BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF026M01

Length=636
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KDO42760.1|  hypothetical protein CISIN_1g014592mg                   312   4e-102   Citrus sinensis [apfelsine]
gb|KDO42759.1|  hypothetical protein CISIN_1g014592mg                   313   5e-102   Citrus sinensis [apfelsine]
ref|XP_006441587.1|  hypothetical protein CICLE_v10020303mg             313   6e-102   Citrus clementina [clementine]
ref|XP_007041181.1|  Elongation factor 1-gamma 3 isoform 1              311   4e-101   Theobroma cacao [chocolate]
ref|XP_010686883.1|  PREDICTED: elongation factor 1-gamma-like          310   1e-100   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010683294.1|  PREDICTED: elongation factor 1-gamma 2-like        309   2e-100   Beta vulgaris subsp. vulgaris [field beet]
gb|KEH34076.1|  translation elongation factor EF1B, gamma chain         309   3e-100   Medicago truncatula
ref|XP_010030200.1|  PREDICTED: elongation factor 1-gamma               308   4e-100   Eucalyptus grandis [rose gum]
ref|XP_004485430.1|  PREDICTED: elongation factor 1-gamma-like is...    308   5e-100   Cicer arietinum [garbanzo]
ref|XP_002264400.1|  PREDICTED: elongation factor 1-gamma-like          308   6e-100   Vitis vinifera
ref|XP_006478210.1|  PREDICTED: elongation factor 1-gamma-like          308   6e-100   Citrus sinensis [apfelsine]
ref|XP_009610261.1|  PREDICTED: elongation factor 1-gamma 2-like ...    307   8e-100   Nicotiana tomentosiformis
ref|XP_009774948.1|  PREDICTED: elongation factor 1-gamma 2-like ...    307   9e-100   Nicotiana sylvestris
ref|XP_009610260.1|  PREDICTED: elongation factor 1-gamma 2-like ...    307   9e-100   Nicotiana tomentosiformis
ref|XP_009774942.1|  PREDICTED: elongation factor 1-gamma 2-like ...    307   1e-99    Nicotiana sylvestris
gb|ACU24330.1|  unknown                                                 301   1e-99    Glycine max [soybeans]
ref|XP_003592901.1|  Elongation factor 1-gamma                          307   1e-99    Medicago truncatula
ref|XP_003592902.1|  Elongation factor 1-gamma                          307   1e-99    
ref|XP_010553691.1|  PREDICTED: probable elongation factor 1-gamma 2    307   1e-99    Tarenaya hassleriana [spider flower]
gb|ACB72462.1|  elongation factor 1 gamma-like protein                  306   2e-99    Nicotiana tabacum [American tobacco]
ref|XP_007222556.1|  hypothetical protein PRUPE_ppa006233mg             306   2e-99    
ref|XP_010544111.1|  PREDICTED: probable elongation factor 1-gamma 2    306   2e-99    Tarenaya hassleriana [spider flower]
dbj|BAP19108.1|  elongation factor 1 gamma-like protein                 297   2e-99    Ipomoea nil [qian niu]
ref|XP_002526432.1|  elongation factor 1 gamma, putative                302   2e-99    Ricinus communis
ref|XP_008219063.1|  PREDICTED: elongation factor 1-gamma-like          306   3e-99    Prunus mume [ume]
ref|XP_011047878.1|  PREDICTED: elongation factor 1-gamma               306   3e-99    Populus euphratica
emb|CAN75785.1|  hypothetical protein VITISV_021574                     306   3e-99    Vitis vinifera
ref|XP_007148576.1|  hypothetical protein PHAVU_006G220100g             306   3e-99    Phaseolus vulgaris [French bean]
gb|AFK34308.1|  unknown                                                 306   4e-99    Medicago truncatula
ref|XP_009759973.1|  PREDICTED: elongation factor 1-gamma 2-like ...    306   4e-99    Nicotiana sylvestris
ref|XP_009759974.1|  PREDICTED: elongation factor 1-gamma 2-like ...    306   4e-99    Nicotiana sylvestris
gb|ADB11388.1|  gamma class glutathione transferase EF1Bgamma3          305   5e-99    Populus trichocarpa [western balsam poplar]
ref|XP_007153909.1|  hypothetical protein PHAVU_003G075200g             305   5e-99    Phaseolus vulgaris [French bean]
emb|CDP10743.1|  unnamed protein product                                305   6e-99    Coffea canephora [robusta coffee]
ref|XP_010272551.1|  PREDICTED: elongation factor 1-gamma-like is...    305   8e-99    Nelumbo nucifera [Indian lotus]
ref|XP_006600242.1|  PREDICTED: elongation factor 1-gamma isoform X1    305   8e-99    
gb|ACA50518.1|  elongation factor 1-gamma                               305   1e-98    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001046318.1|  Os02g0220600                                       304   1e-98    
ref|XP_006647077.1|  PREDICTED: elongation factor 1-gamma 2-like        304   2e-98    Oryza brachyantha
gb|ABA81876.1|  unknown                                                 304   2e-98    Solanum tuberosum [potatoes]
gb|KEH32762.1|  translation elongation factor EF1B, gamma chain         304   2e-98    Medicago truncatula
gb|AHZ94964.1|  elongation factor 1                                     303   2e-98    Lilium regale
ref|XP_004155227.1|  PREDICTED: LOW QUALITY PROTEIN: elongation f...    303   2e-98    
ref|XP_010242290.1|  PREDICTED: elongation factor 1-gamma-like          304   2e-98    Nelumbo nucifera [Indian lotus]
ref|XP_010272550.1|  PREDICTED: elongation factor 1-gamma-like is...    306   2e-98    Nelumbo nucifera [Indian lotus]
ref|XP_008452241.1|  PREDICTED: elongation factor 1-gamma-like          303   2e-98    Cucumis melo [Oriental melon]
ref|XP_008452240.1|  PREDICTED: elongation factor 1-gamma-like          303   2e-98    Cucumis melo [Oriental melon]
gb|KEH32761.1|  translation elongation factor EF1B, gamma chain         303   2e-98    Medicago truncatula
gb|KJB47884.1|  hypothetical protein B456_008G046300                    298   3e-98    Gossypium raimondii
ref|XP_008456982.1|  PREDICTED: elongation factor 1-gamma-like          304   3e-98    Cucumis melo [Oriental melon]
ref|NP_001046317.1|  Os02g0220500                                       303   3e-98    
ref|XP_008378997.1|  PREDICTED: elongation factor 1-gamma               294   3e-98    
ref|NP_001274793.1|  elongation factor 1-gamma 2-like                   303   3e-98    Solanum tuberosum [potatoes]
sp|Q6YW46.2|EF1G2_ORYSJ  RecName: Full=Elongation factor 1-gamma ...    303   4e-98    Oryza sativa Japonica Group [Japonica rice]
gb|AAO72574.1|  elongation factor 1 gamma-like protein                  303   4e-98    Oryza sativa Japonica Group [Japonica rice]
gb|EEE56572.1|  hypothetical protein OsJ_05923                          305   4e-98    Oryza sativa Japonica Group [Japonica rice]
gb|KHN03584.1|  Elongation factor 1-gamma                               303   4e-98    Glycine soja [wild soybean]
gb|KJB47885.1|  hypothetical protein B456_008G046300                    300   5e-98    Gossypium raimondii
gb|EEC72757.1|  hypothetical protein OsI_06402                          305   5e-98    Oryza sativa Indica Group [Indian rice]
ref|XP_010928857.1|  PREDICTED: elongation factor 1-gamma 2             303   5e-98    Elaeis guineensis
ref|XP_006339363.1|  PREDICTED: elongation factor 1-gamma 2-like ...    303   6e-98    Solanum tuberosum [potatoes]
ref|XP_006385057.1|  elongation factor 1-gamma 1 family protein         303   6e-98    Populus trichocarpa [western balsam poplar]
ref|XP_006339362.1|  PREDICTED: elongation factor 1-gamma 2-like ...    303   7e-98    Solanum tuberosum [potatoes]
gb|KJB47897.1|  hypothetical protein B456_008G046200                    303   7e-98    Gossypium raimondii
ref|XP_004133719.1|  PREDICTED: elongation factor 1-gamma-like          302   7e-98    
ref|XP_006389499.1|  elongation factor 1-gamma 1 family protein         302   8e-98    
gb|AIZ68134.1|  translation elongation factor 1-gamma                   302   9e-98    Ornithogalum longebracteatum [sea-onion]
gb|ADR70876.1|  eukaryotic translation elongation factor 1B gamma...    302   1e-97    Hevea brasiliensis [jebe]
ref|XP_008789740.1|  PREDICTED: elongation factor 1-gamma 1 isofo...    301   1e-97    
ref|XP_011074970.1|  PREDICTED: elongation factor 1-gamma-like          302   1e-97    Sesamum indicum [beniseed]
ref|XP_008789739.1|  PREDICTED: elongation factor 1-gamma 2 isofo...    302   1e-97    Phoenix dactylifera
ref|XP_011028370.1|  PREDICTED: elongation factor 1-gamma 2-like        302   1e-97    Populus euphratica
gb|KJB47883.1|  hypothetical protein B456_008G046300                    302   1e-97    Gossypium raimondii
gb|KHG12420.1|  hypothetical protein F383_17048                         302   1e-97    Gossypium arboreum [tree cotton]
ref|XP_010907209.1|  PREDICTED: elongation factor 1-gamma 2-like        302   1e-97    Elaeis guineensis
gb|KHG04277.1|  hypothetical protein F383_29497                         302   1e-97    Gossypium arboreum [tree cotton]
gb|KHN39680.1|  Elongation factor 1-gamma                               299   1e-97    Glycine soja [wild soybean]
gb|EYU22759.1|  hypothetical protein MIMGU_mgv1a007114mg                301   2e-97    Erythranthe guttata [common monkey flower]
ref|XP_004966044.1|  PREDICTED: elongation factor 1-gamma 3-like        301   2e-97    Setaria italica
ref|NP_001242737.1|  uncharacterized protein LOC100810452               301   2e-97    
gb|KHN40193.1|  Elongation factor 1-gamma                               301   2e-97    Glycine soja [wild soybean]
ref|XP_002325529.1|  hypothetical protein POPTR_0019s10560g             301   2e-97    Populus trichocarpa [western balsam poplar]
ref|XP_004240589.1|  PREDICTED: elongation factor 1-gamma 2-like        301   2e-97    Solanum lycopersicum
ref|XP_011031541.1|  PREDICTED: elongation factor 1-gamma-like          301   2e-97    Populus euphratica
ref|XP_002278756.2|  PREDICTED: elongation factor 1-gamma               301   3e-97    Vitis vinifera
ref|NP_001241223.1|  uncharacterized protein LOC100787125               301   3e-97    Glycine max [soybeans]
ref|XP_004966045.1|  PREDICTED: elongation factor 1-gamma 3-like        301   3e-97    Setaria italica
ref|XP_008677347.1|  PREDICTED: elongation factor 1-gamma 2 isofo...    301   3e-97    
gb|KDO40980.1|  hypothetical protein CISIN_1g021153mg                   296   3e-97    Citrus sinensis [apfelsine]
ref|XP_004951452.1|  PREDICTED: elongation factor 1-gamma 2-like        301   4e-97    Setaria italica
ref|NP_001131533.1|  uncharacterized protein LOC100192872               296   4e-97    
ref|XP_004250642.1|  PREDICTED: elongation factor 1-gamma 2-like ...    300   5e-97    Solanum lycopersicum
ref|XP_006392372.1|  hypothetical protein EUTSA_v10023493mg             298   6e-97    
gb|ACJ85171.1|  unknown                                                 300   6e-97    Medicago truncatula
ref|XP_004294500.1|  PREDICTED: elongation factor 1-gamma-like          300   6e-97    Fragaria vesca subsp. vesca
ref|XP_004250641.1|  PREDICTED: elongation factor 1-gamma 2-like ...    300   6e-97    Solanum lycopersicum
gb|AFW71312.1|  hypothetical protein ZEAMMB73_547198                    296   7e-97    
gb|KDO40981.1|  hypothetical protein CISIN_1g021153mg                   296   1e-96    Citrus sinensis [apfelsine]
gb|KDO40983.1|  hypothetical protein CISIN_1g021153mg                   294   1e-96    Citrus sinensis [apfelsine]
ref|XP_002451782.1|  hypothetical protein SORBIDRAFT_04g007760          299   1e-96    Sorghum bicolor [broomcorn]
ref|XP_003540135.1|  PREDICTED: elongation factor 1-gamma-like          299   1e-96    
ref|XP_006392370.1|  hypothetical protein EUTSA_v10023493mg             299   1e-96    Eutrema salsugineum [saltwater cress]
ref|XP_008352808.1|  PREDICTED: elongation factor 1-gamma-like          299   1e-96    
gb|KDP42461.1|  hypothetical protein JCGZ_00258                         299   2e-96    Jatropha curcas
ref|XP_002438602.1|  hypothetical protein SORBIDRAFT_10g022570          298   2e-96    Sorghum bicolor [broomcorn]
ref|XP_010101278.1|  Elongation factor 1-gamma                          300   2e-96    
ref|XP_008804357.1|  PREDICTED: elongation factor 1-gamma 2-like        300   3e-96    Phoenix dactylifera
gb|AFW76477.1|  elongation factor gamma1                                294   3e-96    
ref|XP_008643919.1|  PREDICTED: uncharacterized protein LOC100381...    298   3e-96    
ref|NP_001148829.1|  elongation factor 1-gamma 3                        298   3e-96    Zea mays [maize]
ref|NP_001151229.1|  elongation factor 1-gamma 2                        298   3e-96    Zea mays [maize]
ref|XP_009355338.1|  PREDICTED: elongation factor 1-gamma               298   3e-96    Pyrus x bretschneideri [bai li]
ref|XP_009353791.1|  PREDICTED: elongation factor 1-gamma               298   3e-96    Pyrus x bretschneideri [bai li]
gb|AFW87006.1|  hypothetical protein ZEAMMB73_710904                    297   3e-96    
ref|XP_009417204.1|  PREDICTED: elongation factor 1-gamma 2-like        298   3e-96    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009362385.1|  PREDICTED: elongation factor 1-gamma-like          298   4e-96    Pyrus x bretschneideri [bai li]
gb|AFW76480.1|  elongation factor gamma1                                297   4e-96    
ref|XP_006431568.1|  hypothetical protein CICLE_v10003566mg             298   5e-96    Citrus clementina [clementine]
ref|XP_008647353.1|  PREDICTED: uncharacterized protein LOC100192...    298   6e-96    
ref|XP_006494223.1|  PREDICTED: elongation factor 1-gamma 3-like ...    298   6e-96    Citrus sinensis [apfelsine]
gb|ACU24584.1|  unknown                                                 297   7e-96    Glycine max [soybeans]
emb|CDY22629.1|  BnaC08g42630D                                          297   8e-96    Brassica napus [oilseed rape]
emb|CDY31074.1|  BnaA08g26240D                                          297   8e-96    Brassica napus [oilseed rape]
ref|XP_008365322.1|  PREDICTED: LOW QUALITY PROTEIN: elongation f...    297   9e-96    
ref|XP_009110814.1|  PREDICTED: probable elongation factor 1-gamma 1    297   1e-95    Brassica rapa
emb|CDX93494.1|  BnaA06g05540D                                          297   1e-95    
ref|XP_004300001.1|  PREDICTED: elongation factor 1-gamma-like          297   1e-95    Fragaria vesca subsp. vesca
ref|XP_009418787.1|  PREDICTED: elongation factor 1-gamma 2-like        296   2e-95    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006845799.1|  hypothetical protein AMTR_s00019p00255470          297   2e-95    
gb|ACG36145.1|  elongation factor 1-gamma 3                             296   2e-95    Zea mays [maize]
ref|XP_009148264.1|  PREDICTED: probable elongation factor 1-gamma 1    296   2e-95    Brassica rapa
ref|XP_008218698.1|  PREDICTED: elongation factor 1-gamma-like          296   3e-95    Prunus mume [ume]
ref|XP_006417552.1|  hypothetical protein EUTSA_v10007759mg             296   3e-95    Eutrema salsugineum [saltwater cress]
ref|XP_004308137.1|  PREDICTED: elongation factor 1-gamma-like is...    296   3e-95    Fragaria vesca subsp. vesca
ref|XP_008218696.1|  PREDICTED: elongation factor 1-gamma               296   3e-95    Prunus mume [ume]
emb|CDY50887.1|  BnaCnng19790D                                          295   4e-95    Brassica napus [oilseed rape]
emb|CDY06365.1|  BnaA09g48380D                                          295   5e-95    
ref|NP_001057916.1|  Os06g0571400                                       295   5e-95    
gb|AAL87298.1|  unknown protein                                         293   5e-95    Arabidopsis thaliana [mouse-ear cress]
gb|EPS67955.1|  elongation factor 1 gamma-like protein                  295   5e-95    Genlisea aurea
gb|EYU28215.1|  hypothetical protein MIMGU_mgv1a007176mg                295   5e-95    Erythranthe guttata [common monkey flower]
ref|XP_009118302.1|  PREDICTED: probable elongation factor 1-gamma 1    295   5e-95    Brassica rapa
ref|XP_008339412.1|  PREDICTED: elongation factor 1-gamma               295   6e-95    
gb|AAO72563.1|  elongation factor 1 gamma-like protein                  295   6e-95    Oryza sativa Japonica Group [Japonica rice]
emb|CBI29690.3|  unnamed protein product                                295   6e-95    Vitis vinifera
ref|XP_006302321.1|  hypothetical protein CARUB_v10020374mg             295   7e-95    Capsella rubella
ref|XP_010490215.1|  PREDICTED: probable elongation factor 1-gamma 1    295   7e-95    Camelina sativa [gold-of-pleasure]
ref|NP_563848.1|  elongation factor EF-1 gamma subunit                  295   8e-95    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006656177.1|  PREDICTED: elongation factor 1-gamma 3-like        295   8e-95    
ref|XP_010470318.1|  PREDICTED: probable elongation factor 1-gamma 2    295   8e-95    Camelina sativa [gold-of-pleasure]
ref|XP_006307657.1|  hypothetical protein CARUB_v10009284mg             295   9e-95    Capsella rubella
ref|XP_010511351.1|  PREDICTED: probable elongation factor 1-gamma 2    295   9e-95    Camelina sativa [gold-of-pleasure]
ref|XP_011470423.1|  PREDICTED: elongation factor 1-gamma-like is...    296   9e-95    Fragaria vesca subsp. vesca
gb|EAZ37421.1|  hypothetical protein OsJ_21756                          295   1e-94    Oryza sativa Japonica Group [Japonica rice]
gb|AAK59587.1|  putative elongation factor 1B gamma                     294   1e-94    Arabidopsis thaliana [mouse-ear cress]
ref|NP_176084.1|  elongation factor EF-1 gamma subunit                  294   1e-94    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002892012.1|  hypothetical protein ARALYDRAFT_474857             294   1e-94    
ref|XP_002889762.1|  hypothetical protein ARALYDRAFT_471063             293   2e-94    
sp|Q9FUM1.1|EF1G_PRUAV  RecName: Full=Elongation factor 1-gamma; ...    294   2e-94    Prunus avium [gean]
ref|XP_007222927.1|  hypothetical protein PRUPE_ppa005220mg             295   2e-94    Prunus persica
ref|XP_010475805.1|  PREDICTED: probable elongation factor 1-gamm...    294   3e-94    
gb|AGC13144.1|  EF1Bgamma class glutathione S-transferase               292   9e-94    Pinus tabuliformis [southern Chinese pine]
ref|XP_003563720.1|  PREDICTED: elongation factor 1-gamma 3             291   1e-93    Brachypodium distachyon [annual false brome]
ref|XP_010475804.1|  PREDICTED: probable elongation factor 1-gamm...    291   2e-93    Camelina sativa [gold-of-pleasure]
gb|AHC03515.1|  gamma class glutathione S-transferase                   290   6e-93    Larix kaempferi [karamatsu]
ref|XP_010458260.1|  PREDICTED: probable elongation factor 1-gamma 1    290   7e-93    Camelina sativa [gold-of-pleasure]
gb|ACJ84953.1|  unknown                                                 280   7e-93    Medicago truncatula
ref|XP_003571724.1|  PREDICTED: elongation factor 1-gamma 2             289   1e-92    Brachypodium distachyon [annual false brome]
emb|CDY20681.1|  BnaC08g13770D                                          293   1e-92    Brassica napus [oilseed rape]
dbj|BAD94347.1|  hypothetical protein                                   280   1e-92    Arabidopsis thaliana [mouse-ear cress]
gb|ABK25057.1|  unknown                                                 288   3e-92    Picea sitchensis
emb|CBI29691.3|  unnamed protein product                                276   2e-91    Vitis vinifera
gb|EMT01475.1|  Elongation factor 1-gamma 2                             291   4e-91    
gb|KGN56266.1|  hypothetical protein Csa_3G110630                       283   1e-90    
ref|NP_001235707.1|  elongation factor 1-gamma                          283   2e-90    
gb|EMS60520.1|  Elongation factor 1-gamma 2                             276   1e-87    Triticum urartu
gb|EMT20600.1|  Elongation factor 1-gamma 2                             276   2e-87    
gb|AIW07751.1|  elongation factor subfamily 1b subunit gamma            268   2e-87    Pinus krempfii
gb|AIW07759.1|  elongation factor subfamily 1b subunit gamma            267   2e-87    Pinus krempfii
gb|EEC80835.1|  hypothetical protein OsI_23436                          275   8e-87    Oryza sativa Indica Group [Indian rice]
gb|AIW07777.1|  elongation factor subfamily 1b subunit gamma            266   9e-87    Pinus krempfii
dbj|BAH56923.1|  AT1G57720                                              245   7e-76    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011099002.1|  PREDICTED: elongation factor 1-gamma 2-like        239   1e-73    Sesamum indicum [beniseed]
ref|XP_002973046.1|  hypothetical protein SELMODRAFT_98733              238   1e-72    
ref|XP_002984514.1|  hypothetical protein SELMODRAFT_156635             237   2e-72    Selaginella moellendorffii
ref|XP_001771013.1|  predicted protein                                  229   2e-69    
gb|KGN56265.1|  hypothetical protein Csa_3G110620                       226   9e-69    
ref|XP_001758671.1|  predicted protein                                  227   2e-68    
ref|XP_001774148.1|  predicted protein                                  226   5e-68    
ref|XP_004172027.1|  PREDICTED: LOW QUALITY PROTEIN: elongation f...    222   3e-67    
gb|AFP90271.1|  elongation factor 1-gamma 1                             214   4e-67    Pinus yunnanensis [Yunnan pine]
gb|AFP90278.1|  elongation factor 1-gamma 1                             213   4e-67    Pinus yunnanensis [Yunnan pine]
gb|AFP90281.1|  elongation factor 1-gamma 1                             213   9e-67    Pinus yunnanensis [Yunnan pine]
gb|AFP90241.1|  elongation factor 1-gamma 1                             213   1e-66    Pinus tabuliformis [southern Chinese pine]
gb|AFP90255.1|  elongation factor 1-gamma 1                             212   2e-66    Pinus tabuliformis [southern Chinese pine]
gb|AFP90268.1|  elongation factor 1-gamma 1                             211   2e-66    Pinus densata
gb|AFP90265.1|  elongation factor 1-gamma 1                             211   3e-66    Pinus densata
gb|AFP90276.1|  elongation factor 1-gamma 1                             211   3e-66    Pinus densata
gb|AFP90258.1|  elongation factor 1-gamma 1                             211   6e-66    Pinus densata
gb|AFP90247.1|  elongation factor 1-gamma 1                             210   9e-66    Pinus tabuliformis [southern Chinese pine]
gb|AFP90264.1|  elongation factor 1-gamma 1                             210   1e-65    Pinus densata
gb|AFP90253.1|  elongation factor 1-gamma 1                             209   1e-65    Pinus tabuliformis [southern Chinese pine]
gb|AFP90275.1|  elongation factor 1-gamma 1                             209   1e-65    Pinus densata
gb|AFP90246.1|  elongation factor 1-gamma 1                             209   2e-65    Pinus densata
gb|AFP90254.1|  elongation factor 1-gamma 1                             209   2e-65    Pinus tabuliformis [southern Chinese pine]
gb|AFP90282.1|  elongation factor 1-gamma 1                             209   2e-65    Pinus densata
gb|AFP90244.1|  elongation factor 1-gamma 1                             208   7e-65    Pinus densata
ref|XP_004134257.1|  PREDICTED: elongation factor 1-gamma-like          210   1e-62    
dbj|BAD94101.1|  hypothetical protein                                   182   6e-55    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001167773.1|  hypothetical protein                               173   2e-51    
ref|XP_007041191.1|  Elongation factor 1-gamma 3, putative              170   9e-49    
gb|ABR25394.1|  elongation factor 1-gamma 3                             165   2e-48    Oryza sativa Indica Group [Indian rice]
ref|XP_005645852.1|  glutathione S-transferase                          169   5e-46    Coccomyxa subellipsoidea C-169
ref|XP_004341586.1|  elongation factor 1-gamma family protein           145   2e-37    Acanthamoeba castellanii str. Neff
gb|EXX52334.1|  Tef4p                                                   136   6e-35    Rhizophagus irregularis DAOM 197198w
emb|CBK20805.2|  unnamed protein product                                134   1e-34    Blastocystis hominis
gb|ETL96568.1|  hypothetical protein L917_05966                         131   2e-34    Phytophthora parasitica
gb|ESA05922.1|  hypothetical protein GLOINDRAFT_349960                  137   2e-34    
emb|CCI44608.1|  unnamed protein product                                136   3e-34    Albugo candida
gb|ETM49712.1|  hypothetical protein L914_06089                         130   9e-34    Phytophthora parasitica
emb|CBK21757.2|  unnamed protein product                                134   1e-33    Blastocystis hominis
gb|ETK89973.1|  hypothetical protein L915_06156                         130   3e-33    Phytophthora parasitica
emb|CCA15330.1|  calciumdependent protein 1 putative                    133   4e-33    Albugo laibachii Nc14
ref|XP_008867564.1|  hypothetical protein H310_04829                    131   3e-32    Aphanomyces invadans
ref|XP_006680023.1|  hypothetical protein BATDEDRAFT_37118              130   4e-32    Batrachochytrium dendrobatidis JAM81
gb|ETK89994.1|  hypothetical protein L915_06152                         130   5e-32    Phytophthora parasitica
gb|ETP19871.1|  hypothetical protein F441_06281                         130   5e-32    Phytophthora parasitica CJ01A1
ref|XP_008891718.1|  hypothetical protein PPTG_02398                    130   6e-32    Phytophthora parasitica INRA-310
ref|XP_002901767.1|  elongation factor 1-gamma, putative                130   7e-32    Phytophthora infestans T30-4
