFALTGMLDRWMYRL+EA+TKPN  S
Sbjct  292  LYDLSPITVTIKEERRSFLHFITRLCAILGGTFALTGMLDRWMYRLLEALTKPNRGS  348



>ref|XP_011008533.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Populus euphratica]
Length=351

 Score =   211 bits (536),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 99/117 (85%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDGT RILH  SGTFKYYIKIVPTEYRY+SK+VL TNQFSV+EY+S I +F+R WPAVYF
Sbjct  232  LDGTARILHETSGTFKYYIKIVPTEYRYISKDVLSTNQFSVTEYFSPITDFERTWPAVYF  291

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARS  317
            LYDLSPITVTIKEERRSFLHFITRLCA+LGGTFALTGMLDRWMYRL+EA+TKPN  S
Sbjct  292  LYDLSPITVTIKEERRSFLHFITRLCAILGGTFALTGMLDRWMYRLLEALTKPNRGS  348



>ref|XP_009408557.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Musa acuminata subsp. malaccensis]
Length=350

 Score =   211 bits (536),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 101/120 (84%), Positives = 108/120 (90%), Gaps = 0/120 (0%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDGT R+LH  SGTFKYYIKIVPTEYRYLSKEVLPTNQFSV+EYY  I   DR+WPAVYF
Sbjct  231  LDGTTRMLHDTSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVTEYYVPIRVTDRSWPAVYF  290

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            LYDLSPITVTIKEERRSFLHF+TRLCAVLGGTFALTGMLDRW YR+VEAVTK  +RS +R
Sbjct  291  LYDLSPITVTIKEERRSFLHFLTRLCAVLGGTFALTGMLDRWTYRIVEAVTKSKSRSVLR  350



>ref|XP_002322569.2| hypothetical protein POPTR_0016s02310g [Populus trichocarpa]
 gb|ABK93267.1| unknown [Populus trichocarpa]
 gb|EEF04330.2| hypothetical protein POPTR_0016s02310g [Populus trichocarpa]
Length=366

 Score =   210 bits (535),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 99/117 (85%), Positives = 107/117 (91%), Gaps = 0/117 (0%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDGT RIL   SG FKYYIKIVPTEYRY+SK+VLPTNQFSV+EY+S I +FDR WPAVYF
Sbjct  247  LDGTARILRETSGIFKYYIKIVPTEYRYISKDVLPTNQFSVTEYFSPITDFDRTWPAVYF  306

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARS  317
            LYDLSPITVTIKEERRSFLHFITRLCA+LGGTFALTGMLDRWMYRL+EA+TKPN  S
Sbjct  307  LYDLSPITVTIKEERRSFLHFITRLCAILGGTFALTGMLDRWMYRLLEALTKPNRGS  363



>gb|KHG20152.1| Endoplasmic reticulum-Golgi intermediate compartment 3 [Gossypium 
arboreum]
Length=181

 Score =   204 bits (519),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/117 (84%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LD T RILH  SGTFKYYIKIVPTEYRY+SKEVLPTNQFSVSEY+S ++EFDR WPAVYF
Sbjct  62   LDDTVRILHDTSGTFKYYIKIVPTEYRYISKEVLPTNQFSVSEYFSPMNEFDRTWPAVYF  121

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARS  317
            LYDLSPITVTIKEERRSFLHF TRL AVLGGTFALTGMLDRWMYRL++A+T  +AR 
Sbjct  122  LYDLSPITVTIKEERRSFLHFTTRLSAVLGGTFALTGMLDRWMYRLIKALTTTSARG  178



>ref|XP_010525179.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X2 [Tarenaya hassleriana]
Length=355

 Score =   210 bits (534),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 101/121 (83%), Positives = 111/121 (92%), Gaps = 1/121 (1%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDGT RILH  SGTFKYYIKIVPTEYRYLSKEVL TNQFSV+EYY  + EFDR WPAVYF
Sbjct  235  LDGTVRILHDTSGTFKYYIKIVPTEYRYLSKEVLSTNQFSVTEYYLPMREFDRTWPAVYF  294

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVT-KPNARSTV  311
            LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWM+RL+E++T KP++RS +
Sbjct  295  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMFRLIESLTRKPSSRSIL  354

Query  310  R  308
            +
Sbjct  355  K  355



>ref|XP_010525178.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X1 [Tarenaya hassleriana]
 ref|XP_010525180.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X1 [Tarenaya hassleriana]
Length=356

 Score =   210 bits (534),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 101/121 (83%), Positives = 111/121 (92%), Gaps = 1/121 (1%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDGT RILH  SGTFKYYIKIVPTEYRYLSKEVL TNQFSV+EYY  + EFDR WPAVYF
Sbjct  236  LDGTVRILHDTSGTFKYYIKIVPTEYRYLSKEVLSTNQFSVTEYYLPMREFDRTWPAVYF  295

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVT-KPNARSTV  311
            LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWM+RL+E++T KP++RS +
Sbjct  296  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMFRLIESLTRKPSSRSIL  355

Query  310  R  308
            +
Sbjct  356  K  356



>ref|XP_010245571.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 isoform X2 [Nelumbo nucifera]
 ref|XP_010245576.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 isoform X2 [Nelumbo nucifera]
Length=349

 Score =   209 bits (533),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 99/120 (83%), Positives = 110/120 (92%), Gaps = 0/120 (0%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDGT RIL   SGTFKYYIKIVPTEYRYLSK+VLPTNQFSV+EY+  ++E+DR WPAVYF
Sbjct  230  LDGTVRILRDTSGTFKYYIKIVPTEYRYLSKDVLPTNQFSVTEYFVPMNEYDRTWPAVYF  289

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRL+E+ TK ++RS +R
Sbjct  290  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLLESFTKSSSRSILR  349



>gb|KJB75348.1| hypothetical protein B456_012G039800 [Gossypium raimondii]
Length=293

 Score =   207 bits (528),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/120 (83%), Positives = 108/120 (90%), Gaps = 0/120 (0%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LD T RILH  SGTFKYYIKIVPTEYRY+SKEVLPTNQFSVSEY+S ++EFDR WPAVYF
Sbjct  174  LDDTVRILHDTSGTFKYYIKIVPTEYRYISKEVLPTNQFSVSEYFSPMNEFDRTWPAVYF  233

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            LYDLSPITVTIKEE RSFLHFITRL AVLGGTFALTGMLDRWMYRL++A+T P+AR   R
Sbjct  234  LYDLSPITVTIKEECRSFLHFITRLSAVLGGTFALTGMLDRWMYRLIKALTTPSARGAYR  293



>ref|XP_006351995.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X1 [Solanum tuberosum]
 ref|XP_006351996.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X2 [Solanum tuberosum]
Length=350

 Score =   209 bits (533),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 96/120 (80%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDGT RIL   SGTFKYYIK+VPTEYRY+SKEV PTNQFSV+EY+S IH+F+R WPAVYF
Sbjct  231  LDGTSRILRGSSGTFKYYIKVVPTEYRYISKEVSPTNQFSVTEYFSPIHDFERTWPAVYF  290

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            LYDLSPITVTI+EERRSFLHFITRLCAVLGGTFALTGMLD WMY+++E+ TK N+R+ VR
Sbjct  291  LYDLSPITVTIREERRSFLHFITRLCAVLGGTFALTGMLDGWMYKILESFTKKNSRTIVR  350



>gb|ACU19028.1| unknown [Glycine max]
Length=347

 Score =   209 bits (532),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 97/116 (84%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LD T RILH  SGTFKYYIK+VPTEYRY+SKEVLPTNQFSVSEYYS I++FDR WPAVYF
Sbjct  231  LDDTTRILHDTSGTFKYYIKVVPTEYRYISKEVLPTNQFSVSEYYSPINQFDRTWPAVYF  290

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNAR  320
            LYDLSPITVTIKEERRSF HFITRLCAVLGGTFA+TGMLDRWMYRL+E +TK  ++
Sbjct  291  LYDLSPITVTIKEERRSFFHFITRLCAVLGGTFAVTGMLDRWMYRLLETLTKSKSK  346



>ref|XP_010923699.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 isoform X1 [Elaeis guineensis]
 ref|XP_010923700.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 isoform X1 [Elaeis guineensis]
Length=351

 Score =   209 bits (532),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 98/120 (82%), Positives = 108/120 (90%), Gaps = 0/120 (0%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDGT RILH  SGTFKYYIKIVPTEYRYLSK VLPTNQFSV+EY+  + E +R+WPAVYF
Sbjct  232  LDGTTRILHDTSGTFKYYIKIVPTEYRYLSKTVLPTNQFSVTEYFIPLREIERSWPAVYF  291

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYR++EA T+  +RS +R
Sbjct  292  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRIIEAATQSKSRSMLR  351



>gb|KJB75345.1| hypothetical protein B456_012G039800 [Gossypium raimondii]
Length=322

 Score =   208 bits (529),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 100/120 (83%), Positives = 108/120 (90%), Gaps = 0/120 (0%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LD T RILH  SGTFKYYIKIVPTEYRY+SKEVLPTNQFSVSEY+S ++EFDR WPAVYF
Sbjct  203  LDDTVRILHDTSGTFKYYIKIVPTEYRYISKEVLPTNQFSVSEYFSPMNEFDRTWPAVYF  262

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            LYDLSPITVTIKEE RSFLHFITRL AVLGGTFALTGMLDRWMYRL++A+T P+AR   R
Sbjct  263  LYDLSPITVTIKEECRSFLHFITRLSAVLGGTFALTGMLDRWMYRLIKALTTPSARGAYR  322



>ref|XP_010923701.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 isoform X2 [Elaeis guineensis]
 ref|XP_010923702.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 isoform X2 [Elaeis guineensis]
Length=350

 Score =   209 bits (532),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 98/120 (82%), Positives = 108/120 (90%), Gaps = 0/120 (0%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDGT RILH  SGTFKYYIKIVPTEYRYLSK VLPTNQFSV+EY+  + E +R+WPAVYF
Sbjct  231  LDGTTRILHDTSGTFKYYIKIVPTEYRYLSKTVLPTNQFSVTEYFIPLREIERSWPAVYF  290

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYR++EA T+  +RS +R
Sbjct  291  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRIIEAATQSKSRSMLR  350



>gb|KEH35189.1| endoplasmic reticulum vesicle transporter [Medicago truncatula]
Length=355

 Score =   209 bits (532),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 100/117 (85%), Positives = 106/117 (91%), Gaps = 1/117 (1%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLI-HEFDRAWPAVY  491
            LD T RILH  SGTFKYYIKIVPTEYRY+SKEVLPTNQFSV+EY+S I  +FDR WPAVY
Sbjct  238  LDETSRILHDASGTFKYYIKIVPTEYRYISKEVLPTNQFSVTEYFSPITSQFDRTWPAVY  297

Query  490  FLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNAR  320
            FLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFA+TGMLDRWMYRLVEA TKP  +
Sbjct  298  FLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFAVTGMLDRWMYRLVEAATKPKNK  354



>emb|CDP16085.1| unnamed protein product [Coffea canephora]
Length=351

 Score =   209 bits (531),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 101/120 (84%), Positives = 108/120 (90%), Gaps = 1/120 (1%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDGT RIL   SGTFKYYIKIVPTEY YLSKEVLPTNQFSV+EY+S ++EFDR WPAVYF
Sbjct  233  LDGTTRILRGTSGTFKYYIKIVPTEYNYLSKEVLPTNQFSVTEYFSPMNEFDRTWPAVYF  292

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            LYDLSPITVTIKEERR+FLHFITRLCAVLGGTFALTGMLDRWMYRL+EA  KP  RS +R
Sbjct  293  LYDLSPITVTIKEERRNFLHFITRLCAVLGGTFALTGMLDRWMYRLLEAFIKPK-RSLLR  351



>gb|KJB75343.1| hypothetical protein B456_012G039800 [Gossypium raimondii]
Length=350

 Score =   208 bits (530),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 100/120 (83%), Positives = 108/120 (90%), Gaps = 0/120 (0%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LD T RILH  SGTFKYYIKIVPTEYRY+SKEVLPTNQFSVSEY+S ++EFDR WPAVYF
Sbjct  231  LDDTVRILHDTSGTFKYYIKIVPTEYRYISKEVLPTNQFSVSEYFSPMNEFDRTWPAVYF  290

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            LYDLSPITVTIKEE RSFLHFITRL AVLGGTFALTGMLDRWMYRL++A+T P+AR   R
Sbjct  291  LYDLSPITVTIKEECRSFLHFITRLSAVLGGTFALTGMLDRWMYRLIKALTTPSARGAYR  350



>ref|XP_010245563.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 isoform X1 [Nelumbo nucifera]
Length=384

 Score =   209 bits (533),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 99/120 (83%), Positives = 110/120 (92%), Gaps = 0/120 (0%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDGT RIL   SGTFKYYIKIVPTEYRYLSK+VLPTNQFSV+EY+  ++E+DR WPAVYF
Sbjct  265  LDGTVRILRDTSGTFKYYIKIVPTEYRYLSKDVLPTNQFSVTEYFVPMNEYDRTWPAVYF  324

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRL+E+ TK ++RS +R
Sbjct  325  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLLESFTKSSSRSILR  384



>ref|XP_006858296.1| hypothetical protein AMTR_s00064p00067290 [Amborella trichopoda]
 gb|ERN19763.1| hypothetical protein AMTR_s00064p00067290 [Amborella trichopoda]
Length=354

 Score =   208 bits (530),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 97/115 (84%), Positives = 107/115 (93%), Gaps = 0/115 (0%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDGT+RIL   SGTFKYYIKIVPTEYRY+ KEVLPTNQFSV+EY+  +HEFDR WPAVYF
Sbjct  234  LDGTKRILRDASGTFKYYIKIVPTEYRYIWKEVLPTNQFSVTEYFVPMHEFDRTWPAVYF  293

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNA  323
            LYDLSPITVTIKEERRSFLHF+TRLCAVLGGTFALTGMLDRWMYRL+EA+TK ++
Sbjct  294  LYDLSPITVTIKEERRSFLHFLTRLCAVLGGTFALTGMLDRWMYRLLEAITKKHS  348



>gb|KJB40581.1| hypothetical protein B456_007G069900 [Gossypium raimondii]
 gb|KJB40582.1| hypothetical protein B456_007G069900 [Gossypium raimondii]
 gb|KJB40583.1| hypothetical protein B456_007G069900 [Gossypium raimondii]
Length=351

 Score =   208 bits (529),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 99/120 (83%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDGT RILH  SGTFKYYIKIVPTEYRY+ KEVLPTNQFS SEY+S + E+DR+WPAVYF
Sbjct  232  LDGTVRILHETSGTFKYYIKIVPTEYRYIWKEVLPTNQFSASEYFSPMKEYDRSWPAVYF  291

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRL+E VTK +     R
Sbjct  292  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLIEEVTKASGTRAYR  351



>ref|XP_008794432.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Phoenix dactylifera]
 ref|XP_008794433.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Phoenix dactylifera]
 ref|XP_008794434.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Phoenix dactylifera]
Length=352

 Score =   207 bits (528),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 98/120 (82%), Positives = 107/120 (89%), Gaps = 0/120 (0%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDGT RILH  SGTFKYYIKIVPTEYRYLSK VLPTNQFSV+EY+  + E +R+WPAVYF
Sbjct  233  LDGTTRILHDTSGTFKYYIKIVPTEYRYLSKAVLPTNQFSVTEYFVPLREIERSWPAVYF  292

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            LYDLSPITVTIKEER SFLHFITRLCAVLGGTFALTGMLDRWMYR++EA TK  +RS +R
Sbjct  293  LYDLSPITVTIKEERPSFLHFITRLCAVLGGTFALTGMLDRWMYRIIEAATKSKSRSILR  352



>ref|XP_010688789.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Beta vulgaris subsp. vulgaris]
 ref|XP_010688790.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Beta vulgaris subsp. vulgaris]
 ref|XP_010688791.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Beta vulgaris subsp. vulgaris]
Length=381

 Score =   208 bits (530),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 96/119 (81%), Positives = 106/119 (89%), Gaps = 0/119 (0%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDGT RIL   SGTFKYYIKIVPTEY+Y+SK+VLPTNQFSV+EY+S + +FDR WPAVYF
Sbjct  263  LDGTVRILRGTSGTFKYYIKIVPTEYKYISKDVLPTNQFSVTEYFSPMKDFDRTWPAVYF  322

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTV  311
            LYDLSPITVTI+EERRSFLHF+TRLCAVLGGTFALTGMLDRWMYRLVE V KP  R  +
Sbjct  323  LYDLSPITVTIREERRSFLHFLTRLCAVLGGTFALTGMLDRWMYRLVEMVMKPTKRGVI  381



>gb|KJB75344.1| hypothetical protein B456_012G039800 [Gossypium raimondii]
Length=388

 Score =   208 bits (530),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 100/120 (83%), Positives = 108/120 (90%), Gaps = 0/120 (0%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LD T RILH  SGTFKYYIKIVPTEYRY+SKEVLPTNQFSVSEY+S ++EFDR WPAVYF
Sbjct  269  LDDTVRILHDTSGTFKYYIKIVPTEYRYISKEVLPTNQFSVSEYFSPMNEFDRTWPAVYF  328

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            LYDLSPITVTIKEE RSFLHFITRL AVLGGTFALTGMLDRWMYRL++A+T P+AR   R
Sbjct  329  LYDLSPITVTIKEECRSFLHFITRLSAVLGGTFALTGMLDRWMYRLIKALTTPSARGAYR  388



>ref|XP_009145393.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Brassica rapa]
 emb|CDY10632.1| BnaA05g17300D [Brassica napus]
Length=350

 Score =   205 bits (522),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 96/118 (81%), Positives = 108/118 (92%), Gaps = 1/118 (1%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDGT RILH  SGTFKYYIKIVPTEYRYLSK++L TNQ+SV+EYY+ ++EFDR WPAVYF
Sbjct  230  LDGTNRILHDTSGTFKYYIKIVPTEYRYLSKDILTTNQYSVTEYYTPMNEFDRTWPAVYF  289

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVT-KPNARS  317
            LYDLSPITVTIKEERRSFLH ITRLCAVLGGTFALTGMLDRWM+R++E+ T KP+ RS
Sbjct  290  LYDLSPITVTIKEERRSFLHLITRLCAVLGGTFALTGMLDRWMFRIIESFTKKPSTRS  347



>ref|XP_008463181.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Cucumis melo]
 ref|XP_008463182.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Cucumis melo]
Length=346

 Score =   204 bits (520),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDGT RILH  SGTFKYYIKIVPTEY+Y+SK+VLPTNQFSV+EY+S + + DR+WPAVYF
Sbjct  229  LDGTVRILHDTSGTFKYYIKIVPTEYKYISKDVLPTNQFSVTEYFSPMTDSDRSWPAVYF  288

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNAR  320
            LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFA+TGMLDRWM+R +EA+TKP  R
Sbjct  289  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFAVTGMLDRWMFRFLEALTKPKRR  344



>ref|XP_002458688.1| hypothetical protein SORBIDRAFT_03g038260 [Sorghum bicolor]
 gb|EES03808.1| hypothetical protein SORBIDRAFT_03g038260 [Sorghum bicolor]
Length=350

 Score =   204 bits (519),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 96/120 (80%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LD T RILH  SGTFKYYIK+VPTEY+YLSK+VLPTNQFSV+EY+  I   DRAWPAVYF
Sbjct  231  LDETSRILHDTSGTFKYYIKVVPTEYKYLSKKVLPTNQFSVTEYFLPIRPSDRAWPAVYF  290

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            LYDLSPITVTIKEERR+FLHFITRLCAVLGGTFA+TGMLDRWMYRL+E+VT    RS +R
Sbjct  291  LYDLSPITVTIKEERRNFLHFITRLCAVLGGTFAMTGMLDRWMYRLIESVTNSKTRSVLR  350



>ref|XP_004155757.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Cucumis sativus]
Length=266

 Score =   200 bits (509),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 94/117 (80%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDGT RIL   SGTFKYYIKIVPTEY+Y+SK VLPTNQFSV+EY+S + + DR+WPAVYF
Sbjct  149  LDGTVRILRDTSGTFKYYIKIVPTEYKYISKAVLPTNQFSVTEYFSPMTDSDRSWPAVYF  208

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARS  317
            LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFA+TGMLDRWM+R +EA+TKP  R+
Sbjct  209  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFAVTGMLDRWMFRFLEALTKPKRRT  265



>ref|XP_003558212.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Brachypodium distachyon]
Length=349

 Score =   202 bits (515),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 94/120 (78%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LD T RILH  SGTFKYYIK+VPTEYRYLSK+VLPTNQFSV+EY+  I   DR+WPAVYF
Sbjct  230  LDDTTRILHDASGTFKYYIKVVPTEYRYLSKQVLPTNQFSVTEYFVPIRPADRSWPAVYF  289

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            LYDLSPITVTIKEERR+FLHFITRLCAVLGGTFA+TGMLDRWMYR++E+V+    RS +R
Sbjct  290  LYDLSPITVTIKEERRNFLHFITRLCAVLGGTFAMTGMLDRWMYRIIESVSSSKPRSVLR  349



>gb|KGN51067.1| hypothetical protein Csa_5G426440 [Cucumis sativus]
Length=346

 Score =   201 bits (511),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 94/117 (80%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDGT RIL   SGTFKYYIKIVPTEY+Y+SK VLPTNQFSV+EY+S + + DR+WPAVYF
Sbjct  229  LDGTVRILRDTSGTFKYYIKIVPTEYKYISKAVLPTNQFSVTEYFSPMTDSDRSWPAVYF  288

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARS  317
            LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFA+TGMLDRWM+R +EA+TKP  R+
Sbjct  289  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFAVTGMLDRWMFRFLEALTKPKRRT  345