ref|XP_002901771.1|  elongation factor 1-gamma, putative                128   1e-31    Phytophthora infestans T30-4
ref|XP_009519315.1|  hypothetical protein PHYSODRAFT_284839             129   2e-31    Phytophthora sojae
gb|EPY23706.1|  elongation factor 1-gamma                               125   2e-31    Strigomonas culicis
ref|XP_009519320.1|  hypothetical protein PHYSODRAFT_359164             129   2e-31    Phytophthora sojae
ref|XP_001562716.1|  elongation factor-1 gamma                          128   2e-31    Leishmania braziliensis MHOM/BR/75/M2904
emb|CEP19706.1|  hypothetical protein                                   127   6e-31    Parasitella parasitica
ref|NP_001184949.1|  elongation factor EF-1 gamma subunit               125   6e-31    Arabidopsis thaliana [mouse-ear cress]
gb|EPY29488.1|  elongation factor 1-gamma                               126   1e-30    Strigomonas culicis
gb|EPY20606.1|  elongation factor 1-gamma                               127   1e-30    Strigomonas culicis
emb|CDH60277.1|  elongation factor 1 gamma domain-containingprotein     125   2e-30    Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_003872780.1|  elongation factor-1 gamma                          125   4e-30    Leishmania mexicana MHOM/GT/2001/U1103
ref|XP_010704334.1|  elongation factor-1 gamma                          125   4e-30    Leishmania panamensis
gb|EPY38232.1|  elongation factor 1-gamma                               122   5e-30    Angomonas deanei
gb|EFA79702.1|  glutathione S-transferase domain-containing protein     125   6e-30    Heterostelium album PN500
emb|CDS05969.1|  hypothetical protein LRAMOSA08497                      124   8e-30    Lichtheimia ramosa
emb|CCC95849.1|  unnamed protein product                                124   1e-29    Trypanosoma congolense IL3000
gb|EPY35420.1|  elongation factor 1-gamma                               123   1e-29    Angomonas deanei
gb|EPY35413.1|  elongation factor 1-gamma                               123   2e-29    Angomonas deanei
emb|CCC95841.1|  unnamed protein product                                123   2e-29    Trypanosoma congolense IL3000
gb|EPY28959.1|  elongation factor 1-gamma                               123   2e-29    Angomonas deanei
ref|XP_003858781.1|  elongation factor-1 gamma                          123   2e-29    Leishmania donovani
emb|CAC35543.1|  elongation factor-1 gamma                              123   2e-29    Leishmania infantum
ref|XP_001463560.1|  elongation factor-1 gamma                          123   2e-29    Leishmania infantum JPCM5
ref|XP_001463559.1|  elongation factor-1 gamma                          123   2e-29    Leishmania infantum JPCM5
gb|EPB91935.1|  hypothetical protein HMPREF1544_01229                   122   3e-29    Mucor circinelloides f. circinelloides 1006PhL
ref|XP_004353907.1|  glutathione S-transferase domain-containing ...    122   3e-29    Cavenderia fasciculata
sp|P34715.1|EF1G_TRYCR  RecName: Full=Elongation factor 1-gamma; ...    122   3e-29    Trypanosoma cruzi
ref|XP_001681271.1|  elongation factor-1 gamma                          122   4e-29    Leishmania major strain Friedlin
gb|EKF26874.1|  elongation factor 1-gamma (EF-1-gamma), putative        118   4e-29    Trypanosoma cruzi marinkellei
dbj|GAM21220.1|  hypothetical protein SAMD00019534_043950               121   8e-29    Acytostelium subglobosum LB1
gb|EKG02410.1|  elongation factor 1-gamma (EF-1-gamma), putative        121   9e-29    Trypanosoma cruzi
emb|CEI89465.1|  hypothetical protein RMCBS344292_03820                 121   9e-29    Rhizopus microsporus
ref|XP_806964.1|  elongation factor 1-gamma (EF-1-gamma)                121   9e-29    Trypanosoma cruzi strain CL Brener
emb|CEG74026.1|  hypothetical protein RMATCC62417_09299                 121   1e-28    Rhizopus microsporus
gb|AAS55635.1|  elongation factor 1B gamma 2                            121   1e-28    Crithidia fasciculata
emb|CEI97373.1|  hypothetical protein RMCBS344292_11508                 121   1e-28    Rhizopus microsporus
ref|XP_008365338.1|  PREDICTED: elongation factor 1-gamma-like          119   2e-28    
ref|XP_009825362.1|  hypothetical protein H257_03107                    120   2e-28    Aphanomyces astaci
ref|XP_829366.1|  elongation factor 1 gamma                             120   2e-28    Trypanosoma brucei brucei TREU927
gb|EPB85278.1|  hypothetical protein HMPREF1544_07959                   120   2e-28    Mucor circinelloides f. circinelloides 1006PhL
emb|CBH18353.1|  elongation factor 1 gamma, putative                    120   2e-28    Trypanosoma brucei gambiense DAL972
gb|ESL05599.1|  elongation factor 1-gamma                               120   2e-28    Trypanosoma rangeli SC58
ref|XP_009314156.1|  putative elongation factor 1-gamma (EF-1-gamma)    120   2e-28    Trypanosoma grayi
emb|CBH18338.1|  elongation factor 1 gamma, putative                    120   3e-28    Trypanosoma brucei gambiense DAL972
emb|CDS12960.1|  hypothetical protein LRAMOSA05144                      119   3e-28    Lichtheimia ramosa
emb|CCW66695.1|  unnamed protein product                                119   3e-28    Phytomonas sp. isolate Hart1
ref|XP_829376.1|  elongation factor 1 gamma                             120   4e-28    Trypanosoma brucei brucei TREU927
emb|CCC53922.1|  putative elongation factor 1 gamma                     119   5e-28    Trypanosoma vivax Y486
gb|EIE88418.1|  hypothetical protein RO3G_13129                         119   5e-28    Rhizopus delemar RA 99-880
ref|XP_002371737.1|  elongation factor 1-gamma, putative                119   5e-28    Toxoplasma gondii ME49
emb|CAF94681.1|  unnamed protein product                                114   8e-28    
emb|CCW64576.1|  unnamed protein product                                118   9e-28    
ref|XP_008888397.1|  elongation factor 1-gamma, putative                118   9e-28    
gb|EIE85200.1|  hypothetical protein RO3G_09910                         118   1e-27    
gb|EXX52333.1|  Tef4p                                                   117   1e-27    
emb|CDO76003.1|  hypothetical protein BN946_scf184780.g10               117   2e-27    
emb|CDH55788.1|  elongation factor 1-gamma                              117   3e-27    
ref|XP_007367152.1|  elongation factor 1-gamma                          117   4e-27    
ref|XP_009040775.1|  hypothetical protein AURANDRAFT_70385              117   4e-27    
ref|XP_009041108.1|  hypothetical protein AURANDRAFT_39051              116   6e-27    
emb|CDH55787.1|  elongation factor 1-gamma                              116   7e-27    
ref|XP_003886058.1|  hypothetical protein NCLIV_064580                  115   9e-27    
gb|AAS55634.1|  elongation factor 1B gamma 1                            114   2e-26    
gb|ELU41062.1|  elongation factor 1-gamma                               117   3e-26    
ref|XP_007755740.1|  elongation factor 1-gamma                          113   6e-26    
ref|XP_009157113.1|  elongation factor EF-1 gamma subunit               113   6e-26    
ref|XP_008605170.1|  hypothetical protein SDRG_01423                    113   6e-26    
emb|CBJ27519.1|  eukaryotic elongation factor-1 B gamma                 113   6e-26    
ref|XP_007387562.1|  elongation factor 1-gamma                          113   8e-26    
dbj|BAN38538.1|  eukaryotic translation elongation factor 1 gamma...    108   1e-25    
ref|XP_007736285.1|  elongation factor 1-gamma                          112   1e-25    
ref|XP_651475.1|  eukaryotic translation elongation factor 1 gamma      108   1e-25    
ref|XP_007727684.1|  elongation factor 1-gamma                          112   2e-25    
gb|KIK66373.1|  hypothetical protein GYMLUDRAFT_1025824                 112   2e-25    
emb|CDH55790.1|  glutathione s-transferase                              111   2e-25    
ref|XP_003677986.1|  hypothetical protein NCAS_0H03290                  112   2e-25    
gb|EUC62963.1|  elongation factor 1-gamma                               112   2e-25    
gb|KDO34814.1|  hypothetical protein SPRG_00875                         111   2e-25    
gb|KEP46305.1|  elongation factor 1-gamma                               112   2e-25    
ref|XP_003970321.1|  PREDICTED: elongation factor 1-gamma-like          112   2e-25    
gb|KIW71582.1|  hypothetical protein PV04_03729                         111   2e-25    
ref|XP_003675590.1|  hypothetical protein NCAS_0C02340                  111   2e-25    
gb|EPS96197.1|  hypothetical protein FOMPIDRAFT_1025472                 111   2e-25    
ref|XP_001248928.1|  elongation factor 1 gamma domain-containing ...    111   2e-25    
gb|EFW16904.1|  elongation factor 1-gamma                               111   3e-25    
ref|XP_002259965.1|  elongation factor 1-gamma                          111   3e-25    
gb|KIW17213.1|  hypothetical protein PV08_04404                         111   3e-25    
emb|CCO33107.1|  Elongation factor 1-gamma Short=EF-1-gamma             111   3e-25    
gb|KEQ85130.1|  eEF1-gamma domain-containing protein                    111   4e-25    
gb|KFH71059.1|  hypothetical protein MVEG_03905                         110   4e-25    
gb|EWM21126.1|  elongation factor 1                                     111   4e-25    
gb|AAD54312.1|  elongation factor eEF1 gamma chain                      103   4e-25    
gb|ABG88953.1|  elongation factor-1 gamma                               110   5e-25    
ref|XP_007743206.1|  elongation factor 1-gamma                          110   6e-25    
gb|KIW96849.1|  hypothetical protein Z519_02240                         110   6e-25    
ref|XP_008727405.1|  hypothetical protein G647_04846                    110   6e-25    
emb|CCO33241.1|  Elongation factor 1-gamma Short=EF-1-gamma             110   9e-25    
ref|XP_003679479.1|  elongation factor 1 gamma domain-containing ...    110   9e-25    
gb|KIW26889.1|  hypothetical protein PV07_06682                         110   1e-24    
gb|KIW75623.1|  hypothetical protein Z517_10365                         109   1e-24    
ref|XP_007375336.1|  hypothetical protein SPAPADRAFT_61149              109   1e-24    
gb|KIW57420.1|  hypothetical protein PV05_05970                         109   1e-24    
emb|CCO33106.1|  Elongation factor 1-gamma-A Short=EF-1-gamma-A         109   1e-24    
ref|XP_001598134.1|  elongation factor 1 gamma domain-containing ...    109   1e-24    
gb|ABG88951.1|  elongation factor-1 gamma                               109   1e-24    
emb|CCM01656.1|  predicted protein                                      109   1e-24    
ref|XP_007805315.1|  hypothetical protein EPUS_08392                    109   1e-24    
gb|KEQ58308.1|  eEF1-gamma domain-containing protein                    109   1e-24    
ref|XP_002419498.1|  elongation factor 1 gamma domain-containing ...    108   2e-24    
gb|KIX93645.1|  hypothetical protein Z520_10551                         108   2e-24    
ref|XP_001382613.1|  elongation factor 1 gamma domain-containing ...    108   2e-24    
ref|XP_001614168.1|  elongation factor 1-gamma                          108   2e-24    
emb|CAK42245.1|  unnamed protein product                                104   2e-24    
ref|XP_002420602.1|  elongation factor 1 gamma domain-containing ...    108   3e-24    
gb|AEG78432.1|  elongation factor-1 gamma                               106   3e-24    
ref|XP_009009109.1|  hypothetical protein HELRODRAFT_105304             108   3e-24    
ref|XP_004199475.1|  Piso0_001255                                       108   3e-24    
gb|KIV85484.1|  hypothetical protein PV11_01176                         108   3e-24    
ref|XP_008716958.1|  hypothetical protein HMPREF1541_04390              108   3e-24    
gb|KDQ23974.1|  hypothetical protein PLEOSDRAFT_1067979                 108   3e-24    
ref|XP_002618567.1|  conserved hypothetical protein                     107   3e-24    
ref|XP_004223626.1|  elongation factor 1-gamma                          108   3e-24    
gb|KGU06197.1|  elongation factor 1-gamma                               108   3e-24    
gb|KGR09240.1|  elongation factor 1-gamma                               108   3e-24    
gb|EEQ44636.1|  elongation factor 1-gamma 1                             108   3e-24    
ref|XP_001524775.1|  conserved hypothetical protein                     108   3e-24    
gb|KGQ91245.1|  elongation factor 1-gamma                               108   4e-24    
gb|KGU06273.1|  elongation factor 1-gamma                               108   4e-24    
ref|XP_712054.1|  potential translation elongation factor Cam1p         108   4e-24    
gb|KHC32906.1|  elongation factor 1-gamma                               108   4e-24    
gb|KGR11185.1|  elongation factor 1-gamma                               108   4e-24    
gb|KGQ84572.1|  elongation factor 1-gamma                               108   4e-24    
gb|KHC32837.1|  elongation factor 1-gamma                               108   4e-24    
gb|KGR05763.1|  elongation factor 1-gamma                               108   4e-24    
ref|XP_004363777.1|  eukaryotic translation elongation factor 1 g...    108   4e-24    
emb|CCO33240.1|  Elongation factor 1-gamma Short=EF-1-gamma             108   4e-24    
gb|ABG88954.1|  elongation factor-1 gamma                               108   4e-24    
gb|KGU26884.1|  elongation factor 1-gamma                               108   4e-24    
gb|KFY71067.1|  hypothetical protein V499_08719                         108   4e-24    
ref|XP_001526253.1|  elongation factor 1-gamma 1                        108   4e-24    
gb|EEQ46357.1|  conserved hypothetical protein                          108   4e-24    
emb|CCO33242.1|  Elongation factor 1-gamma Short=EF-1-gamma             107   4e-24    
gb|KFZ04743.1|  hypothetical protein V501_09006                         107   5e-24    
emb|CCO33105.1|  Elongation factor 1-gamma Short=EF-1-gamma             107   5e-24    
ref|XP_003744624.1|  PREDICTED: elongation factor 1-gamma-like          107   6e-24    
ref|XP_007001088.1|  hypothetical protein TREMEDRAFT_56155              107   7e-24    
gb|KFH74042.1|  hypothetical protein MVEG_01255                         107   7e-24    
gb|ETW29468.1|  hypothetical protein PFFCH_03121                        105   8e-24    
ref|XP_009497236.1|  hypothetical protein H696_05111                    103   8e-24    
gb|KFZ07694.1|  hypothetical protein V502_09840                         107   8e-24    
gb|KGG52346.1|  hypothetical protein DI09_185p10                        107   1e-23    
ref|XP_003290965.1|  hypothetical protein DICPUDRAFT_49566              107   1e-23    
ref|XP_003292098.1|  hypothetical protein DICPUDRAFT_156785             106   1e-23    
ref|XP_007376481.1|  elongation factor 1-gamma 1                        106   1e-23    
gb|KDQ08948.1|  hypothetical protein BOTBODRAFT_37468                   106   1e-23    
ref|XP_005089146.1|  PREDICTED: elongation factor 1-gamma-like          106   1e-23    
ref|XP_003289626.1|  hypothetical protein DICPUDRAFT_92342              105   1e-23    
gb|EMD34943.1|  hypothetical protein CERSUDRAFT_116469                  106   1e-23    
ref|XP_011388729.1|  hypothetical protein UMAG_02442                    106   1e-23    
ref|XP_008815696.1|  elongation factor 1-gamma                          106   2e-23    
ref|XP_008081375.1|  eEF1-gamma                                         106   2e-23    
gb|KIW37511.1|  hypothetical protein PV06_10164                         106   2e-23    
ref|XP_001396615.2|  hypothetical protein ANI_1_1132134                 105   2e-23    
gb|ETL96579.1|  hypothetical protein L917_05965                         105   2e-23    
gb|ENI01501.1|  hypothetical protein COCC4DRAFT_43377                   108   2e-23    
gb|EHL02475.1|  putative Elongation factor 1-gamma 2                    106   2e-23    
gb|EUN29355.1|  hypothetical protein COCVIDRAFT_24648                   108   2e-23    
ref|XP_007707915.1|  hypothetical protein COCCADRAFT_1433               108   2e-23    
gb|KIX10612.1|  hypothetical protein Z518_01696                         106   2e-23    
gb|KFX90510.1|  hypothetical protein O988_08171                         106   2e-23    
gb|KFX50153.1|  Elongation factor 1-gamma 2                             105   2e-23    
ref|XP_005723183.1|  PREDICTED: elongation factor 1-gamma-like          106   2e-23    
ref|XP_007692467.1|  hypothetical protein COCMIDRAFT_107326             108   2e-23    
ref|XP_005913461.1|  PREDICTED: elongation factor 1-gamma-like          106   2e-23    
gb|ABG11961.1|  tail muscle elongation factor 1 gamma                   106   2e-23    
ref|XP_003297795.1|  hypothetical protein PTT_08317                     108   3e-23    
ref|XP_002153321.1|  elongation factor 1 gamma domain-containing ...    105   3e-23    
sp|Q90YC0.1|EF1G_CARAU  RecName: Full=Elongation factor 1-gamma; ...    105   3e-23    
ref|XP_004545571.1|  PREDICTED: elongation factor 1-gamma-like          106   3e-23    
gb|EPS26219.1|  hypothetical protein PDE_01155                          105   3e-23    
ref|XP_006220052.1|  PREDICTED: probable elongation factor 1-gamm...    102   3e-23    
gb|ESZ99426.1|  40S ribosomal protein S3aE                              105   3e-23    
gb|EGD96347.1|  elongation factor 1-gamma                               105   3e-23    
ref|XP_001350110.2|  elongation factor 1-gamma, putative                105   3e-23    
gb|ETW47418.1|  hypothetical protein PFMALIP_04497                      105   3e-23    
gb|ETW34692.1|  hypothetical protein PFTANZ_04597                       105   3e-23    
gb|EZF26004.1|  hypothetical protein H100_01805                         105   3e-23    
ref|XP_009497238.1|  hypothetical protein H696_05113                    105   3e-23    
ref|XP_008325378.1|  PREDICTED: LOW QUALITY PROTEIN: elongation f...    105   3e-23    
ref|XP_003023789.1|  glutathione S-transferase, putative                105   3e-23    
ref|XP_003232586.1|  elongation factor 1 gamma domain-containing ...    105   3e-23    
gb|KFY62519.1|  hypothetical protein V496_04550                         105   3e-23    
ref|XP_007705773.1|  hypothetical protein COCSADRAFT_185747             108   3e-23    
ref|XP_001731727.1|  hypothetical protein MGL_0995                      104   3e-23    
gb|EZF28996.1|  hypothetical protein H101_07317                         105   3e-23    
gb|KEQ93378.1|  hypothetical protein AUEXF2481DRAFT_42115               105   3e-23    
gb|KDQ08950.1|  hypothetical protein BOTBODRAFT_59000                   105   3e-23    
gb|ETW55524.1|  hypothetical protein PFUGPA_02286                       105   3e-23    
ref|XP_003956526.1|  hypothetical protein KAFR_0C04000                  105   3e-23    
gb|EUR65945.1|  hypothetical protein PFBG_04685                         105   3e-23    
ref|XP_001733005.1|  glutathione S-transferase domain-containing ...    105   4e-23    
gb|KEQ75846.1|  eEF1-gamma domain-containing protein                    105   4e-23    
ref|XP_003017269.1|  glutathione S-transferase, putative                105   4e-23    
emb|CDR38853.1|  CYFA0S02e07140g1_1                                     105   4e-23    
gb|KGU22970.1|  elongation factor 1-gamma                               105   4e-23    
ref|XP_003980245.1|  hypothetical protein NDAI_0G05860                  105   4e-23    
gb|ADX97113.1|  elongation factor 1-gamma                               104   4e-23    
emb|CCE41259.1|  hypothetical protein CPAR2_302480                      105   4e-23    
ref|XP_003028482.1|  hypothetical protein SCHCODRAFT_86015              105   4e-23    
ref|XP_005707114.1|  elongation factor EF-1 gamma subunit               108   5e-23    
dbj|GAM40842.1|  Tef4 homolog                                           105   5e-23    
ref|XP_005988901.1|  PREDICTED: elongation factor 1-gamma-like          105   5e-23    
emb|CCE42133.1|  hypothetical protein CPAR2_806820                      105   5e-23    
gb|EHA24459.1|  hypothetical protein ASPNIDRAFT_210029                  105   5e-23    
ref|XP_003444636.1|  PREDICTED: elongation factor 1-gamma-like          105   5e-23    
gb|KEF61767.1|  elongation factor 1-gamma                               105   5e-23    
ref|XP_004202421.1|  Piso0_001255                                       104   6e-23    
gb|AIL25493.1|  EF1Bgamma1                                              104   6e-23    
ref|XP_007387563.1|  EF1G-domain-containing protein                     105   7e-23    
gb|KIV91053.1|  hypothetical protein PV10_05638                         104   7e-23    
ref|XP_500806.1|  elongation factor 1 gamma domain-containing pro...    104   7e-23    
ref|XP_003668941.1|  hypothetical protein NDAI_0C00370                  104   7e-23    
gb|EOA93957.1|  Elongation factor 1-gamma                               100   7e-23    
ref|XP_006684814.1|  eEF1-gamma domain-containing protein               104   8e-23    
gb|KIH56458.1|  elongation factor 1 gamma, hypothetical protein         104   8e-23    
emb|CEL61253.1|  Elongation factor 1-gamma OS=Schizosaccharomyces...    104   8e-23    
gb|EYC11955.1|  hypothetical protein Y032_0049g1870                     104   8e-23    
gb|KIL64615.1|  hypothetical protein M378DRAFT_24485                    104   8e-23    
emb|CDO66172.1|  elongation factor 1-gamma, putative                    104   9e-23    
emb|CBQ71185.1|  related to translation elongation factor eEF1, g...    104   9e-23    
ref|XP_007865989.1|  eEF1-gamma domain-containing protein               104   1e-22    
ref|XP_003645716.1|  hypothetical protein Ecym_3413                     103   1e-22    
ref|XP_006781411.1|  PREDICTED: elongation factor 1-gamma-like is...    104   1e-22    
ref|XP_002548408.1|  elongation factor 1-gamma 1                        103   1e-22    
ref|XP_006781412.1|  PREDICTED: elongation factor 1-gamma-like is...    104   1e-22    
ref|XP_001643583.1|  hypothetical protein Kpol_1073p11                  103   1e-22    
gb|ELT98041.1|  hypothetical protein CAPTEDRAFT_173297                  103   1e-22    
emb|CCF48051.1|  related to translation elongation factor eEF1, g...    103   1e-22    
ref|XP_003171907.1|  elongation factor 1 gamma domain-containing ...    103   1e-22    
gb|ERG81045.1|  putative elongation factor 1-gamma                      103   1e-22    
gb|KFY33526.1|  hypothetical protein V494_07539                         103   1e-22    
ref|XP_003670363.1|  hypothetical protein NDAI_0E03030                  103   1e-22    
gb|KFY32718.1|  hypothetical protein V495_08808                         103   1e-22    
ref|XP_004073276.1|  PREDICTED: elongation factor 1-gamma               103   1e-22    
ref|XP_007246522.1|  PREDICTED: elongation factor 1-gamma               103   1e-22    
gb|KII90102.1|  hypothetical protein PLICRDRAFT_53213                   103   1e-22    
gb|KFY07012.1|  hypothetical protein V492_07522                         103   1e-22    
ref|XP_953151.1|  elongation factor 1-gamma                             103   2e-22    
gb|KIL64627.1|  hypothetical protein M378DRAFT_11400                    103   2e-22    
ref|XP_001642592.1|  hypothetical protein Kpol_333p4                    103   2e-22    
gb|KFY21400.1|  hypothetical protein V493_07447                         103   2e-22    
gb|KFX87110.1|  hypothetical protein V490_08542                         103   2e-22    
ref|XP_628596.1|  elongation factor EF1-gamma (glutathione S-tran...    103   2e-22    
ref|XP_007306386.1|  elongation factor 1-gamma                          103   2e-22    
ref|XP_007922713.1|  hypothetical protein MYCFIDRAFT_70922              103   2e-22    
ref|XP_011277482.1|  Elongation factor 1-gamma                          103   2e-22    
ref|XP_007398794.1|  hypothetical protein PHACADRAFT_260849             103   2e-22    
emb|CCK67906.1|  hypothetical protein KNAG_0A02170                      103   2e-22    
ref|XP_502225.1|  elongation factor 1 gamma domain-containing pro...    103   2e-22    
ref|XP_007264683.1|  elongation factor 1-gamma                          103   2e-22    
ref|XP_008027706.1|  hypothetical protein SETTUDRAFT_91803              105   2e-22    
gb|EWC45095.1|  hypothetical protein DRE_06234                          103   3e-22    
ref|XP_003662028.1|  hypothetical protein MYCTH_2302076                 102   3e-22    
ref|XP_007322954.1|  hypothetical protein SERLADRAFT_400352             103   3e-22    
ref|XP_002410199.1|  elongation factor 1 gamma, putative              99.0    3e-22    
gb|ELR10406.1|  hypothetical protein GMDG_00818                         102   3e-22    
gb|KHN78250.1|  putative elongation factor 1-gamma                      105   3e-22    
gb|EMF15588.1|  eEF1-gamma domain-containing protein                    102   3e-22    
ref|XP_448998.1|  elongation factor 1 gamma domain-containing pro...    102   3e-22    
ref|XP_006697077.1|  elongation factor 1-gamma-like protein             102   3e-22    
emb|CCF73767.1|  unnamed protein product                                102   3e-22    



>gb|KDO42760.1| hypothetical protein CISIN_1g014592mg [Citrus sinensis]
Length=387

 Score =   312 bits (800),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 144/154 (94%), Positives = 152/154 (99%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+N
Sbjct  234  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLN  293

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKYAFGKML+IGSEPPFKVKGLWLFRG+EIP+F++DECYDMELY+WK+
Sbjct  294  KVGGFLQRMDLARKYAFGKMLIIGSEPPFKVKGLWLFRGQEIPQFIMDECYDMELYDWKK  353

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDIND AQKERVSQMIED EPFEGEALLDAKCFK
Sbjct  354  VDINDEAQKERVSQMIEDHEPFEGEALLDAKCFK  387



>gb|KDO42759.1| hypothetical protein CISIN_1g014592mg [Citrus sinensis]
Length=422

 Score =   313 bits (803),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 144/154 (94%), Positives = 152/154 (99%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+N
Sbjct  269  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLN  328

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKYAFGKML+IGSEPPFKVKGLWLFRG+EIP+F++DECYDMELY+WK+
Sbjct  329  KVGGFLQRMDLARKYAFGKMLIIGSEPPFKVKGLWLFRGQEIPQFIMDECYDMELYDWKK  388

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDIND AQKERVSQMIED EPFEGEALLDAKCFK
Sbjct  389  VDINDEAQKERVSQMIEDHEPFEGEALLDAKCFK  422



>ref|XP_006441587.1| hypothetical protein CICLE_v10020303mg [Citrus clementina]
 gb|ESR54827.1| hypothetical protein CICLE_v10020303mg [Citrus clementina]
Length=422

 Score =   313 bits (802),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 143/154 (93%), Positives = 152/154 (99%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENT+SFVT+N
Sbjct  269  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTISFVTLN  328

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKYAFGKML+IGSEPPFKVKGLWLFRG+EIP+F++DECYDMELY+WK+
Sbjct  329  KVGGFLQRMDLARKYAFGKMLIIGSEPPFKVKGLWLFRGQEIPQFIMDECYDMELYDWKK  388

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDIND AQKERVSQMIED EPFEGEALLDAKCFK
Sbjct  389  VDINDEAQKERVSQMIEDHEPFEGEALLDAKCFK  422



>ref|XP_007041181.1| Elongation factor 1-gamma 3 isoform 1 [Theobroma cacao]
 gb|EOX97012.1| Elongation factor 1-gamma 3 isoform 1 [Theobroma cacao]
Length=422

 Score =   311 bits (796),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 146/154 (95%), Positives = 151/154 (98%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYN+ENTVSFVTMN
Sbjct  269  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNEENTVSFVTMN  328

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRG+EIP+FVLDECYDMELYEWK+
Sbjct  329  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGQEIPQFVLDECYDMELYEWKK  388

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D AQKERVSQMIED EPFEGE LLDAKCFK
Sbjct  389  VDISDEAQKERVSQMIEDCEPFEGEPLLDAKCFK  422



>ref|XP_010686883.1| PREDICTED: elongation factor 1-gamma-like [Beta vulgaris subsp. 
vulgaris]
Length=416

 Score =   310 bits (793),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 145/154 (94%), Positives = 151/154 (98%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYN+ENTVSFVTMN
Sbjct  263  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNEENTVSFVTMN  322

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRG+EIP+FVLDECYDMELYEW +
Sbjct  323  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGQEIPQFVLDECYDMELYEWTK  382

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VD++D AQKERVSQMIED EPFEGEALLDAKCFK
Sbjct  383  VDLSDEAQKERVSQMIEDYEPFEGEALLDAKCFK  416



>ref|XP_010683294.1| PREDICTED: elongation factor 1-gamma 2-like [Beta vulgaris subsp. 
vulgaris]
Length=418

 Score =   309 bits (792),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 145/154 (94%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKM+LDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYN+ENTVSFVTMN
Sbjct  265  LPPSKMVLDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNEENTVSFVTMN  324

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRG EIP+FVLDECYDMELYEW +
Sbjct  325  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGPEIPQFVLDECYDMELYEWTK  384

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D AQKERVSQMIED EPFEGEALLDAKCFK
Sbjct  385  VDISDEAQKERVSQMIEDFEPFEGEALLDAKCFK  418



>gb|KEH34076.1| translation elongation factor EF1B, gamma chain [Medicago truncatula]
Length=419

 Score =   309 bits (791),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 142/154 (92%), Positives = 151/154 (98%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKM+LD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+N
Sbjct  266  LPPSKMVLDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLN  325

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKYAFGKML+IGSEPPFKVKGLWLFRG+EIPKF++DECYDMELYEW +
Sbjct  326  KVGGFLQRMDLARKYAFGKMLIIGSEPPFKVKGLWLFRGQEIPKFIMDECYDMELYEWTK  385

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D AQKERVSQMIED EPFEGEALLDAKCFK
Sbjct  386  VDISDEAQKERVSQMIEDFEPFEGEALLDAKCFK  419



>ref|XP_010030200.1| PREDICTED: elongation factor 1-gamma [Eucalyptus grandis]
 ref|XP_010030201.1| PREDICTED: elongation factor 1-gamma [Eucalyptus grandis]
 gb|KCW57149.1| hypothetical protein EUGRSUZ_I02782 [Eucalyptus grandis]
Length=419

 Score =   308 bits (790),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 144/154 (94%), Positives = 151/154 (98%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+N
Sbjct  266  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLN  325

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKYAFGKMLVIGSE PFKVKGLWLFRG+E+P+FV+DECYDMELYEWK+
Sbjct  326  KVGGFLQRMDLARKYAFGKMLVIGSEAPFKVKGLWLFRGQEVPQFVIDECYDMELYEWKK  385

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D AQKERVSQMIED EPFEGEALLDAKCFK
Sbjct  386  VDISDEAQKERVSQMIEDQEPFEGEALLDAKCFK  419



>ref|XP_004485430.1| PREDICTED: elongation factor 1-gamma-like isoform X1 [Cicer arietinum]
 ref|XP_004485431.1| PREDICTED: elongation factor 1-gamma-like isoform X2 [Cicer arietinum]
Length=420

 Score =   308 bits (789),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 144/154 (94%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+N
Sbjct  267  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLN  326

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRG+EIPKFV++ECYDMELYEW +
Sbjct  327  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGQEIPKFVMEECYDMELYEWTK  386

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D AQKER SQMIED EPFEGEALLDAKCFK
Sbjct  387  VDISDEAQKERASQMIEDFEPFEGEALLDAKCFK  420



>ref|XP_002264400.1| PREDICTED: elongation factor 1-gamma-like [Vitis vinifera]
 ref|XP_010657965.1| PREDICTED: elongation factor 1-gamma-like [Vitis vinifera]
Length=423

 Score =   308 bits (789),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 143/154 (93%), Positives = 151/154 (98%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+N
Sbjct  270  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLN  329

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKYAFGKMLVIGSE PFKVKGLWLFRG+EIP+F++DECYDMELYEWK+
Sbjct  330  KVGGFLQRMDLARKYAFGKMLVIGSEAPFKVKGLWLFRGQEIPQFIIDECYDMELYEWKK  389

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D AQKERV+QMIED EPFEGEALLDAKCFK
Sbjct  390  VDISDEAQKERVNQMIEDQEPFEGEALLDAKCFK  423



>ref|XP_006478210.1| PREDICTED: elongation factor 1-gamma-like [Citrus sinensis]
Length=422

 Score =   308 bits (789),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 143/154 (93%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+N
Sbjct  269  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLN  328

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRG+ IP+F++ ECYDMELY+WK+
Sbjct  329  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGQVIPQFIMYECYDMELYDWKK  388

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDIND AQKERVSQMIED EPFEGEALLDAKCFK
Sbjct  389  VDINDEAQKERVSQMIEDHEPFEGEALLDAKCFK  422



>ref|XP_009610261.1| PREDICTED: elongation factor 1-gamma 2-like isoform X2 [Nicotiana 
tomentosiformis]
Length=417

 Score =   307 bits (787),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 145/154 (94%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKY DENTVSFVT+N
Sbjct  264  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYQDENTVSFVTLN  323

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKYAFGKMLVIGSE P+KVKGLWLFRGKEIPKFV+DECYDMELYEWK+
Sbjct  324  KVGGFLQRMDLARKYAFGKMLVIGSEAPYKVKGLWLFRGKEIPKFVMDECYDMELYEWKE  383

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDIND AQKERV+QMIED EPFEGEALLDAKCFK
Sbjct  384  VDINDEAQKERVNQMIEDYEPFEGEALLDAKCFK  417



>ref|XP_009774948.1| PREDICTED: elongation factor 1-gamma 2-like isoform X2 [Nicotiana 
sylvestris]
Length=417

 Score =   307 bits (787),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 145/154 (94%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKY DENTVSFVT+N
Sbjct  264  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYQDENTVSFVTLN  323

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKYAFGKMLVIGSE P+KVKGLWLFRGKEIPKFV+DECYDMELYEWK+
Sbjct  324  KVGGFLQRMDLARKYAFGKMLVIGSEAPYKVKGLWLFRGKEIPKFVMDECYDMELYEWKE  383

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDIND AQKERV+QMIED EPFEGEALLDAKCFK
Sbjct  384  VDINDEAQKERVNQMIEDYEPFEGEALLDAKCFK  417



>ref|XP_009610260.1| PREDICTED: elongation factor 1-gamma 2-like isoform X1 [Nicotiana 
tomentosiformis]
Length=417

 Score =   307 bits (787),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 145/154 (94%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKY DENTVSFVT+N
Sbjct  264  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYQDENTVSFVTLN  323

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKYAFGKMLVIGSE P+KVKGLWLFRGKEIPKFV+DECYDMELYEWK+
Sbjct  324  KVGGFLQRMDLARKYAFGKMLVIGSEAPYKVKGLWLFRGKEIPKFVMDECYDMELYEWKE  383

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDIND AQKERV+QMIED EPFEGEALLDAKCFK
Sbjct  384  VDINDEAQKERVNQMIEDYEPFEGEALLDAKCFK  417



>ref|XP_009774942.1| PREDICTED: elongation factor 1-gamma 2-like isoform X1 [Nicotiana 
sylvestris]
Length=417

 Score =   307 bits (787),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 145/154 (94%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKY DENTVSFVT+N
Sbjct  264  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYQDENTVSFVTLN  323

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKYAFGKMLVIGSE P+KVKGLWLFRGKEIPKFV+DECYDMELYEWK+
Sbjct  324  KVGGFLQRMDLARKYAFGKMLVIGSEAPYKVKGLWLFRGKEIPKFVMDECYDMELYEWKE  383

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDIND AQKERV+QMIED EPFEGEALLDAKCFK
Sbjct  384  VDINDEAQKERVNQMIEDYEPFEGEALLDAKCFK  417



>gb|ACU24330.1| unknown [Glycine max]
Length=255

 Score =   301 bits (772),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 143/154 (93%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPS MILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+N
Sbjct  102  LPPSPMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLN  161

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKYAFGKMLVIGS PPFKVKGLWLFRG+EIPKFV+DECYDMELYEW +
Sbjct  162  KVGGFLQRMDLARKYAFGKMLVIGSVPPFKVKGLWLFRGQEIPKFVIDECYDMELYEWTK  221

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D AQKERV+QMIED EPFEGEALLDAKCFK
Sbjct  222  VDISDEAQKERVNQMIEDYEPFEGEALLDAKCFK  255



>ref|XP_003592901.1| Elongation factor 1-gamma [Medicago truncatula]
 gb|ABE91935.1| Elongation factor 1, gamma chain; Glutathione S-transferase, 
C-terminal; Thioredoxin-like fold [Medicago truncatula]
 gb|AES63152.1| translation elongation factor EF1B, gamma chain [Medicago truncatula]
Length=418

 Score =   307 bits (787),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 141/154 (92%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILD+WKRLYSNTK NFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+N
Sbjct  265  LPPSKMILDDWKRLYSNTKRNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLN  324

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKYAFGKML+IGSEPPFKVKGLWLFRG+EIPKF++DECYDMELYEW +
Sbjct  325  KVGGFLQRMDLARKYAFGKMLIIGSEPPFKVKGLWLFRGQEIPKFIIDECYDMELYEWTK  384

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D  QKER SQMIEDAEPFEGEALLDAKCFK
Sbjct  385  VDISDEVQKERASQMIEDAEPFEGEALLDAKCFK  418



>ref|XP_003592902.1| Elongation factor 1-gamma [Medicago truncatula]
 gb|AES63153.1| translation elongation factor EF1B, gamma chain [Medicago truncatula]
Length=418

 Score =   307 bits (786),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 141/154 (92%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILD+WKRLYSNTK NFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+N
Sbjct  265  LPPSKMILDDWKRLYSNTKRNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLN  324

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKYAFGKML+IGSEPPFKVKGLWLFRG+EIPKF++DECYDMELYEW +
Sbjct  325  KVGGFLQRMDLARKYAFGKMLIIGSEPPFKVKGLWLFRGQEIPKFIIDECYDMELYEWTK  384

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D  QKER SQMIEDAEPFEGEALLDAKCFK
Sbjct  385  VDISDEVQKERASQMIEDAEPFEGEALLDAKCFK  418



>ref|XP_010553691.1| PREDICTED: probable elongation factor 1-gamma 2 [Tarenaya hassleriana]
Length=415

 Score =   307 bits (786),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 144/154 (94%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYN+ENTVSFVT+N
Sbjct  262  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNEENTVSFVTLN  321

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDL RKYAFGKMLV GSEPPFKVKGLWLFRG+EIPKFV+DE YDMELYEWK+
Sbjct  322  KVGGFLQRMDLTRKYAFGKMLVCGSEPPFKVKGLWLFRGQEIPKFVMDEVYDMELYEWKK  381

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D AQKERVSQMIEDAEPFEGEALLDAKCFK
Sbjct  382  VDISDEAQKERVSQMIEDAEPFEGEALLDAKCFK  415



>gb|ACB72462.1| elongation factor 1 gamma-like protein [Nicotiana tabacum]
Length=417

 Score =   306 bits (785),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 144/154 (94%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKY DENTVSFVT+N
Sbjct  264  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYQDENTVSFVTLN  323

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKYAFGKMLVIGSE P+KVKGLWLFRGKEIPKFV+DECYDMELYEWK+
Sbjct  324  KVGGFLQRMDLARKYAFGKMLVIGSEAPYKVKGLWLFRGKEIPKFVMDECYDMELYEWKE  383

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDIND +QKERV+QMIED EPFEGEALLDAKCFK
Sbjct  384  VDINDESQKERVNQMIEDYEPFEGEALLDAKCFK  417



>ref|XP_007222556.1| hypothetical protein PRUPE_ppa006233mg [Prunus persica]
 gb|EMJ23755.1| hypothetical protein PRUPE_ppa006233mg [Prunus persica]
Length=421

 Score =   306 bits (785),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 141/154 (92%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILDEWKRLYSNTKTNFREVA+KGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+N
Sbjct  268  LPPSKMILDEWKRLYSNTKTNFREVAVKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLN  327

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRG+EIPKF++DECYDMELY+W++
Sbjct  328  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGQEIPKFIIDECYDMELYDWRK  387