>ref|NP_001131002.1| DUF1692 domain, endoplasmic reticulum vescicle transporter protein 
[Zea mays]
 gb|ACF79423.1| unknown [Zea mays]
 gb|AFW84738.1| DUF1692 domain, endoplasmic reticulum vescicle transporter protein 
[Zea mays]
Length=293

 Score =   199 bits (506),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 93/120 (78%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LD T RILH  SGTFKYYIK+VPTEY+YLSK+VLPTNQFSV+EY+  I   DRAWPAVYF
Sbjct  174  LDETSRILHDTSGTFKYYIKVVPTEYKYLSKKVLPTNQFSVTEYFLPIRPTDRAWPAVYF  233

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            LYDLSPITVTIKEERR+FLHF+TRLCAVLGGTFA+TGMLDRWMY+L++ VT    RS +R
Sbjct  234  LYDLSPITVTIKEERRNFLHFVTRLCAVLGGTFAMTGMLDRWMYQLIKTVTNSKTRSVLR  293



>ref|XP_009135799.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Brassica rapa]
 ref|XP_009135800.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Brassica rapa]
 emb|CDX92937.1| BnaA03g36590D [Brassica napus]
Length=353

 Score =   201 bits (510),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 96/118 (81%), Positives = 106/118 (90%), Gaps = 1/118 (1%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LD T RIL   SGTFKYYIKIVPTEYRYLSK+VL TNQ+SV+EYY+ ++EFDR WPAVYF
Sbjct  233  LDDTNRILRDTSGTFKYYIKIVPTEYRYLSKDVLTTNQYSVTEYYTPMNEFDRTWPAVYF  292

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVT-KPNARS  317
            LYDLSPITVTIKEERRSFLH ITRLCAVLGGTFALTGMLDRWM+RL+E+ T KP+ RS
Sbjct  293  LYDLSPITVTIKEERRSFLHLITRLCAVLGGTFALTGMLDRWMFRLIESFTKKPSTRS  350



>ref|XP_006650685.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Oryza brachyantha]
Length=351

 Score =   200 bits (509),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 97/121 (80%), Positives = 106/121 (88%), Gaps = 1/121 (1%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRA-WPAVY  491
            LD T RILH  SGTFKYYIKIVPTEYRYLSK+VLPTNQFSV+EY+      DR+ WPAVY
Sbjct  231  LDDTTRILHDTSGTFKYYIKIVPTEYRYLSKQVLPTNQFSVTEYFVPKRATDRSSWPAVY  290

Query  490  FLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTV  311
            FLYDLSPITVTIKEERR+FLHFITRLCAVLGGTFA+TGMLDRWMYRL+E+VTK   RS +
Sbjct  291  FLYDLSPITVTIKEERRNFLHFITRLCAVLGGTFAMTGMLDRWMYRLIESVTKSKTRSVL  350

Query  310  R  308
            R
Sbjct  351  R  351



>ref|NP_001051473.1| Os03g0784400 [Oryza sativa Japonica Group]
 gb|AAK72889.1|AC091123_8 unknown protein [Oryza sativa Japonica Group]
 gb|ABF99217.1| Serologically defined breast cancer antigen NY-BR-84, putative, 
expressed [Oryza sativa Japonica Group]
 dbj|BAF13387.1| Os03g0784400 [Oryza sativa Japonica Group]
 dbj|BAG96099.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE60050.1| hypothetical protein OsJ_12848 [Oryza sativa Japonica Group]
Length=350

 Score =   200 bits (508),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 97/121 (80%), Positives = 106/121 (88%), Gaps = 1/121 (1%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDR-AWPAVY  491
            LD T RILH  SGTFKYYIKIVPTEYRYLSK+VLPTNQFSV+EY+      DR AWPAVY
Sbjct  230  LDETTRILHDTSGTFKYYIKIVPTEYRYLSKQVLPTNQFSVTEYFVPKRATDRSAWPAVY  289

Query  490  FLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTV  311
            FLYDLSPITVTIKEERR+FLHF+TRLCAVLGGTFA+TGMLDRWMYRL+E+VTK   RS +
Sbjct  290  FLYDLSPITVTIKEERRNFLHFLTRLCAVLGGTFAMTGMLDRWMYRLIESVTKSKTRSVL  349

Query  310  R  308
            R
Sbjct  350  R  350



>ref|XP_008654279.1| PREDICTED: DUF1692 domain, endoplasmic reticulum vescicle transporter 
protein isoform X1 [Zea mays]
 gb|ACF88129.1| unknown [Zea mays]
 gb|ACG25763.1| serologically defined breast cancer antigen NY-BR-84 [Zea mays]
 gb|ACG31724.1| serologically defined breast cancer antigen NY-BR-84 [Zea mays]
 gb|AFW84737.1| DUF1692 domain, endoplasmic reticulum vescicle transporter protein 
[Zea mays]
Length=350

 Score =   200 bits (508),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/120 (78%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LD T RILH  SGTFKYYIK+VPTEY+YLSK+VLPTNQFSV+EY+  I   DRAWPAVYF
Sbjct  231  LDETSRILHDTSGTFKYYIKVVPTEYKYLSKKVLPTNQFSVTEYFLPIRPTDRAWPAVYF  290

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            LYDLSPITVTIKEERR+FLHF+TRLCAVLGGTFA+TGMLDRWMY+L++ VT    RS +R
Sbjct  291  LYDLSPITVTIKEERRNFLHFVTRLCAVLGGTFAMTGMLDRWMYQLIKTVTNSKTRSVLR  350



>gb|EEC76283.1| hypothetical protein OsI_13786 [Oryza sativa Indica Group]
Length=350

 Score =   199 bits (507),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 97/121 (80%), Positives = 106/121 (88%), Gaps = 1/121 (1%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDR-AWPAVY  491
            LD T RILH  SGTFKYYIKIVPTEYRYLSK+VLPTNQFSV+EY+      DR AWPAVY
Sbjct  230  LDETTRILHDTSGTFKYYIKIVPTEYRYLSKQVLPTNQFSVTEYFVPKRATDRSAWPAVY  289

Query  490  FLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTV  311
            FLYDLSPITVTIKEERR+FLHF+TRLCAVLGGTFA+TGMLDRWMYRL+E+VTK   RS +
Sbjct  290  FLYDLSPITVTIKEERRNFLHFLTRLCAVLGGTFAMTGMLDRWMYRLIESVTKSKTRSVL  349

Query  310  R  308
            R
Sbjct  350  R  350



>ref|XP_006406186.1| hypothetical protein EUTSA_v10021173mg [Eutrema salsugineum]
 gb|ESQ47639.1| hypothetical protein EUTSA_v10021173mg [Eutrema salsugineum]
Length=312

 Score =   198 bits (504),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/118 (80%), Positives = 105/118 (89%), Gaps = 1/118 (1%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LD T RIL   SGTFKYYIK+VPTEYRYLSK+VL TNQ+SV+EYY+ ++EFDR WPAVYF
Sbjct  192  LDDTNRILRDTSGTFKYYIKVVPTEYRYLSKDVLSTNQYSVTEYYTPMNEFDRTWPAVYF  251

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVT-KPNARS  317
            LYDLSPITVTIKEERRSFLH ITRLCAVLGGTFALTGMLDRWM+R +E+ T KP+ RS
Sbjct  252  LYDLSPITVTIKEERRSFLHLITRLCAVLGGTFALTGMLDRWMFRFIESFTKKPSTRS  309



>ref|XP_010532527.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Tarenaya hassleriana]
Length=353

 Score =   199 bits (507),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/121 (79%), Positives = 108/121 (89%), Gaps = 1/121 (1%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDGT R+LH  SGTFKYYIKIVPTEY YLSKEVL TNQFSV+EYY  ++EFDR WP VYF
Sbjct  233  LDGTVRMLHDTSGTFKYYIKIVPTEYGYLSKEVLSTNQFSVTEYYLPMNEFDRTWPGVYF  292

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK-PNARSTV  311
            LYDLSPITV IKEERRSFLHF+TRLCAVLGGTFALTGMLDRWM+RL+E++TK P++ S +
Sbjct  293  LYDLSPITVAIKEERRSFLHFLTRLCAVLGGTFALTGMLDRWMFRLLESITKRPSSGSRL  352

Query  310  R  308
            +
Sbjct  353  K  353



>ref|XP_006406187.1| hypothetical protein EUTSA_v10021173mg [Eutrema salsugineum]
 gb|ESQ47640.1| hypothetical protein EUTSA_v10021173mg [Eutrema salsugineum]
Length=313

 Score =   198 bits (504),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/118 (80%), Positives = 105/118 (89%), Gaps = 1/118 (1%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LD T RIL   SGTFKYYIK+VPTEYRYLSK+VL TNQ+SV+EYY+ ++EFDR WPAVYF
Sbjct  193  LDDTNRILRDTSGTFKYYIKVVPTEYRYLSKDVLSTNQYSVTEYYTPMNEFDRTWPAVYF  252

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVT-KPNARS  317
            LYDLSPITVTIKEERRSFLH ITRLCAVLGGTFALTGMLDRWM+R +E+ T KP+ RS
Sbjct  253  LYDLSPITVTIKEERRSFLHLITRLCAVLGGTFALTGMLDRWMFRFIESFTKKPSTRS  310



>emb|CDY24301.1| BnaC03g42740D [Brassica napus]
Length=353

 Score =   199 bits (507),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/118 (81%), Positives = 106/118 (90%), Gaps = 1/118 (1%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LD T RIL   SGTFKYYIKIVPTEYRYLSK+VL TNQ+SV+EYY+ ++EFDR WPAVYF
Sbjct  233  LDDTNRILRDTSGTFKYYIKIVPTEYRYLSKDVLTTNQYSVTEYYTPMNEFDRTWPAVYF  292

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVT-KPNARS  317
            LYDLSPITVTI+EERRSFLH ITRLCAVLGGTFALTGMLDRWM+RL+E+ T KP+ RS
Sbjct  293  LYDLSPITVTIREERRSFLHLITRLCAVLGGTFALTGMLDRWMFRLIESFTKKPSTRS  350



>ref|XP_004982677.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Setaria italica]
Length=350

 Score =   199 bits (506),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/120 (78%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LD T R+LH  SGTFKYYIK+VPTEYRYLSK+VL TNQFSV+EY+  I   DRAWPAVYF
Sbjct  231  LDETSRVLHDTSGTFKYYIKVVPTEYRYLSKKVLLTNQFSVTEYFLPIRPTDRAWPAVYF  290

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            LYDLSPITVTIKEERR+FLHF+TRLCAVLGGTFA+TGMLDRWMYRL+E+VT    RS +R
Sbjct  291  LYDLSPITVTIKEERRNFLHFLTRLCAVLGGTFAMTGMLDRWMYRLIESVTNSKTRSVLR  350



>ref|XP_002883352.1| hypothetical protein ARALYDRAFT_479742 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59611.1| hypothetical protein ARALYDRAFT_479742 [Arabidopsis lyrata subsp. 
lyrata]
Length=354

 Score =   199 bits (506),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/115 (81%), Positives = 103/115 (90%), Gaps = 0/115 (0%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LD T RILH  SGTFKYYIKIVPTEYRYLSK+VL TNQ+SV+EYY+ + EFDR WPAVYF
Sbjct  237  LDDTNRILHDTSGTFKYYIKIVPTEYRYLSKDVLSTNQYSVTEYYTPMTEFDRTWPAVYF  296

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNA  323
            LYDLSPITVTIKEERRSFLH ITRLCAVLGGTFALTGMLDRWM+RL+E+  K ++
Sbjct  297  LYDLSPITVTIKEERRSFLHLITRLCAVLGGTFALTGMLDRWMFRLIESFNKKSS  351



>emb|CDY37404.1| BnaC05g30260D [Brassica napus]
Length=350

 Score =   199 bits (506),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 93/118 (79%), Positives = 106/118 (90%), Gaps = 1/118 (1%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDGT RILH  SGTFKYYIKIVPTEYRYLSK++L TNQ+S++EYY+ ++ FDR WPAVYF
Sbjct  230  LDGTNRILHDTSGTFKYYIKIVPTEYRYLSKDILTTNQYSLTEYYTPMNAFDRTWPAVYF  289

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVT-KPNARS  317
            LYDLSPITVTIKEERRSF+H ITRLCAVLGGTFALTGMLDRWM+R++E  T KP+ RS
Sbjct  290  LYDLSPITVTIKEERRSFVHLITRLCAVLGGTFALTGMLDRWMFRMIEYFTKKPSTRS  347



>gb|EPS71314.1| hypothetical protein M569_03444, partial [Genlisea aurea]
Length=357

 Score =   199 bits (506),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 93/120 (78%), Positives = 107/120 (89%), Gaps = 0/120 (0%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LD T RILH  SGTFKYYIKIVPTEY+Y+SKEVLPTNQFSV+EY+S + +  R+WPAV+F
Sbjct  238  LDDTVRILHETSGTFKYYIKIVPTEYKYISKEVLPTNQFSVTEYFSPMDKDSRSWPAVFF  297

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            LYDLSPITVTI+EERRSF HFITRLCAVLGGTFALTGMLD+WM+RL+ A+TKP   S+VR
Sbjct  298  LYDLSPITVTIREERRSFRHFITRLCAVLGGTFALTGMLDKWMHRLIGAMTKPRTGSSVR  357



>dbj|BAJ84787.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ85349.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=348

 Score =   199 bits (505),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 92/120 (77%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LD T RILH  SGTFKYYIK+VPTEYRYLSK VLPTNQFSV+EY+  I   DR+WPAVYF
Sbjct  229  LDDTSRILHDTSGTFKYYIKVVPTEYRYLSKGVLPTNQFSVTEYFVPIRPTDRSWPAVYF  288

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            LYDLSPITVTI+EERR+FLHFITRLCAVLGGTFA+TGMLDRWMYR++E+++    RS +R
Sbjct  289  LYDLSPITVTIREERRNFLHFITRLCAVLGGTFAMTGMLDRWMYRIIESISSSKPRSGMR  348



>ref|XP_009407709.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Musa acuminata subsp. malaccensis]
Length=352

 Score =   199 bits (505),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 95/120 (79%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDGT RILH  SGTFKYYIKIVPTEYRYLS  V+PTNQFSV+EY+      DR+WPAVYF
Sbjct  233  LDGTTRILHDTSGTFKYYIKIVPTEYRYLSHRVMPTNQFSVTEYFVPTRAIDRSWPAVYF  292

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            LYDLSPI VTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYR++EA TK    S  R
Sbjct  293  LYDLSPIIVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRIIEAFTKSKTGSIFR  352



>ref|XP_004140296.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Cucumis sativus]
Length=388

 Score =   199 bits (507),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 94/117 (80%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDGT RIL   SGTFKYYIKIVPTEY+Y+SK VLPTNQFSV+EY+S + + DR+WPAVYF
Sbjct  271  LDGTVRILRDTSGTFKYYIKIVPTEYKYISKAVLPTNQFSVTEYFSPMTDSDRSWPAVYF  330

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARS  317
            LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFA+TGMLDRWM+R +EA+TKP  R+
Sbjct  331  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFAVTGMLDRWMFRFLEALTKPKRRT  387



>ref|XP_010466507.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Camelina sativa]
 ref|XP_010466508.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Camelina sativa]
Length=358

 Score =   198 bits (504),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 94/118 (80%), Positives = 104/118 (88%), Gaps = 1/118 (1%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LD T R+LH  SGTFKYYIKIVPTEYRYLSK+VL TNQ+SV+EYY+ + EFDR WPAVYF
Sbjct  239  LDDTNRMLHDTSGTFKYYIKIVPTEYRYLSKDVLSTNQYSVTEYYTPMTEFDRTWPAVYF  298

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK-PNARS  317
            LYDLSPITVTIKEERRSFLH ITRLCAVLGGTFALTGMLDRWM+R +E+  K P+ RS
Sbjct  299  LYDLSPITVTIKEERRSFLHLITRLCAVLGGTFALTGMLDRWMFRFIESFNKNPSTRS  356



>gb|EMT22267.1| hypothetical protein F775_30192 [Aegilops tauschii]
Length=393

 Score =   199 bits (506),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 92/120 (77%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LD T RILH  SGTFKYYIK+VPTEYRYLSK VLPTNQFSV+EY+  I   DR+WPAVYF
Sbjct  229  LDDTSRILHDTSGTFKYYIKVVPTEYRYLSKGVLPTNQFSVTEYFVPIRPTDRSWPAVYF  288

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            LYDLSPITVTI+EERR+FLHFITRLCAVLGGTFA+TGMLDRWMYR++E+++    RS +R
Sbjct  289  LYDLSPITVTIREERRNFLHFITRLCAVLGGTFAMTGMLDRWMYRIIESISSSKPRSGMR  348



>ref|XP_006298011.1| hypothetical protein CARUB_v10014056mg [Capsella rubella]
 ref|XP_006298012.1| hypothetical protein CARUB_v10014056mg [Capsella rubella]
 gb|EOA30909.1| hypothetical protein CARUB_v10014056mg [Capsella rubella]
 gb|EOA30910.1| hypothetical protein CARUB_v10014056mg [Capsella rubella]
Length=356

 Score =   198 bits (503),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 94/118 (80%), Positives = 104/118 (88%), Gaps = 1/118 (1%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LD T R+LH  SGTFKYYIKIVPTEYRYLSK+VL TNQ+SV+EYY+ + +FDR WPAVYF
Sbjct  237  LDDTNRMLHETSGTFKYYIKIVPTEYRYLSKDVLSTNQYSVTEYYTPMTDFDRTWPAVYF  296

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK-PNARS  317
            LYDLSPITVTIKEERRSFLH ITRLCAVLGGTFALTGMLDRWM+RL+E+  K  N RS
Sbjct  297  LYDLSPITVTIKEERRSFLHLITRLCAVLGGTFALTGMLDRWMFRLIESFNKNTNTRS  354



>ref|XP_010511216.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Camelina sativa]
 ref|XP_010511224.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Camelina sativa]
 ref|XP_010488250.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Camelina sativa]
 ref|XP_010488252.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Camelina sativa]
Length=358

 Score =   197 bits (502),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/118 (79%), Positives = 104/118 (88%), Gaps = 1/118 (1%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LD T R+LH  SGTFKYYIKIVPTEY+YLSK+VL TNQ+SV+EYY+ + EFDR WPAVYF
Sbjct  239  LDDTNRMLHDTSGTFKYYIKIVPTEYKYLSKDVLSTNQYSVTEYYTPMTEFDRTWPAVYF  298

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK-PNARS  317
            LYDLSPITVTIKEERRSFLH ITRLCAVLGGTFALTGMLDRWM+R +E+  K P+ RS
Sbjct  299  LYDLSPITVTIKEERRSFLHLITRLCAVLGGTFALTGMLDRWMFRFIESFNKNPSTRS  356



>gb|KJB75346.1| hypothetical protein B456_012G039800 [Gossypium raimondii]
Length=347

 Score =   197 bits (500),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 97/120 (81%), Positives = 105/120 (88%), Gaps = 3/120 (3%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LD T RILH  SGTFKYYIKIVPTEYRY+SKEVLPTNQFSVSEY+S ++EFDR WPAVYF
Sbjct  231  LDDTVRILHDTSGTFKYYIKIVPTEYRYISKEVLPTNQFSVSEYFSPMNEFDRTWPAVYF  290

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            LYDLSPITVTIKEE RSFLHFITRL AVLGGTFALT   DRWMYRL++A+T P+AR   R
Sbjct  291  LYDLSPITVTIKEECRSFLHFITRLSAVLGGTFALT---DRWMYRLIKALTTPSARGAYR  347



>ref|NP_188868.2| Endoplasmic reticulum vesicle transporter protein [Arabidopsis 
thaliana]
 gb|AAK43988.1|AF370173_1 unknown protein [Arabidopsis thaliana]
 dbj|BAD43192.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43746.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43970.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD44059.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD94071.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE76618.1| Endoplasmic reticulum vesicle transporter protein [Arabidopsis 
thaliana]
Length=354

 Score =   197 bits (500),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/118 (79%), Positives = 104/118 (88%), Gaps = 1/118 (1%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LD T RILH  SGTFKYYIKIVPTEYRYLSK+VL TNQ+SV+EY++ + EFDR WPAVYF
Sbjct  237  LDDTNRILHDTSGTFKYYIKIVPTEYRYLSKDVLSTNQYSVTEYFTPMTEFDRTWPAVYF  296

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVT-KPNARS  317
            LYDLSPITVTIKEERRSFLH ITRLCAVLGGTFALTGMLDRWM+R +E+   KP+ R+
Sbjct  297  LYDLSPITVTIKEERRSFLHLITRLCAVLGGTFALTGMLDRWMFRFIESFNKKPSTRA  354



>gb|KJB75349.1| hypothetical protein B456_012G039800 [Gossypium raimondii]
Length=406

 Score =   197 bits (501),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 100/138 (72%), Positives = 108/138 (78%), Gaps = 18/138 (13%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIK------------------IVPTEYRYLSKEVLPTNQFSVS  542
            LD T RILH  SGTFKYYIK                  IVPTEYRY+SKEVLPTNQFSVS
Sbjct  269  LDDTVRILHDTSGTFKYYIKRASIKLLRRLHSNIGCLQIVPTEYRYISKEVLPTNQFSVS  328

Query  541  EYYSLIHEFDRAWPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRW  362
            EY+S ++EFDR WPAVYFLYDLSPITVTIKEE RSFLHFITRL AVLGGTFALTGMLDRW
Sbjct  329  EYFSPMNEFDRTWPAVYFLYDLSPITVTIKEECRSFLHFITRLSAVLGGTFALTGMLDRW  388