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI D  QKERV+QMIED EPFEGEALLDAKCFK
Sbjct  388  VDITDEDQKERVNQMIEDQEPFEGEALLDAKCFK  421



>ref|XP_010544111.1| PREDICTED: probable elongation factor 1-gamma 2 [Tarenaya hassleriana]
Length=416

 Score =   306 bits (785),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 144/154 (94%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+N
Sbjct  263  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLN  322

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDL RKY FGKMLV GSEPPFKVKGLWLFRG+EIPKFV+DE YDMELYEWK+
Sbjct  323  KVGGFLQRMDLVRKYGFGKMLVCGSEPPFKVKGLWLFRGQEIPKFVMDEVYDMELYEWKK  382

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D AQKERVSQMIEDAEPFEGEALLDAKCFK
Sbjct  383  VDISDEAQKERVSQMIEDAEPFEGEALLDAKCFK  416



>dbj|BAP19108.1| elongation factor 1 gamma-like protein, partial [Ipomoea nil]
Length=170

 Score =   297 bits (761),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 141/154 (92%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+N
Sbjct  17   LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLN  76

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KV GFLQRMDLARKYAFGKMLVIGS+PPFKVKGLWLFRGKEIPKF++DE YDMELYEW++
Sbjct  77   KVSGFLQRMDLARKYAFGKMLVIGSQPPFKVKGLWLFRGKEIPKFIMDEVYDMELYEWRE  136

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
             DIND AQKERV+QMIED EPFEGE LLDAKCFK
Sbjct  137  ADINDEAQKERVNQMIEDHEPFEGEDLLDAKCFK  170



>ref|XP_002526432.1| elongation factor 1 gamma, putative [Ricinus communis]
 gb|EEF35927.1| elongation factor 1 gamma, putative [Ricinus communis]
Length=307

 Score =   302 bits (774),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 141/154 (92%), Positives = 151/154 (98%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+N
Sbjct  154  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLN  213

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKYAFGKMLVIGS PP+KVKGLWLFRG+EIP+FV+DECYDMELY+WK+
Sbjct  214  KVGGFLQRMDLARKYAFGKMLVIGSNPPYKVKGLWLFRGQEIPQFVIDECYDMELYDWKK  273

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VD++D AQKERV+QMIED EPFEGEALLDAKCFK
Sbjct  274  VDLSDEAQKERVNQMIEDFEPFEGEALLDAKCFK  307



>ref|XP_008219063.1| PREDICTED: elongation factor 1-gamma-like [Prunus mume]
Length=421

 Score =   306 bits (784),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 140/154 (91%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILDEWKRLYSNTKTNFRE+A+KGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+N
Sbjct  268  LPPSKMILDEWKRLYSNTKTNFREIAVKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLN  327

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRG+EIPKF++DECYDMELY+W++
Sbjct  328  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGQEIPKFIIDECYDMELYDWRK  387

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI D  QKERV+QMIED EPFEGEALLDAKCFK
Sbjct  388  VDITDEDQKERVNQMIEDQEPFEGEALLDAKCFK  421



>ref|XP_011047878.1| PREDICTED: elongation factor 1-gamma [Populus euphratica]
 ref|XP_011047880.1| PREDICTED: elongation factor 1-gamma [Populus euphratica]
Length=421

 Score =   306 bits (784),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 142/154 (92%), Positives = 151/154 (98%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILD+WKRLYSNTKTNFREVAIKGFW+MYDPEGYSLWFCDYKYNDENTVSFVT+N
Sbjct  268  LPPSKMILDDWKRLYSNTKTNFREVAIKGFWEMYDPEGYSLWFCDYKYNDENTVSFVTLN  327

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRG+EIP+FV+DECYDMELYEW +
Sbjct  328  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGQEIPQFVIDECYDMELYEWTK  387

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D AQKERVSQMIED EPFEG+ALLDAKCFK
Sbjct  388  VDISDEAQKERVSQMIEDHEPFEGDALLDAKCFK  421



>emb|CAN75785.1| hypothetical protein VITISV_021574 [Vitis vinifera]
Length=423

 Score =   306 bits (784),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 142/154 (92%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILDEWKRLYSNTKTNF EVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+N
Sbjct  270  LPPSKMILDEWKRLYSNTKTNFHEVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLN  329

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKYAFGKMLVIGSE PFKVKGLWLFRG+EIP+F++DECYDMELYEWK+
Sbjct  330  KVGGFLQRMDLARKYAFGKMLVIGSEAPFKVKGLWLFRGQEIPQFIIDECYDMELYEWKK  389

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D AQKERV+QMIED EPFEGEALLDAKCFK
Sbjct  390  VDISDEAQKERVNQMIEDQEPFEGEALLDAKCFK  423



>ref|XP_007148576.1| hypothetical protein PHAVU_006G220100g [Phaseolus vulgaris]
 gb|ESW20570.1| hypothetical protein PHAVU_006G220100g [Phaseolus vulgaris]
Length=419

 Score =   306 bits (783),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 143/154 (93%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+N
Sbjct  266  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLN  325

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKYAFGKMLVIGS+ PFKVKGLWLFRG+EIPKFV+DECYDMELYEW +
Sbjct  326  KVGGFLQRMDLARKYAFGKMLVIGSQAPFKVKGLWLFRGQEIPKFVMDECYDMELYEWTK  385

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D AQKERVSQMIED EPFEGE+LLDAKCFK
Sbjct  386  VDISDEAQKERVSQMIEDYEPFEGESLLDAKCFK  419



>gb|AFK34308.1| unknown [Medicago truncatula]
Length=418

 Score =   306 bits (783),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 140/154 (91%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILD+WKRLYSNTK NFREVAIKGFWDMYDPEGYSLWFCDYKYNDENT SFVT+N
Sbjct  265  LPPSKMILDDWKRLYSNTKRNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTASFVTLN  324

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKYAFGKML+IGSEPPFKVKGLWLFRG+EIPKF++DECYDMELYEW +
Sbjct  325  KVGGFLQRMDLARKYAFGKMLIIGSEPPFKVKGLWLFRGQEIPKFIIDECYDMELYEWTK  384

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D  QKER SQMIEDAEPFEGEALLDAKCFK
Sbjct  385  VDISDEVQKERASQMIEDAEPFEGEALLDAKCFK  418



>ref|XP_009759973.1| PREDICTED: elongation factor 1-gamma 2-like isoform X1 [Nicotiana 
sylvestris]
Length=417

 Score =   306 bits (783),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 144/154 (94%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKY DENTVSFVT+N
Sbjct  264  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYQDENTVSFVTLN  323

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKYAFGKMLVIGSE P+KVKGLWLFRGKEIPKFV+DECYDMELYEWK+
Sbjct  324  KVGGFLQRMDLARKYAFGKMLVIGSEAPYKVKGLWLFRGKEIPKFVMDECYDMELYEWKE  383

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDIND AQKERV+QMIED EPFEGE+LLDAKCFK
Sbjct  384  VDINDEAQKERVNQMIEDYEPFEGESLLDAKCFK  417



>ref|XP_009759974.1| PREDICTED: elongation factor 1-gamma 2-like isoform X2 [Nicotiana 
sylvestris]
Length=417

 Score =   306 bits (783),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 144/154 (94%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKY DENTVSFVT+N
Sbjct  264  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYQDENTVSFVTLN  323

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKYAFGKMLVIGSE P+KVKGLWLFRGKEIPKFV+DECYDMELYEWK+
Sbjct  324  KVGGFLQRMDLARKYAFGKMLVIGSEAPYKVKGLWLFRGKEIPKFVMDECYDMELYEWKE  383

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDIND AQKERV+QMIED EPFEGE+LLDAKCFK
Sbjct  384  VDINDEAQKERVNQMIEDYEPFEGESLLDAKCFK  417



>gb|ADB11388.1| gamma class glutathione transferase EF1Bgamma3 [Populus trichocarpa]
Length=421

 Score =   305 bits (782),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 142/154 (92%), Positives = 151/154 (98%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILD+WKRLYSNTKTNFREVAIKGFW+MYDPEGYSLWFCDYKYNDENTVSFVT+N
Sbjct  268  LPPSKMILDDWKRLYSNTKTNFREVAIKGFWEMYDPEGYSLWFCDYKYNDENTVSFVTLN  327

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRG+EIP+FV+DECYDMELYEW +
Sbjct  328  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGQEIPQFVIDECYDMELYEWTK  387

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D AQKERVSQMIED EPFEG+ALLDAKCFK
Sbjct  388  VDISDEAQKERVSQMIEDYEPFEGDALLDAKCFK  421



>ref|XP_007153909.1| hypothetical protein PHAVU_003G075200g [Phaseolus vulgaris]
 gb|ESW25903.1| hypothetical protein PHAVU_003G075200g [Phaseolus vulgaris]
Length=420

 Score =   305 bits (782),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 143/154 (93%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPS MILDEWKRLYSNTK+NFREVAIKGFWDMYDPEGYSLWFC+YKYNDENTVSFVTMN
Sbjct  267  LPPSPMILDEWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCNYKYNDENTVSFVTMN  326

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKYAFGKMLVIGS PPFKVKGLWLFRG+EIPKFV+DECYDMELYEW +
Sbjct  327  KVGGFLQRMDLARKYAFGKMLVIGSNPPFKVKGLWLFRGQEIPKFVIDECYDMELYEWTK  386

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D AQKERVSQMIED EPFEGEALLDAKCFK
Sbjct  387  VDISDEAQKERVSQMIEDYEPFEGEALLDAKCFK  420



>emb|CDP10743.1| unnamed protein product [Coffea canephora]
Length=421

 Score =   305 bits (782),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 144/154 (94%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILDEWKRLYSNTKTNFREVAIKGFW+MYDPEGYSLWFCDYKYNDENTVSFVT+N
Sbjct  268  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWEMYDPEGYSLWFCDYKYNDENTVSFVTLN  327

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKF+LDE YDMELY+WK+
Sbjct  328  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFILDEVYDMELYDWKE  387

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D AQKERVSQMIED EPFEGE LLDAKCFK
Sbjct  388  VDISDEAQKERVSQMIEDYEPFEGEPLLDAKCFK  421



>ref|XP_010272551.1| PREDICTED: elongation factor 1-gamma-like isoform X2 [Nelumbo 
nucifera]
Length=423

 Score =   305 bits (781),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 140/154 (91%), Positives = 152/154 (99%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILDEWKRLYSNTK+NFREVAIKGFWDM+DP+GYSLWFCDYKYNDENTVSFVT+N
Sbjct  270  LPPSKMILDEWKRLYSNTKSNFREVAIKGFWDMFDPDGYSLWFCDYKYNDENTVSFVTLN  329

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KV GFLQRMDLARKYAFGK+LVIGSEPP+KVKGLWLFRG+EIP+FVLDECYDMELY+W++
Sbjct  330  KVSGFLQRMDLARKYAFGKILVIGSEPPYKVKGLWLFRGQEIPQFVLDECYDMELYDWRK  389

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDIND AQKERV+QMIEDAEPFEGEALLDAKCFK
Sbjct  390  VDINDEAQKERVNQMIEDAEPFEGEALLDAKCFK  423



>ref|XP_006600242.1| PREDICTED: elongation factor 1-gamma isoform X1 [Glycine max]
 gb|AJE59628.1| EF1Bgamma class glutathione S-transferase [Glycine max]
Length=420

 Score =   305 bits (781),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 143/154 (93%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPS MILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+N
Sbjct  267  LPPSPMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLN  326

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKYAFGKMLVIGS PPFKVKGLWLFRG+EIPKFV+DECYDMELYEW +
Sbjct  327  KVGGFLQRMDLARKYAFGKMLVIGSVPPFKVKGLWLFRGQEIPKFVIDECYDMELYEWTK  386

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D AQKERV+QMIED EPFEGEALLDAKCFK
Sbjct  387  VDISDEAQKERVNQMIEDYEPFEGEALLDAKCFK  420



>gb|ACA50518.1| elongation factor 1-gamma [Oryza sativa Japonica Group]
Length=414

 Score =   305 bits (780),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 144/154 (94%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN
Sbjct  261  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  320

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDL RKYAFGKMLVIGSEPPFKVKGLWLFRG EIPKFV+DE YDMELYEW +
Sbjct  321  KVGGFLQRMDLCRKYAFGKMLVIGSEPPFKVKGLWLFRGPEIPKFVMDEVYDMELYEWTK  380

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D AQKERVS MIED EPFEGEALLDAKCFK
Sbjct  381  VDISDEAQKERVSAMIEDLEPFEGEALLDAKCFK  414



>ref|NP_001046318.1| Os02g0220600 [Oryza sativa Japonica Group]
 sp|Q9ZRI7.1|EF1G1_ORYSJ RecName: Full=Elongation factor 1-gamma 1; Short=EF-1-gamma 1; 
AltName: Full=eEF-1B gamma 1 [Oryza sativa Japonica Group]
 dbj|BAA34206.1| elongation factor 1B gamma [Oryza sativa]
 dbj|BAD17615.1| Elongation factor 1-gamma [Oryza sativa Japonica Group]
 dbj|BAF08232.1| Os02g0220600 [Oryza sativa Japonica Group]
Length=418

 Score =   304 bits (779),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 144/154 (94%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN
Sbjct  265  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  324

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDL RKYAFGKMLVIGSEPPFKVKGLWLFRG EIPKFV+DE YDMELYEW +
Sbjct  325  KVGGFLQRMDLCRKYAFGKMLVIGSEPPFKVKGLWLFRGPEIPKFVMDEVYDMELYEWTK  384

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D AQKERVS MIED EPFEGEALLDAKCFK
Sbjct  385  VDISDEAQKERVSAMIEDLEPFEGEALLDAKCFK  418



>ref|XP_006647077.1| PREDICTED: elongation factor 1-gamma 2-like [Oryza brachyantha]
Length=418

 Score =   304 bits (779),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 144/154 (94%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN
Sbjct  265  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  324

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDL RKYAFGKMLVIGSEPPFKVKGLWLFRG EIPKFV+DE YDMELYEW +
Sbjct  325  KVGGFLQRMDLCRKYAFGKMLVIGSEPPFKVKGLWLFRGPEIPKFVMDEVYDMELYEWTK  384

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D AQKERVS MIED EPFEGEALLDAKCFK
Sbjct  385  VDISDEAQKERVSAMIEDLEPFEGEALLDAKCFK  418



>gb|ABA81876.1| unknown [Solanum tuberosum]
Length=413

 Score =   304 bits (778),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 140/154 (91%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILD+WKRLYSNTKTNFREVA+KGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+N
Sbjct  260  LPPSKMILDDWKRLYSNTKTNFREVAVKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLN  319

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDL RKYAFGKML++GSE PFKV+GLWLFRGKEIPKFV+DE YDMELYEWK+
Sbjct  320  KVGGFLQRMDLVRKYAFGKMLIVGSEAPFKVQGLWLFRGKEIPKFVMDEVYDMELYEWKE  379

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDIND AQKERVSQMIED EPFEG+ALLDAKCFK
Sbjct  380  VDINDEAQKERVSQMIEDHEPFEGQALLDAKCFK  413



>gb|KEH32762.1| translation elongation factor EF1B, gamma chain [Medicago truncatula]
Length=419

 Score =   304 bits (779),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 142/154 (92%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILD+WKRLYSNTK NFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+N
Sbjct  266  LPPSKMILDDWKRLYSNTKNNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLN  325

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRG+EIPKFV+DECYDMELYEW +
Sbjct  326  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGQEIPKFVMDECYDMELYEWTK  385

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D AQKERV QMIED EPFEGE LLDAKCFK
Sbjct  386  VDISDEAQKERVGQMIEDFEPFEGEPLLDAKCFK  419



>gb|AHZ94964.1| elongation factor 1, partial [Lilium regale]
Length=405

 Score =   303 bits (777),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 143/154 (93%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPS MILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDEN VSFVT+N
Sbjct  252  LPPSPMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENMVSFVTLN  311

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIP+FV+DECYDMELYEW +
Sbjct  312  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPQFVIDECYDMELYEWTR  371

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D AQKERVS MIED EPFEGEALLDAKCFK
Sbjct  372  VDISDEAQKERVSAMIEDQEPFEGEALLDAKCFK  405



>ref|XP_004155227.1| PREDICTED: LOW QUALITY PROTEIN: elongation factor 1-gamma-like 
[Cucumis sativus]
Length=409

 Score =   303 bits (777),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 142/154 (92%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPS MILDEWKRLYSNTK+NFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+N
Sbjct  256  LPPSSMILDEWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLN  315

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMD+ARKYAFGKMLVIGSE P+KVKGLWLFRG EIP+FVLDECYDMELYEWK+
Sbjct  316  KVGGFLQRMDIARKYAFGKMLVIGSEAPYKVKGLWLFRGXEIPQFVLDECYDMELYEWKK  375

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D AQKERVSQMIED EPFEGEALLDAKCFK
Sbjct  376  VDISDEAQKERVSQMIEDQEPFEGEALLDAKCFK  409



>ref|XP_010242290.1| PREDICTED: elongation factor 1-gamma-like [Nelumbo nucifera]
 ref|XP_010242291.1| PREDICTED: elongation factor 1-gamma-like [Nelumbo nucifera]
Length=424

 Score =   304 bits (779),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 141/154 (92%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYD EGYSLWFCDYKYNDENTVSFVT+N
Sbjct  271  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDAEGYSLWFCDYKYNDENTVSFVTLN  330

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KV GFLQRMDLARKYAFGKMLVIGS PPFKVKGLWLFRG+++P+FVLDECYDMELY+W++
Sbjct  331  KVSGFLQRMDLARKYAFGKMLVIGSGPPFKVKGLWLFRGQDVPQFVLDECYDMELYDWRK  390

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDIND AQKERV+QMIEDAEPFEGEALLDAKCFK
Sbjct  391  VDINDEAQKERVNQMIEDAEPFEGEALLDAKCFK  424



>ref|XP_010272550.1| PREDICTED: elongation factor 1-gamma-like isoform X1 [Nelumbo 
nucifera]
Length=487

 Score =   306 bits (784),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 140/154 (91%), Positives = 152/154 (99%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILDEWKRLYSNTK+NFREVAIKGFWDM+DP+GYSLWFCDYKYNDENTVSFVT+N
Sbjct  334  LPPSKMILDEWKRLYSNTKSNFREVAIKGFWDMFDPDGYSLWFCDYKYNDENTVSFVTLN  393

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KV GFLQRMDLARKYAFGK+LVIGSEPP+KVKGLWLFRG+EIP+FVLDECYDMELY+W++
Sbjct  394  KVSGFLQRMDLARKYAFGKILVIGSEPPYKVKGLWLFRGQEIPQFVLDECYDMELYDWRK  453

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDIND AQKERV+QMIEDAEPFEGEALLDAKCFK
Sbjct  454  VDINDEAQKERVNQMIEDAEPFEGEALLDAKCFK  487



>ref|XP_008452241.1| PREDICTED: elongation factor 1-gamma-like [Cucumis melo]
Length=410

 Score =   303 bits (777),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 141/154 (92%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPS MILDEWKRLYSNTKTNFRE+AIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+N
Sbjct  257  LPPSSMILDEWKRLYSNTKTNFREIAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLN  316

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMD+ARKYAFGKMLVIGSE P+KVKGLWLFRGKEIP+FVLDECYDMELYEWK+
Sbjct  317  KVGGFLQRMDIARKYAFGKMLVIGSEAPYKVKGLWLFRGKEIPQFVLDECYDMELYEWKK  376

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D AQKERV+QMIED EPFEGE LLDAKCFK
Sbjct  377  VDISDEAQKERVNQMIEDQEPFEGEVLLDAKCFK  410



>ref|XP_008452240.1| PREDICTED: elongation factor 1-gamma-like [Cucumis melo]
Length=409

 Score =   303 bits (777),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 141/154 (92%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPS MILD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+N
Sbjct  256  LPPSSMILDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLN  315

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMD+ARKYAFGKMLVIGSE P+KVKGLWLFRGKEIP+FVLDECYDMELYEWK+
Sbjct  316  KVGGFLQRMDIARKYAFGKMLVIGSEAPYKVKGLWLFRGKEIPQFVLDECYDMELYEWKK  375

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VD++D AQKERV+QMIED EPFEGEALLDAKCFK
Sbjct  376  VDVSDEAQKERVNQMIEDQEPFEGEALLDAKCFK  409



>gb|KEH32761.1| translation elongation factor EF1B, gamma chain [Medicago truncatula]
Length=384

 Score =   303 bits (775),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 142/154 (92%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILD+WKRLYSNTK NFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+N
Sbjct  231  LPPSKMILDDWKRLYSNTKNNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLN  290

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRG+EIPKFV+DECYDMELYEW +
Sbjct  291  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGQEIPKFVMDECYDMELYEWTK  350

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D AQKERV QMIED EPFEGE LLDAKCFK
Sbjct  351  VDISDEAQKERVGQMIEDFEPFEGEPLLDAKCFK  384



>gb|KJB47884.1| hypothetical protein B456_008G046300 [Gossypium raimondii]
Length=259

 Score =   298 bits (763),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 139/154 (90%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKM+LD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYN+ENTVSFVTMN
Sbjct  106  LPPSKMVLDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNEENTVSFVTMN  165

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKYAFGKMLVIG+ PPFKVKGLWLFRG+EIP+FV+DECYDMELYEWK+
Sbjct  166  KVGGFLQRMDLARKYAFGKMLVIGANPPFKVKGLWLFRGQEIPQFVIDECYDMELYEWKK  225

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VD++D AQKERV+QMIED EPFEGE LLDAKCFK
Sbjct  226  VDLSDAAQKERVNQMIEDCEPFEGEPLLDAKCFK  259



>ref|XP_008456982.1| PREDICTED: elongation factor 1-gamma-like [Cucumis melo]
Length=422

 Score =   304 bits (778),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 142/154 (92%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDEN VSFVT+N
Sbjct  269  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENIVSFVTLN  328

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRG+EIPKF+LDECYDMELYEW++
Sbjct  329  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGQEIPKFILDECYDMELYEWRK  388

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D  QKE V+QMIED EPFEGEALLDAKCFK
Sbjct  389  VDISDEVQKECVNQMIEDQEPFEGEALLDAKCFK  422



>ref|NP_001046317.1| Os02g0220500 [Oryza sativa Japonica Group]
 dbj|BAD17614.1| putative elongation factor 1-gamma [Oryza sativa Japonica Group]
 dbj|BAF08231.1| Os02g0220500 [Oryza sativa Japonica Group]
 gb|EEC72756.1| hypothetical protein OsI_06401 [Oryza sativa Indica Group]
 gb|EEE56571.1| hypothetical protein OsJ_05922 [Oryza sativa Japonica Group]
Length=414

 Score =   303 bits (777),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 143/154 (93%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN
Sbjct  261  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  320

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDL RKYAFGKMLVIGSEPPFKVKGLWLFRG EIPKFV+DE YDMELYEW +
Sbjct  321  KVGGFLQRMDLCRKYAFGKMLVIGSEPPFKVKGLWLFRGPEIPKFVMDEVYDMELYEWTK  380

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D AQKERVS MIED EPFEGE+LLDAKCFK
Sbjct  381  VDISDEAQKERVSAMIEDLEPFEGESLLDAKCFK  414



>ref|XP_008378997.1| PREDICTED: elongation factor 1-gamma, partial [Malus domestica]
Length=157

 Score =   294 bits (753),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 139/154 (90%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKM+LD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFC+YKYNDENTVSFVT+N
Sbjct  4    LPPSKMVLDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCEYKYNDENTVSFVTLN  63

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKYAFGKMLVIGSE PFKVKGLWLFRG+EIPKFV+DECYDMELY W +
Sbjct  64   KVGGFLQRMDLARKYAFGKMLVIGSEAPFKVKGLWLFRGQEIPKFVMDECYDMELYNWTK  123

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D  QKERV+QMIED EPFEGEALLDAKCFK
Sbjct  124  VDISDENQKERVNQMIEDQEPFEGEALLDAKCFK  157



>ref|NP_001274793.1| elongation factor 1-gamma 2-like [Solanum tuberosum]
 gb|ABB87108.1| putative elongation factor 1-gamma-like [Solanum tuberosum]
Length=414

 Score =   303 bits (776),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 140/154 (91%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILD+WKRLYSNTKTNFREVA+KGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+N
Sbjct  261  LPPSKMILDDWKRLYSNTKTNFREVAVKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLN  320

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDL RKYAFGKML++GSE PFKV+GLWLFRGKEIPKFV+DE YDMELYEWK+
Sbjct  321  KVGGFLQRMDLVRKYAFGKMLIVGSEAPFKVQGLWLFRGKEIPKFVMDEVYDMELYEWKE  380

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDIND AQKERVSQMIED EPFEG+ALLDAKCFK
Sbjct  381  VDINDEAQKERVSQMIEDHEPFEGQALLDAKCFK  414



>sp|Q6YW46.2|EF1G2_ORYSJ RecName: Full=Elongation factor 1-gamma 2; Short=EF-1-gamma 2; 
AltName: Full=eEF-1B gamma 2 [Oryza sativa Japonica Group]
Length=418

 Score =   303 bits (776),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 143/154 (93%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN
Sbjct  265  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  324

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDL RKYAFGKMLVIGSEPPFKVKGLWLFRG EIPKFV+DE YDMELYEW +
Sbjct  325  KVGGFLQRMDLCRKYAFGKMLVIGSEPPFKVKGLWLFRGPEIPKFVMDEVYDMELYEWTK  384

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D AQKERVS MIED EPFEGE+LLDAKCFK
Sbjct  385  VDISDEAQKERVSAMIEDLEPFEGESLLDAKCFK  418



>gb|AAO72574.1| elongation factor 1 gamma-like protein [Oryza sativa Japonica 
Group]
Length=409

 Score =   303 bits (775),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 143/154 (93%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN
Sbjct  256  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  315

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDL RKYAFGKMLVIGSEPPFKVKGLWLFRG EIPKFV+DE YDMELYEW +
Sbjct  316  KVGGFLQRMDLCRKYAFGKMLVIGSEPPFKVKGLWLFRGPEIPKFVMDEVYDMELYEWTK  375

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D AQKERVS MIED EPFEGE+LLDAKCFK
Sbjct  376  VDISDEAQKERVSAMIEDLEPFEGESLLDAKCFK  409



>gb|EEE56572.1| hypothetical protein OsJ_05923 [Oryza sativa Japonica Group]
Length=479

 Score =   305 bits (781),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 144/154 (94%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN
Sbjct  326  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  385

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDL RKYAFGKMLVIGSEPPFKVKGLWLFRG EIPKFV+DE YDMELYEW +
Sbjct  386  KVGGFLQRMDLCRKYAFGKMLVIGSEPPFKVKGLWLFRGPEIPKFVMDEVYDMELYEWTK  445

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D AQKERVS MIED EPFEGEALLDAKCFK
Sbjct  446  VDISDEAQKERVSAMIEDLEPFEGEALLDAKCFK  479



>gb|KHN03584.1| Elongation factor 1-gamma [Glycine soja]
Length=420

 Score =   303 bits (776),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 142/154 (92%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPS MILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYN ENTVSFVT+N
Sbjct  267  LPPSPMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNQENTVSFVTLN  326

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKYAFGKMLVIGS PPFKVKGLWLFRG+EIPKFV+DECYDMELYEW +
Sbjct  327  KVGGFLQRMDLARKYAFGKMLVIGSVPPFKVKGLWLFRGQEIPKFVIDECYDMELYEWTK  386

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D AQKERV+QMIED EPFEGEALLDAKCFK
Sbjct  387  VDISDEAQKERVNQMIEDYEPFEGEALLDAKCFK  420



>gb|KJB47885.1| hypothetical protein B456_008G046300 [Gossypium raimondii]
Length=319

 Score =   300 bits (767),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 139/154 (90%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKM+LD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYN+ENTVSFVTMN
Sbjct  166  LPPSKMVLDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNEENTVSFVTMN  225

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKYAFGKMLVIG+ PPFKVKGLWLFRG+EIP+FV+DECYDMELYEWK+
Sbjct  226  KVGGFLQRMDLARKYAFGKMLVIGANPPFKVKGLWLFRGQEIPQFVIDECYDMELYEWKK  285

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VD++D AQKERV+QMIED EPFEGE LLDAKCFK
Sbjct  286  VDLSDAAQKERVNQMIEDCEPFEGEPLLDAKCFK  319



>gb|EEC72757.1| hypothetical protein OsI_06402 [Oryza sativa Indica Group]
Length=479

 Score =   305 bits (781),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 144/154 (94%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN
Sbjct  326  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  385

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDL RKYAFGKMLVIGSEPPFKVKGLWLFRG EIPKFV+DE YDMELYEW +
Sbjct  386  KVGGFLQRMDLCRKYAFGKMLVIGSEPPFKVKGLWLFRGPEIPKFVMDEVYDMELYEWTK  445

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D AQKERVS MIED EPFEGEALLDAKCFK
Sbjct  446  VDISDEAQKERVSAMIEDLEPFEGEALLDAKCFK  479



>ref|XP_010928857.1| PREDICTED: elongation factor 1-gamma 2 [Elaeis guineensis]
Length=419

 Score =   303 bits (775),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 141/154 (92%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFC+YKYNDENTVSFVT+N
Sbjct  266  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCEYKYNDENTVSFVTLN  325

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KV GFLQRMDLARKYAFGKMLVIGSEPP+KVKGLWLFRG+EIP+FVLDECYDMELYEW +
Sbjct  326  KVSGFLQRMDLARKYAFGKMLVIGSEPPYKVKGLWLFRGQEIPQFVLDECYDMELYEWTK  385

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI D AQKERV+ MIED EPFEGEALLDAKCFK
Sbjct  386  VDITDEAQKERVNAMIEDQEPFEGEALLDAKCFK  419



>ref|XP_006339363.1| PREDICTED: elongation factor 1-gamma 2-like isoform X2 [Solanum 
tuberosum]
Length=414

 Score =   303 bits (775),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 140/154 (91%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILD+WKRLYSNTKTNFREVA+KGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+N
Sbjct  261  LPPSKMILDDWKRLYSNTKTNFREVAVKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLN  320

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDL RKYAFGKML++GSE PFKV+GLWLFRGKEIPKFV++E YDMELYEWK+
Sbjct  321  KVGGFLQRMDLVRKYAFGKMLIVGSEAPFKVQGLWLFRGKEIPKFVMEEVYDMELYEWKE  380

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDIND AQKERVSQMIED EPFEGEALLDAKCFK
Sbjct  381  VDINDEAQKERVSQMIEDHEPFEGEALLDAKCFK  414



>ref|XP_006385057.1| elongation factor 1-gamma 1 family protein [Populus trichocarpa]
 gb|ABK94655.1| unknown [Populus trichocarpa]
 gb|ADB11387.1| gamma class glutathione transferase EF1Bgamma2 [Populus trichocarpa]
 gb|ERP62854.1| elongation factor 1-gamma 1 family protein [Populus trichocarpa]
Length=422

 Score =   303 bits (775),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 140/154 (91%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILD+WKRLYSNTKTNFREVAIKGFW+MYDPEGYSLWFC+YKYN+ENTVSFVT+N
Sbjct  269  LPPSKMILDDWKRLYSNTKTNFREVAIKGFWEMYDPEGYSLWFCNYKYNEENTVSFVTLN  328

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRG+EIP+FV+DECYDMELYEW +
Sbjct  329  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGQEIPQFVIDECYDMELYEWTK  388

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D AQKER SQMIED EPFEGEALLDAKCFK
Sbjct  389  VDISDEAQKERASQMIEDCEPFEGEALLDAKCFK  422



>ref|XP_006339362.1| PREDICTED: elongation factor 1-gamma 2-like isoform X1 [Solanum 
tuberosum]
Length=416

 Score =   303 bits (775),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 140/154 (91%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILD+WKRLYSNTKTNFREVA+KGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+N
Sbjct  263  LPPSKMILDDWKRLYSNTKTNFREVAVKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLN  322

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDL RKYAFGKML++GSE PFKV+GLWLFRGKEIPKFV++E YDMELYEWK+
Sbjct  323  KVGGFLQRMDLVRKYAFGKMLIVGSEAPFKVQGLWLFRGKEIPKFVMEEVYDMELYEWKE  382

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDIND AQKERVSQMIED EPFEGEALLDAKCFK
Sbjct  383  VDINDEAQKERVSQMIEDHEPFEGEALLDAKCFK  416



>gb|KJB47897.1| hypothetical protein B456_008G046200 [Gossypium raimondii]
Length=421

 Score =   303 bits (775),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 139/154 (90%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKM+LD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYN+ENTVSFVTMN
Sbjct  268  LPPSKMVLDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNEENTVSFVTMN  327

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKYAFGKMLVIG+ PPFKVKGLWLFRG+EIP+FV+DECYDMELYEWK+
Sbjct  328  KVGGFLQRMDLARKYAFGKMLVIGANPPFKVKGLWLFRGQEIPQFVIDECYDMELYEWKK  387

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VD++D AQKERV+QMIED EPFEGE LLDAKCFK
Sbjct  388  VDLSDAAQKERVNQMIEDCEPFEGEPLLDAKCFK  421



>ref|XP_004133719.1| PREDICTED: elongation factor 1-gamma-like [Cucumis sativus]
Length=409

 Score =   302 bits (774),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 142/154 (92%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPS MILDEWK LYSNTK+NFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+N
Sbjct  256  LPPSSMILDEWKCLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLN  315

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMD+ARKYAFGKMLVIGSE P+KVKGLWLFRGKEIP+FVLDECYDMELYEWK+
Sbjct  316  KVGGFLQRMDIARKYAFGKMLVIGSEAPYKVKGLWLFRGKEIPQFVLDECYDMELYEWKK  375

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D AQKERVSQMIED EPFEGEALLDAKCFK
Sbjct  376  VDISDEAQKERVSQMIEDQEPFEGEALLDAKCFK  409



>ref|XP_006389499.1| elongation factor 1-gamma 1 family protein [Populus trichocarpa]
 gb|ERP48413.1| elongation factor 1-gamma 1 family protein [Populus trichocarpa]
Length=421

 Score =   302 bits (774),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 141/154 (92%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILD+WKRLYSNTKTNFREVAIKGFW+MYDPEGYSLWFCDYKYNDENTVSFVT+N
Sbjct  268  LPPSKMILDDWKRLYSNTKTNFREVAIKGFWEMYDPEGYSLWFCDYKYNDENTVSFVTLN  327

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKYAFGKMLVIGSE PFKVKGLWLFRG+EIP+FV+DECYDMELYEW +
Sbjct  328  KVGGFLQRMDLARKYAFGKMLVIGSEAPFKVKGLWLFRGQEIPQFVIDECYDMELYEWTK  387

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D AQKERVSQMIED EPFEG+ALLDAKCFK
Sbjct  388  VDISDEAQKERVSQMIEDYEPFEGDALLDAKCFK  421



>gb|AIZ68134.1| translation elongation factor 1-gamma [Ornithogalum saundersiae]
Length=414

 Score =   302 bits (773),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 140/154 (91%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFC+YKYN+ENTVSFVT+N
Sbjct  261  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCEYKYNEENTVSFVTLN  320

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKYAFGKMLVIGSEPP+KVKGLWLFRGKEIP FV++ECYDMELYEW +
Sbjct  321  KVGGFLQRMDLARKYAFGKMLVIGSEPPYKVKGLWLFRGKEIPPFVVEECYDMELYEWTK  380

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VD+ND AQKERV+ MIED EPFEGEALLDAKCFK
Sbjct  381  VDLNDEAQKERVNAMIEDQEPFEGEALLDAKCFK  414



>gb|ADR70876.1| eukaryotic translation elongation factor 1B gamma-subunit [Hevea 
brasiliensis]
Length=424

 Score =   302 bits (774),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 140/154 (91%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+N
Sbjct  271  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLN  330

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KV GFLQRMDLARKYAFGKMLVIG  PP+KVKGLWLFRG+EIP+FV+DECYDMELYEWK+
Sbjct  331  KVSGFLQRMDLARKYAFGKMLVIGENPPYKVKGLWLFRGQEIPQFVIDECYDMELYEWKK  390

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D AQKERV+QMIED EPFEGE LLDAKCFK
Sbjct  391  VDISDEAQKERVNQMIEDQEPFEGEPLLDAKCFK  424



>ref|XP_008789740.1| PREDICTED: elongation factor 1-gamma 1 isoform X2 [Phoenix dactylifera]
Length=384

 Score =   301 bits (771),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 140/154 (91%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+N
Sbjct  231  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLN  290

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KV GFLQRMDLARKYAFGKMLVIGSEPP+KVKGLWLFRG+EIP+FVLDECYDMELYEW +
Sbjct  291  KVSGFLQRMDLARKYAFGKMLVIGSEPPYKVKGLWLFRGQEIPQFVLDECYDMELYEWTK  350

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
             DI D AQKER++ MIED EPFEGEALLDAKCFK
Sbjct  351  ADITDEAQKERINAMIEDQEPFEGEALLDAKCFK  384



>ref|XP_011074970.1| PREDICTED: elongation factor 1-gamma-like [Sesamum indicum]
Length=420

 Score =   302 bits (774),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 141/154 (92%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDP GYSLWFC+YKYNDENTVSFVT+N
Sbjct  267  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPAGYSLWFCNYKYNDENTVSFVTLN  326

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KV GFLQRMDLARKYAFGKMLVIGSE P+KVKGLWLFRG EIP+FVLDECYDMELY+W +
Sbjct  327  KVSGFLQRMDLARKYAFGKMLVIGSEAPYKVKGLWLFRGTEIPQFVLDECYDMELYDWTK  386

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDIND AQKERV+QMIEDAEPFEGEALLDAKCFK
Sbjct  387  VDINDEAQKERVNQMIEDAEPFEGEALLDAKCFK  420



>ref|XP_008789739.1| PREDICTED: elongation factor 1-gamma 2 isoform X1 [Phoenix dactylifera]
Length=419

 Score =   302 bits (773),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 140/154 (91%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+N
Sbjct  266  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLN  325

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KV GFLQRMDLARKYAFGKMLVIGSEPP+KVKGLWLFRG+EIP+FVLDECYDMELYEW +
Sbjct  326  KVSGFLQRMDLARKYAFGKMLVIGSEPPYKVKGLWLFRGQEIPQFVLDECYDMELYEWTK  385

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
             DI D AQKER++ MIED EPFEGEALLDAKCFK
Sbjct  386  ADITDEAQKERINAMIEDQEPFEGEALLDAKCFK  419



>ref|XP_011028370.1| PREDICTED: elongation factor 1-gamma 2-like [Populus euphratica]
Length=422

 Score =   302 bits (774),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 139/154 (90%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILD+WKRLYSNTKTNFREVAIKGFW+MYDPEGYSLWFC+YKYN+ENTVSFVT+N
Sbjct  269  LPPSKMILDDWKRLYSNTKTNFREVAIKGFWEMYDPEGYSLWFCNYKYNEENTVSFVTLN  328

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRG+EIP+F++DECYDMELYEW +
Sbjct  329  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGQEIPQFIIDECYDMELYEWTK  388

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D AQKER SQMIED EPFEGEALLDAKCFK
Sbjct  389  VDISDEAQKERASQMIEDCEPFEGEALLDAKCFK  422



>gb|KJB47883.1| hypothetical protein B456_008G046300 [Gossypium raimondii]
 gb|KJB47887.1| hypothetical protein B456_008G046300 [Gossypium raimondii]
 gb|KJB47888.1| hypothetical protein B456_008G046300 [Gossypium raimondii]
Length=421

 Score =   302 bits (774),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 139/154 (90%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKM+LD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYN+ENTVSFVTMN
Sbjct  268  LPPSKMVLDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNEENTVSFVTMN  327

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKYAFGKMLVIG+ PPFKVKGLWLFRG+EIP+FV+DECYDMELYEWK+
Sbjct  328  KVGGFLQRMDLARKYAFGKMLVIGANPPFKVKGLWLFRGQEIPQFVIDECYDMELYEWKK  387

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VD++D AQKERV+QMIED EPFEGE LLDAKCFK
Sbjct  388  VDLSDAAQKERVNQMIEDCEPFEGEPLLDAKCFK  421



>gb|KHG12420.1| hypothetical protein F383_17048 [Gossypium arboreum]
Length=421

 Score =   302 bits (773),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 139/154 (90%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKM+LD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYN+ENTVSFVTMN
Sbjct  268  LPPSKMVLDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNEENTVSFVTMN  327

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKYAFGKMLVIG+ PPFKVKGLWLFRG+EIP+FV+DECYDMELYEWK+
Sbjct  328  KVGGFLQRMDLARKYAFGKMLVIGANPPFKVKGLWLFRGQEIPQFVIDECYDMELYEWKK  387

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VD++D AQKERV+QMIED EPFEGE LLDAKCFK
Sbjct  388  VDLSDAAQKERVNQMIEDCEPFEGEPLLDAKCFK  421



>ref|XP_010907209.1| PREDICTED: elongation factor 1-gamma 2-like [Elaeis guineensis]
Length=419

 Score =   302 bits (773),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 141/154 (92%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+N
Sbjct  266  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLN  325

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KV GFLQRMDLARKYAFGKMLVIGSEPP+KVKGLWLFRG+ IP+FVLDECYDMELYEW +
Sbjct  326  KVSGFLQRMDLARKYAFGKMLVIGSEPPYKVKGLWLFRGQHIPQFVLDECYDMELYEWTK  385

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI D AQKERV+ MIED EPFEGEALLDAKCFK
Sbjct  386  VDITDEAQKERVNAMIEDQEPFEGEALLDAKCFK  419



>gb|KHG04277.1| hypothetical protein F383_29497 [Gossypium arboreum]
Length=421

 Score =   302 bits (773),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 139/154 (90%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKM+LD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYN+ENTVSFVTMN
Sbjct  268  LPPSKMVLDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNEENTVSFVTMN  327

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKYAFGKMLVIG+ PPFKVKGLWLFRG+EIP+FV+DECYDMELYEWK+
Sbjct  328  KVGGFLQRMDLARKYAFGKMLVIGANPPFKVKGLWLFRGQEIPQFVIDECYDMELYEWKK  387

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VD++D AQKERV+QMIED EPFEGE LLDAKCFK
Sbjct  388  VDLSDAAQKERVNQMIEDCEPFEGEPLLDAKCFK  421



>gb|KHN39680.1| Elongation factor 1-gamma [Glycine soja]
Length=331

 Score =   299 bits (765),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 139/154 (90%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+N
Sbjct  178  LPPSKMILDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLN  237

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKYAFGKMLVIGS+ PFKVKGLWLFRG+EIPKFV+DECYDMELY+W +
Sbjct  238  KVGGFLQRMDLARKYAFGKMLVIGSQAPFKVKGLWLFRGQEIPKFVIDECYDMELYDWTK  297

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D  QKERV+QMIED EPFEGE+LLDAKCFK
Sbjct  298  VDISDETQKERVNQMIEDFEPFEGESLLDAKCFK  331



>gb|EYU22759.1| hypothetical protein MIMGU_mgv1a007114mg [Erythranthe guttata]
Length=419

 Score =   301 bits (772),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 138/154 (90%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKM+LD+WKRLYSNTKTNFREVA+KGFWDMYDPEGYSLWFC+YKYNDENTVSFVT+N
Sbjct  266  LPPSKMVLDDWKRLYSNTKTNFREVAVKGFWDMYDPEGYSLWFCEYKYNDENTVSFVTLN  325

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKYAFGKMLVIG+E PFKVKGLWLFRG EIP+FV+DECYDMELY W +
Sbjct  326  KVGGFLQRMDLARKYAFGKMLVIGTEAPFKVKGLWLFRGTEIPQFVMDECYDMELYHWTK  385

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDIND AQKER SQMIEDAEPFEGE LLDAKCFK
Sbjct  386  VDINDEAQKERASQMIEDAEPFEGEGLLDAKCFK  419



>ref|XP_004966044.1| PREDICTED: elongation factor 1-gamma 3-like [Setaria italica]
Length=414

 Score =   301 bits (771),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 139/154 (90%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN
Sbjct  261  LPPSKMILDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  320

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDL RKYAFGKMLV+GSEPPFK+KGLWLFRG+E+PKFV+DE YDMELYEW +
Sbjct  321  KVGGFLQRMDLCRKYAFGKMLVVGSEPPFKLKGLWLFRGQEVPKFVMDEVYDMELYEWTK  380

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D AQ+ERVS MIED EPFEGEALLDAKCFK
Sbjct  381  VDISDEAQRERVSAMIEDQEPFEGEALLDAKCFK  414



>ref|NP_001242737.1| uncharacterized protein LOC100810452 [Glycine max]
 gb|ACU18062.1| unknown [Glycine max]
Length=420

 Score =   301 bits (772),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 140/154 (91%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPS MILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYN ENTVSFVT+N
Sbjct  267  LPPSPMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNQENTVSFVTLN  326