Query  361  MYRLVEAVTKPNARSTVR  308
            MYRL++A+T P+AR   R
Sbjct  389  MYRLIKALTTPSARGAYR  406



>gb|KJB75347.1| hypothetical protein B456_012G039800 [Gossypium raimondii]
Length=385

 Score =   196 bits (499),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 97/120 (81%), Positives = 105/120 (88%), Gaps = 3/120 (3%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LD T RILH  SGTFKYYIKIVPTEYRY+SKEVLPTNQFSVSEY+S ++EFDR WPAVYF
Sbjct  269  LDDTVRILHDTSGTFKYYIKIVPTEYRYISKEVLPTNQFSVSEYFSPMNEFDRTWPAVYF  328

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            LYDLSPITVTIKEE RSFLHFITRL AVLGGTFALT   DRWMYRL++A+T P+AR   R
Sbjct  329  LYDLSPITVTIKEECRSFLHFITRLSAVLGGTFALT---DRWMYRLIKALTTPSARGAYR  385



>gb|EMS49840.1| hypothetical protein TRIUR3_11686 [Triticum urartu]
Length=532

 Score =   199 bits (506),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 92/120 (77%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LD T RILH  SGTFKYYIK+VPTEYRYLSK VLPTNQFSV+EY+  I   DR+WPAVYF
Sbjct  229  LDDTSRILHDTSGTFKYYIKVVPTEYRYLSKGVLPTNQFSVTEYFVPIRPTDRSWPAVYF  288

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            LYDLSPITVTI+EERR+FLHFITRLCAVLGGTFA+TGMLDRWMYR++E+++    RS +R
Sbjct  289  LYDLSPITVTIREERRNFLHFITRLCAVLGGTFAMTGMLDRWMYRIIESISSSKPRSGMR  348



>ref|XP_008348329.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like, partial [Malus domestica]
Length=259

 Score =   180 bits (456),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 85/98 (87%), Positives = 93/98 (95%), Gaps = 0/98 (0%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDGT+RILH  SGTFKYYIKIVPTEYRY+SKEVL TNQFSV+EY+S + +FDR+WPAVYF
Sbjct  152  LDGTDRILHDTSGTFKYYIKIVPTEYRYISKEVLSTNQFSVTEYFSPMKQFDRSWPAVYF  211

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGM  374
            LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTG+
Sbjct  212  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGL  249



>ref|XP_001754824.1| predicted protein [Physcomitrella patens]
 gb|EDQ80278.1| predicted protein [Physcomitrella patens]
Length=347

 Score =   174 bits (441),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 94/110 (85%), Gaps = 0/110 (0%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDG+ERILH  SGTFKY++KIVPTEY YL  EV+PTNQFSV+EYY      DR++PAVYF
Sbjct  229  LDGSERILHDTSGTFKYFLKIVPTEYHYLHGEVMPTNQFSVTEYYQRTKPSDRSYPAVYF  288

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAV  338
            +YDLSPI VTI+E RR+F HFITRLCAVLGGTFA+TGMLDRWM R+++ V
Sbjct  289  VYDLSPIVVTIREHRRNFGHFITRLCAVLGGTFAVTGMLDRWMSRIIDFV  338



>dbj|BAB17274.1| unnamed protein product [Arabidopsis thaliana]
Length=333

 Score =   172 bits (436),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 82/97 (85%), Positives = 88/97 (91%), Gaps = 0/97 (0%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LD T RILH  SGTFKYYIKIVPTEYRYLSK+VL TNQ+SV+EY++ + EFDR WPAVYF
Sbjct  237  LDDTNRILHDTSGTFKYYIKIVPTEYRYLSKDVLSTNQYSVTEYFTPMTEFDRTWPAVYF  296

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTG  377
            LYDLSPITVTIKEERRSFLH ITRLCAVLGGTFALTG
Sbjct  297  LYDLSPITVTIKEERRSFLHLITRLCAVLGGTFALTG  333



>ref|XP_002993277.1| hypothetical protein SELMODRAFT_431378 [Selaginella moellendorffii]
 ref|XP_002994225.1| hypothetical protein SELMODRAFT_236933 [Selaginella moellendorffii]
 gb|EFJ04730.1| hypothetical protein SELMODRAFT_236933 [Selaginella moellendorffii]
 gb|EFJ05698.1| hypothetical protein SELMODRAFT_431378 [Selaginella moellendorffii]
Length=333

 Score =   170 bits (431),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 80/115 (70%), Positives = 93/115 (81%), Gaps = 0/115 (0%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LD T RIL   +GTFKY+IKIVPTEYRYL+   LPTNQFSV EYY    + D +WPAVYF
Sbjct  216  LDRTVRILRDTAGTFKYFIKIVPTEYRYLNGGKLPTNQFSVGEYYLAARDDDISWPAVYF  275

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNA  323
            LYDLSPITV IKEERRSF H +TR CA++GGTF+LTGMLDRW+YRLVE++T+   
Sbjct  276  LYDLSPITVLIKEERRSFGHLLTRFCAIVGGTFSLTGMLDRWIYRLVESITRAKG  330



>ref|XP_005651581.1| DUF1692-domain-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE27037.1| DUF1692-domain-containing protein [Coccomyxa subellipsoidea C-169]
Length=327

 Score =   137 bits (345),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 60/110 (55%), Positives = 85/110 (77%), Gaps = 0/110 (0%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDG ERIL   SGTFKY++K+VPTEY++ +     TNQ+SV+EY +++H+ +   P+V+F
Sbjct  213  LDGAERILDKESGTFKYFLKVVPTEYQWSAGTRTTTNQYSVTEYDTVVHKGEMQMPSVWF  272

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAV  338
             YD+SPI+VTI E R+SF H + R CAV+GG FA+TGM DRW++R+V A+
Sbjct  273  SYDISPISVTISEIRKSFAHLLVRFCAVVGGVFAVTGMFDRWVHRIVTAI  322



>tpg|DAA57059.1| TPA: hypothetical protein ZEAMMB73_408305, partial [Zea mays]
Length=75

 Score =   128 bits (322),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 60/73 (82%), Positives = 65/73 (89%), Gaps = 0/73 (0%)
 Frame = -3

Query  526  IHEFDRAWPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLV  347
            I   +RAWPAVYFLYDLSPITVTIKEERR+FLHFITRLCAVLGGTFA+TGMLDRWMYRLV
Sbjct  3    IRPTERAWPAVYFLYDLSPITVTIKEERRNFLHFITRLCAVLGGTFAMTGMLDRWMYRLV  62

Query  346  EAVTKPNARSTVR  308
            E+VT    RS +R
Sbjct  63   ESVTNSKTRSVLR  75



>gb|AFW82389.1| putative DUF1692 domain containing protein [Zea mays]
Length=1061

 Score =   140 bits (354),  Expect = 3e-34, Method: Composition-based stats.
 Identities = 62/79 (78%), Positives = 72/79 (91%), Gaps = 0/79 (0%)
 Frame = -3

Query  613  IKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYFLYDLSPITVTIKEERRSF  434
            +K+VPTEY+YLSK++LPTNQ SV+EY+  I   +RAWPAVYFLYDLSPIT TIKEERR+F
Sbjct  501  LKVVPTEYKYLSKKILPTNQGSVTEYFLSIRPTERAWPAVYFLYDLSPITFTIKEERRNF  560

Query  433  LHFITRLCAVLGGTFALTG  377
            LHFITRLCAVLGGTFA+TG
Sbjct  561  LHFITRLCAVLGGTFAMTG  579



>gb|AFW85973.1| putative DUF1692 domain containing protein [Zea mays]
Length=1070

 Score =   140 bits (354),  Expect = 3e-34, Method: Composition-based stats.
 Identities = 62/79 (78%), Positives = 72/79 (91%), Gaps = 0/79 (0%)
 Frame = -3

Query  613  IKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYFLYDLSPITVTIKEERRSF  434
            +K+VPTEY+YLSK++LPTNQ SV+EY+  I   +RAWPAVYFLYDLSPIT TIKEERR+F
Sbjct  515  LKVVPTEYKYLSKKILPTNQGSVTEYFLSIRPTERAWPAVYFLYDLSPITFTIKEERRNF  574

Query  433  LHFITRLCAVLGGTFALTG  377
            LHFITRLCAVLGGTFA+TG
Sbjct  575  LHFITRLCAVLGGTFAMTG  593



>gb|AFW83755.1| hypothetical protein ZEAMMB73_317062 [Zea mays]
Length=1594

 Score =   140 bits (354),  Expect = 5e-34, Method: Composition-based stats.
 Identities = 62/79 (78%), Positives = 72/79 (91%), Gaps = 0/79 (0%)
 Frame = -3

Query  613  IKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYFLYDLSPITVTIKEERRSF  434
            +K+VPTEY+YLSK++LPTNQ SV+EY+  I   +RAWPAVYFLYDLSPIT TIKEERR+F
Sbjct  515  LKVVPTEYKYLSKKILPTNQGSVTEYFLSIRPTERAWPAVYFLYDLSPITFTIKEERRNF  574

Query  433  LHFITRLCAVLGGTFALTG  377
            LHFITRLCAVLGGTFA+TG
Sbjct  575  LHFITRLCAVLGGTFAMTG  593



>ref|XP_005839166.1| hypothetical protein GUITHDRAFT_65491 [Guillardia theta CCMP2712]
 gb|EKX52186.1| hypothetical protein GUITHDRAFT_65491 [Guillardia theta CCMP2712]
Length=425

 Score =   110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 48/104 (46%), Positives = 68/104 (65%), Gaps = 0/104 (0%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDG  RI    S  ++Y++K+VPT+Y+Y +  +L TNQFS +E    +  F R  P V+F
Sbjct  311  LDGVVRICEFRSAMYQYFVKVVPTQYQYRNGTILSTNQFSTTENTRQLEGFTRGLPGVFF  370

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMY  356
             YDLSPI  T+ E   SFLHF+T LCA++GG F + G++D  +Y
Sbjct  371  FYDLSPIKATLAERNNSFLHFLTGLCAIIGGVFTVMGIIDSTIY  414



>ref|XP_005826990.1| hypothetical protein GUITHDRAFT_154283 [Guillardia theta CCMP2712]
 gb|EKX40010.1| hypothetical protein GUITHDRAFT_154283 [Guillardia theta CCMP2712]
Length=331

 Score =   109 bits (272),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 74/99 (75%), Gaps = 3/99 (3%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDG  ++L  GSGTF+YYIKIVPT++ +L   ++ TNQ+SV++++  + +    +PAVYF
Sbjct  212  LDGEMKVLDQGSGTFEYYIKIVPTKFHHLDGTIIDTNQYSVTDHFRKLQD---GFPAVYF  268

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGML  371
            +YD+SPI V +K+ ++SF H+ T+LCA+ GG + +TG L
Sbjct  269  IYDISPIMVRVKQWKQSFSHYATQLCAITGGMYVVTGQL  307



>ref|XP_004355625.1| endoplasmic reticulum-golgi intermediate compartment protein 
3 [Dictyostelium fasciculatum]
 gb|EGG17141.1| endoplasmic reticulum-golgi intermediate compartment protein 
3 [Dictyostelium fasciculatum]
Length=335

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/115 (43%), Positives = 75/115 (65%), Gaps = 3/115 (3%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDR---AWPA  497
            LDG  +    GSG F+YYIK+VPT Y  L+   + TNQFSV+E+Y L+ + D      P 
Sbjct  213  LDGVTKTEMVGSGMFQYYIKVVPTLYEGLNGNRISTNQFSVTEHYRLLAKKDEEPSGLPG  272

Query  496  VYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            ++F+YDLSPI + + E+ +SF  F+T +CA++GG F + G+LD  +Y+  + + K
Sbjct  273  LFFMYDLSPIMMKVSEQGKSFASFLTSVCAIVGGVFTVAGILDSMIYKTTKNLKK  327



>ref|XP_002285801.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Vitis vinifera]
 ref|XP_010664314.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Vitis vinifera]
 emb|CBI19141.3| unnamed protein product [Vitis vinifera]
Length=386

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 77/114 (68%), Gaps = 3/114 (3%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDR--AWPAV  494
            LDG + I    SG ++Y+IK+VPT Y ++S   + TNQFSV+E++    E  R  + P V
Sbjct  266  LDGVQWIQATPSGMYQYFIKVVPTVYTHVSGHTISTNQFSVTEHFRNA-ELGRLQSLPGV  324

Query  493  YFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            +F YDLSPI VT  EE  SFLHF+T +CA++GG F ++G+LD ++Y   +A+ K
Sbjct  325  FFFYDLSPIKVTFTEEHVSFLHFLTNVCAIVGGVFTVSGILDSFIYHSQKAIKK  378



>gb|EMS52396.1| hypothetical protein TRIUR3_27593 [Triticum urartu]
Length=407

 Score =   107 bits (267),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 51/114 (45%), Positives = 79/114 (69%), Gaps = 3/114 (3%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDR--AWPAV  494
            LDG + I H+  G  +Y++K+VPT Y +L+++++ +NQFSV+E+ S   +  R  A P V
Sbjct  287  LDGAQWIQHSSYGMAQYFVKVVPTVYSHLNEQIILSNQFSVTEH-SRSGDSGRVQALPGV  345

Query  493  YFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            +F YDLSPI VT  E   SFLHF+T +CA++GG F ++G++D ++Y    A+TK
Sbjct  346  FFFYDLSPIKVTFTERHVSFLHFLTNVCAIVGGVFTVSGIIDSFVYHGQRAITK  399



>dbj|GAM20914.1| hypothetical protein SAMD00019534_040890 [Acytostelium subglobosum 
LB1]
Length=376

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 75/112 (67%), Gaps = 3/112 (3%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDR---AWPA  497
            LDG  +   AG+G F+YYIK+VPT Y  +S  V+ TNQ+SV+E+Y L+ +        P 
Sbjct  254  LDGVTKTEIAGTGMFQYYIKVVPTTYEGISGHVIATNQYSVTEHYRLLGKQGEELSGLPG  313

Query  496  VYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEA  341
            ++F+YDLSPI + + E  RSF  F+TR+CA++GG F + G+ D ++Y+  ++
Sbjct  314  LFFMYDLSPIMMRVVETSRSFATFLTRVCAIIGGVFTVAGIFDSFIYQTTKS  365



>dbj|BAK05850.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=391

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/114 (44%), Positives = 79/114 (69%), Gaps = 3/114 (3%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDR--AWPAV  494
            LDG + I H+  G  +Y++K+VPT Y +++++++ +NQFSV+E+ S   +  R  A P V
Sbjct  271  LDGAQWIQHSSYGMAQYFVKVVPTVYSHINEQIILSNQFSVTEH-SRSGDSGRVQALPGV  329

Query  493  YFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            +F YDLSPI VT  E   SFLHF+T +CA++GG F ++G++D ++Y    A+TK
Sbjct  330  FFFYDLSPIKVTFTERHVSFLHFLTNVCAIVGGVFTVSGIIDSFVYHGQRAITK  383



>ref|XP_009578622.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3, partial [Fulmarus glacialis]
Length=159

 Score =   102 bits (254),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 72/114 (63%), Gaps = 2/114 (2%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRAWPAV  494
            LDGT+      S  F+Y++K+VPT Y  +  EV+ TNQFSV+ +  + +    D+  P V
Sbjct  38   LDGTDVTAQQASMMFQYFVKVVPTVYMKVDGEVVRTNQFSVTRHEKIANGLLGDQGLPGV  97

Query  493  YFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            + LY+LSP+ V + E+ RSF HF+T +CA++GG F + G++D  +Y    A+ K
Sbjct  98   FVLYELSPMMVKLTEKHRSFTHFLTGVCAIVGGIFTVAGLIDSLIYHSARAIQK  151



>ref|XP_010239982.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X2 [Brachypodium distachyon]
Length=297

 Score =   105 bits (261),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 76/113 (67%), Gaps = 1/113 (1%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFD-RAWPAVY  491
            LDG     H+  G ++Y++K+VPT Y +++++++ +NQFSV+E+         +A P V+
Sbjct  177  LDGAHWFQHSPYGMYQYFVKVVPTVYSHINEQIILSNQFSVTEHARSSESVRMQALPGVF  236

Query  490  FLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            F YDLSPI VT  E   SFLHF+T +CA++GG F ++G++D ++Y    A+TK
Sbjct  237  FFYDLSPIKVTFTERHVSFLHFLTNVCAIVGGVFTVSGIIDSFVYHGQRAITK  289



>dbj|BAJ87561.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ99855.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93512.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=383

 Score =   105 bits (262),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 72/112 (64%), Gaps = 0/112 (0%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDG +    A  GT++Y+IK+VPT Y  +    + +NQFSV+E++   +   R  P V+F
Sbjct  264  LDGAQWTQPASDGTYQYFIKVVPTIYNDIRGRKIDSNQFSVTEHFRDGNVQPRPQPGVFF  323

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             YD SPI V   EE RSFLH++T LCA++GG F + G++D ++Y   +A+ K
Sbjct  324  FYDFSPIKVIFTEENRSFLHYLTNLCAIVGGIFTVAGIIDSFIYHGQKALKK  375



>gb|EEE61111.1| hypothetical protein OsJ_15023 [Oryza sativa Japonica Group]
Length=369

 Score =   105 bits (261),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 77/113 (68%), Gaps = 1/113 (1%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFD-RAWPAVY  491
            LDG + + H+  G ++Y+IK+VPT Y  +++ ++ +NQFSV+E++        +A P V+
Sbjct  249  LDGAQWMQHSSYGMYQYFIKVVPTVYTDINEHIILSNQFSVTEHFRSSESGRIQAVPGVF  308

Query  490  FLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            F YDLSPI VT  E+  SFLHF+T +CA++GG F ++G++D ++Y    A+ K
Sbjct  309  FFYDLSPIKVTFTEQHVSFLHFLTNVCAIVGGVFTVSGIIDSFVYHGQRAIKK  361



>ref|XP_003568216.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Brachypodium distachyon]
Length=384

 Score =   105 bits (261),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 72/112 (64%), Gaps = 0/112 (0%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDG +    A  GT++Y+IK+VPT Y       + +NQFSV+E++   +   R  P V+F
Sbjct  265  LDGAQWTQPASDGTYQYFIKVVPTNYTDTRGRKIDSNQFSVTEHFRDGNVHPRPQPGVFF  324

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             YD SPI V   EE +SFLH++T LCA++GG F ++G++D ++Y   +A+ K
Sbjct  325  FYDFSPIKVIFTEENKSFLHYLTNLCAIVGGIFTVSGIIDSFIYHGQKALKK  376



>ref|NP_001148795.1| LOC100282412 [Zea mays]
 gb|ACF82571.1| unknown [Zea mays]
 gb|ACG32935.1| serologically defined breast cancer antigen NY-BR-84 [Zea mays]
 tpg|DAA37500.1| TPA: DUF1692 domain, endoplasmic reticulum vescicle transporter 
protein [Zea mays]
Length=386

 Score =   105 bits (261),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 77/113 (68%), Gaps = 1/113 (1%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYY-SLIHEFDRAWPAVY  491
            LDG   + H+  G ++Y+IK+VPT Y  +++ ++ +NQFSV+E++ S      +A P V+
Sbjct  266  LDGANWVQHSSYGMYQYFIKVVPTVYTDINEHIILSNQFSVTEHFRSGESGRMQALPGVF  325

Query  490  FLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            F YDLSPI VT  E+  SFLHF+T +CA++GG F ++G++D ++Y    A+ K
Sbjct  326  FFYDLSPIKVTFTEQHVSFLHFLTNVCAIVGGVFTVSGIIDSFVYHSQRAIKK  378



>ref|XP_005232398.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like, partial [Falco peregrinus]
Length=300

 Score =   104 bits (259),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 73/114 (64%), Gaps = 2/114 (2%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRAWPAV  494
            LDGT+   H  S  F+Y++K+VPT Y  +  EV+ TNQFSV+ +  + +    D+  P V
Sbjct  179  LDGTDVTAHQASMMFQYFVKVVPTVYMKVDGEVVRTNQFSVTRHEKIANGLLGDQGLPGV  238

Query  493  YFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            + LY+LSP+ V + E+ RSF HF+T +CA++GG F + G++D  +Y    A+ K
Sbjct  239  FVLYELSPMMVKLTEKHRSFTHFLTGVCAIIGGIFTVAGLIDSLIYHSARAIQK  292



>gb|EYU18489.1| hypothetical protein MIMGU_mgv1a008051mg [Erythranthe guttata]
Length=386

 Score =   105 bits (261),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 74/113 (65%), Gaps = 1/113 (1%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFD-RAWPAVY  491
            LDG E +    +G ++Y++K+VPT Y  +    + +NQFSV+E+Y    E   R+ P ++
Sbjct  266  LDGVEWVQIRPNGVYQYFLKVVPTIYTNIKGHTIQSNQFSVTEHYKSSEEDQYRSLPGIF  325

Query  490  FLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            F YDLSPI VT  EE  SFLHF+T +CA++GG F + G++D ++Y   +A+ K
Sbjct  326  FFYDLSPIKVTFTEEHASFLHFLTHICAIVGGVFTVAGIVDSFIYHGQKAIRK  378



>ref|XP_010934993.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Elaeis guineensis]
Length=384

 Score =   105 bits (261),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 73/112 (65%), Gaps = 0/112 (0%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDG +    A SGT++Y+IK+VPT Y  +    + +NQFSV+E++   + + +  P V+F
Sbjct  265  LDGAQWTQKASSGTYQYFIKVVPTIYTDIRGRKIHSNQFSVTEHFKDGNVYPKPPPGVFF  324

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             YD SPI V   EE +S LHF+T LCA++GG F ++G++D ++Y    A+ K
Sbjct  325  FYDFSPIKVIFTEESKSLLHFLTNLCAIIGGVFTVSGIIDAFVYHGQRAIKK  376