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKYAFGKMLVIGS+PPFKVKGLWLFRG+EIP+FV+DECYDMELYEW +
Sbjct  327  KVGGFLQRMDLARKYAFGKMLVIGSDPPFKVKGLWLFRGQEIPQFVIDECYDMELYEWTK  386

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D  QKERV+QMIED EPFEGEALLDAKCFK
Sbjct  387  VDISDEPQKERVNQMIEDCEPFEGEALLDAKCFK  420



>gb|KHN40193.1| Elongation factor 1-gamma [Glycine soja]
 gb|AJE59625.1| EF1Bgamma class glutathione S-transferase [Glycine max]
Length=420

 Score =   301 bits (771),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 140/154 (91%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPS MILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYN ENTVSFVT+N
Sbjct  267  LPPSPMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNQENTVSFVTLN  326

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKYAFGKMLVIGS+PPFKVKGLWLFRG+EIP+FV+DECYDMELYEW +
Sbjct  327  KVGGFLQRMDLARKYAFGKMLVIGSDPPFKVKGLWLFRGQEIPQFVIDECYDMELYEWTK  386

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D  QKERV+QMIED EPFEGEALLDAKCFK
Sbjct  387  VDISDEPQKERVNQMIEDCEPFEGEALLDAKCFK  420



>ref|XP_002325529.1| hypothetical protein POPTR_0019s10560g [Populus trichocarpa]
 gb|EEE99910.1| hypothetical protein POPTR_0019s10560g [Populus trichocarpa]
 gb|ADB11386.1| gamma class glutathione transferase EF1Bgamma1 [Populus trichocarpa]
Length=426

 Score =   301 bits (772),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 141/154 (92%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILDEWKRLYSNTKTNFREVAIKGFW+MYDPEGYSLWFCDYKYNDENTVSFVT+N
Sbjct  273  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWEMYDPEGYSLWFCDYKYNDENTVSFVTLN  332

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKYAFGKMLVIGS PPFKVKGLWLFRG+EIP+FV+DECYDMELYEWK+
Sbjct  333  KVGGFLQRMDLARKYAFGKMLVIGSGPPFKVKGLWLFRGQEIPQFVIDECYDMELYEWKK  392

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI D  QKER SQMIED EPFEGE LLDAKCFK
Sbjct  393  VDITDEEQKERASQMIEDYEPFEGEPLLDAKCFK  426



>ref|XP_004240589.1| PREDICTED: elongation factor 1-gamma 2-like [Solanum lycopersicum]
Length=413

 Score =   301 bits (771),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 138/154 (90%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILD+WKRLYSNTKTNFREVA+KGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+N
Sbjct  260  LPPSKMILDDWKRLYSNTKTNFREVAVKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLN  319

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRM+L RKYAFGKML++GSE PFKV+GLWLFRGKEIPKFV++E YDMELYEWK+
Sbjct  320  KVGGFLQRMELVRKYAFGKMLIVGSEAPFKVQGLWLFRGKEIPKFVMEEVYDMELYEWKE  379

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDIND AQKERVSQMIED EPFEG+ALLDAKCFK
Sbjct  380  VDINDEAQKERVSQMIEDHEPFEGQALLDAKCFK  413



>ref|XP_011031541.1| PREDICTED: elongation factor 1-gamma-like [Populus euphratica]
 ref|XP_011031542.1| PREDICTED: elongation factor 1-gamma-like [Populus euphratica]
 ref|XP_011031543.1| PREDICTED: elongation factor 1-gamma-like [Populus euphratica]
Length=426

 Score =   301 bits (772),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 141/154 (92%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILDEWKRLYSNTKTNFREVAIKGFW+MYDPEGYSLWFCDYKYNDENTVSFVT+N
Sbjct  273  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWEMYDPEGYSLWFCDYKYNDENTVSFVTLN  332

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKYAFGKMLVIGS PPFKVKGLWLFRG+EIP+FV+DECYDMELYEWK+
Sbjct  333  KVGGFLQRMDLARKYAFGKMLVIGSGPPFKVKGLWLFRGQEIPQFVIDECYDMELYEWKK  392

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI D  QKER SQMIED EPFEGE LLDAKCFK
Sbjct  393  VDITDEEQKERASQMIEDYEPFEGEPLLDAKCFK  426



>ref|XP_002278756.2| PREDICTED: elongation factor 1-gamma [Vitis vinifera]
Length=424

 Score =   301 bits (771),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 138/154 (90%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKM+LD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+N
Sbjct  271  LPPSKMVLDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLN  330

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KV GFLQRMDLARKYAFGKML++GSE PFKVKGLWLFRG+EIP+FV+DECYDMELYEWK+
Sbjct  331  KVTGFLQRMDLARKYAFGKMLIVGSEAPFKVKGLWLFRGQEIPQFVIDECYDMELYEWKK  390

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VD++D AQKERV+QMIED EPFEGEALLDAKCFK
Sbjct  391  VDLSDEAQKERVNQMIEDQEPFEGEALLDAKCFK  424



>ref|NP_001241223.1| uncharacterized protein LOC100787125 [Glycine max]
 gb|ACU24574.1| unknown [Glycine max]
 gb|AJE59627.1| EF1Bgamma class glutathione S-transferase [Glycine max]
Length=419

 Score =   301 bits (771),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 139/154 (90%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+N
Sbjct  266  LPPSKMILDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLN  325

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKYAFGKMLVIGS+ PFKVKGLWLFRG+EIPKFV+DECYDMELY+W +
Sbjct  326  KVGGFLQRMDLARKYAFGKMLVIGSQAPFKVKGLWLFRGQEIPKFVIDECYDMELYDWTK  385

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D  QKERV+QMIED EPFEGE+LLDAKCFK
Sbjct  386  VDISDETQKERVNQMIEDFEPFEGESLLDAKCFK  419



>ref|XP_004966045.1| PREDICTED: elongation factor 1-gamma 3-like [Setaria italica]
Length=414

 Score =   301 bits (770),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 139/154 (90%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN
Sbjct  261  LPPSKMILDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  320

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDL RKYAFGKMLV+GSEPPFK+KGLWLFRG+E+PKFV+DE YDMELYEW +
Sbjct  321  KVGGFLQRMDLCRKYAFGKMLVVGSEPPFKLKGLWLFRGQEVPKFVMDEVYDMELYEWTK  380

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D AQ+ERVS MIED EPFEGEALLDAKCFK
Sbjct  381  VDISDEAQRERVSAMIEDQEPFEGEALLDAKCFK  414



>ref|XP_008677347.1| PREDICTED: elongation factor 1-gamma 2 isoform X1 [Zea mays]
 ref|XP_008677348.1| PREDICTED: elongation factor 1-gamma 2 isoform X1 [Zea mays]
 ref|XP_008679834.1| PREDICTED: elongation factor 1-gamma 2-like [Zea mays]
 ref|XP_008679835.1| PREDICTED: elongation factor 1-gamma 2-like [Zea mays]
 gb|AFW66035.1| elongation factor 1-gamma 2 [Zea mays]
 gb|AFW66036.1| elongation factor 1-gamma 2 [Zea mays]
Length=414

 Score =   301 bits (770),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 140/154 (91%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN
Sbjct  261  LPPSKMILDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  320

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDL RKYAFGKMLV+GSEPPFKVKGLWLFRG EIPKFV+DE YDMELYEW +
Sbjct  321  KVGGFLQRMDLCRKYAFGKMLVVGSEPPFKVKGLWLFRGSEIPKFVMDEVYDMELYEWTK  380

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VD++D AQKERV+ MIED EPFEGEALLDAKCFK
Sbjct  381  VDLSDEAQKERVNAMIEDQEPFEGEALLDAKCFK  414



>gb|KDO40980.1| hypothetical protein CISIN_1g021153mg [Citrus sinensis]
Length=287

 Score =   296 bits (759),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 137/154 (89%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILD+WKRLYSNTK+NFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+N
Sbjct  134  LPPSKMILDDWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLN  193

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KV GFLQRMDLARKYAFGKML+IG+EPP+KVKGLWLFRG EIPKFV+DECYDMELY+WK+
Sbjct  194  KVSGFLQRMDLARKYAFGKMLIIGNEPPYKVKGLWLFRGPEIPKFVMDECYDMELYDWKK  253

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
             DI+D  QKERV+QMIED EPFEGEALLDAKCFK
Sbjct  254  ADISDEEQKERVNQMIEDHEPFEGEALLDAKCFK  287



>ref|XP_004951452.1| PREDICTED: elongation factor 1-gamma 2-like [Setaria italica]
Length=417

 Score =   301 bits (770),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 140/154 (91%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN
Sbjct  264  LPPSKMILDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  323

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDL RKYAFGKMLV+GSEPPFKVKGLWLFRG EIPKFV+DE YDMELYEW +
Sbjct  324  KVGGFLQRMDLCRKYAFGKMLVVGSEPPFKVKGLWLFRGSEIPKFVMDEVYDMELYEWTK  383

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VD++D AQKERV+ MIED EPFEGEALLDAKCFK
Sbjct  384  VDLSDEAQKERVNAMIEDQEPFEGEALLDAKCFK  417



>ref|NP_001131533.1| uncharacterized protein LOC100192872 [Zea mays]
 gb|ACF79973.1| unknown [Zea mays]
Length=307

 Score =   296 bits (759),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 137/154 (89%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKM+LD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+N
Sbjct  154  LPPSKMVLDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLN  213

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDL RKYAFGKMLVIGSEPPFK+KGLWLFRG+++PKFV+DE YDMELYEW +
Sbjct  214  KVGGFLQRMDLCRKYAFGKMLVIGSEPPFKLKGLWLFRGQDVPKFVMDEVYDMELYEWTK  273

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D AQKERV+ MIED EPFEGEALLDAKCFK
Sbjct  274  VDISDEAQKERVNAMIEDQEPFEGEALLDAKCFK  307



>ref|XP_004250642.1| PREDICTED: elongation factor 1-gamma 2-like isoform X2 [Solanum 
lycopersicum]
Length=414

 Score =   300 bits (768),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 139/154 (90%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILD+WKRLYSNTKTNFREVA+KGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+N
Sbjct  261  LPPSKMILDDWKRLYSNTKTNFREVAVKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLN  320

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDL RKYAFGKML++GSE PFKV+GLWLFRGKEIP FV++E YDMELYEWK+
Sbjct  321  KVGGFLQRMDLVRKYAFGKMLIVGSEAPFKVQGLWLFRGKEIPMFVMEEVYDMELYEWKE  380

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDIND AQKERVSQMIED EPFEGEALLDAKCFK
Sbjct  381  VDINDEAQKERVSQMIEDHEPFEGEALLDAKCFK  414



>ref|XP_006392372.1| hypothetical protein EUTSA_v10023493mg [Eutrema salsugineum]
 gb|ESQ29658.1| hypothetical protein EUTSA_v10023493mg [Eutrema salsugineum]
Length=350

 Score =   298 bits (763),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 139/154 (90%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPS M+LDEWKRLYSNTK+NFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+N
Sbjct  197  LPPSPMVLDEWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLN  256

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKYAFGKML+ GSE PFKVKGLWLFRG EIPKF++DE YDMELYEW +
Sbjct  257  KVGGFLQRMDLARKYAFGKMLICGSEGPFKVKGLWLFRGPEIPKFIMDEVYDMELYEWTK  316

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D AQKERVSQMIEDAEPFEGEALLDAKCFK
Sbjct  317  VDISDEAQKERVSQMIEDAEPFEGEALLDAKCFK  350



>gb|ACJ85171.1| unknown [Medicago truncatula]
Length=418

 Score =   300 bits (769),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 138/154 (90%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILD+WKRLYSNTK NFREVAIKGFWDMY PEGYSLWFCDYKYNDENT SFVT+N
Sbjct  265  LPPSKMILDDWKRLYSNTKRNFREVAIKGFWDMYVPEGYSLWFCDYKYNDENTASFVTLN  324

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRM LARKYAFGKML+IGSEPPFKVKGLWLFRG+EIPKF++DECYDMELYEW +
Sbjct  325  KVGGFLQRMALARKYAFGKMLIIGSEPPFKVKGLWLFRGQEIPKFIIDECYDMELYEWTK  384

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D  QKER SQMIEDAEPFEGEALLDAKCFK
Sbjct  385  VDISDEVQKERASQMIEDAEPFEGEALLDAKCFK  418



>ref|XP_004294500.1| PREDICTED: elongation factor 1-gamma-like [Fragaria vesca subsp. 
vesca]
Length=419

 Score =   300 bits (769),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 137/154 (89%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILD+WKRLYSNTKTNFREVA+KGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+N
Sbjct  266  LPPSKMILDDWKRLYSNTKTNFREVAVKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLN  325

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKYAFGKMLVIGS+PPFKVKGLWLFRG+E+P+F++DECYDMELY+W +
Sbjct  326  KVGGFLQRMDLARKYAFGKMLVIGSDPPFKVKGLWLFRGQEVPQFIIDECYDMELYDWCK  385

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI D  QKERV+QMIED EPFEGEALLDAKCFK
Sbjct  386  VDITDENQKERVNQMIEDHEPFEGEALLDAKCFK  419



>ref|XP_004250641.1| PREDICTED: elongation factor 1-gamma 2-like isoform X1 [Solanum 
lycopersicum]
Length=414

 Score =   300 bits (768),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 139/154 (90%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILD+WKRLYSNTKTNFREVA+KGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+N
Sbjct  261  LPPSKMILDDWKRLYSNTKTNFREVAVKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLN  320

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDL RKYAFGKML++GSE PFKV+GLWLFRGKEIP FV++E YDMELYEWK+
Sbjct  321  KVGGFLQRMDLVRKYAFGKMLIVGSEAPFKVQGLWLFRGKEIPMFVMEEVYDMELYEWKE  380

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDIND AQKERVSQMIED EPFEGEALLDAKCFK
Sbjct  381  VDINDEAQKERVSQMIEDHEPFEGEALLDAKCFK  414



>gb|AFW71312.1| hypothetical protein ZEAMMB73_547198 [Zea mays]
Length=317

 Score =   296 bits (759),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 139/154 (90%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSK+ILD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN
Sbjct  164  LPPSKLILDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  223

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDL RKYAFGKMLV+GSEPPFKVKGLWLFRG EIPKFV+DE YDMELYEW +
Sbjct  224  KVGGFLQRMDLCRKYAFGKMLVVGSEPPFKVKGLWLFRGPEIPKFVMDEVYDMELYEWTK  283

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VD++D AQKERV+ MIED EPFEGEALLDAKCFK
Sbjct  284  VDLSDEAQKERVNAMIEDQEPFEGEALLDAKCFK  317



>gb|KDO40981.1| hypothetical protein CISIN_1g021153mg [Citrus sinensis]
 gb|KDO40982.1| hypothetical protein CISIN_1g021153mg [Citrus sinensis]
Length=316

 Score =   296 bits (757),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 137/154 (89%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILD+WKRLYSNTK+NFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+N
Sbjct  163  LPPSKMILDDWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLN  222

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KV GFLQRMDLARKYAFGKML+IG+EPP+KVKGLWLFRG EIPKFV+DECYDMELY+WK+
Sbjct  223  KVSGFLQRMDLARKYAFGKMLIIGNEPPYKVKGLWLFRGPEIPKFVMDECYDMELYDWKK  282

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
             DI+D  QKERV+QMIED EPFEGEALLDAKCFK
Sbjct  283  ADISDEEQKERVNQMIEDHEPFEGEALLDAKCFK  316



>gb|KDO40983.1| hypothetical protein CISIN_1g021153mg [Citrus sinensis]
 gb|KDO40984.1| hypothetical protein CISIN_1g021153mg [Citrus sinensis]
 gb|KDO40985.1| hypothetical protein CISIN_1g021153mg [Citrus sinensis]
Length=256

 Score =   294 bits (752),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 137/154 (89%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILD+WKRLYSNTK+NFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+N
Sbjct  103  LPPSKMILDDWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLN  162

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KV GFLQRMDLARKYAFGKML+IG+EPP+KVKGLWLFRG EIPKFV+DECYDMELY+WK+
Sbjct  163  KVSGFLQRMDLARKYAFGKMLIIGNEPPYKVKGLWLFRGPEIPKFVMDECYDMELYDWKK  222

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
             DI+D  QKERV+QMIED EPFEGEALLDAKCFK
Sbjct  223  ADISDEEQKERVNQMIEDHEPFEGEALLDAKCFK  256



>ref|XP_002451782.1| hypothetical protein SORBIDRAFT_04g007760 [Sorghum bicolor]
 gb|EES04758.1| hypothetical protein SORBIDRAFT_04g007760 [Sorghum bicolor]
Length=418

 Score =   299 bits (766),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 139/154 (90%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+N
Sbjct  265  LPPSKMILDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLN  324

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDL RKYAFGKMLV+GSEPPFKVKGLWLFRG EIPKFV+DE YDMELYEW +
Sbjct  325  KVGGFLQRMDLCRKYAFGKMLVVGSEPPFKVKGLWLFRGSEIPKFVMDEVYDMELYEWTK  384

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VD++D AQKERV+ MIED EPFEGEALLDAKCFK
Sbjct  385  VDLSDEAQKERVNAMIEDQEPFEGEALLDAKCFK  418



>ref|XP_003540135.1| PREDICTED: elongation factor 1-gamma-like [Glycine max]
 gb|KHN11054.1| Elongation factor 1-gamma [Glycine soja]
 gb|AJE59626.1| EF1Bgamma class glutathione S-transferase [Glycine max]
Length=418

 Score =   299 bits (766),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 138/154 (90%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDEN+VSFVT+N
Sbjct  265  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENSVSFVTLN  324

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKYAFGKMLVIGS+ PFKVKGLWLFRG+EIP+FV+DECYDMELY+W +
Sbjct  325  KVGGFLQRMDLARKYAFGKMLVIGSQAPFKVKGLWLFRGQEIPQFVIDECYDMELYDWTK  384

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D  QKERV+QMIED EPFEGE LLDAKCFK
Sbjct  385  VDISDETQKERVNQMIEDYEPFEGEPLLDAKCFK  418



>ref|XP_006392370.1| hypothetical protein EUTSA_v10023493mg [Eutrema salsugineum]
 ref|XP_006392371.1| hypothetical protein EUTSA_v10023493mg [Eutrema salsugineum]
 gb|ESQ29656.1| hypothetical protein EUTSA_v10023493mg [Eutrema salsugineum]
 gb|ESQ29657.1| hypothetical protein EUTSA_v10023493mg [Eutrema salsugineum]
Length=414

 Score =   299 bits (766),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 139/154 (90%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPS M+LDEWKRLYSNTK+NFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+N
Sbjct  261  LPPSPMVLDEWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLN  320

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKYAFGKML+ GSE PFKVKGLWLFRG EIPKF++DE YDMELYEW +
Sbjct  321  KVGGFLQRMDLARKYAFGKMLICGSEGPFKVKGLWLFRGPEIPKFIMDEVYDMELYEWTK  380

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D AQKERVSQMIEDAEPFEGEALLDAKCFK
Sbjct  381  VDISDEAQKERVSQMIEDAEPFEGEALLDAKCFK  414



>ref|XP_008352808.1| PREDICTED: elongation factor 1-gamma-like [Malus domestica]
Length=424

 Score =   299 bits (766),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 138/154 (90%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILD+WKRLYSNTKTNFREVA+KGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+N
Sbjct  271  LPPSKMILDDWKRLYSNTKTNFREVAVKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLN  330

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKYAFGKMLVIGS PPFKVKGLWLFRG+EIPKF++DECYDM LYEW++
Sbjct  331  KVGGFLQRMDLARKYAFGKMLVIGSAPPFKVKGLWLFRGQEIPKFIIDECYDMXLYEWRK  390

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI D  QKERV+QMIED EPFEGE LLDAKCFK
Sbjct  391  VDITDEDQKERVNQMIEDHEPFEGEDLLDAKCFK  424



>gb|KDP42461.1| hypothetical protein JCGZ_00258 [Jatropha curcas]
Length=423

 Score =   299 bits (766),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 138/154 (90%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFC+YKYNDENTVSFVT+N
Sbjct  270  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCEYKYNDENTVSFVTLN  329

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKYAFGKMLVIG+ PP+KVKGLWLFRG EIP+FV+DECYDMELY+WK+
Sbjct  330  KVGGFLQRMDLARKYAFGKMLVIGANPPYKVKGLWLFRGSEIPQFVIDECYDMELYDWKK  389

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D  QKERV+QMIED EPFEGE LLDAKCFK
Sbjct  390  VDISDEEQKERVNQMIEDFEPFEGEPLLDAKCFK  423



>ref|XP_002438602.1| hypothetical protein SORBIDRAFT_10g022570 [Sorghum bicolor]
 gb|EER89969.1| hypothetical protein SORBIDRAFT_10g022570 [Sorghum bicolor]
Length=417

 Score =   298 bits (764),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 138/154 (90%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKM+LD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+N
Sbjct  264  LPPSKMVLDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLN  323

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKYAFGKMLVIGSE PFK+KGLWLFRG+E+PKFV+DE YDMELYEW +
Sbjct  324  KVGGFLQRMDLARKYAFGKMLVIGSEAPFKLKGLWLFRGQEVPKFVMDEVYDMELYEWTK  383

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D AQKERV+ MIED EPFEGEALLDAKCFK
Sbjct  384  VDISDEAQKERVNAMIEDQEPFEGEALLDAKCFK  417



>ref|XP_010101278.1| Elongation factor 1-gamma [Morus notabilis]
 gb|EXB88213.1| Elongation factor 1-gamma [Morus notabilis]
Length=460

 Score =   300 bits (768),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 138/154 (90%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYN+ENTVS+VT+N
Sbjct  307  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNEENTVSYVTLN  366

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KV GFLQRMDLARKYAFGKMLVIGS PPFKVKGLWLFRG++IP+FV+DECYDMELYEW++
Sbjct  367  KVSGFLQRMDLARKYAFGKMLVIGSGPPFKVKGLWLFRGQQIPQFVIDECYDMELYEWQK  426

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI D AQKERV+QMIED EPFEGEALLD+KCFK
Sbjct  427  VDITDEAQKERVNQMIEDHEPFEGEALLDSKCFK  460



>ref|XP_008804357.1| PREDICTED: elongation factor 1-gamma 2-like [Phoenix dactylifera]
Length=461

 Score =   300 bits (768),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 139/154 (90%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILDEWKRLYSNTKTNFREVAIKGFW+MYDPEGYSLWFCDYKYNDENTVSFVT+N
Sbjct  308  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWNMYDPEGYSLWFCDYKYNDENTVSFVTLN  367