>ref|XP_003579883.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X1 [Brachypodium distachyon]
Length=386

 Score =   105 bits (261),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 76/113 (67%), Gaps = 1/113 (1%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFD-RAWPAVY  491
            LDG     H+  G ++Y++K+VPT Y +++++++ +NQFSV+E+         +A P V+
Sbjct  266  LDGAHWFQHSPYGMYQYFVKVVPTVYSHINEQIILSNQFSVTEHARSSESVRMQALPGVF  325

Query  490  FLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            F YDLSPI VT  E   SFLHF+T +CA++GG F ++G++D ++Y    A+TK
Sbjct  326  FFYDLSPIKVTFTERHVSFLHFLTNVCAIVGGVFTVSGIIDSFVYHGQRAITK  378



>gb|ACN35132.1| unknown [Zea mays]
 tpg|DAA37502.1| TPA: DUF1692 domain, endoplasmic reticulum vescicle transporter 
protein [Zea mays]
Length=391

 Score =   105 bits (261),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 77/113 (68%), Gaps = 1/113 (1%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYY-SLIHEFDRAWPAVY  491
            LDG   + H+  G ++Y+IK+VPT Y  +++ ++ +NQFSV+E++ S      +A P V+
Sbjct  271  LDGANWVQHSSYGMYQYFIKVVPTVYTDINEHIILSNQFSVTEHFRSGESGRMQALPGVF  330

Query  490  FLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            F YDLSPI VT  E+  SFLHF+T +CA++GG F ++G++D ++Y    A+ K
Sbjct  331  FFYDLSPIKVTFTEQHVSFLHFLTNVCAIVGGVFTVSGIIDSFVYHSQRAIKK  383



>gb|KFK42194.1| hypothetical protein AALP_AA2G223600 [Arabis alpina]
Length=385

 Score =   105 bits (261),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 74/112 (66%), Gaps = 0/112 (0%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDG        +G ++Y+IK+VPTEY  + + ++ +NQFSV+E++    +  ++ P V+F
Sbjct  266  LDGVPWTQETLNGMYQYFIKVVPTEYTDVKEHIIQSNQFSVTEHFEKTDDHRQSLPGVFF  325

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             YDLSPI V  +E+   FLHF+T +CA++GG F ++G++D ++Y    A+ K
Sbjct  326  FYDLSPIKVIFREQHVEFLHFLTNVCAIVGGVFTVSGIIDSFVYHGQRAIKK  377



>ref|XP_002447951.1| hypothetical protein SORBIDRAFT_06g018670 [Sorghum bicolor]
 gb|EES12279.1| hypothetical protein SORBIDRAFT_06g018670 [Sorghum bicolor]
Length=386

 Score =   104 bits (260),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 77/113 (68%), Gaps = 1/113 (1%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYY-SLIHEFDRAWPAVY  491
            LDG   + H+  G ++Y+IK+VPT Y  +++ ++ +NQFSV+E++ S      +A P V+
Sbjct  266  LDGASWVQHSSYGMYQYFIKVVPTVYTDINEHIILSNQFSVTEHFRSGESGRMQALPGVF  325

Query  490  FLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            F YDLSPI VT  E+  SFLHF+T +CA++GG F ++G++D ++Y    A+ K
Sbjct  326  FFYDLSPIKVTFTEQHVSFLHFLTNVCAIVGGVFTVSGIIDSFVYHSQRAIKK  378



>ref|XP_005438238.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Falco cherrug]
Length=308

 Score =   104 bits (259),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 73/114 (64%), Gaps = 2/114 (2%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRAWPAV  494
            LDGT+   H  S  F+Y++K+VPT Y  +  EV+ TNQFSV+ +  + +    D+  P V
Sbjct  187  LDGTDVTAHQASMMFQYFVKVVPTVYMKVDGEVVRTNQFSVTRHEKIANGLLGDQGLPGV  246

Query  493  YFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            + LY+LSP+ V + E+ RSF HF+T +CA++GG F + G++D  +Y    A+ K
Sbjct  247  FVLYELSPMMVKLTEKHRSFTHFLTGVCAIIGGIFTVAGLIDSLIYHSARAIQK  300



>ref|XP_005774403.1| hypothetical protein EMIHUDRAFT_430522 [Emiliania huxleyi CCMP1516]
 ref|XP_005778028.1| hypothetical protein EMIHUDRAFT_418794 [Emiliania huxleyi CCMP1516]
 gb|EOD21974.1| hypothetical protein EMIHUDRAFT_430522 [Emiliania huxleyi CCMP1516]
 gb|EOD25599.1| hypothetical protein EMIHUDRAFT_418794 [Emiliania huxleyi CCMP1516]
Length=406

 Score =   105 bits (261),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 72/106 (68%), Gaps = 2/106 (2%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAW--PAV  494
            LD +  ILH GSG F+YY+K+VPT Y + S   L + Q+SV+E +   H+    +  P V
Sbjct  291  LDESTMILHNGSGVFQYYLKVVPTTYVFASGRNLTSCQYSVTEQFKSAHDPRNGFVLPGV  350

Query  493  YFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMY  356
            +F+YD+SPI VT +EER +F +F+T LCA++GG F + G++D  +Y
Sbjct  351  FFIYDISPIMVTFREERPAFSYFLTSLCAIVGGVFTVAGIVDSCIY  396



>emb|CAE02574.2| OSJNBa0006M15.17 [Oryza sativa Japonica Group]
 emb|CAH67017.1| H0523F07.5 [Oryza sativa Indica Group]
 gb|EEC77387.1| hypothetical protein OsI_16129 [Oryza sativa Indica Group]
Length=386

 Score =   104 bits (260),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 77/113 (68%), Gaps = 1/113 (1%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFD-RAWPAVY  491
            LDG + + H+  G ++Y+IK+VPT Y  +++ ++ +NQFSV+E++        +A P V+
Sbjct  266  LDGAQWMQHSSYGMYQYFIKVVPTVYTDINEHIILSNQFSVTEHFRSSESGRIQAVPGVF  325

Query  490  FLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            F YDLSPI VT  E+  SFLHF+T +CA++GG F ++G++D ++Y    A+ K
Sbjct  326  FFYDLSPIKVTFTEQHVSFLHFLTNVCAIVGGVFTVSGIIDSFVYHGQRAIKK  378



>ref|XP_009917276.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3, partial [Haliaeetus albicilla]
Length=174

 Score =   101 bits (251),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 71/114 (62%), Gaps = 2/114 (2%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRAWPAV  494
            LDGT+      S  F+Y++K+VPT Y  +  EV+ TNQFSV+ +  + +    D+  P V
Sbjct  53   LDGTDVAAQQASMMFQYFVKVVPTVYMKVDGEVVRTNQFSVTRHEKIANGLLGDQGLPGV  112

Query  493  YFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            + LY+LSP+ V + E+ RSF HF+T +CA++GG F + G +D  +Y    A+ K
Sbjct  113  FVLYELSPMMVKLTEKHRSFTHFLTGVCAIVGGIFTVAGFIDSLIYHSARAIQK  166



>gb|KFO97972.1| Endoplasmic reticulum-Golgi intermediate compartment protein 
3, partial [Calypte anna]
Length=330

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 73/114 (64%), Gaps = 2/114 (2%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRAWPAV  494
            LDGT+   H  S  F+Y++K+VPT Y  +  EV+ TNQFSV+ +  + +    D+  P V
Sbjct  209  LDGTDVTAHQASMMFQYFVKVVPTVYMKVDGEVVRTNQFSVTRHEKIANGLLGDQGLPGV  268

Query  493  YFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            + LY+LSP+ V + E+ RSF HF+T +CA++GG F + G++D  +Y    A+ K
Sbjct  269  FVLYELSPMMVKLTEKHRSFTHFLTGVCAIVGGIFTVAGLIDSLIYHSARAIQK  322



>ref|XP_001764962.1| predicted protein [Physcomitrella patens]
 gb|EDQ70178.1| predicted protein [Physcomitrella patens]
Length=385

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 71/112 (63%), Gaps = 0/112 (0%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LD    I    +G ++Y+IK+VPT Y  +    + TNQFSV+E+Y+      R  P V+F
Sbjct  266  LDKVTNIQKDLNGMYQYFIKVVPTVYTDIKGRKISTNQFSVTEHYTAGDHGPRFVPGVFF  325

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             YDLSPI V   EER SFLHF+T +CA++GG +++ G++D ++Y    A+ K
Sbjct  326  FYDLSPIKVKFSEERPSFLHFLTNVCAIVGGVYSIAGIIDSFVYHGHRAIKK  377



>ref|XP_008504578.1| PREDICTED: LOW QUALITY PROTEIN: endoplasmic reticulum-Golgi intermediate 
compartment protein 3 [Calypte anna]
Length=391

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 73/114 (64%), Gaps = 2/114 (2%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRAWPAV  494
            LDGT+   H  S  F+Y++K+VPT Y  +  EV+ TNQFSV+ +  + +    D+  P V
Sbjct  270  LDGTDVTAHQASMMFQYFVKVVPTVYMKVDGEVVRTNQFSVTRHEKIANGLLGDQGLPGV  329

Query  493  YFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            + LY+LSP+ V + E+ RSF HF+T +CA++GG F + G++D  +Y    A+ K
Sbjct  330  FVLYELSPMMVKLTEKHRSFTHFLTGVCAIVGGIFTVAGLIDSLIYHSARAIQK  383



>ref|XP_002439992.1| hypothetical protein SORBIDRAFT_09g023960 [Sorghum bicolor]
 gb|EES18422.1| hypothetical protein SORBIDRAFT_09g023960 [Sorghum bicolor]
Length=384

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 73/112 (65%), Gaps = 0/112 (0%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDG + I  A  GT++Y+IK+VPT Y  +    + +NQFSV+E++   +   +  P V+F
Sbjct  265  LDGAQWIQPASDGTYQYFIKVVPTIYTDIRGHNIHSNQFSVTEHFRDGNILPKPQPGVFF  324

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             YD SPI V   EE RS LH++T LCA++GG F ++G++D ++Y   +A+ K
Sbjct  325  FYDFSPIKVIFTEENRSLLHYLTNLCAIVGGVFTVSGIIDSFIYHGQKALKK  376



>gb|EPS71395.1| hypothetical protein M569_03362 [Genlisea aurea]
Length=385

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 74/113 (65%), Gaps = 1/113 (1%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFD-RAWPAVY  491
            LDG + +    +G ++Y+IK+VPT Y  +    + +NQFSV+E+Y    E   R+ P V+
Sbjct  265  LDGAQWVQEKPNGIYQYFIKVVPTVYTDIRGHTIQSNQFSVTEHYKSPEEDRFRSSPGVF  324

Query  490  FLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            F+YDLSPI VT  E    FLHF+T +CA++GG F++ GM+D ++Y   +A+ K
Sbjct  325  FVYDLSPIQVTFTEHHTPFLHFLTHICAIVGGIFSVAGMVDSFVYHGQKAIRK  377



>ref|XP_001754958.1| predicted protein [Physcomitrella patens]
 gb|EDQ80412.1| predicted protein [Physcomitrella patens]
Length=385

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 69/112 (62%), Gaps = 0/112 (0%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LD    I    +G F+Y+IK+VPT Y  +    + TNQFSV E+Y+      R  P V+F
Sbjct  266  LDKVTSIQKDQNGMFQYFIKVVPTVYTDIKGRKISTNQFSVMEHYTAGDHGPRVIPGVFF  325

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             YDL+PI V   EER SFLHF+T +CA++GG + + G++D ++Y    A+ K
Sbjct  326  FYDLTPIKVKFTEERPSFLHFLTNVCAIIGGIYTIAGIVDSFIYHGHRAIKK  377



>ref|XP_005534205.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X1 [Pseudopodoces humilis]
Length=383

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 72/114 (63%), Gaps = 2/114 (2%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRAWPAV  494
            LDGT  I    S  F+Y++K+VPT YR +  EV+ TNQFSV+ +  + +    D+  P V
Sbjct  262  LDGTAVIAQQASMMFQYFVKVVPTVYRKVDGEVVRTNQFSVTRHEKIANGLLGDQGLPGV  321

Query  493  YFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            + LY+LSP+ V + E+ RSF HF+T +CA++GG F + G +D  +Y    A+ K
Sbjct  322  FVLYELSPMMVKLTEKHRSFTHFLTGVCAIVGGIFTVAGFIDSLIYHSARAIQK  375



>ref|XP_005534206.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X2 [Pseudopodoces humilis]
Length=390

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 72/114 (63%), Gaps = 2/114 (2%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRAWPAV  494
            LDGT  I    S  F+Y++K+VPT YR +  EV+ TNQFSV+ +  + +    D+  P V
Sbjct  269  LDGTAVIAQQASMMFQYFVKVVPTVYRKVDGEVVRTNQFSVTRHEKIANGLLGDQGLPGV  328

Query  493  YFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            + LY+LSP+ V + E+ RSF HF+T +CA++GG F + G +D  +Y    A+ K
Sbjct  329  FVLYELSPMMVKLTEKHRSFTHFLTGVCAIVGGIFTVAGFIDSLIYHSARAIQK  382



>ref|XP_002264644.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Vitis vinifera]
 emb|CBI29463.3| unnamed protein product [Vitis vinifera]
Length=386

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 73/113 (65%), Gaps = 1/113 (1%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYY-SLIHEFDRAWPAVY  491
            LDG +    A  G ++Y+IK+VPT Y  +    + +NQFSV+E++ S       + P VY
Sbjct  266  LDGAQWFQDAPDGMYQYFIKVVPTIYTDIRGHTIQSNQFSVTEHFRSAEPGRPHSLPGVY  325

Query  490  FLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            F YDLSPI VT KEE  SFLHF+T +CA++GG F ++G++D ++Y    A+ K
Sbjct  326  FFYDLSPIKVTSKEEHSSFLHFMTNICAIVGGIFTVSGIIDSFVYHGHRAIKK  378



>ref|XP_008804335.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X2 [Phoenix dactylifera]
Length=356

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 72/112 (64%), Gaps = 0/112 (0%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDG +    A SG ++Y+IK+VPT Y  +    + +NQFSV+E++   + + +  P V+F
Sbjct  237  LDGAQWTRQASSGMYQYFIKVVPTIYTDIRGRKIHSNQFSVTEHFKDGNVYPKPPPGVFF  296

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             YD SPI V   EE +S LHF+T LCA++GG F ++G++D ++Y    A+ K
Sbjct  297  FYDFSPIKVIFTEENKSLLHFLTNLCAIVGGVFTVSGIIDAFIYHGQRAIKK  348



>ref|XP_008804334.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X1 [Phoenix dactylifera]
Length=384

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 72/112 (64%), Gaps = 0/112 (0%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDG +    A SG ++Y+IK+VPT Y  +    + +NQFSV+E++   + + +  P V+F
Sbjct  265  LDGAQWTRQASSGMYQYFIKVVPTIYTDIRGRKIHSNQFSVTEHFKDGNVYPKPPPGVFF  324

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             YD SPI V   EE +S LHF+T LCA++GG F ++G++D ++Y    A+ K
Sbjct  325  FYDFSPIKVIFTEENKSLLHFLTNLCAIVGGVFTVSGIIDAFIYHGQRAIKK  376



>ref|XP_006033884.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Alligator sinensis]
Length=356

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 73/114 (64%), Gaps = 2/114 (2%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRAWPAV  494
            LDGT+ I    S  F+Y++K+VPT Y  +  EV+ TNQFSV+ +  + +    D+  P V
Sbjct  235  LDGTDVIAQQASMMFQYFVKVVPTVYMKVDGEVVRTNQFSVTRHEKIANGLIGDQGLPGV  294

Query  493  YFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            + LY+LSP+ V + E+ RSF HF+T +CA++GG F + G++D  +Y    A+ K
Sbjct  295  FVLYELSPMMVKLTEKHRSFTHFLTGVCAIIGGVFTVAGLIDSLIYHSSRAIQK  348



>ref|XP_002191084.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 isoform 1 [Taeniopygia guttata]
Length=383

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 72/114 (63%), Gaps = 2/114 (2%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRAWPAV  494
            LDGT       S  F+Y++K+VPT YR +  EV+ TNQFSV+++  + +    D+  P V
Sbjct  262  LDGTAVTAQQASMMFQYFVKVVPTVYRKVDGEVVRTNQFSVTQHEKIANGLLGDQGLPGV  321

Query  493  YFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            + LY+LSP+ V + E+ RSF HF+T +CA++GG F + G +D  +Y    A+ K
Sbjct  322  FVLYELSPMMVKLTEKHRSFTHFVTGVCAIVGGIFTVAGFIDSLIYHSARAIQK  375



>ref|XP_004237893.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Solanum lycopersicum]
Length=386

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/114 (44%), Positives = 75/114 (66%), Gaps = 3/114 (3%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDR--AWPAV  494
            LDG +       G ++Y+IK+VPT Y  +S   + TNQFSV+E++    +F R  + P V
Sbjct  266  LDGVKWTQETPHGMYQYFIKVVPTVYTDVSGHTIQTNQFSVTEHFKGA-DFGRFQSIPGV  324

Query  493  YFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            +F YDLSPI VT  E+  SFLHF+T +CA++GG F ++G+LD ++Y   +A+ K
Sbjct  325  FFFYDLSPIKVTFTEQHASFLHFLTNVCAIVGGVFTVSGILDSFIYHGQKAIKK  378



>ref|XP_006266817.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Alligator mississippiensis]
Length=383

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 73/114 (64%), Gaps = 2/114 (2%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRAWPAV  494
            LDGT+ I    S  F+Y++K+VPT Y  +  EV+ TNQFSV+ +  + +    D+  P V
Sbjct  262  LDGTDVIAQQASMMFQYFVKVVPTVYMKVDGEVVRTNQFSVTRHEKIANGLIGDQGLPGV  321

Query  493  YFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            + LY+LSP+ V + E+ RSF HF+T +CA++GG F + G++D  +Y    A+ K
Sbjct  322  FVLYELSPMMVKLTEKHRSFTHFLTGVCAIIGGVFTVAGLIDSLIYHSSRAIQK  375



>ref|XP_002302286.1| hypothetical protein POPTR_0002s09500g [Populus trichocarpa]
 gb|EEE81559.1| hypothetical protein POPTR_0002s09500g [Populus trichocarpa]
Length=377

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/114 (44%), Positives = 76/114 (67%), Gaps = 3/114 (3%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYY--SLIHEFDRAWPAV  494
            LDG +      SG ++Y+IK+VPT Y  +S   + +NQFSV+E++  + I    ++ P V
Sbjct  257  LDGVQWTQETPSGMYQYFIKVVPTVYTDVSGHTIQSNQFSVTEHFRGADIGRL-QSLPGV  315

Query  493  YFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            +F YDLSPI VT  EE  SFLHF+T +CA++GG F ++G+LD ++Y   +A+ K
Sbjct  316  FFFYDLSPIKVTFTEEHVSFLHFLTNVCAIVGGVFTVSGILDSFIYHGQKAIKK  369



>ref|XP_008378547.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Malus domestica]
Length=386

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 73/113 (65%), Gaps = 1/113 (1%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAW-PAVY  491
            LDG        SG ++Y+IK+VPT Y  +S   + +NQFSV+E+Y      +  + P V+
Sbjct  266  LDGVHWTQDNPSGMYQYFIKVVPTVYTDVSGHTIQSNQFSVTEHYRGTEMGNLQFLPGVF  325

Query  490  FLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            F YDLSPI VT  EE  SFLHF+T +CA++GG F ++G+LD ++Y   +A+ K
Sbjct  326  FFYDLSPIKVTFTEEHISFLHFLTNVCAIVGGVFTVSGILDSFIYHGQKAIKK  378



>ref|XP_009373163.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Pyrus x bretschneideri]
Length=386

 Score =   103 bits (256),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 73/113 (65%), Gaps = 1/113 (1%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAW-PAVY  491
            LDG        SG ++Y+IK+VPT Y  +S   + +NQFSV+E+Y      +  + P V+
Sbjct  266  LDGVHWTQDNPSGMYQYFIKVVPTVYTDVSGHTIQSNQFSVTEHYRGAEMGNLQFLPGVF  325

Query  490  FLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            F YDLSPI VT  EE  SFLHF+T +CA++GG F ++G+LD ++Y   +A+ K
Sbjct  326  FFYDLSPIKVTFTEEHISFLHFLTNVCAIVGGVFTVSGILDSFIYHGQKAIKK  378



>ref|XP_009369662.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Pyrus x bretschneideri]
Length=387

 Score =   103 bits (256),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 73/113 (65%), Gaps = 1/113 (1%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAW-PAVY  491
            LDG        SG ++Y+IK+VPT Y  +S   + +NQFSV+E+Y      +  + P V+
Sbjct  267  LDGVHWTQDNPSGMYQYFIKVVPTVYTDVSGHTIQSNQFSVTEHYRGTEMGNLQFLPGVF  326

Query  490  FLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            F YDLSPI VT  EE  SFLHF+T +CA++GG F ++G+LD ++Y   +A+ K
Sbjct  327  FFYDLSPIKVTFTEEHISFLHFLTNVCAIVGGVFTVSGILDSFIYHGQKAIKK  379



>ref|XP_007018816.1| Endoplasmic reticulum vesicle transporter protein isoform 1 [Theobroma 
cacao]
 gb|EOY16041.1| Endoplasmic reticulum vesicle transporter protein isoform 1 [Theobroma 
cacao]
Length=386

 Score =   103 bits (256),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 50/114 (44%), Positives = 74/114 (65%), Gaps = 3/114 (3%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDR--AWPAV  494
            LDG        SG ++Y+IK+VPT Y  +S   + +NQFSV+E++    E +R  + P V
Sbjct  266  LDGVHWTQEQPSGMYQYFIKVVPTVYTDVSGHTIQSNQFSVTEHFKGA-EINRLQSLPGV  324