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KV GFLQRMDLARKYAFGKMLVIGSEPP+KVKGLWLFRG++IP+FVLDECYDMELYEW +
Sbjct  368  KVSGFLQRMDLARKYAFGKMLVIGSEPPYKVKGLWLFRGQQIPQFVLDECYDMELYEWTK  427

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI D  QKERV+ MIED EPFEGEALLDAKCFK
Sbjct  428  VDIADEVQKERVNAMIEDQEPFEGEALLDAKCFK  461



>gb|AFW76477.1| elongation factor gamma1 [Zea mays]
Length=291

 Score =   294 bits (753),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 137/154 (89%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKM+LD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+N
Sbjct  138  LPPSKMVLDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLN  197

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDL RKYAFGKMLVIGSEPPFK+KGLWLFRG+++PKFV+DE YDMELYEW +
Sbjct  198  KVGGFLQRMDLCRKYAFGKMLVIGSEPPFKLKGLWLFRGQDVPKFVMDEVYDMELYEWTK  257

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D AQKERV+ MIED EPFEGEALLDAKCFK
Sbjct  258  VDISDEAQKERVNAMIEDQEPFEGEALLDAKCFK  291



>ref|XP_008643919.1| PREDICTED: uncharacterized protein LOC100381466 isoform X1 [Zea 
mays]
 gb|AFW71313.1| hypothetical protein ZEAMMB73_547198 [Zea mays]
Length=414

 Score =   298 bits (764),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 139/154 (90%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSK+ILD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN
Sbjct  261  LPPSKLILDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  320

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDL RKYAFGKMLV+GSEPPFKVKGLWLFRG EIPKFV+DE YDMELYEW +
Sbjct  321  KVGGFLQRMDLCRKYAFGKMLVVGSEPPFKVKGLWLFRGPEIPKFVMDEVYDMELYEWTK  380

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VD++D AQKERV+ MIED EPFEGEALLDAKCFK
Sbjct  381  VDLSDEAQKERVNAMIEDQEPFEGEALLDAKCFK  414



>ref|NP_001148829.1| elongation factor 1-gamma 3 [Zea mays]
 gb|ACG33050.1| elongation factor 1-gamma 3 [Zea mays]
 gb|AFW87009.1| elongation factor 1-gamma 3 [Zea mays]
Length=417

 Score =   298 bits (764),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 137/154 (89%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKM+LD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+N
Sbjct  264  LPPSKMVLDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLN  323

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDL RKYAFGKMLV+GSEPPFK+KGLWLFRG+E+PKFV+DE YDMELYEW +
Sbjct  324  KVGGFLQRMDLCRKYAFGKMLVVGSEPPFKLKGLWLFRGQEVPKFVMDEVYDMELYEWTK  383

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D AQKERV+ MIED EPFEGEALLDAKCFK
Sbjct  384  VDISDEAQKERVNAMIEDQEPFEGEALLDAKCFK  417



>ref|NP_001151229.1| elongation factor 1-gamma 2 [Zea mays]
 gb|ACG42059.1| elongation factor 1-gamma 2 [Zea mays]
Length=414

 Score =   298 bits (764),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 139/154 (90%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN
Sbjct  261  LPPSKMILDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  320

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDL RKYAFGKMLV+GSEPPFKVKGLWLFRG EIPKFV+DE YDMELYEW +
Sbjct  321  KVGGFLQRMDLCRKYAFGKMLVVGSEPPFKVKGLWLFRGSEIPKFVMDEVYDMELYEWAK  380

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VD++  AQKERV+ MIED EPFEGEALLDAKCFK
Sbjct  381  VDLSAEAQKERVNAMIEDQEPFEGEALLDAKCFK  414



>ref|XP_009355338.1| PREDICTED: elongation factor 1-gamma [Pyrus x bretschneideri]
Length=420

 Score =   298 bits (764),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 139/154 (90%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKM+LD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFC+YKYNDENTVSFVT+N
Sbjct  267  LPPSKMVLDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCEYKYNDENTVSFVTLN  326

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKYAFGKMLVIGSE PFKVKGLWLFRG+EIPKFV+DECYDMELY W +
Sbjct  327  KVGGFLQRMDLARKYAFGKMLVIGSEAPFKVKGLWLFRGQEIPKFVMDECYDMELYNWTK  386

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D  QKERV+QMIED EPFEGEALLDAKCFK
Sbjct  387  VDISDENQKERVNQMIEDQEPFEGEALLDAKCFK  420



>ref|XP_009353791.1| PREDICTED: elongation factor 1-gamma [Pyrus x bretschneideri]
 ref|XP_009353792.1| PREDICTED: elongation factor 1-gamma [Pyrus x bretschneideri]
Length=420

 Score =   298 bits (764),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 138/154 (90%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKM+LD+WKRLYSNTK+NFREVAIKGFWDMYDPEGYSLWFC+YKYNDENTVSFVT+N
Sbjct  267  LPPSKMVLDDWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCEYKYNDENTVSFVTLN  326

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKYAFGKMLVIGSE PFKVKGLWLFRG+EIPKFV+DECYDMELY W +
Sbjct  327  KVGGFLQRMDLARKYAFGKMLVIGSEAPFKVKGLWLFRGQEIPKFVMDECYDMELYSWTK  386

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D  QKERV+QMIED EPFEGEALLDAKCFK
Sbjct  387  VDISDENQKERVNQMIEDQEPFEGEALLDAKCFK  420



>gb|AFW87006.1| hypothetical protein ZEAMMB73_710904 [Zea mays]
 gb|AFW87007.1| hypothetical protein ZEAMMB73_710904 [Zea mays]
Length=382

 Score =   297 bits (761),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 137/154 (89%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKM+LD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+N
Sbjct  229  LPPSKMVLDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLN  288

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDL RKYAFGKMLV+GSEPPFK+KGLWLFRG+E+PKFV+DE YDMELYEW +
Sbjct  289  KVGGFLQRMDLCRKYAFGKMLVVGSEPPFKLKGLWLFRGQEVPKFVMDEVYDMELYEWTK  348

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D AQKERV+ MIED EPFEGEALLDAKCFK
Sbjct  349  VDISDEAQKERVNAMIEDQEPFEGEALLDAKCFK  382



>ref|XP_009417204.1| PREDICTED: elongation factor 1-gamma 2-like [Musa acuminata subsp. 
malaccensis]
Length=419

 Score =   298 bits (764),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 140/154 (91%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+N
Sbjct  266  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLN  325

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KV GFLQRMDLARKYAFGKMLVIGS+PPFKVKG+WLFRG EIPKFVLDE YDMELY+W +
Sbjct  326  KVSGFLQRMDLARKYAFGKMLVIGSDPPFKVKGVWLFRGLEIPKFVLDEVYDMELYDWAK  385

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D AQKERV+ MIED EPFEGEALLDAKCFK
Sbjct  386  VDISDEAQKERVNAMIEDQEPFEGEALLDAKCFK  419



>ref|XP_009362385.1| PREDICTED: elongation factor 1-gamma-like [Pyrus x bretschneideri]
Length=422

 Score =   298 bits (764),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 137/154 (89%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILD+WKRLYSNTKTNFREVA+KGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+N
Sbjct  269  LPPSKMILDDWKRLYSNTKTNFREVAVKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLN  328

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKYAFGKMLVIGS PPFKVKGLWLFRG+EIPKF+++ECYDM+LYEW++
Sbjct  329  KVGGFLQRMDLARKYAFGKMLVIGSAPPFKVKGLWLFRGQEIPKFIINECYDMDLYEWRK  388

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI D  QKERV QMIED EPFEGE LLDAKCFK
Sbjct  389  VDITDEDQKERVCQMIEDHEPFEGEDLLDAKCFK  422



>gb|AFW76480.1| elongation factor gamma1 [Zea mays]
Length=382

 Score =   297 bits (760),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 137/154 (89%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKM+LD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+N
Sbjct  229  LPPSKMVLDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLN  288

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDL RKYAFGKMLVIGSEPPFK+KGLWLFRG+++PKFV+DE YDMELYEW +
Sbjct  289  KVGGFLQRMDLCRKYAFGKMLVIGSEPPFKLKGLWLFRGQDVPKFVMDEVYDMELYEWTK  348

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D AQKERV+ MIED EPFEGEALLDAKCFK
Sbjct  349  VDISDEAQKERVNAMIEDQEPFEGEALLDAKCFK  382



>ref|XP_006431568.1| hypothetical protein CICLE_v10003566mg [Citrus clementina]
 gb|ESR44808.1| hypothetical protein CICLE_v10003566mg [Citrus clementina]
Length=418

 Score =   298 bits (762),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 137/154 (89%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILD+WKRLYSNTK+NFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+N
Sbjct  265  LPPSKMILDDWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLN  324

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KV GFLQRMDLARKYAFGKML+IG+EPP+KVKGLWLFRG EIPKFV+DECYDMELY+WK+
Sbjct  325  KVSGFLQRMDLARKYAFGKMLIIGNEPPYKVKGLWLFRGPEIPKFVMDECYDMELYDWKK  384

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
             DI+D  QKERV+QMIED EPFEGEALLDAKCFK
Sbjct  385  ADISDEEQKERVNQMIEDHEPFEGEALLDAKCFK  418



>ref|XP_008647353.1| PREDICTED: uncharacterized protein LOC100192872 isoform X1 [Zea 
mays]
 gb|AFW76478.1| elongation factor gamma1 [Zea mays]
Length=417

 Score =   298 bits (762),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 137/154 (89%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKM+LD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+N
Sbjct  264  LPPSKMVLDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLN  323

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDL RKYAFGKMLVIGSEPPFK+KGLWLFRG+++PKFV+DE YDMELYEW +
Sbjct  324  KVGGFLQRMDLCRKYAFGKMLVIGSEPPFKLKGLWLFRGQDVPKFVMDEVYDMELYEWTK  383

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D AQKERV+ MIED EPFEGEALLDAKCFK
Sbjct  384  VDISDEAQKERVNAMIEDQEPFEGEALLDAKCFK  417



>ref|XP_006494223.1| PREDICTED: elongation factor 1-gamma 3-like isoform X1 [Citrus 
sinensis]
 ref|XP_006494224.1| PREDICTED: elongation factor 1-gamma 3-like isoform X2 [Citrus 
sinensis]
 gb|ACP43319.1| translation elongation factor [Citrus maxima]
Length=418

 Score =   298 bits (762),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 137/154 (89%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILD+WKRLYSNTK+NFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+N
Sbjct  265  LPPSKMILDDWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLN  324

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KV GFLQRMDLARKYAFGKML+IG+EPP+KVKGLWLFRG EIPKFV+DECYDMELY+WK+
Sbjct  325  KVSGFLQRMDLARKYAFGKMLIIGNEPPYKVKGLWLFRGPEIPKFVMDECYDMELYDWKK  384

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
             DI+D  QKERV+QMIED EPFEGEALLDAKCFK
Sbjct  385  ADISDEEQKERVNQMIEDHEPFEGEALLDAKCFK  418



>gb|ACU24584.1| unknown [Glycine max]
Length=418

 Score =   297 bits (761),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 138/154 (90%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDEN+VSFVT+N
Sbjct  265  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENSVSFVTLN  324

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKYAFGKMLVIGS+ PFKVKGLWLFRG+EIP+FV+DECYDMELY+W +
Sbjct  325  KVGGFLQRMDLARKYAFGKMLVIGSQAPFKVKGLWLFRGQEIPQFVIDECYDMELYDWTK  384

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI D  QKERV+QMIED EPFEGE LLDAKCFK
Sbjct  385  VDIFDETQKERVNQMIEDYEPFEGEPLLDAKCFK  418



>emb|CDY22629.1| BnaC08g42630D [Brassica napus]
Length=415

 Score =   297 bits (761),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 138/154 (90%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPS M+LDEWKRLYSNTK+NFREVAIKGFWDMYDPEGYSLWFCDYKYNDEN VSFVT+N
Sbjct  262  LPPSPMVLDEWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENMVSFVTLN  321

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKYAFGKML+ GSE PFKVKGLWLFRG EIPKF++DE YDMELYEW +
Sbjct  322  KVGGFLQRMDLARKYAFGKMLICGSEAPFKVKGLWLFRGPEIPKFIMDEVYDMELYEWTK  381

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D AQKERVSQMIEDAEPFEGEALLDAKCFK
Sbjct  382  VDISDEAQKERVSQMIEDAEPFEGEALLDAKCFK  415



>emb|CDY31074.1| BnaA08g26240D [Brassica napus]
Length=412

 Score =   297 bits (760),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 139/154 (90%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPS M+LDEWKRLYSNTK+NFREVAIKGFWDMYDPEGYSLWFCDYKYNDEN VSFVT+N
Sbjct  259  LPPSPMVLDEWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENMVSFVTLN  318

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKYAFGKML+ GSE PFKVKGLWLFRG EIPKFV+DE YDMELYEW +
Sbjct  319  KVGGFLQRMDLARKYAFGKMLICGSEGPFKVKGLWLFRGPEIPKFVMDEVYDMELYEWTK  378

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D AQKERVSQMIEDAEPFEGEALLDAKCFK
Sbjct  379  VDISDEAQKERVSQMIEDAEPFEGEALLDAKCFK  412



>ref|XP_008365322.1| PREDICTED: LOW QUALITY PROTEIN: elongation factor 1-gamma-like 
[Malus domestica]
Length=419

 Score =   297 bits (761),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 139/154 (90%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKM+LD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFC+YKYNDENTVSFVT+N
Sbjct  266  LPPSKMVLDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCEYKYNDENTVSFVTLN  325

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKYAFGKMLVIGSE PFKVKGLWLFRG+EIPKFV+DECYDMELY W +
Sbjct  326  KVGGFLQRMDLARKYAFGKMLVIGSEAPFKVKGLWLFRGQEIPKFVMDECYDMELYNWTK  385

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D  QKERV+QMIED EPFEGEALLDAKCFK
Sbjct  386  VDISDENQKERVNQMIEDQEPFEGEALLDAKCFK  419



>ref|XP_009110814.1| PREDICTED: probable elongation factor 1-gamma 1 [Brassica rapa]
Length=412

 Score =   297 bits (760),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 139/154 (90%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPS M+LDEWKRLYSNTK+NFREVAIKGFWDMYDPEGYSLWFCDYKYNDEN VSFVT+N
Sbjct  259  LPPSPMVLDEWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENMVSFVTLN  318

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKYAFGKML+ GSE PFKVKGLWLFRG EIPKFV+DE YDMELYEW +
Sbjct  319  KVGGFLQRMDLARKYAFGKMLICGSEGPFKVKGLWLFRGPEIPKFVMDEVYDMELYEWTK  378

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D AQKERVSQMIEDAEPFEGEALLDAKCFK
Sbjct  379  VDISDEAQKERVSQMIEDAEPFEGEALLDAKCFK  412



>emb|CDX93494.1| BnaA06g05540D [Brassica napus]
Length=413

 Score =   297 bits (760),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 139/154 (90%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPS M+LDEWKRLYSNTK+NFREVAIKGFWDMYDPEGYSLWFCDYKYNDEN VSFVT+N
Sbjct  260  LPPSPMVLDEWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENMVSFVTLN  319

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKYAFGKML+ GSE PFKVKGLWLFRG EIPKFV+DE YDMELYEW +
Sbjct  320  KVGGFLQRMDLARKYAFGKMLICGSEGPFKVKGLWLFRGPEIPKFVMDEVYDMELYEWTK  379

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D AQKERVSQMIEDAEPFEGEALLDAKCFK
Sbjct  380  VDISDEAQKERVSQMIEDAEPFEGEALLDAKCFK  413



>ref|XP_004300001.1| PREDICTED: elongation factor 1-gamma-like [Fragaria vesca subsp. 
vesca]
Length=420

 Score =   297 bits (760),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 137/154 (89%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+N
Sbjct  267  LPPSKMILDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLN  326

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKYAFGKML+IG+ PP+KVKGLWLFRG EIP+FV+ ECYDMELYEW +
Sbjct  327  KVGGFLQRMDLARKYAFGKMLIIGANPPYKVKGLWLFRGPEIPEFVMQECYDMELYEWTK  386

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D  QKERVSQMIED EPFEGE LLDAKCFK
Sbjct  387  VDISDENQKERVSQMIEDQEPFEGEPLLDAKCFK  420



>ref|XP_009418787.1| PREDICTED: elongation factor 1-gamma 2-like [Musa acuminata subsp. 
malaccensis]
Length=421

 Score =   296 bits (759),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 139/154 (90%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+N
Sbjct  268  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLN  327

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KV GFLQRMDL RKYAFGKMLVIGSEPPFKVKG+WLFRG+EIPKFVLDE YDMELY+W +
Sbjct  328  KVSGFLQRMDLTRKYAFGKMLVIGSEPPFKVKGVWLFRGQEIPKFVLDEVYDMELYDWAK  387

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D AQKE V+ MIED EPFEGEALLDAKCFK
Sbjct  388  VDISDEAQKELVNAMIEDQEPFEGEALLDAKCFK  421



>ref|XP_006845799.1| hypothetical protein AMTR_s00019p00255470 [Amborella trichopoda]
 gb|ERN07474.1| hypothetical protein AMTR_s00019p00255470 [Amborella trichopoda]
Length=430

 Score =   297 bits (760),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 135/154 (88%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKM+LD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVS+VT+N
Sbjct  277  LPPSKMVLDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSYVTLN  336

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KV GFLQRMDLARKYAFGK+L+IGSEPP+K+KG+WLFRG+EIP+FVLDECYDMELYEW +
Sbjct  337  KVAGFLQRMDLARKYAFGKVLIIGSEPPYKLKGVWLFRGQEIPQFVLDECYDMELYEWTK  396

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDIND  QKERV+ MIED EPFEGEALLDAKCFK
Sbjct  397  VDINDETQKERVNAMIEDQEPFEGEALLDAKCFK  430



>gb|ACG36145.1| elongation factor 1-gamma 3 [Zea mays]
Length=417

 Score =   296 bits (758),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 136/154 (88%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKM+LD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+N
Sbjct  264  LPPSKMVLDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLN  323

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDL RKYAFGKMLVIGSEPPFK+KGLWLFRG+++PKFV+DE YD+ELYEW +
Sbjct  324  KVGGFLQRMDLCRKYAFGKMLVIGSEPPFKLKGLWLFRGQDVPKFVMDEVYDIELYEWTK  383

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D AQKERV+ MIED EPFEGEALLDAKCFK
Sbjct  384  VDISDEAQKERVNAMIEDQEPFEGEALLDAKCFK  417



>ref|XP_009148264.1| PREDICTED: probable elongation factor 1-gamma 1 [Brassica rapa]
Length=413

 Score =   296 bits (758),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 138/154 (90%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPP+ M+LDEWKRLYSNTK+NFREVAIKGFWDMYDPEGYSLWFCDYKYNDEN VSFVT+N
Sbjct  260  LPPTPMVLDEWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENMVSFVTLN  319

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKYAFGKML+ GSE PFKVKGLWLFRG EIPKFV+DE YDMELYEW +
Sbjct  320  KVGGFLQRMDLARKYAFGKMLICGSEGPFKVKGLWLFRGPEIPKFVMDEVYDMELYEWTK  379

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D AQKERVSQMIEDAEPFEGEALLDAKCFK
Sbjct  380  VDISDEAQKERVSQMIEDAEPFEGEALLDAKCFK  413



>ref|XP_008218698.1| PREDICTED: elongation factor 1-gamma-like [Prunus mume]
Length=420

 Score =   296 bits (758),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 136/154 (88%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPS M+LD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFC+YKYNDENTVSFVT+N
Sbjct  267  LPPSSMVLDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCEYKYNDENTVSFVTLN  326

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRG+EIP FV++ECYDMELY+W +
Sbjct  327  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGQEIPPFVMEECYDMELYKWTK  386

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VD++D  QKERV+QMIED EPFEGEALLDAKCFK
Sbjct  387  VDLSDENQKERVNQMIEDQEPFEGEALLDAKCFK  420



>ref|XP_006417552.1| hypothetical protein EUTSA_v10007759mg [Eutrema salsugineum]
 gb|ESQ35905.1| hypothetical protein EUTSA_v10007759mg [Eutrema salsugineum]
Length=413

 Score =   296 bits (757),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 138/154 (90%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPS M+LDEWKRLYSNTK+NFREVAIKGFWDMYDPEGYSLWFCDYKYNDEN VSFVT+N
Sbjct  260  LPPSPMVLDEWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENMVSFVTLN  319

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKYAFGKML+ GSE PFKVKGLWLFRG EIPKF++DE YDMELYEW +
Sbjct  320  KVGGFLQRMDLARKYAFGKMLICGSEGPFKVKGLWLFRGPEIPKFIMDEVYDMELYEWTK  379

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D AQKERVSQMIEDAEPFEGEALLDAKCFK
Sbjct  380  VDISDEAQKERVSQMIEDAEPFEGEALLDAKCFK  413



>ref|XP_004308137.1| PREDICTED: elongation factor 1-gamma-like isoform X2 [Fragaria 
vesca subsp. vesca]
Length=420

 Score =   296 bits (757),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 136/154 (88%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+N
Sbjct  267  LPPSKMILDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLN  326

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKYAFGKML+IG+ PP+KVKGLWLFRG E+P+FV+ ECYDMELYEW +
Sbjct  327  KVGGFLQRMDLARKYAFGKMLIIGANPPYKVKGLWLFRGPEVPEFVMQECYDMELYEWTK  386

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D  QKERVSQMIED EPFEGE LLDAKCFK
Sbjct  387  VDISDENQKERVSQMIEDQEPFEGEPLLDAKCFK  420



>ref|XP_008218696.1| PREDICTED: elongation factor 1-gamma [Prunus mume]
 ref|XP_008218697.1| PREDICTED: elongation factor 1-gamma [Prunus mume]
Length=422

 Score =   296 bits (757),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 136/154 (88%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPS M+LD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFC+YKYNDENTVSFVT+N
Sbjct  269  LPPSSMVLDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCEYKYNDENTVSFVTLN  328

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRG+EIP FV++ECYDMELY W +
Sbjct  329  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGQEIPPFVMEECYDMELYNWTK  388

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VD++D  QKERV+QMIED EPFEGEALLDAKCFK
Sbjct  389  VDLSDENQKERVNQMIEDQEPFEGEALLDAKCFK  422



>emb|CDY50887.1| BnaCnng19790D [Brassica napus]
Length=413

 Score =   295 bits (756),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 137/154 (89%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPS M+LDEWKRLYSNTK+NFREVAIKGFWDMYDPEGYSLWFCDYKYNDEN VSFVT+N
Sbjct  260  LPPSPMVLDEWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENMVSFVTLN  319