Query  493  YFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            +F YDLSPI VT  E+  SFLHF+T +CA++GG F ++G+LD ++Y    A+ K
Sbjct  325  FFFYDLSPIKVTFTEQHVSFLHFLTNVCAIVGGVFTVSGILDSFIYHGQRAIKK  378



>ref|XP_009708266.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3, partial [Cariama cristata]
Length=174

 Score =   100 bits (248),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 70/114 (61%), Gaps = 2/114 (2%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRAWPAV  494
            LDGT+      S  F+Y++K+VPT Y  +  EV+ TNQFSV+ +  +      D+  P V
Sbjct  53   LDGTDVTAEQASMMFQYFVKVVPTVYMKVDGEVVRTNQFSVTRHEKIASGLLGDQGLPGV  112

Query  493  YFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            + LY+LSP+ V + E+ RSF HF+T +CA++GG F + G +D  +Y    A+ K
Sbjct  113  FVLYELSPMMVKLTEKHRSFTHFLTGVCAIVGGIFTVAGFIDSLIYHSARAIQK  166



>ref|XP_011013540.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Populus euphratica]
Length=386

 Score =   103 bits (256),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 50/114 (44%), Positives = 76/114 (67%), Gaps = 3/114 (3%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYY--SLIHEFDRAWPAV  494
            LDG +      SG ++Y+IK+VPT Y  +S   + +NQFSV+E++  + I    ++ P V
Sbjct  266  LDGVQWTQETPSGMYQYFIKVVPTVYTDVSGHTIQSNQFSVTEHFRGTDIGRL-QSLPGV  324

Query  493  YFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            +F YDLSPI VT  EE  SFLHF+T +CA++GG F ++G+LD ++Y   +A+ K
Sbjct  325  FFFYDLSPIKVTFTEEHVSFLHFLTNVCAIVGGVFTVSGILDSFIYHGQKAIKK  378



>gb|KFO76211.1| Endoplasmic reticulum-Golgi intermediate compartment protein 
3, partial [Cuculus canorus]
Length=353

 Score =   102 bits (255),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 72/114 (63%), Gaps = 2/114 (2%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRAWPAV  494
            LDGT+     GS  F+Y++K+VPT Y  +  EV+ TNQFSV+ +  + +    D+  P V
Sbjct  233  LDGTDVTAQQGSMMFQYFVKVVPTVYMKVDGEVVRTNQFSVTRHEKIANGLLGDQGLPGV  292

Query  493  YFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            + LY+LSP+ V + E+ RSF HF+T +CA++GG F + G +D  +Y    A+ K
Sbjct  293  FVLYELSPMMVKLTEKHRSFTHFLTGVCAIVGGIFTVAGFIDSLIYHSARAIQK  346



>ref|XP_008802686.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X2 [Phoenix dactylifera]
Length=357

 Score =   102 bits (255),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 72/112 (64%), Gaps = 0/112 (0%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDG +    A SG ++Y+IK+VPT Y  +    + +NQFSV+E++   + + +  P V+F
Sbjct  238  LDGAQWTQEASSGMYQYFIKVVPTIYTDIRGRKIHSNQFSVTEHFKDGNVYPKPPPGVFF  297

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             YD SPI V   EE +S LHF+T LCA++GG F ++G++D ++Y    A+ K
Sbjct  298  FYDFSPIKVIFTEETKSLLHFLTNLCAIVGGVFTVSGIIDAFIYHGQRAIKK  349



>ref|XP_009559309.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Cuculus canorus]
Length=365

 Score =   102 bits (255),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 72/114 (63%), Gaps = 2/114 (2%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRAWPAV  494
            LDGT+     GS  F+Y++K+VPT Y  +  EV+ TNQFSV+ +  + +    D+  P V
Sbjct  244  LDGTDVTAQQGSMMFQYFVKVVPTVYMKVDGEVVRTNQFSVTRHEKIANGLLGDQGLPGV  303

Query  493  YFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            + LY+LSP+ V + E+ RSF HF+T +CA++GG F + G +D  +Y    A+ K
Sbjct  304  FVLYELSPMMVKLTEKHRSFTHFLTGVCAIVGGIFTVAGFIDSLIYHSARAIQK  357



>ref|XP_008802685.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X1 [Phoenix dactylifera]
Length=384

 Score =   102 bits (255),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 72/112 (64%), Gaps = 0/112 (0%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDG +    A SG ++Y+IK+VPT Y  +    + +NQFSV+E++   + + +  P V+F
Sbjct  265  LDGAQWTQEASSGMYQYFIKVVPTIYTDIRGRKIHSNQFSVTEHFKDGNVYPKPPPGVFF  324

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             YD SPI V   EE +S LHF+T LCA++GG F ++G++D ++Y    A+ K
Sbjct  325  FYDFSPIKVIFTEETKSLLHFLTNLCAIVGGVFTVSGIIDAFIYHGQRAIKK  376



>ref|XP_011464591.1| PREDICTED: LOW QUALITY PROTEIN: endoplasmic reticulum-Golgi intermediate 
compartment protein 3-like [Fragaria vesca subsp. 
vesca]
Length=386

 Score =   102 bits (255),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 73/113 (65%), Gaps = 1/113 (1%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAW-PAVY  491
            LDG        SG ++Y+IK+VPT Y  +S   + +NQFSV+E+Y      +  + P V+
Sbjct  266  LDGVHWTQDNPSGMYQYFIKVVPTVYTDVSGHTIQSNQFSVTEHYRGTEIGNLQFLPGVF  325

Query  490  FLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            F YDLSPI VT  EE  SFLHF+T +CA++GG F ++G+LD ++Y   +A+ K
Sbjct  326  FFYDLSPIKVTFTEEHISFLHFLTNVCAIVGGVFTVSGILDSFIYHGQKAIKK  378



>ref|XP_002306582.1| hypothetical protein POPTR_0005s16700g [Populus trichocarpa]
 gb|EEE93578.1| hypothetical protein POPTR_0005s16700g [Populus trichocarpa]
Length=386

 Score =   102 bits (255),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 50/114 (44%), Positives = 76/114 (67%), Gaps = 3/114 (3%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYY--SLIHEFDRAWPAV  494
            LDG +      SG ++Y+IK+VPT Y  +S   + +NQFSV+E++  + I    ++ P V
Sbjct  266  LDGVQWTQETPSGMYQYFIKVVPTVYTDVSGHTIQSNQFSVTEHFRGTDIGRL-QSLPGV  324

Query  493  YFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            +F YDLSPI VT  EE  SFLHF+T +CA++GG F ++G+LD ++Y   +A+ K
Sbjct  325  FFFYDLSPIKVTFTEEHVSFLHFLTNVCAIVGGVFTVSGILDTFIYHGQKAIKK  378



>emb|CDP01031.1| unnamed protein product [Coffea canephora]
Length=297

 Score =   102 bits (253),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 76/114 (67%), Gaps = 3/114 (3%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDR--AWPAV  494
            LDG E +    +G ++Y+IK+VPT Y  ++   + +NQFSV+E++    E  R  + P V
Sbjct  177  LDGVEWMQQTPNGMYQYFIKVVPTVYTDVNGHNIQSNQFSVTEHFKGA-EIGRLQSIPGV  235

Query  493  YFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            +F YDLSPI VT  E+  SFLHF+T +CA++GG F ++G++D ++Y   +A+ K
Sbjct  236  FFFYDLSPIKVTFTEQHVSFLHFLTNVCAIIGGVFTVSGIIDSFVYHGQKAIKK  289



>gb|KFQ65052.1| Endoplasmic reticulum-Golgi intermediate compartment protein 
3, partial [Pelecanus crispus]
Length=329

 Score =   102 bits (253),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 72/114 (63%), Gaps = 2/114 (2%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRAWPAV  494
            LDGT+   H  S  F+Y++K+VPT Y  +  EV+ TNQFSV+ +  + +    D+  P V
Sbjct  209  LDGTDVTAHQASMMFQYFVKVVPTVYMKVDGEVVRTNQFSVTRHEKIANGLLGDQGLPGV  268

Query  493  YFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            + LY+LSP+ V + E+ RSF HF+T +CA++GG F + G +D  +Y    A+ K
Sbjct  269  FVLYELSPMMVKLTEKHRSFTHFLTGVCAIVGGIFTVAGFIDSLIYHSACAIQK  322



>ref|XP_009488027.1| PREDICTED: LOW QUALITY PROTEIN: endoplasmic reticulum-Golgi intermediate 
compartment protein 3, partial [Pelecanus crispus]
Length=362

 Score =   102 bits (253),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 72/114 (63%), Gaps = 2/114 (2%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRAWPAV  494
            LDGT+   H  S  F+Y++K+VPT Y  +  EV+ TNQFSV+ +  + +    D+  P V
Sbjct  241  LDGTDVTAHQASMMFQYFVKVVPTVYMKVDGEVVRTNQFSVTRHEKIANGLLGDQGLPGV  300

Query  493  YFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            + LY+LSP+ V + E+ RSF HF+T +CA++GG F + G +D  +Y    A+ K
Sbjct  301  FVLYELSPMMVKLTEKHRSFTHFLTGVCAIVGGIFTVAGFIDSLIYHSACAIQK  354



>ref|XP_010411485.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Corvus cornix cornix]
Length=359

 Score =   102 bits (253),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 71/114 (62%), Gaps = 2/114 (2%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRAWPAV  494
            LDGT       S  F+Y++K+VPT YR +  EV+ TNQFSV+ +  + +    D+  P V
Sbjct  238  LDGTAVTAQQASMMFQYFVKVVPTVYRKVDGEVVRTNQFSVTRHEKIANGLLGDQGLPGV  297

Query  493  YFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            + LY+LSP+ V + E+ RSF HF+T +CA++GG F + G +D  +Y    A+ K
Sbjct  298  FVLYELSPMMVKLTEKHRSFTHFLTGVCAIVGGIFTVAGFIDSLIYHSARAIQK  351



>gb|KFW74284.1| Endoplasmic reticulum-Golgi intermediate compartment protein 
3, partial [Manacus vitellinus]
Length=338

 Score =   102 bits (253),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 71/114 (62%), Gaps = 2/114 (2%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRAWPAV  494
            LDGT       S  F+Y++K+VPT YR +  EV+ TNQFSV+ +  + +    D+  P V
Sbjct  217  LDGTAVTAQQASMMFQYFVKVVPTVYRKVDGEVVRTNQFSVTRHEKIANGLLGDQGLPGV  276

Query  493  YFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            + LY+LSP+ V + E+ RSF HF+T +CA++GG F + G +D  +Y    A+ K
Sbjct  277  FVLYELSPMMVKLTEKHRSFTHFLTGVCAIVGGIFTVAGFIDSLIYHSARAIQK  330



>ref|XP_008627777.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3, partial [Corvus brachyrhynchos]
Length=341

 Score =   102 bits (253),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 71/114 (62%), Gaps = 2/114 (2%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRAWPAV  494
            LDGT       S  F+Y++K+VPT YR +  EV+ TNQFSV+ +  + +    D+  P V
Sbjct  220  LDGTAVTAQQASMMFQYFVKVVPTVYRKVDGEVVRTNQFSVTRHEKIANGLLGDQGLPGV  279

Query  493  YFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            + LY+LSP+ V + E+ RSF HF+T +CA++GG F + G +D  +Y    A+ K
Sbjct  280  FVLYELSPMMVKLTEKHRSFTHFLTGVCAIVGGIFTVAGFIDSLIYHSARAIQK  333



>gb|KFO52827.1| Endoplasmic reticulum-Golgi intermediate compartment protein 
3, partial [Corvus brachyrhynchos]
Length=336

 Score =   101 bits (252),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 71/114 (62%), Gaps = 2/114 (2%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRAWPAV  494
            LDGT       S  F+Y++K+VPT YR +  EV+ TNQFSV+ +  + +    D+  P V
Sbjct  215  LDGTAVTAQQASMMFQYFVKVVPTVYRKVDGEVVRTNQFSVTRHEKIANGLLGDQGLPGV  274

Query  493  YFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            + LY+LSP+ V + E+ RSF HF+T +CA++GG F + G +D  +Y    A+ K
Sbjct  275  FVLYELSPMMVKLTEKHRSFTHFLTGVCAIVGGIFTVAGFIDSLIYHSARAIQK  328



>ref|XP_008932726.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3, partial [Manacus vitellinus]
Length=334

 Score =   101 bits (252),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 71/114 (62%), Gaps = 2/114 (2%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRAWPAV  494
            LDGT       S  F+Y++K+VPT YR +  EV+ TNQFSV+ +  + +    D+  P V
Sbjct  213  LDGTAVTAQQASMMFQYFVKVVPTVYRKVDGEVVRTNQFSVTRHEKIANGLLGDQGLPGV  272

Query  493  YFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            + LY+LSP+ V + E+ RSF HF+T +CA++GG F + G +D  +Y    A+ K
Sbjct  273  FVLYELSPMMVKLTEKHRSFTHFLTGVCAIVGGIFTVAGFIDSLIYHSARAIQK  326



>ref|XP_009931564.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3, partial [Opisthocomus hoazin]
Length=305

 Score =   101 bits (251),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 72/114 (63%), Gaps = 2/114 (2%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRAWPAV  494
            LDGT+     GS  F+Y++K+VPT Y  +  EV+ TNQFSV+ +  + +    D+  P V
Sbjct  184  LDGTDITAQQGSMMFQYFVKVVPTVYMKVDGEVVRTNQFSVTRHEKIANGLLGDQGLPGV  243

Query  493  YFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            + LY+LSP+ V + E+ RSF HF+T +CA++GG F + G +D  +Y    A+ +
Sbjct  244  FVLYELSPMMVKLTEKHRSFTHFLTGVCAIVGGIFTVAGFIDSLIYHSARAIQR  297



>ref|XP_005428461.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Geospiza fortis]
Length=339

 Score =   101 bits (252),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 71/114 (62%), Gaps = 2/114 (2%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRAWPAV  494
            LDGT       S  F+Y++K+VPT YR +  EV+ TNQFSV+ +  + +    D+  P V
Sbjct  218  LDGTAITAQQASMMFQYFVKVVPTVYRKVDGEVVRTNQFSVTRHEKIANGLLGDQGLPGV  277

Query  493  YFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            + LY+LSP+ V + E+ RSF HF+T +CA++GG F + G +D  +Y    A+ K
Sbjct  278  FVLYELSPMMVKLTEKHRSFTHFLTGVCAIVGGIFTVAGFIDSLIYHSARAIQK  331



>ref|XP_010261264.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Nelumbo nucifera]
Length=385

 Score =   102 bits (253),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 49/114 (43%), Positives = 76/114 (67%), Gaps = 3/114 (3%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDR--AWPAV  494
            LD  + +    SG ++Y+IK+VPT Y  ++   + +NQFSV+E++    EF R  + P V
Sbjct  265  LDRVQWVQQTPSGMYQYFIKVVPTVYTDVNGHTIQSNQFSVTEHFRNA-EFGRPQSLPGV  323

Query  493  YFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            +F YDLSPI VT  EE  SFLHF+T +CA++GG F ++G++D ++Y   +A+ K
Sbjct  324  FFFYDLSPIKVTFTEEHVSFLHFLTSVCAIVGGIFTVSGIVDSFIYHGQKAIKK  377



>ref|NP_001132255.1| DUF1692 domain, endoplasmic reticulum vescicle transporter protein 
[Zea mays]
 gb|ACF81030.1| unknown [Zea mays]
 gb|ACN28701.1| unknown [Zea mays]
 gb|AFW82352.1| DUF1692 domain, endoplasmic reticulum vescicle transporter protein 
[Zea mays]
Length=384

 Score =   102 bits (253),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 73/112 (65%), Gaps = 0/112 (0%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDG +    A  GT++Y+IK+VPT Y  +    + +NQFSV+E++   +   ++ P V+F
Sbjct  265  LDGAQWTQPASDGTYQYFIKVVPTIYTDIRGRGIHSNQFSVTEHFRDGNVRPKSQPGVFF  324

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             YD SPI V   EE RS LH++T LCA++GG F ++G++D ++Y   +A+ K
Sbjct  325  FYDFSPIKVIFTEENRSLLHYLTNLCAIVGGVFTVSGIIDSFIYHGQKALKK  376



>gb|AFW78473.1| DUF1692 domain, endoplasmic reticulum vescicle transporter protein, 
partial [Zea mays]
Length=284

 Score =   101 bits (251),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 72/112 (64%), Gaps = 0/112 (0%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDG +    A  GT++Y+IK+VPT Y  +    + +NQFSV+E++   +   +  P V+F
Sbjct  165  LDGAQWTQPASDGTYQYFIKVVPTIYTDIRGHNIHSNQFSVTEHFRDGNVRPKPQPGVFF  224

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             YD SPI V   EE RS LH++T LCA++GG F ++G++D ++Y   +A+ K
Sbjct  225  FYDFSPIKVIFTEESRSLLHYLTNLCAIVGGVFTVSGIIDSFIYHGQKALKK  276



>ref|XP_006652356.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Oryza brachyantha]
Length=386

 Score =   102 bits (253),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 46/113 (41%), Positives = 76/113 (67%), Gaps = 1/113 (1%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFD-RAWPAVY  491
            LD  + + H+  G ++Y+IK+VPT Y  +++ ++ +NQFSV+E++        +A P V+
Sbjct  266  LDRAQWVQHSSYGMYQYFIKVVPTVYTDINEHIILSNQFSVTEHFRSSESGRIQAVPGVF  325

Query  490  FLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            F YDLSPI VT  E+  SFLHF+T +CA++GG F ++G++D ++Y    A+ K
Sbjct  326  FFYDLSPIKVTFTEQHVSFLHFLTNVCAIVGGVFTVSGIIDSFVYHGQRAIKK  378



>gb|EMS61746.1| hypothetical protein TRIUR3_13518 [Triticum urartu]
Length=391

 Score =   101 bits (252),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 73/120 (61%), Gaps = 8/120 (7%)
 Frame = -3

Query  667  LDGTERILH--------AGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFD  512
            LDGT +           A  GT++Y+IK+VPT Y  +    + +NQFSV+E++   +   
Sbjct  264  LDGTNQFHEHSAQWTQPASDGTYQYFIKVVPTIYNDIRGRKIDSNQFSVTEHFRDGNVQP  323

Query  511  RAWPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            R  P V+F YD SPI V   EE RSFLH++T LCA++GG F + G++D ++Y   +A+ K
Sbjct  324  RPQPGVFFFYDFSPIKVIFTEENRSFLHYLTNLCAIVGGIFTVAGIIDSFIYHGQKALKK  383



>ref|XP_008219664.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Prunus mume]
Length=386

 Score =   101 bits (252),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 73/113 (65%), Gaps = 1/113 (1%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAW-PAVY  491
            LDG        SG ++Y+IK+VPT Y  +S   + +NQFSV+E++      +  + P V+
Sbjct  266  LDGVHWAQATPSGMYQYFIKVVPTVYTDVSGHTIQSNQFSVTEHFRGTEVGNLQYLPGVF  325

Query  490  FLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            F YDLSPI VT  EE  SFLHF+T +CA++GG F ++G+LD ++Y   +A+ K
Sbjct  326  FFYDLSPIKVTFTEEHISFLHFLTNVCAIVGGVFTVSGILDSFIYHGQKAIKK  378



>ref|XP_007227487.1| hypothetical protein PRUPE_ppa007001mg [Prunus persica]
 gb|EMJ28686.1| hypothetical protein PRUPE_ppa007001mg [Prunus persica]
Length=386

 Score =   101 bits (252),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 73/113 (65%), Gaps = 1/113 (1%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAW-PAVY  491
            LDG        SG ++Y+IK+VPT Y  +S   + +NQFSV+E++      +  + P V+
Sbjct  266  LDGVHWAQATPSGMYQYFIKVVPTVYTDVSGHTIQSNQFSVTEHFRGTEVGNLQYLPGVF  325

Query  490  FLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            F YDLSPI VT  EE  SFLHF+T +CA++GG F ++G+LD ++Y   +A+ K
Sbjct  326  FFYDLSPIKVTFTEEHISFLHFLTNVCAIVGGVFTVSGILDSFIYHGQKAIKK  378



>ref|XP_009097046.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 isoform X1 [Serinus canaria]
Length=390

 Score =   101 bits (252),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 71/114 (62%), Gaps = 2/114 (2%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRAWPAV  494
            LDGT       S  F+Y++K+VPT YR +  EV+ TNQFSV+ +  + +    D+  P V
Sbjct  269  LDGTAVTAQQASMMFQYFVKVVPTVYRKVDGEVVRTNQFSVTRHEKIANGLLGDQGLPGV  328

Query  493  YFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            + LY+LSP+ V + E+ RSF HF+T +CA++GG F + G +D  +Y    A+ K
Sbjct  329  FVLYELSPMMVKLTEKHRSFTHFLTGVCAIVGGIFTVAGFIDSLIYHSARAIQK  382



>ref|XP_009390586.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Musa acuminata subsp. malaccensis]
Length=386

 Score =   101 bits (252),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 74/113 (65%), Gaps = 1/113 (1%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFD-RAWPAVY  491
            LDG + + H  +G ++Y+IK+VPT Y  ++   + +NQFSV+E++        ++ P V+
Sbjct  266  LDGVQWVQHTPNGMYQYFIKVVPTVYTDINGRTIQSNQFSVTEHFKSDDTGRLQSVPGVF  325

Query  490  FLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            F YDLSPI VT  E   SFLHF+T +CA++GG F ++G+LD ++Y    A+ K
Sbjct  326  FFYDLSPIKVTFMEGHVSFLHFLTNVCAIVGGIFTVSGILDSFIYHGQRAIKK  378



>gb|KFV71275.1| Endoplasmic reticulum-Golgi intermediate compartment protein 
3, partial [Picoides pubescens]
Length=330

 Score =   101 bits (251),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 71/114 (62%), Gaps = 2/114 (2%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRAWPAV  494
            LDGT+      S  F+Y++K+VPT Y  +  EV+ TNQFSV+ +  + +    D+  P V
Sbjct  209  LDGTDVTAQQASMMFQYFVKVVPTVYMKVDGEVVRTNQFSVTRHEKIANGLLGDQGLPGV  268

Query  493  YFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            + LY+LSP+ V + E+ RSF HF+T +CA+LGG F + G +D  +Y    A+ K
Sbjct  269  FVLYELSPMMVKLTEKHRSFTHFLTGVCAILGGIFTVAGFIDSLIYHSARAIQK  322



>gb|KDO80920.1| hypothetical protein CISIN_1g016587mg [Citrus sinensis]
 gb|KDO80921.1| hypothetical protein CISIN_1g016587mg [Citrus sinensis]
Length=297

 Score =   100 bits (250),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 72/113 (64%), Gaps = 1/113 (1%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFD-RAWPAVY  491
            LDG        SG ++Y+IK+VPT Y  +S   + +NQFSV+E++    +   +  P V+
Sbjct  177  LDGVRWTQETPSGMYQYFIKVVPTVYTDVSGHTIQSNQFSVTEHFRSSEQGRLQTLPGVF  236

Query  490  FLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            F YDLSPI VT  EE  SFLHF+T +CA++GG F ++G++D ++Y    A+ K
Sbjct  237  FFYDLSPIKVTFTEEHVSFLHFLTNVCAIVGGVFTVSGIIDAFIYHGQRAIKK  289



>ref|XP_009097047.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 isoform X2 [Serinus canaria]
Length=383

 Score =   101 bits (252),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 71/114 (62%), Gaps = 2/114 (2%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRAWPAV  494
            LDGT       S  F+Y++K+VPT YR +  EV+ TNQFSV+ +  + +    D+  P V
Sbjct  262  LDGTAVTAQQASMMFQYFVKVVPTVYRKVDGEVVRTNQFSVTRHEKIANGLLGDQGLPGV  321

Query  493  YFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            + LY+LSP+ V + E+ RSF HF+T +CA++GG F + G +D  +Y    A+ K
Sbjct  322  FVLYELSPMMVKLTEKHRSFTHFLTGVCAIVGGIFTVAGFIDSLIYHSARAIQK  375



>ref|XP_010198765.1| PREDICTED: LOW QUALITY PROTEIN: endoplasmic reticulum-Golgi intermediate 
compartment protein 3, partial [Colius striatus]
Length=343

 Score =   101 bits (251),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 72/114 (63%), Gaps = 2/114 (2%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRAWPAV  494
            LDGT+      S  F+Y++K+VPT Y  +  EV+ TNQFSV+ +  + +    D+  P V
Sbjct  222  LDGTDVTAQQASMMFQYFVKVVPTVYMKVDGEVVRTNQFSVTRHEKIANGLLGDQGLPGV  281

Query  493  YFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            + LY+LSP+ V + E+ RSF HF+T +CA++GG F + G++D  +Y    A+ K
Sbjct  282  FVLYELSPMMVKLTEKHRSFTHFLTGVCAIVGGIFTVAGLIDSLIYHSARAIQK  335



>ref|XP_004975824.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Setaria italica]
Length=386

 Score =   101 bits (252),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 46/113 (41%), Positives = 75/113 (66%), Gaps = 1/113 (1%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFD-RAWPAVY  491
            LD  + + H+  G ++Y+IK+VPT Y  ++  ++ +NQFSV+E++        +A P V+
Sbjct  266  LDRAQWVQHSSYGMYQYFIKVVPTVYTDINDRIILSNQFSVTEHFRSSESGRIQALPGVF  325

Query  490  FLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            F YDLSPI VT  E+  SFLHF+T +CA++GG F ++G++D ++Y    A+ K
Sbjct  326  FFYDLSPIKVTFTEQHVSFLHFLTNVCAIVGGVFTVSGIIDSFVYHGQRAIKK  378



>gb|KFP23539.1| Endoplasmic reticulum-Golgi intermediate compartment protein 
3, partial [Colius striatus]
Length=330

 Score =   101 bits (251),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 72/114 (63%), Gaps = 2/114 (2%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRAWPAV  494
            LDGT+      S  F+Y++K+VPT Y  +  EV+ TNQFSV+ +  + +    D+  P V
Sbjct  209  LDGTDVTAQQASMMFQYFVKVVPTVYMKVDGEVVRTNQFSVTRHEKIANGLLGDQGLPGV  268

Query  493  YFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            + LY+LSP+ V + E+ RSF HF+T +CA++GG F + G++D  +Y    A+ K
Sbjct  269  FVLYELSPMMVKLTEKHRSFTHFLTGVCAIVGGIFTVAGLIDSLIYHSARAIQK  322



>gb|KFR09655.1| Endoplasmic reticulum-Golgi intermediate compartment protein 
3, partial [Opisthocomus hoazin]
Length=308

 Score =   101 bits (251),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 72/114 (63%), Gaps = 2/114 (2%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRAWPAV  494
            LDGT+     GS  F+Y++K+VPT Y  +  EV+ TNQFSV+ +  + +    D+  P V
Sbjct  187  LDGTDITAQQGSMMFQYFVKVVPTVYMKVDGEVVRTNQFSVTRHEKIANGLLGDQGLPGV  246

Query  493  YFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            + LY+LSP+ V + E+ RSF HF+T +CA++GG F + G +D  +Y    A+ +
Sbjct  247  FVLYELSPMMVKLTEKHRSFTHFLTGVCAIVGGIFTVAGFIDSLIYHSARAIQR  300



>ref|XP_010019924.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3, partial [Nestor notabilis]
Length=335

 Score =   101 bits (251),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 72/114 (63%), Gaps = 2/114 (2%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRAWPAV  494
            LDGT+      S  F+Y++K+VPT Y  +  EV+ TNQFSV+ +  + +    D+  P V
Sbjct  214  LDGTDVTAQQASMMFQYFVKVVPTVYMKVDGEVVRTNQFSVTRHEKIANGLLGDQGLPGV  273

Query  493  YFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            + LY+LSP+ V + E+ RSF HF+T +CA++GG F + G++D  +Y    A+ K
Sbjct  274  FVLYELSPMMVKLTEKHRSFTHFLTGVCAIVGGIFTVAGLIDSLIYHSARAIQK  327



>gb|KFQ56065.1| Endoplasmic reticulum-Golgi intermediate compartment protein 
3, partial [Nestor notabilis]
Length=330

 Score =   101 bits (251),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 72/114 (63%), Gaps = 2/114 (2%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRAWPAV  494
            LDGT+      S  F+Y++K+VPT Y  +  EV+ TNQFSV+ +  + +    D+  P V
Sbjct  209  LDGTDVTAQQASMMFQYFVKVVPTVYMKVDGEVVRTNQFSVTRHEKIANGLLGDQGLPGV  268

Query  493  YFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            + LY+LSP+ V + E+ RSF HF+T +CA++GG F + G++D  +Y    A+ K
Sbjct  269  FVLYELSPMMVKLTEKHRSFTHFLTGVCAIVGGIFTVAGLIDSLIYHSARAIQK  322



>ref|XP_005496545.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 isoform X1 [Zonotrichia albicollis]
Length=383

 Score =   101 bits (252),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 71/114 (62%), Gaps = 2/114 (2%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRAWPAV  494
            LDGT       S  F+Y++K+VPT YR +  EV+ TNQFSV+ +  + +    D+  P V
Sbjct  262  LDGTAITAQQASMMFQYFVKVVPTVYRKVDGEVVRTNQFSVTRHEKIANGLLGDQGLPGV  321

Query  493  YFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            + LY+LSP+ V + E+ RSF HF+T +CA++GG F + G +D  +Y    A+ K
Sbjct  322  FVLYELSPMMVKLTEKHRSFTHFLTGVCAIVGGIFTVAGFIDSLIYHSARAIQK  375



>ref|XP_002513896.1| Endoplasmic reticulum-Golgi intermediate compartment protein, 
putative [Ricinus communis]
 gb|EEF48479.1| Endoplasmic reticulum-Golgi intermediate compartment protein, 
putative [Ricinus communis]
Length=386

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 73/113 (65%), Gaps = 1/113 (1%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFD-RAWPAVY  491
            LDG        SG ++Y+IK+VPT Y  +S   + +NQFSV+E++        ++ P V+
Sbjct  266  LDGVHWTQETPSGMYQYFIKVVPTVYTDVSGYTIQSNQFSVTEHFRSAEAGRLQSLPGVF  325

Query  490  FLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            F YDLSPI VT  EE  SFLHF+T +CA++GG F ++G+LD ++Y   +A+ K
Sbjct  326  FFYDLSPIKVTFTEEHVSFLHFLTNVCAIVGGVFTVSGILDSFIYHGQKAIKK  378



>ref|XP_010060169.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Eucalyptus grandis]
 gb|KCW66743.1| hypothetical protein EUGRSUZ_F00498 [Eucalyptus grandis]
Length=386

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/115 (43%), Positives = 75/115 (65%), Gaps = 5/115 (4%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYY---SLIHEFDRAWPA  497
            LD  +      SG ++Y+IK+VPT Y  +S   + +NQFSV+E++    + H   ++ P 
Sbjct  266  LDNVQWTQETPSGMYQYFIKVVPTVYTDVSGHTIQSNQFSVTEHFRNADIGHL--QSLPG  323

Query  496  VYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            V+F YDLSPI VT  EE  SFLHF+T +CA++GG F ++G+LD ++Y   +A+ K
Sbjct  324  VFFFYDLSPIKVTFTEEHVSFLHFLTNMCAIVGGVFTVSGILDSFIYHGQKAIKK  378



>gb|KCW66744.1| hypothetical protein EUGRSUZ_F00498 [Eucalyptus grandis]
Length=387

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/115 (43%), Positives = 75/115 (65%), Gaps = 5/115 (4%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYY---SLIHEFDRAWPA  497
            LD  +      SG ++Y+IK+VPT Y  +S   + +NQFSV+E++    + H   ++ P 
Sbjct  267  LDNVQWTQETPSGMYQYFIKVVPTVYTDVSGHTIQSNQFSVTEHFRNADIGHL--QSLPG  324

Query  496  VYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            V+F YDLSPI VT  EE  SFLHF+T +CA++GG F ++G+LD ++Y   +A+ K
Sbjct  325  VFFFYDLSPIKVTFTEEHVSFLHFLTNMCAIVGGVFTVSGILDSFIYHGQKAIKK  379



>ref|XP_009509474.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3, partial [Phalacrocorax carbo]
Length=157

 Score = 98.2 bits (243),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/114 (39%), Positives = 70/114 (61%), Gaps = 2/114 (2%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRAWPAV  494
            LDG +      S  F+Y++K+VPT Y  +  EV+ TNQFSV+ +  + +    D+  P V
Sbjct  36   LDGMDVTAQQASMMFQYFVKVVPTVYMKVDGEVVRTNQFSVTRHEKIANGLLGDQGLPGV  95

Query  493  YFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            + LY+LSP+ V + E+ RSF HF+T +CA++GG F + G +D  +Y    ++ K
Sbjct  96   FVLYELSPMMVKLTEKHRSFTHFLTGVCAIVGGIFTVAGFIDSLIYHSARSIQK  149



>ref|XP_005496546.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 isoform X2 [Zonotrichia albicollis]
Length=390

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 71/114 (62%), Gaps = 2/114 (2%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRAWPAV  494
            LDGT       S  F+Y++K+VPT YR +  EV+ TNQFSV+ +  + +    D+  P V
Sbjct  269  LDGTAITAQQASMMFQYFVKVVPTVYRKVDGEVVRTNQFSVTRHEKIANGLLGDQGLPGV  328

Query  493  YFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            + LY+LSP+ V + E+ RSF HF+T +CA++GG F + G +D  +Y    A+ K
Sbjct  329  FVLYELSPMMVKLTEKHRSFTHFLTGVCAIVGGIFTVAGFIDSLIYHSARAIQK  382



>ref|XP_010105897.1| hypothetical protein L484_021555 [Morus notabilis]
 gb|EXC06716.1| hypothetical protein L484_021555 [Morus notabilis]
Length=386

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 73/113 (65%), Gaps = 1/113 (1%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAW-PAVY  491
            LDG +      SG ++Y+IK+VPT Y  +S   + +NQFSV+E++      +  + P V+
Sbjct  266  LDGVKWTQETPSGMYQYFIKVVPTVYTDVSGHTIQSNQFSVTEHFRNSELGNLQFLPGVF  325

Query  490  FLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            F YDLSPI VT  EE  SFLHF+T +CA++GG F ++G+LD ++Y    A+ K
Sbjct  326  FFYDLSPIKVTFTEEHISFLHFLTNVCAIVGGVFTVSGILDSFIYHGQRAIKK  378



>ref|XP_004961675.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Setaria italica]
Length=384

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 72/112 (64%), Gaps = 0/112 (0%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDG +    A  GT++Y+IK+VPT Y  +    + +NQFSV+E++   +   +  P V+F
Sbjct  265  LDGAQWAQPASDGTYQYFIKVVPTIYTDIRGRKIHSNQFSVTEHFRDGNVRPKPQPGVFF  324

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             YD SPI V   EE RS LH++T LCA++GG F ++G++D ++Y   +A+ K
Sbjct  325  FYDFSPIKVIFTEENRSLLHYLTNLCAIVGGVFTVSGIIDSFIYHGQKALKK  376



>ref|XP_006472628.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Citrus sinensis]
 gb|KDO80919.1| hypothetical protein CISIN_1g016587mg [Citrus sinensis]
Length=386

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 72/113 (64%), Gaps = 1/113 (1%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFD-RAWPAVY  491
            LDG        SG ++Y+IK+VPT Y  +S   + +NQFSV+E++    +   +  P V+
Sbjct  266  LDGVRWTQETPSGMYQYFIKVVPTVYTDVSGHTIQSNQFSVTEHFRSSEQGRLQTLPGVF  325

Query  490  FLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            F YDLSPI VT  EE  SFLHF+T +CA++GG F ++G++D ++Y    A+ K
Sbjct  326  FFYDLSPIKVTFTEEHVSFLHFLTNVCAIVGGVFTVSGIIDAFIYHGQRAIKK  378



>ref|XP_005147587.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X1 [Melopsittacus undulatus]
Length=383

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 72/114 (63%), Gaps = 2/114 (2%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRAWPAV  494
            LDGT+      S  F+Y++K+VPT Y  +  EV+ TNQFSV+ +  + +    D+  P V
Sbjct  262  LDGTDVTAQQASMMFQYFVKVVPTVYMKVDGEVVRTNQFSVTRHEKIANGLLGDQGLPGV  321

Query  493  YFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            + LY+LSP+ V + E+ RSF HF+T +CA++GG F + G++D  +Y    A+ K
Sbjct  322  FVLYELSPMMVKLTEKHRSFTHFLTGVCAIVGGIFTVAGLIDSLIYHSARAIQK  375



>gb|ETE61956.1| Endoplasmic reticulum-Golgi intermediate compartment protein 
3 [Ophiophagus hannah]
Length=327

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 72/114 (63%), Gaps = 2/114 (2%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRAWPAV  494
            LDGT    H  S  F+Y++K+VPT Y  +  E++ TNQFSV+ +  + +    D+  P V
Sbjct  206  LDGTVVTAHQASMMFQYFVKVVPTVYMKVDGEMVRTNQFSVTRHEKIANGLIGDQGLPGV  265

Query  493  YFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            + LY+LSP+ V + E+ RSF HF+T +CA++GG F + G++D  +Y    A+ K
Sbjct  266  FVLYELSPMMVKLTEKHRSFTHFLTGVCAIIGGVFTVAGLIDSLIYHSARAIQK  319



>ref|NP_001141198.1| uncharacterized protein LOC100273285 [Zea mays]
 gb|ACF85689.1| unknown [Zea mays]
 gb|ACR36949.1| unknown [Zea mays]
 gb|AFW78472.1| DUF1692 domain, endoplasmic reticulum vescicle transporter protein 
[Zea mays]
Length=384

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 72/112 (64%), Gaps = 0/112 (0%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDG +    A  GT++Y+IK+VPT Y  +    + +NQFSV+E++   +   +  P V+F
Sbjct  265  LDGAQWTQPASDGTYQYFIKVVPTIYTDIRGHNIHSNQFSVTEHFRDGNVRPKPQPGVFF  324

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             YD SPI V   EE RS LH++T LCA++GG F ++G++D ++Y   +A+ K
Sbjct  325  FYDFSPIKVIFTEESRSLLHYLTNLCAIVGGVFTVSGIIDSFIYHGQKALKK  376



>ref|XP_005147588.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X2 [Melopsittacus undulatus]
Length=388

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 72/114 (63%), Gaps = 2/114 (2%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRAWPAV  494
            LDGT+      S  F+Y++K+VPT Y  +  EV+ TNQFSV+ +  + +    D+  P V
Sbjct  267  LDGTDVTAQQASMMFQYFVKVVPTVYMKVDGEVVRTNQFSVTRHEKIANGLLGDQGLPGV  326

Query  493  YFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            + LY+LSP+ V + E+ RSF HF+T +CA++GG F + G++D  +Y    A+ K
Sbjct  327  FVLYELSPMMVKLTEKHRSFTHFLTGVCAIVGGIFTVAGLIDSLIYHSARAIQK  380



>ref|XP_010939627.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Elaeis guineensis]
Length=386

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/114 (43%), Positives = 74/114 (65%), Gaps = 3/114 (3%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDR--AWPAV  494
            LDG + +     G ++Y+IK+VPT Y  +S   + +NQFSV+E++    +  R  + P V
Sbjct  266  LDGVQWVQQTPYGMYQYFIKVVPTVYTDISGRTIQSNQFSVTEHFRS-DDVGRIQSLPGV  324

Query  493  YFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            +F YDLSPI VT  EE  SFLHF+T +CA++GG F ++G+LD ++Y    A+ K
Sbjct  325  FFFYDLSPIKVTFTEEHVSFLHFLTNVCAIVGGIFTVSGILDSFIYHGQRAIKK  378



>ref|XP_001759631.1| predicted protein [Physcomitrella patens]
 gb|EDQ75543.1| predicted protein [Physcomitrella patens]
Length=382

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 74/119 (62%), Gaps = 1/119 (1%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF-DRAWPAVY  491
            LD  ERI     G ++Y+IK+VPT Y       + TNQF+V++++  +    D A P V+
Sbjct  264  LDKLERIQTTTHGMYQYFIKVVPTVYTDTRGRKISTNQFAVTDHFKGVGPGEDHALPGVF  323

Query  490  FLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARST  314
            F YDLSPI V   E+R SF HF+T +CA++GG F+++G++D ++Y   + + K   + T
Sbjct  324  FFYDLSPIKVKFTEKRMSFFHFLTNVCAIVGGVFSVSGIIDAFVYHGQKQIKKRLGKDT  382



>ref|XP_009904016.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3, partial [Picoides pubescens]
Length=448

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 71/114 (62%), Gaps = 2/114 (2%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRAWPAV  494
            LDGT+      S  F+Y++K+VPT Y  +  EV+ TNQFSV+ +  + +    D+  P V
Sbjct  327  LDGTDVTAQQASMMFQYFVKVVPTVYMKVDGEVVRTNQFSVTRHEKIANGLLGDQGLPGV  386

Query  493  YFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            + LY+LSP+ V + E+ RSF HF+T +CA+LGG F + G +D  +Y    A+ K
Sbjct  387  FVLYELSPMMVKLTEKHRSFTHFLTGVCAILGGIFTVAGFIDSLIYHSARAIQK  440



>gb|KGL94343.1| Endoplasmic reticulum-Golgi intermediate compartment protein 
3, partial [Charadrius vociferus]
Length=336

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 71/114 (62%), Gaps = 2/114 (2%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRAWPAV  494
            LDGT+      S  F+Y++K+VPT Y  +  EV+ TNQFSV+ +  + +    D+  P V
Sbjct  215  LDGTDVTAQQASMMFQYFVKVVPTVYMKVDGEVVRTNQFSVTRHEKIANGLLGDQGLPGV  274

Query  493  YFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            + LY+LSP+ V + E+ RSF HF+T +CA++GG F + G +D  +Y    A+ K
Sbjct  275  FVLYELSPMMVKLTEKHRSFTHFLTGVCAIIGGIFTVAGFIDSLIYHSARAIQK  328



>ref|XP_009884638.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3, partial [Charadrius vociferus]
Length=344

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 71/114 (62%), Gaps = 2/114 (2%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRAWPAV  494
            LDGT+      S  F+Y++K+VPT Y  +  EV+ TNQFSV+ +  + +    D+  P V
Sbjct  223  LDGTDVTAQQASMMFQYFVKVVPTVYMKVDGEVVRTNQFSVTRHEKIANGLLGDQGLPGV  282

Query  493  YFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            + LY+LSP+ V + E+ RSF HF+T +CA++GG F + G +D  +Y    A+ K
Sbjct  283  FVLYELSPMMVKLTEKHRSFTHFLTGVCAIIGGIFTVAGFIDSLIYHSARAIQK  336



>ref|XP_006654573.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Oryza brachyantha]
Length=384

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 72/112 (64%), Gaps = 0/112 (0%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            L+G +    A  GT++Y+IK+VPT Y  L    + +NQFSV+E++   +   +  P V+F
Sbjct  265  LNGAQWTQPASDGTYQYFIKVVPTIYTDLRGRKIHSNQFSVTEHFRDGNVRPKPQPGVFF  324

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             YD SPI V   EE RS LH++T LCA++GG F ++G++D ++Y   +A+ K
Sbjct  325  FYDFSPIKVIFTEENRSLLHYLTNLCAIVGGVFTVSGIIDSFIYHGQKALKK  376



>ref|XP_009327626.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3, partial [Pygoscelis adeliae]
Length=210

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 69/114 (61%), Gaps = 2/114 (2%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRAWPAV  494
            LDGT+      S  F+Y++K+VPT Y  +  EV+ TNQFSV+    + +    D+  P V
Sbjct  89   LDGTDITAQQASMMFQYFVKVVPTVYMKVDGEVVRTNQFSVTRREKIANGLLGDQGLPGV  148

Query  493  YFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            + LY+L P+ V + EE RSF HF+T +CA++GG F + G +D  +Y    A+ K
Sbjct  149  FVLYELLPMMVKLTEEHRSFTHFLTGVCAIVGGIFTVAGFIDSLIYHSARAIQK  202



>ref|XP_010294012.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3, partial [Phaethon lepturus]
 gb|KFQ69900.1| Endoplasmic reticulum-Golgi intermediate compartment protein 
3, partial [Phaethon lepturus]
Length=330

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 71/114 (62%), Gaps = 2/114 (2%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRAWPAV  494
            LDGT+      S  F+Y++K+VPT Y  +  EV+ TNQFSV+ +  + +    D+  P V
Sbjct  209  LDGTDVTAQQASMMFQYFVKVVPTVYMKVDGEVVRTNQFSVTRHEKIANGLLGDQGLPGV  268

Query  493  YFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            + LY+LSP+ V + E+ RSF HF+T +CA++GG F + G +D  +Y    A+ K
Sbjct  269  FVLYELSPMMVKLTEKHRSFTHFLTGVCAIVGGIFTVAGFIDSLIYHSAHAIQK  322



>ref|XP_010562891.1| PREDICTED: LOW QUALITY PROTEIN: endoplasmic reticulum-Golgi intermediate 
compartment protein 3 [Haliaeetus leucocephalus]
Length=332

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 71/114 (62%), Gaps = 2/114 (2%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRAWPAV  494
            LDGT+      S  F+Y++K+VPT Y  +  EV+ TNQFSV+ +  + +    D+  P V
Sbjct  211  LDGTDVAAQQASMMFQYFVKVVPTVYMKVDGEVVRTNQFSVTRHEKIANGLLGDQGLPGV  270

Query  493  YFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            + LY+LSP+ V + E+ RSF HF+T +CA++GG F + G +D  +Y    A+ K
Sbjct  271  FVLYELSPMMVKLTEKHRSFTHFLTGVCAIVGGIFTVAGFIDSLIYHSARAIQK  324



>ref|XP_009946915.1| PREDICTED: LOW QUALITY PROTEIN: endoplasmic reticulum-Golgi intermediate 
compartment protein 3, partial [Leptosomus discolor]
Length=358

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 71/114 (62%), Gaps = 2/114 (2%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRAWPAV  494
            LDGT+      S  F+Y++K+VPT Y  +  EV+ TNQFSV+ +  + +    D+  P V
Sbjct  237  LDGTDVTAQQASMMFQYFVKVVPTVYMKVDGEVVRTNQFSVTRHEKIANGLLGDQGLPGV  296

Query  493  YFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            + LY+LSP+ V + E+ RSF HF+T +CA++GG F + G +D  +Y    A+ K
Sbjct  297  FVLYELSPMMVKLTEKHRSFTHFLTGVCAIIGGIFTVAGFIDSLIYHSARAIQK  350



>ref|XP_006354000.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Solanum tuberosum]
Length=386

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/114 (43%), Positives = 74/114 (65%), Gaps = 3/114 (3%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDR--AWPAV  494
            LDG         G ++Y+IK+VPT Y  +S   + +NQFSV+E++    +F R  + P V
Sbjct  266  LDGVMWTQETPHGMYQYFIKVVPTVYTDVSGHTIQSNQFSVTEHFQGA-DFGRFQSIPGV  324

Query  493  YFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            +F YDLSPI VT  E+  SFLHF+T +CA++GG F ++G+LD ++Y   +A+ K
Sbjct  325  FFFYDLSPIKVTFTEQHVSFLHFLTNVCAIVGGVFTVSGILDSFIYHGQKAIKK  378



>ref|XP_010676904.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Beta vulgaris subsp. vulgaris]
Length=386

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 74/113 (65%), Gaps = 1/113 (1%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYY-SLIHEFDRAWPAVY  491
            LDG     +  +G ++Y++K+VPT Y  ++   + +NQFSV+E++ S         P V+
Sbjct  266  LDGVHWTHNTPNGMYQYFLKVVPTVYTDVNGHTINSNQFSVTEHFKSASAGHFSTLPGVF  325

Query  490  FLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            F YDLSPI VT KEE  SFLHF+T +CA++GG F ++G++D ++Y   +A+ K
Sbjct  326  FFYDLSPIKVTFKEEHVSFLHFLTNVCAIVGGVFTVSGIIDSFVYHGQKAIKK  378



>ref|XP_005514697.1| PREDICTED: LOW QUALITY PROTEIN: endoplasmic reticulum-Golgi intermediate 
compartment protein 3, partial [Columba livia]
Length=343

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 71/114 (62%), Gaps = 2/114 (2%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRAWPAV  494
            LDGT+      S  F+Y++K+VPT Y  +  EV+ TNQFSV+ +  + +    D+  P V
Sbjct  222  LDGTDVTAQQASMMFQYFVKVVPTVYMKVDGEVVRTNQFSVTRHEKIANGLLGDQGLPGV  281

Query  493  YFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            + LY+LSP+ V + E+ RSF HF+T +CA++GG F + G +D  +Y    A+ K
Sbjct  282  FVLYELSPMMVKLTEKHRSFTHFLTGVCAIVGGIFTVAGFIDSLIYHSARAIQK  335



>gb|EMC76893.1| Endoplasmic reticulum-Golgi intermediate compartment protein 
3, partial [Columba livia]
Length=330

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 71/114 (62%), Gaps = 2/114 (2%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRAWPAV  494
            LDGT+      S  F+Y++K+VPT Y  +  EV+ TNQFSV+ +  + +    D+  P V
Sbjct  209  LDGTDVTAQQASMMFQYFVKVVPTVYMKVDGEVVRTNQFSVTRHEKIANGLLGDQGLPGV  268

Query  493  YFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            + LY+LSP+ V + E+ RSF HF+T +CA++GG F + G +D  +Y    A+ K
Sbjct  269  FVLYELSPMMVKLTEKHRSFTHFLTGVCAIVGGIFTVAGFIDSLIYHSARAIQK  322



>gb|KFR06735.1| Endoplasmic reticulum-Golgi intermediate compartment protein 
3, partial [Nipponia nippon]
Length=330

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 71/114 (62%), Gaps = 2/114 (2%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRAWPAV  494
            LDGT+      S  F+Y++K+VPT Y  +  EV+ TNQFSV+ +  + +    D+  P V
Sbjct  209  LDGTDVTAQQASMMFQYFVKVVPTVYMKVDGEVVRTNQFSVTRHEKIANGLLGDQGLPGV  268

Query  493  YFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            + LY+LSP+ V + E+ RSF HF+T +CA++GG F + G +D  +Y    A+ K
Sbjct  269  FVLYELSPMMVKLTEKHRSFTHFLTGVCAIVGGIFTVAGFIDSLIYHSARAIQK  322



>ref|XP_009471655.1| PREDICTED: LOW QUALITY PROTEIN: endoplasmic reticulum-Golgi intermediate 
compartment protein 3 [Nipponia nippon]
Length=342

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 71/114 (62%), Gaps = 2/114 (2%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRAWPAV  494
            LDGT+      S  F+Y++K+VPT Y  +  EV+ TNQFSV+ +  + +    D+  P V
Sbjct  221  LDGTDVTAQQASMMFQYFVKVVPTVYMKVDGEVVRTNQFSVTRHEKIANGLLGDQGLPGV  280

Query  493  YFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            + LY+LSP+ V + E+ RSF HF+T +CA++GG F + G +D  +Y    A+ K
Sbjct  281  FVLYELSPMMVKLTEKHRSFTHFLTGVCAIVGGIFTVAGFIDSLIYHSARAIQK  334



>ref|XP_008568949.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 isoform X3 [Galeopterus variegatus]
Length=370

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 71/114 (62%), Gaps = 2/114 (2%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRAWPAV  494
            LD T       S  F+Y++K+VPT Y  +  EVL TNQFSV+ +  + +    D+  P V
Sbjct  249  LDSTNVTAPQASMMFQYFVKVVPTVYMKVDGEVLRTNQFSVTRHEKVANGLLGDQGLPGV  308

Query  493  YFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            + LY+LSP+ V + E+RRSF HF+T +CA++GG F + G++D  +Y    A+ K
Sbjct  309  FVLYELSPMMVKLTEKRRSFTHFLTGVCAIIGGMFTVAGLIDSLIYHSARAIQK  362



>ref|XP_004142610.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Cucumis sativus]
 gb|KGN54613.1| hypothetical protein Csa_4G377760 [Cucumis sativus]
Length=385

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/116 (43%), Positives = 75/116 (65%), Gaps = 1/116 (1%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIH-EFDRAWPAVY  491
            LDG +      SG F+Y+IK+VPT Y+ ++ + + +NQFSV+++   I  E  +A   V+
Sbjct  265  LDGVQWNQGTLSGMFQYFIKVVPTVYKAVNGKAIKSNQFSVTQHLRGIDGESFQALHGVF  324

Query  490  FLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNA  323
            F YDLSPI VT  EE  SF HF+T +CA++GG F ++G+LD  +Y   +A+ K  A
Sbjct  325  FFYDLSPIKVTFTEEHISFFHFLTNVCAIVGGVFTISGILDSIIYHGQKAIKKKMA  380



>ref|XP_002977139.1| hypothetical protein SELMODRAFT_271242 [Selaginella moellendorffii]
 ref|XP_002992135.1| hypothetical protein SELMODRAFT_162191 [Selaginella moellendorffii]
 gb|EFJ06790.1| hypothetical protein SELMODRAFT_162191 [Selaginella moellendorffii]
 gb|EFJ21748.1| hypothetical protein SELMODRAFT_271242 [Selaginella moellendorffii]
Length=386

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/113 (40%), Positives = 74/113 (65%), Gaps = 1/113 (1%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFD-RAWPAVY  491
            LD  +RI    S  ++Y+IK+VPT Y  ++   + TNQFSV++++  +   + R+ P V+
Sbjct  266  LDKEKRIQKFPSAMYQYFIKVVPTAYTDMTGHKIVTNQFSVTDHFKAVEGLNGRSLPGVF  325

Query  490  FLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            F Y+LSPI V   E + SFLHF+T +CA++GG F ++G++D ++Y    A+ K
Sbjct  326  FFYELSPIKVLFTERKTSFLHFLTNVCAIIGGVFTVSGIIDSFIYHGHRAIKK  378



>ref|XP_008568816.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 isoform X1 [Galeopterus variegatus]
Length=388

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 71/114 (62%), Gaps = 2/114 (2%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRAWPAV  494
            LD T       S  F+Y++K+VPT Y  +  EVL TNQFSV+ +  + +    D+  P V
Sbjct  267  LDSTNVTAPQASMMFQYFVKVVPTVYMKVDGEVLRTNQFSVTRHEKVANGLLGDQGLPGV  326

Query  493  YFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            + LY+LSP+ V + E+RRSF HF+T +CA++GG F + G++D  +Y    A+ K
Sbjct  327  FVLYELSPMMVKLTEKRRSFTHFLTGVCAIIGGMFTVAGLIDSLIYHSARAIQK  380



>ref|NP_001087591.1| endoplasmic reticulum-Golgi intermediate compartment protein 
3 [Xenopus laevis]
 sp|Q66KH2.1|ERGI3_XENLA RecName: Full=Endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Xenopus laevis]
 gb|AAH80394.1| MGC83277 protein [Xenopus laevis]
Length=389

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 71/114 (62%), Gaps = 2/114 (2%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRAWPAV  494
            LDGT  +    S  F+Y++KIVPT Y  +  EVL TNQFSV+ +  + +    D+  P V
Sbjct  268  LDGTSIVAMQSSMMFQYFVKIVPTVYVKVDGEVLRTNQFSVTRHEKMTNGLIGDQGLPGV  327

Query  493  YFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            + LY+LSP+ V   E+ RSF HF+T +CA++GG F + G++D  +Y    A+ K
Sbjct  328  FVLYELSPMMVKFTEKHRSFTHFLTGVCAIIGGVFTVAGLIDSLIYYSTRAIQK  381



>ref|XP_008568883.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 isoform X2 [Galeopterus variegatus]
Length=383

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 71/114 (62%), Gaps = 2/114 (2%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRAWPAV  494
            LD T       S  F+Y++K+VPT Y  +  EVL TNQFSV+ +  + +    D+  P V
Sbjct  262  LDSTNVTAPQASMMFQYFVKVVPTVYMKVDGEVLRTNQFSVTRHEKVANGLLGDQGLPGV  321

Query  493  YFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            + LY+LSP+ V + E+RRSF HF+T +CA++GG F + G++D  +Y    A+ K
Sbjct  322  FVLYELSPMMVKLTEKRRSFTHFLTGVCAIIGGMFTVAGLIDSLIYHSARAIQK  375



>ref|XP_005986794.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X2 [Latimeria chalumnae]
Length=385

 Score =   100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 71/114 (62%), Gaps = 2/114 (2%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRAWPAV  494
            LDGT+      S  F+Y++KIVPT Y  +  EV+ TNQFSV+ +  + +    D+  P V
Sbjct  264  LDGTKVFAEQASMMFQYFVKIVPTIYVNIDGEVVRTNQFSVTRHEKVANGLIGDQGLPGV  323

Query  493  YFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            + LY+LSP+ V   E+ RSF HF+T +CA++GG F + G++D  +Y    A+ K
Sbjct  324  FVLYELSPMMVKFTEKHRSFTHFLTGVCAIIGGVFTVAGLIDSLIYHSARAIQK  377



>ref|XP_005986793.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X1 [Latimeria chalumnae]
Length=390

 Score =   100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 71/114 (62%), Gaps = 2/114 (2%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRAWPAV  494
            LDGT+      S  F+Y++KIVPT Y  +  EV+ TNQFSV+ +  + +    D+  P V
Sbjct  269  LDGTKVFAEQASMMFQYFVKIVPTIYVNIDGEVVRTNQFSVTRHEKVANGLIGDQGLPGV  328

Query  493  YFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            + LY+LSP+ V   E+ RSF HF+T +CA++GG F + G++D  +Y    A+ K
Sbjct  329  FVLYELSPMMVKFTEKHRSFTHFLTGVCAIIGGVFTVAGLIDSLIYHSARAIQK  382



>ref|XP_009419975.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Musa acuminata subsp. malaccensis]
Length=386

 Score =   100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/114 (43%), Positives = 73/114 (64%), Gaps = 3/114 (3%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAW--PAV  494
            LDG + + HA  G ++Y+IK+VPT Y  +    + +NQFSV+E++    +  R    P V
Sbjct  266  LDGVQWVQHAPYGMYQYFIKVVPTVYTDIRGRTIQSNQFSVTEHFRS-DDIGRLQYLPGV  324

Query  493  YFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            +F YDLSPI VT  E   SFLHF+T +CA++GG F ++G+LD ++Y    A+ K
Sbjct  325  FFFYDLSPIKVTFTEGHVSFLHFLTNVCAIVGGVFTVSGILDSFIYHGQRAIKK  378



>ref|XP_005057037.1| PREDICTED: uncharacterized protein LOC101821551 [Ficedula albicollis]
Length=844

 Score =   102 bits (255),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 47/114 (41%), Positives = 71/114 (62%), Gaps = 2/114 (2%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRAWPAV  494
            LDGT       S  F+Y++K+VPT YR +  EV+ TNQFSV+ +  + +    D+  P V
Sbjct  723  LDGTAITAQQASMMFQYFVKVVPTVYRKVDGEVVRTNQFSVTRHEKIANGLLGDQGLPGV  782

Query  493  YFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            + LY+LSP+ V + E+ RSF HF+T +CA++GG F + G +D  +Y    A+ K
Sbjct  783  FVLYELSPMMVKLTEKHRSFTHFLTGVCAIVGGIFTVAGFIDSLIYHSARAIQK  836



>gb|ERZ99514.1| hypothetical protein GLOINDRAFT_339028, partial [Rhizophagus 
irregularis DAOM 181602]
Length=275

 Score = 99.4 bits (246),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 74/121 (61%), Gaps = 9/121 (7%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEY---------YSLIHEF  515
            LDG  R +  G   F+Y++K+V T++ YL+K  + TNQ+SV++Y            +H  
Sbjct  147  LDGIGRSVSQGHYMFQYFVKVVSTQFHYLNKTTIDTNQYSVTQYERDLTGRDTSGHVHTH  206

Query  514  DRAWPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVT  335
                P V+F YD+SP+ +  +EER+SF HF+T +CA++GG F + G+LD ++Y   + + 
Sbjct  207  QGGLPGVFFNYDISPMLIINREERKSFTHFLTGVCAIVGGIFTVAGILDGFIYNAQKTLQ  266

Query  334  K  332
            +
Sbjct  267  R  267



>ref|XP_003615024.1| Endoplasmic reticulum-Golgi intermediate compartment protein 
[Medicago truncatula]
 gb|AES97982.1| endoplasmic reticulum vesicle transporter [Medicago truncatula]
Length=386

 Score =   100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 71/103 (69%), Gaps = 3/103 (3%)
 Frame = -3

Query  634  SGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDR--AWPAVYFLYDLSPITV  461
            SG ++Y+IK+VPT Y  +S   + +NQFSV+E++    +  R  + P V+F YDLSPI V
Sbjct  277  SGMYQYFIKVVPTMYTDVSGNTIQSNQFSVTEHFRTA-DVGRLQSLPGVFFFYDLSPIKV  335

Query  460  TIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            T  EE  SFLHF+T +CA++GG F ++G+LD ++Y   +A+ K
Sbjct  336  TFTEEHVSFLHFLTNVCAIVGGIFTVSGILDSFIYHGQKAIKK  378



>ref|XP_008445347.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Cucumis melo]
Length=386

 Score =   100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 50/114 (44%), Positives = 74/114 (65%), Gaps = 3/114 (3%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDR--AWPAV  494
            LDG +      S T++Y+IK+VPT Y+ +S   + +NQFSV+E+     E  R  + PAV
Sbjct  266  LDGVQWEQETPSATYQYFIKVVPTVYKDVSGNTIQSNQFSVTEHVRTA-EVGRLQSLPAV  324

Query  493  YFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            +F YDLSPI VT  E   SFLHF+T +CA++GG F ++G+LD ++Y   + + K
Sbjct  325  FFFYDLSPIKVTFTEGHVSFLHFLTNVCAIVGGIFTVSGILDSFIYHGQKVIKK  378



>ref|XP_009595173.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X2 [Nicotiana tomentosiformis]
Length=376

 Score =   100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 75/114 (66%), Gaps = 3/114 (3%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYY--SLIHEFDRAWPAV  494
            LDG         G ++Y+IK+VPT Y  +S   + +NQFSV+E++  + +  F ++ P V
Sbjct  256  LDGVTWTQETPHGMYQYFIKVVPTVYTDVSGHTIQSNQFSVTEHFKGADVGRF-QSIPGV  314

Query  493  YFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            +F YDLSPI VT  E+  SFLHF+T +CA++GG F ++G+LD ++Y   +A+ K
Sbjct  315  FFFYDLSPIKVTFTEQHVSFLHFLTNVCAIVGGVFTVSGILDSFIYHGQKAIKK  368



>ref|XP_011087876.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Sesamum indicum]
Length=384

 Score =   100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 73/120 (61%), Gaps = 0/120 (0%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDG + +    +G ++Y+ K+VPT Y  +    + +NQFSV+E+Y       R+ P V+F
Sbjct  265  LDGVQWVQENPNGVYQYFTKVVPTIYTNIRGHTIESNQFSVTEHYKSSEVDFRSPPGVFF  324

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
             YDLSPI VT  E    FLHF+T +CA++GG F + G++D ++Y   +A+ K +    +R
Sbjct  325  FYDLSPIKVTFAEAHTPFLHFLTHICAIVGGIFTVAGIVDSFIYHGQKAIRKKSEIGKLR  384



>ref|XP_004340798.1| golgi family protein, putative [Acanthamoeba castellanii str. 
Neff]
 gb|ELR18746.1| golgi family protein, putative [Acanthamoeba castellanii str. 
Neff]
Length=383

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 74/115 (64%), Gaps = 3/115 (3%)
 Frame = -3

Query  667  LDGTERILHAGSGT--FKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAW-PA  497
            LDG E+    G+G+  ++Y++KIVPT Y  L   V+ TNQFSV+E+  ++   D++  P 
Sbjct  261  LDGVEKTTDPGAGSAMYQYFVKIVPTIYESLDGNVINTNQFSVTEHTRMLPPGDKSGLPG  320

Query  496  VYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            ++ +YDLSPI V   E  +SF HF+T +CA++GG F + G++D  +Y  +  + K
Sbjct  321  LFVMYDLSPIMVKFTERTKSFAHFLTGVCAIIGGVFTVAGIIDSLIYNSLRTLGK  375



>ref|XP_010080198.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3, partial [Pterocles gutturalis]
 gb|KFV13924.1| Endoplasmic reticulum-Golgi intermediate compartment protein 
3, partial [Pterocles gutturalis]
Length=330

 Score = 99.8 bits (247),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 71/114 (62%), Gaps = 2/114 (2%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRAWPAV  494
            LDGT+      S  F+Y++K+VPT Y  +  E++ TNQFSV+ +  + +    D+  P V
Sbjct  209  LDGTDVTAQQASMMFQYFVKVVPTVYMKVDGEIVRTNQFSVTRHEKIANGLLGDQGLPGV  268

Query  493  YFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            + LY+LSP+ V + E+ RSF HF+T +CA++GG F + G +D  +Y    A+ K
Sbjct  269  FVLYELSPMMVKLTEKHRSFTHFLTGVCAIVGGIFTVAGFIDSLIYHSARAIQK  322



>ref|XP_009595172.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009779132.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Nicotiana sylvestris]
Length=386

 Score = 99.8 bits (247),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 75/114 (66%), Gaps = 3/114 (3%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYY--SLIHEFDRAWPAV  494
            LDG         G ++Y+IK+VPT Y  +S   + +NQFSV+E++  + +  F ++ P V
Sbjct  266  LDGVTWTQETPHGMYQYFIKVVPTVYTDVSGHTIQSNQFSVTEHFKGADVGRF-QSIPGV  324

Query  493  YFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            +F YDLSPI VT  E+  SFLHF+T +CA++GG F ++G+LD ++Y   +A+ K
Sbjct  325  FFFYDLSPIKVTFTEQHVSFLHFLTNVCAIVGGVFTVSGILDSFIYHGQKAIKK  378



>ref|XP_004514266.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Cicer arietinum]
Length=386

 Score = 99.8 bits (247),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 72/103 (70%), Gaps = 3/103 (3%)
 Frame = -3

Query  634  SGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSL--IHEFDRAWPAVYFLYDLSPITV  461
            +G ++Y+IK+VPT Y  +S   + +NQFSV+E++    +  F ++ P V+F YDLSPI V
Sbjct  277  TGMYQYFIKVVPTVYTDVSGHTIQSNQFSVTEHFRTGDVGHF-QSLPGVFFFYDLSPIQV  335

Query  460  TIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            T  EE  SFLHF+T +CA++GG F ++G+LD ++Y   +A+ K
Sbjct  336  TFTEEHVSFLHFLTNVCAIVGGIFTVSGILDSFIYHGQKAIKK  378



>gb|KJB59935.1| hypothetical protein B456_009G281900 [Gossypium raimondii]
Length=278

 Score = 99.0 bits (245),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 71/103 (69%), Gaps = 3/103 (3%)
 Frame = -3

Query  634  SGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDR--AWPAVYFLYDLSPITV  461
            SG ++Y++K+VPT Y  +S   + +NQFSV+E++    E  R  + P V+F YDLSPI V
Sbjct  169  SGMYQYFLKVVPTVYTDVSGHTIQSNQFSVTEHFKGA-EVGRLQSLPGVFFFYDLSPIKV  227

Query  460  TIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            T  E+  SFLHF+T +CA++GG F ++G+LD ++Y   +A+ K
Sbjct  228  TFTEQHVSFLHFLTNVCAIVGGVFTVSGILDSFIYHGQKAIKK  270



>ref|XP_007429095.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 isoform X2 [Python bivittatus]
Length=372

 Score = 99.8 bits (247),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 71/114 (62%), Gaps = 2/114 (2%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRAWPAV  494
            LDGT       S  F+Y++K+VPT Y  +  EV+ TNQFSV+ +  + +    D+  P V
Sbjct  251  LDGTVVAAQQASMMFQYFVKVVPTVYMKVDGEVVRTNQFSVTRHEKIANGLIGDQGLPGV  310

Query  493  YFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            + LY+LSP+ V + E+ RSF HF+T +CA++GG F + G++D  +Y    A+ K
Sbjct  311  FVLYELSPMMVKLTEKHRSFTHFLTGVCAIIGGVFTVAGLIDSLIYHSARAIQK  364



>ref|XP_007141162.1| hypothetical protein PHAVU_008G172300g [Phaseolus vulgaris]
 gb|ESW13156.1| hypothetical protein PHAVU_008G172300g [Phaseolus vulgaris]
Length=386

 Score = 99.8 bits (247),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 49/114 (43%), Positives = 73/114 (64%), Gaps = 3/114 (3%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDR--AWPAV  494
            LD    I    SG ++Y+IK+VPT Y  ++   + +NQFSV+E++    +  R  + P V
Sbjct  266  LDNVHWIQETPSGMYQYFIKVVPTVYTDVNGHAIQSNQFSVTEHFR-TGDVGRLQSLPGV  324

Query  493  YFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            +F YDLSPI VT  EE  SFLHF+T +CA++GG F ++G+LD ++Y    A+ K
Sbjct  325  FFFYDLSPIKVTFTEEHVSFLHFLTNVCAIVGGIFTVSGILDSFIYHGQRAIKK  378



>gb|KFV43899.1| Endoplasmic reticulum-Golgi intermediate compartment protein 
3, partial [Tyto alba]
Length=330

 Score = 99.4 bits (246),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 71/114 (62%), Gaps = 2/114 (2%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRAWPAV  494
            LDGT+      S  F+Y++K+VPT Y  +  EV+ +NQFSV+ +  + +    D+  P V
Sbjct  209  LDGTDVTAQQASMMFQYFVKVVPTVYMKVDGEVVRSNQFSVTRHEKIANGLLGDQGLPGV  268

Query  493  YFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            + LY+LSP+ V + E+ RSF HF+T +CA++GG F + G +D  +Y    A+ K
Sbjct  269  FVLYELSPMMVKLTEKHRSFTHFLTGVCAIIGGIFTVAGFIDSLVYHSARAIQK  322



>dbj|BAJ86415.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=363

 Score = 99.8 bits (247),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 65/100 (65%), Gaps = 0/100 (0%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDG +    A  GT++Y+IK+VPT Y  +    + +NQFSV+E++   +   R  P V+F
Sbjct  264  LDGAQWTQPASDGTYQYFIKVVPTIYNDIRGRKIDSNQFSVTEHFRDGNVQPRPQPGVFF  323

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLD  368
             YD SPI V   EE RSFLH++T LCA++GG F + G++D
Sbjct  324  FYDFSPIKVIFTEENRSFLHYLTNLCAIVGGIFTVAGIID  363



>ref|XP_009812641.1| PREDICTED: LOW QUALITY PROTEIN: endoplasmic reticulum-Golgi intermediate 
compartment protein 3, partial [Gavia stellata]
Length=334

 Score = 99.4 bits (246),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 71/114 (62%), Gaps = 2/114 (2%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRAWPAV  494
            LDGT+      S  F+Y++K+VPT Y  +  EV+ TNQFSV+ +  + +    D+  P V
Sbjct  213  LDGTDVTAQQASMMFQYFVKVVPTVYMKVDGEVVRTNQFSVTRHEKIANGLLGDQGLPGV  272

Query  493  YFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            + LY+LSP+ V + E+ RSF HF+T +CA++GG F + G +D  +Y    A+ K
Sbjct  273  FVLYELSPMMVKLTEKHRSFTHFLTGVCAIVGGIFTVAGFIDSLIYHSACAIQK  326



>gb|KFP09370.1| Endoplasmic reticulum-Golgi intermediate compartment protein 
3, partial [Egretta garzetta]
Length=330

 Score = 99.4 bits (246),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 71/114 (62%), Gaps = 2/114 (2%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRAWPAV  494
            LDGT+      S  F+Y++K+VPT Y  +  EV+ TNQFSV+ +  + +    D+  P V
Sbjct  209  LDGTDVTAQQASMMFQYFVKVVPTVYMKVDGEVVRTNQFSVTRHEKIANGLLGDQGLPGV  268

Query  493  YFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            + LY+LSP+ V + E+ RSF HF+T +CA++GG F + G +D  +Y    A+ K
Sbjct  269  FVLYELSPMMVKLTEKHRSFTHFLTGVCAIVGGIFTVAGFIDSLIYHSACAIQK  322



>ref|XP_009636179.1| PREDICTED: LOW QUALITY PROTEIN: endoplasmic reticulum-Golgi intermediate 
compartment protein 3, partial [Egretta garzetta]
Length=346

 Score = 99.4 bits (246),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 71/114 (62%), Gaps = 2/114 (2%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRAWPAV  494
            LDGT+      S  F+Y++K+VPT Y  +  EV+ TNQFSV+ +  + +    D+  P V
Sbjct  225  LDGTDVTAQQASMMFQYFVKVVPTVYMKVDGEVVRTNQFSVTRHEKIANGLLGDQGLPGV  284

Query  493  YFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            + LY+LSP+ V + E+ RSF HF+T +CA++GG F + G +D  +Y    A+ K
Sbjct  285  FVLYELSPMMVKLTEKHRSFTHFLTGVCAIVGGIFTVAGFIDSLIYHSACAIQK  338



>ref|XP_008444108.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Cucumis melo]
Length=385

 Score = 99.8 bits (247),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 50/116 (43%), Positives = 74/116 (64%), Gaps = 1/116 (1%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIH-EFDRAWPAVY  491
            LDG +      SG F+Y+IK+VPT Y  ++ + + +NQFSV+++   I  E  +A   V+
Sbjct  265  LDGVQWSQGTLSGMFQYFIKVVPTVYEAVNGKAIKSNQFSVTQHLRGIDGESFQALHGVF  324

Query  490  FLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNA  323
            F YDLSPI VT  EE  SF HF+T +CA++GG F ++G+LD  +Y   +A+ K  A
Sbjct  325  FFYDLSPIKVTFTEEHISFFHFLTNVCAIVGGVFTISGILDSIIYHGQKAIKKKMA  380



>ref|XP_009973938.1| PREDICTED: LOW QUALITY PROTEIN: endoplasmic reticulum-Golgi intermediate 
compartment protein 3, partial [Tyto alba]
Length=346

 Score = 99.4 bits (246),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 71/114 (62%), Gaps = 2/114 (2%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRAWPAV  494
            LDGT+      S  F+Y++K+VPT Y  +  EV+ +NQFSV+ +  + +    D+  P V
Sbjct  225  LDGTDVTAQQASMMFQYFVKVVPTVYMKVDGEVVRSNQFSVTRHEKIANGLLGDQGLPGV  284

Query  493  YFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            + LY+LSP+ V + E+ RSF HF+T +CA++GG F + G +D  +Y    A+ K
Sbjct  285  FVLYELSPMMVKLTEKHRSFTHFLTGVCAIIGGIFTVAGFIDSLVYHSARAIQK  338



>gb|KFV55314.1| Endoplasmic reticulum-Golgi intermediate compartment protein 
3, partial [Gavia stellata]
Length=330

 Score = 99.4 bits (246),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 71/114 (62%), Gaps = 2/114 (2%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRAWPAV  494
            LDGT+      S  F+Y++K+VPT Y  +  EV+ TNQFSV+ +  + +    D+  P V
Sbjct  209  LDGTDVTAQQASMMFQYFVKVVPTVYMKVDGEVVRTNQFSVTRHEKIANGLLGDQGLPGV  268

Query  493  YFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            + LY+LSP+ V + E+ RSF HF+T +CA++GG F + G +D  +Y    A+ K
Sbjct  269  FVLYELSPMMVKLTEKHRSFTHFLTGVCAIVGGIFTVAGFIDSLIYHSACAIQK  322



>ref|XP_010133714.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3, partial [Buceros rhinoceros silvestris]
Length=330

 Score = 99.4 bits (246),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 71/114 (62%), Gaps = 2/114 (2%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRAWPAV  494
            LDGT+      S  F+Y++K+VPT Y  +  EV+ TNQFSV+ +  + +    D+  P V
Sbjct  209  LDGTDVTAQQASMMFQYFVKVVPTVYMKVDGEVVRTNQFSVTRHEKIANGLLGDQGLPGV  268

Query  493  YFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            + LY+LSP+ V + E+ RSF HF+T +CA++GG F + G +D  +Y    A+ K
Sbjct  269  FVLYELSPMMVKLTEKHRSFTHFLTGVCAIVGGIFTVAGFIDSLIYHSACAIQK  322



>ref|NP_001091124.1| ERGIC and golgi 3 [Xenopus laevis]
 gb|AAI29573.1| LOC100036873 protein [Xenopus laevis]
Length=384

 Score = 99.4 bits (246),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 71/114 (62%), Gaps = 2/114 (2%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRAWPAV  494
            LDGT  +    S  F+Y++KIVPT Y  +  EVL TNQFSV+ +  + +    D+  P V
Sbjct  263  LDGTSIVAMQSSMMFQYFVKIVPTVYVKVDGEVLRTNQFSVTRHEKMTNGLIGDQGLPGV  322

Query  493  YFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            + LY+LSP+ V + E+ RSF HF+T +CA++GG F +  ++D  +Y    A+ K
Sbjct  323  FVLYELSPMMVKLTEKHRSFTHFLTGVCAIIGGVFTVASLIDALIYHSTRAIQK  376



>ref|XP_007429094.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 isoform X1 [Python bivittatus]
Length=383

 Score = 99.4 bits (246),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 71/114 (62%), Gaps = 2/114 (2%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRAWPAV  494
            LDGT       S  F+Y++K+VPT Y  +  EV+ TNQFSV+ +  + +    D+  P V
Sbjct  262  LDGTVVAAQQASMMFQYFVKVVPTVYMKVDGEVVRTNQFSVTRHEKIANGLIGDQGLPGV  321

Query  493  YFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            + LY+LSP+ V + E+ RSF HF+T +CA++GG F + G++D  +Y    A+ K
Sbjct  322  FVLYELSPMMVKLTEKHRSFTHFLTGVCAIIGGVFTVAGLIDSLIYHSARAIQK  375



>ref|NP_001055898.1| Os05g0490200 [Oryza sativa Japonica Group]
 gb|AAT69636.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF17812.1| Os05g0490200 [Oryza sativa Japonica Group]
 gb|EEC79441.1| hypothetical protein OsI_20422 [Oryza sativa Indica Group]
 gb|EEE64185.1| hypothetical protein OsJ_19017 [Oryza sativa Japonica Group]
Length=384

 Score = 99.4 bits (246),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 71/112 (63%), Gaps = 0/112 (0%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDG +    A  GT++Y+IK+VPT Y  L    + +NQFSV+E++   +   +  P V+F
Sbjct  265  LDGAQWTQPASDGTYQYFIKVVPTIYTDLRGRKIHSNQFSVTEHFRDGNIRPKPQPGVFF  324

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             YD SPI V   EE  S LH++T LCA++GG F ++G++D ++Y   +A+ K
Sbjct  325  FYDFSPIKVIFTEENSSLLHYLTNLCAIVGGVFTVSGIIDSFIYHGQKALKK  376



>ref|XP_008173907.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 isoform X3 [Chrysemys picta bellii]
Length=351

 Score = 99.4 bits (246),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 71/114 (62%), Gaps = 2/114 (2%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRAWPAV  494
            LDGT+      S  F+Y++K+VPT Y  +  EV+ TNQFSV+ +  + +    D+  P V
Sbjct  230  LDGTDITAQQASMMFQYFVKVVPTVYMKVDGEVVRTNQFSVTRHEKIANGLIGDQGLPGV  289

Query  493  YFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            + LY+LSP+ V + E+ R F HF+T +CA++GG F + G++D  +Y    A+ K
Sbjct  290  FVLYELSPMMVKLTEKHRPFTHFLTGVCAIVGGVFTVAGLIDSLIYHSARAIQK  343



>ref|XP_010269218.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X3 [Nelumbo nucifera]
Length=344

 Score = 99.4 bits (246),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 71/113 (63%), Gaps = 1/113 (1%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIH-EFDRAWPAVY  491
            LDG        SG ++Y+IK+VPT Y  ++   + +NQFSV+E+Y      + +  P V+
Sbjct  224  LDGVHWTQKTPSGMYQYFIKVVPTVYTDINGHAIQSNQFSVTEHYRDAEFTYPQFLPGVF  283

Query  490  FLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            F YDLSPI VT  EE  SFLHF+T +CA++GG F ++G++D ++Y     + K
Sbjct  284  FFYDLSPIKVTFTEEHVSFLHFLTNVCAIVGGIFTVSGIVDSFIYHGQRVIKK  336



>ref|XP_006126746.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X1 [Pelodiscus sinensis]
Length=383

 Score = 99.4 bits (246),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 71/114 (62%), Gaps = 2/114 (2%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRAWPAV  494
            LDGT+      S  F+Y++K+VPT Y  +  EV+ TNQFSV+ +  + +    D+  P V
Sbjct  262  LDGTDVTAQQASMMFQYFVKVVPTVYMKVDGEVVRTNQFSVTRHEKIANGLIGDQGLPGV  321

Query  493  YFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            + LY+LSP+ V + E+ R F HF+T +CA++GG F + G++D  +Y    A+ K
Sbjct  322  FVLYELSPMMVKLTEKHRPFTHFLTGVCAIVGGVFTVAGLIDSLIYHSARAIQK  375



>ref|XP_010269216.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X1 [Nelumbo nucifera]
Length=386

 Score = 99.4 bits (246),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 71/113 (63%), Gaps = 1/113 (1%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIH-EFDRAWPAVY  491
            LDG        SG ++Y+IK+VPT Y  ++   + +NQFSV+E+Y      + +  P V+
Sbjct  266  LDGVHWTQKTPSGMYQYFIKVVPTVYTDINGHAIQSNQFSVTEHYRDAEFTYPQFLPGVF  325

Query  490  FLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            F YDLSPI VT  EE  SFLHF+T +CA++GG F ++G++D ++Y     + K
Sbjct  326  FFYDLSPIKVTFTEEHVSFLHFLTNVCAIVGGIFTVSGIVDSFIYHGQRVIKK  378



>gb|EAW76200.1| ERGIC and golgi 3, isoform CRA_b [Homo sapiens]
Length=239

 Score = 97.8 bits (242),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 70/114 (61%), Gaps = 2/114 (2%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRAWPAV  494
            LD T       S  F+Y++K+VPT Y  +  EVL TNQFSV+ +  + +    D+  P V
Sbjct  118  LDHTNVTAPQASMMFQYFVKVVPTVYMKVDGEVLRTNQFSVTRHEKVANGLLGDQGLPGV  177

Query  493  YFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            + LY+LSP+ V + E+ RSF HF+T +CA++GG F + G++D  +Y    A+ K
Sbjct  178  FVLYELSPMMVKLTEKHRSFTHFLTGVCAIIGGMFTVAGLIDSLIYHSARAIQK  231



>gb|KHN26081.1| Endoplasmic reticulum-Golgi intermediate compartment protein 
3 [Glycine soja]
Length=386

 Score = 99.4 bits (246),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 70/103 (68%), Gaps = 3/103 (3%)
 Frame = -3

Query  634  SGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDR--AWPAVYFLYDLSPITV  461
            SG ++Y+IK+VPT Y  +S   + +NQFSV+E++    +  R  + P V+F YDLSPI V
Sbjct  277  SGMYQYFIKVVPTVYTDVSGHTIQSNQFSVTEHFR-TGDMGRLQSLPGVFFFYDLSPIKV  335

Query  460  TIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            T  EE  SFLHF+T +CA++GG F ++G+LD ++Y    A+ K
Sbjct  336  TFTEENVSFLHFLTNVCAIVGGIFTVSGILDSFIYHGQRAIKK  378



>ref|XP_009386733.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Musa acuminata subsp. malaccensis]
Length=384

 Score = 99.4 bits (246),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 43/100 (43%), Positives = 65/100 (65%), Gaps = 0/100 (0%)
 Frame = -3

Query  631  GTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYFLYDLSPITVTIK  452
            G ++Y+IK+VPT Y  +    + +NQFSV+E++     + R  P VYF YD SPI V   
Sbjct  277  GMYQYFIKVVPTIYHGIRGHKINSNQFSVTEHFRDESVYPRPLPGVYFFYDFSPIKVIFT  336

Query  451  EERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            EE RS LHF+T+LCA++GG F ++G++D ++Y     + K
Sbjct  337  EENRSILHFLTQLCAIIGGVFTVSGIIDAFVYHGARTIKK  376



>gb|ACA64886.1| endoplasmic reticulum-Golgi intermediate compartment protein 
3 (predicted) [Callicebus moloch]
Length=237

 Score = 97.8 bits (242),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 70/114 (61%), Gaps = 2/114 (2%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRAWPAV  494
            LD T       S  F+Y++K+VPT Y  +  EVL TNQFSV+ +  + +    D+  P V
Sbjct  116  LDHTNVTAPQASMMFQYFVKVVPTVYMKVDGEVLRTNQFSVTRHEKVANGLLGDQGLPGV  175

Query  493  YFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            + LY+LSP+ V + E+ RSF HF+T +CA++GG F + G++D  +Y    A+ K
Sbjct  176  FVLYELSPMMVKLTEKHRSFTHFLTGVCAIIGGMFTVAGLIDSLIYHSARAIQK  229



>ref|XP_007042992.1| Endoplasmic reticulum vesicle transporter protein [Theobroma 
cacao]
 gb|EOX98823.1| Endoplasmic reticulum vesicle transporter protein [Theobroma 
cacao]
Length=386

 Score = 99.4 bits (246),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 45/105 (43%), Positives = 71/105 (68%), Gaps = 1/105 (1%)
 Frame = -3

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHE-FDRAWPAVY  491
            LDG + I    +G ++Y+IK+VPT Y  +    + +NQ+SV++++  +   +  + P V+
Sbjct  266  LDGAQWIHETSNGMYQYFIKVVPTIYTDIRGRTVHSNQYSVTQHFKNLEVIYPNSHPGVF  325

Query  490  FLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMY  356
            F+YD SPI VT KEE  SFLHFIT +CAV+GG F + G++D ++Y
Sbjct  326  FIYDFSPIKVTFKEEHISFLHFITNICAVIGGIFTVAGIIDSFVY  370



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1064095936780