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKYAFGKML+ G+E PFKVKGLWLFRG EIPKF++DE YDMELYEW +
Sbjct  320  KVGGFLQRMDLARKYAFGKMLICGAEGPFKVKGLWLFRGPEIPKFIMDEVYDMELYEWTK  379

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D AQKERVSQMIEDAEPFEGEALLDAKCFK
Sbjct  380  VDISDEAQKERVSQMIEDAEPFEGEALLDAKCFK  413



>emb|CDY06365.1| BnaA09g48380D [Brassica napus]
Length=413

 Score =   295 bits (755),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 137/154 (89%), Positives = 145/154 (94%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPS M+LDEWKRLYSNTK+NFREVAIKGFWDMYDPEGYSLWFCDYKYNDEN VSFVT+N
Sbjct  260  LPPSPMVLDEWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENMVSFVTLN  319

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKYAFGKML+ GSE PFKVKGLWLFRG EIPKF++DE YDMELYEW +
Sbjct  320  KVGGFLQRMDLARKYAFGKMLICGSEAPFKVKGLWLFRGPEIPKFIMDEVYDMELYEWTK  379

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
             DI+D AQKERVSQMIEDAEPFEGEALLDAKCFK
Sbjct  380  ADISDEAQKERVSQMIEDAEPFEGEALLDAKCFK  413



>ref|NP_001057916.1| Os06g0571400 [Oryza sativa Japonica Group]
 sp|Q5Z627.1|EF1G3_ORYSJ RecName: Full=Elongation factor 1-gamma 3; Short=EF-1-gamma 3; 
AltName: Full=eEF-1B gamma 3 [Oryza sativa Japonica Group]
 dbj|BAD61828.1| putative elongation factor 1 gamma [Oryza sativa Japonica Group]
 dbj|BAD61932.1| putative elongation factor 1 gamma [Oryza sativa Japonica Group]
 dbj|BAF19830.1| Os06g0571400 [Oryza sativa Japonica Group]
 dbj|BAG90811.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96325.1| unnamed protein product [Oryza sativa Japonica Group]
Length=416

 Score =   295 bits (756),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 138/154 (90%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILDEWKRLYSNTKTNFRE+AIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN
Sbjct  263  LPPSKMILDEWKRLYSNTKTNFREIAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  322

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDL RKYAFGKMLVIGS PPFKVKGLWLFRG++IPKFV+DE YDMELYEW +
Sbjct  323  KVGGFLQRMDLCRKYAFGKMLVIGSTPPFKVKGLWLFRGQDIPKFVMDEVYDMELYEWTK  382

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VD++D AQKERV+ MIED EPFEGE LLDAKCFK
Sbjct  383  VDLSDEAQKERVNAMIEDQEPFEGEDLLDAKCFK  416



>gb|AAL87298.1| unknown protein [Arabidopsis thaliana]
Length=345

 Score =   293 bits (749),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 136/154 (88%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPS M+LD+WKRLYSNTK+NFREVAIKGFWDMYDPEGYSLWFCDYKYNDEN VSFVT+N
Sbjct  192  LPPSPMVLDDWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENMVSFVTLN  251

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKY+FGKML+ GSE PFKVKGLWLFRG EIPKF++DE YDMELYEW +
Sbjct  252  KVGGFLQRMDLARKYSFGKMLICGSEGPFKVKGLWLFRGPEIPKFIMDEVYDMELYEWTK  311

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D AQKERVSQMIEDAEPFEGEALLDAKCFK
Sbjct  312  VDISDEAQKERVSQMIEDAEPFEGEALLDAKCFK  345



>gb|EPS67955.1| elongation factor 1 gamma-like protein, partial [Genlisea aurea]
Length=422

 Score =   295 bits (756),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 139/155 (90%), Positives = 147/155 (95%), Gaps = 1/155 (1%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+N
Sbjct  268  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLN  327

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KV GFLQRMDLARKYAFGKMLVIG  PP+KVKGLWLFRG EIP+FV+DECYD+ELY+W +
Sbjct  328  KVSGFLQRMDLARKYAFGKMLVIGGNPPYKVKGLWLFRGTEIPQFVIDECYDVELYDWAK  387

Query  275  VDINDPAQKERVSQMIEDAEPFE-GEALLDAKCFK  174
            VDIND AQKERV+QMIEDAEPFE GE LLDAKCFK
Sbjct  388  VDINDEAQKERVNQMIEDAEPFEGGEPLLDAKCFK  422



>gb|EYU28215.1| hypothetical protein MIMGU_mgv1a007176mg [Erythranthe guttata]
Length=416

 Score =   295 bits (755),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 137/154 (89%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFC+YKYNDEN VSFVT+N
Sbjct  263  LPPSKMILDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCEYKYNDENKVSFVTLN  322

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KV GFLQRMDLARKYAFGKMLVIGSE PFKVKGLWLFRG EIP+F++DECYDMELY+W +
Sbjct  323  KVSGFLQRMDLARKYAFGKMLVIGSEGPFKVKGLWLFRGTEIPQFIIDECYDMELYDWTK  382

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDIND A KERV+QMIEDAEPFEGE LLDAKCFK
Sbjct  383  VDINDEAHKERVNQMIEDAEPFEGEPLLDAKCFK  416



>ref|XP_009118302.1| PREDICTED: probable elongation factor 1-gamma 1 [Brassica rapa]
Length=413

 Score =   295 bits (755),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 137/154 (89%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPS M+LDEWKRLYSNTK+NFREVAIKGFWDMYDPEGYSLWFCDYKYNDEN VSFVT+N
Sbjct  260  LPPSPMVLDEWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENMVSFVTLN  319

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKYAFGKML+ GSE PFKV+GLWLFRG EIPKF++DE YDMELYEW +
Sbjct  320  KVGGFLQRMDLARKYAFGKMLICGSEAPFKVEGLWLFRGPEIPKFIMDEVYDMELYEWTK  379

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D AQKERVSQMIEDAEPFEGEALLDAKCFK
Sbjct  380  VDISDEAQKERVSQMIEDAEPFEGEALLDAKCFK  413



>ref|XP_008339412.1| PREDICTED: elongation factor 1-gamma [Malus domestica]
Length=420

 Score =   295 bits (755),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 137/154 (89%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKM+LD+WKRLYSNTK+NFREVAIKGFWDMYDPEGYSLWFC+YKYNDENTVSFVT+N
Sbjct  267  LPPSKMVLDDWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCEYKYNDENTVSFVTLN  326

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKYAFGKMLVIGSE PFKVKGLWLFRG+EIPKFV+ ECYDMELY W +
Sbjct  327  KVGGFLQRMDLARKYAFGKMLVIGSEAPFKVKGLWLFRGQEIPKFVMXECYDMELYSWTK  386

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D  QKERV+QMIED EPFEGEALLDAKCFK
Sbjct  387  VDISDENQKERVNQMIEDQEPFEGEALLDAKCFK  420



>gb|AAO72563.1| elongation factor 1 gamma-like protein [Oryza sativa Japonica 
Group]
Length=413

 Score =   295 bits (755),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 138/154 (90%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILDEWKRLYSNTKTNFRE+AIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN
Sbjct  260  LPPSKMILDEWKRLYSNTKTNFREIAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  319

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDL RKYAFGKMLVIGS PPFKVKGLWLFRG++IPKFV+DE YDMELYEW +
Sbjct  320  KVGGFLQRMDLCRKYAFGKMLVIGSTPPFKVKGLWLFRGQDIPKFVMDEVYDMELYEWTK  379

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VD++D AQKERV+ MIED EPFEGE LLDAKCFK
Sbjct  380  VDLSDEAQKERVNAMIEDQEPFEGEDLLDAKCFK  413



>emb|CBI29690.3| unnamed protein product [Vitis vinifera]
Length=435

 Score =   295 bits (756),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 138/149 (93%), Positives = 146/149 (98%), Gaps = 0/149 (0%)
 Frame = -2

Query  620  MILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVGGF  441
            MILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+NKVGGF
Sbjct  1    MILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVGGF  60

Query  440  LQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDIND  261
            LQRMDLARKYAFGKMLVIGSE PFKVKGLWLFRG+EIP+F++DECYDMELYEWK+VDI+D
Sbjct  61   LQRMDLARKYAFGKMLVIGSEAPFKVKGLWLFRGQEIPQFIIDECYDMELYEWKKVDISD  120

Query  260  PAQKERVSQMIEDAEPFEGEALLDAKCFK  174
             AQKERV+QMIED EPFEGEALLDAKCFK
Sbjct  121  EAQKERVNQMIEDQEPFEGEALLDAKCFK  149



>ref|XP_006302321.1| hypothetical protein CARUB_v10020374mg [Capsella rubella]
 gb|EOA35219.1| hypothetical protein CARUB_v10020374mg [Capsella rubella]
Length=413

 Score =   295 bits (754),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 137/154 (89%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPS M+LD+WKRLYSNTK+NFREVAIKGFWDMYDPEGYSLWFCDYKYNDEN VSFVT+N
Sbjct  260  LPPSPMVLDDWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENMVSFVTLN  319

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKYAFGKML+ GSE PFKVKGLWLFRG EIPKF++DE YDMELYEW +
Sbjct  320  KVGGFLQRMDLARKYAFGKMLICGSEGPFKVKGLWLFRGPEIPKFIMDEVYDMELYEWTK  379

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D AQKERVSQMIEDAEPFEGEALLDAKCFK
Sbjct  380  VDISDEAQKERVSQMIEDAEPFEGEALLDAKCFK  413



>ref|XP_010490215.1| PREDICTED: probable elongation factor 1-gamma 1 [Camelina sativa]
Length=415

 Score =   295 bits (754),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 136/154 (88%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPS M+LD+WKRLYSNTK+NFREVAIKGFWDMYDPEGYSLWFCDYKYNDEN VSFVT+N
Sbjct  262  LPPSSMVLDDWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENMVSFVTLN  321

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKY+FGKML+ GSE PFKVKGLWLFRG EIPKF++DE YDMELYEW +
Sbjct  322  KVGGFLQRMDLARKYSFGKMLICGSEGPFKVKGLWLFRGPEIPKFIMDEVYDMELYEWTK  381

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D AQKERVSQMIEDAEPFEGEALLDAKCFK
Sbjct  382  VDISDEAQKERVSQMIEDAEPFEGEALLDAKCFK  415



>ref|NP_563848.1| elongation factor EF-1 gamma subunit [Arabidopsis thaliana]
 sp|O04487.1|EF1G1_ARATH RecName: Full=Probable elongation factor 1-gamma 1; Short=EF-1-gamma 
1; AltName: Full=eEF-1B gamma 1 [Arabidopsis thaliana]
 gb|AAB60721.1| Similar to elongation factor 1-gamma (gb|EF1G_XENLA). ESTs gb|T20564,gb|T45940,gb|T04527 
come from this gene [Arabidopsis 
thaliana]
 dbj|BAH20206.1| AT1G09640 [Arabidopsis thaliana]
 gb|AEE28472.1| elongation factor EF-1 gamma subunit [Arabidopsis thaliana]
Length=414

 Score =   295 bits (754),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 136/154 (88%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPS M+LD+WKRLYSNTK+NFREVAIKGFWDMYDPEGYSLWFCDYKYNDEN VSFVT+N
Sbjct  261  LPPSPMVLDDWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENMVSFVTLN  320

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKY+FGKML+ GSE PFKVKGLWLFRG EIPKF++DE YDMELYEW +
Sbjct  321  KVGGFLQRMDLARKYSFGKMLICGSEGPFKVKGLWLFRGPEIPKFIMDEVYDMELYEWTK  380

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D AQKERVSQMIEDAEPFEGEALLDAKCFK
Sbjct  381  VDISDEAQKERVSQMIEDAEPFEGEALLDAKCFK  414



>ref|XP_006656177.1| PREDICTED: elongation factor 1-gamma 3-like [Oryza brachyantha]
Length=416

 Score =   295 bits (754),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 137/154 (89%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILDEWKRLYSNTKTNFRE+AIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN
Sbjct  263  LPPSKMILDEWKRLYSNTKTNFREIAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  322

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDL RKYAFGKMLVIGS PPFKVKGLWLFRG++IPKFV+DE YDMELY+W +
Sbjct  323  KVGGFLQRMDLCRKYAFGKMLVIGSTPPFKVKGLWLFRGQDIPKFVMDEVYDMELYDWTK  382

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VD++D AQKERV+ MIED EPFEGE LLDAKCFK
Sbjct  383  VDLSDEAQKERVNAMIEDQEPFEGEDLLDAKCFK  416



>ref|XP_010470318.1| PREDICTED: probable elongation factor 1-gamma 2 [Camelina sativa]
Length=413

 Score =   295 bits (754),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 136/154 (88%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPS M+LD+WKRLYSNTK+NFREVAIKGFWDMYDPEGYSLWFCDYKYNDEN VSFVT+N
Sbjct  260  LPPSPMVLDDWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENMVSFVTLN  319

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKYAFGKML+ GSE PFKVKGLW+FRG EIPKF++DE YDMELYEW +
Sbjct  320  KVGGFLQRMDLARKYAFGKMLICGSEGPFKVKGLWIFRGPEIPKFIMDEVYDMELYEWTK  379

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D AQKERVSQMIEDAEPFEGEALLDAKCFK
Sbjct  380  VDISDEAQKERVSQMIEDAEPFEGEALLDAKCFK  413



>ref|XP_006307657.1| hypothetical protein CARUB_v10009284mg [Capsella rubella]
 gb|EOA40555.1| hypothetical protein CARUB_v10009284mg [Capsella rubella]
Length=415

 Score =   295 bits (754),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 136/154 (88%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPS M+LD+WKRLYSNTK+NFREVAIKGFWDMYDPEGYSLWFCDYKYNDEN VSFVT+N
Sbjct  262  LPPSPMVLDDWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENMVSFVTLN  321

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKYAFGKML+ GSE PFKVKGLW+FRG EIPKF++DE YDMELYEW +
Sbjct  322  KVGGFLQRMDLARKYAFGKMLICGSEGPFKVKGLWIFRGPEIPKFIMDEVYDMELYEWTK  381

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D AQKERVSQMIEDAEPFEGEALLDAKCFK
Sbjct  382  VDISDEAQKERVSQMIEDAEPFEGEALLDAKCFK  415



>ref|XP_010511351.1| PREDICTED: probable elongation factor 1-gamma 2 [Camelina sativa]
Length=414

 Score =   295 bits (754),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 136/154 (88%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPS M+LD+WKRLYSNTK+NFREVAIKGFWDMYDPEGYSLWFCDYKYNDEN VSFVT+N
Sbjct  261  LPPSPMVLDDWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENMVSFVTLN  320

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKYAFGKML+ GSE PFKVKGLW+FRG EIPKF++DE YDMELYEW +
Sbjct  321  KVGGFLQRMDLARKYAFGKMLICGSEGPFKVKGLWIFRGPEIPKFIMDEVYDMELYEWTK  380

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D AQKERVSQMIEDAEPFEGEALLDAKCFK
Sbjct  381  VDISDEAQKERVSQMIEDAEPFEGEALLDAKCFK  414



>ref|XP_011470423.1| PREDICTED: elongation factor 1-gamma-like isoform X1 [Fragaria 
vesca subsp. vesca]
Length=479

 Score =   296 bits (759),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 136/154 (88%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+N
Sbjct  326  LPPSKMILDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLN  385

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKYAFGKML+IG+ PP+KVKGLWLFRG E+P+FV+ ECYDMELYEW +
Sbjct  386  KVGGFLQRMDLARKYAFGKMLIIGANPPYKVKGLWLFRGPEVPEFVMQECYDMELYEWTK  445

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D  QKERVSQMIED EPFEGE LLDAKCFK
Sbjct  446  VDISDENQKERVSQMIEDQEPFEGEPLLDAKCFK  479



>gb|EAZ37421.1| hypothetical protein OsJ_21756 [Oryza sativa Japonica Group]
Length=440

 Score =   295 bits (756),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 138/154 (90%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILDEWKRLYSNTKTNFRE+AIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN
Sbjct  287  LPPSKMILDEWKRLYSNTKTNFREIAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  346

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDL RKYAFGKMLVIGS PPFKVKGLWLFRG++IPKFV+DE YDMELYEW +
Sbjct  347  KVGGFLQRMDLCRKYAFGKMLVIGSTPPFKVKGLWLFRGQDIPKFVMDEVYDMELYEWTK  406

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VD++D AQKERV+ MIED EPFEGE LLDAKCFK
Sbjct  407  VDLSDEAQKERVNAMIEDQEPFEGEDLLDAKCFK  440



>gb|AAK59587.1| putative elongation factor 1B gamma [Arabidopsis thaliana]
Length=413

 Score =   294 bits (753),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 136/154 (88%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPS M+LD+WKRLYSNTK+NFREVAIKGFWDMYDPEGYSLWFCDYKYNDEN VSFVT+N
Sbjct  260  LPPSPMVLDDWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENMVSFVTLN  319

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKY+FGKML+ GSE PFKVKGLWLFRG EIPKF++DE YDMELYEW +
Sbjct  320  KVGGFLQRMDLARKYSFGKMLICGSEGPFKVKGLWLFRGPEIPKFIMDEVYDMELYEWTK  379

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D AQKERVSQMIEDAEPFEGEALLDAKCFK
Sbjct  380  VDISDEAQKERVSQMIEDAEPFEGEALLDAKCFK  413



>ref|NP_176084.1| elongation factor EF-1 gamma subunit [Arabidopsis thaliana]
 ref|NP_001031202.1| elongation factor EF-1 gamma subunit [Arabidopsis thaliana]
 sp|Q9FVT2.1|EF1G2_ARATH RecName: Full=Probable elongation factor 1-gamma 2; Short=EF-1-gamma 
2; AltName: Full=eEF-1B gamma 2 [Arabidopsis thaliana]
 gb|AAG50755.1|AC079733_23 elongation factor 1B gamma, putative [Arabidopsis thaliana]
 gb|AAK43879.1|AF370502_1 Unknown protein [Arabidopsis thaliana]
 gb|AAL11623.1|AF424630_1 At1g57720/T8L23_18 [Arabidopsis thaliana]
 gb|AAL16277.1|AF428347_1 At1g57720/T8L23_18 [Arabidopsis thaliana]
 gb|AAL47343.1| unknown protein [Arabidopsis thaliana]
 gb|AAM47351.1| At1g57720/T8L23_18 [Arabidopsis thaliana]
 gb|AAM62488.1| elongation factor 1B gamma, putative [Arabidopsis thaliana]
 gb|AAN41373.1| putative elongation factor 1B gamma [Arabidopsis thaliana]
 gb|AEE33455.1| elongation factor EF-1 gamma subunit [Arabidopsis thaliana]
 gb|AEE33456.1| elongation factor EF-1 gamma subunit [Arabidopsis thaliana]
Length=413

 Score =   294 bits (753),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 136/154 (88%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPS M+LD+WKRLYSNTK+NFREVAIKGFWDMYDPEGYSLWFCDYKYNDEN VSFVT+N
Sbjct  260  LPPSPMVLDDWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENMVSFVTLN  319

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKY+FGKML+ GSE PFKVKGLWLFRG EIPKF++DE YDMELYEW +
Sbjct  320  KVGGFLQRMDLARKYSFGKMLICGSEGPFKVKGLWLFRGPEIPKFIMDEVYDMELYEWTK  379

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D AQKERVSQMIEDAEPFEGEALLDAKCFK
Sbjct  380  VDISDEAQKERVSQMIEDAEPFEGEALLDAKCFK  413



>ref|XP_002892012.1| hypothetical protein ARALYDRAFT_474857 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68271.1| hypothetical protein ARALYDRAFT_474857 [Arabidopsis lyrata subsp. 
lyrata]
Length=413

 Score =   294 bits (752),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 136/154 (88%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPS M+LD+WKRLYSNTK+NFREVAIKGFWDMYDPEGYSLWFCDYKYNDEN VSFVT+N
Sbjct  260  LPPSPMVLDDWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENMVSFVTLN  319

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKY+FGKML+ GSE PFKVKGLWLFRG EIPKF++DE YDMELYEW +
Sbjct  320  KVGGFLQRMDLARKYSFGKMLICGSEGPFKVKGLWLFRGPEIPKFIMDEVYDMELYEWTK  379

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D AQKERVSQMIEDAEPFEGEALLDAKCFK
Sbjct  380  VDISDEAQKERVSQMIEDAEPFEGEALLDAKCFK  413



>ref|XP_002889762.1| hypothetical protein ARALYDRAFT_471063 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66021.1| hypothetical protein ARALYDRAFT_471063 [Arabidopsis lyrata subsp. 
lyrata]
Length=414

 Score =   293 bits (751),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 136/154 (88%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPS M+LD+WKRLYSNTK+NFREVAIKGFWDMYDPEGYSLWFCDYKYNDEN VSFVT+N
Sbjct  261  LPPSPMVLDDWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENMVSFVTLN  320

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKY+FGKML+ GSE PFKVKGLWLFRG EIPKF++DE YDMELYEW +
Sbjct  321  KVGGFLQRMDLARKYSFGKMLICGSEGPFKVKGLWLFRGPEIPKFIMDEVYDMELYEWTK  380

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D AQKERVSQMIEDAEPFEGEALLDAKCFK
Sbjct  381  VDISDEAQKERVSQMIEDAEPFEGEALLDAKCFK  414



>sp|Q9FUM1.1|EF1G_PRUAV RecName: Full=Elongation factor 1-gamma; Short=EF-1-gamma; AltName: 
Full=eEF-1B gamma [Prunus avium]
 gb|AAG17901.1|AF297712_1 translation elongation factor 1-gamma [Prunus avium]
Length=422

 Score =   294 bits (752),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 135/154 (88%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPS M+LD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFC+YKYNDENTVSFVT+N
Sbjct  269  LPPSNMVLDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCEYKYNDENTVSFVTLN  328

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRG+EIP FV++ECYDMELY W +
Sbjct  329  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGQEIPPFVMEECYDMELYNWTK  388

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VD++D  QKERV+Q+IED EPFEGEALLDAKCFK
Sbjct  389  VDLSDENQKERVNQVIEDQEPFEGEALLDAKCFK  422



>ref|XP_007222927.1| hypothetical protein PRUPE_ppa005220mg [Prunus persica]
 gb|EMJ24126.1| hypothetical protein PRUPE_ppa005220mg [Prunus persica]
Length=472

 Score =   295 bits (756),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 135/154 (88%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPS M+LD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFC+YKYNDENTVSFVT+N
Sbjct  319  LPPSGMVLDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCEYKYNDENTVSFVTLN  378

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRG+EIP FV++ECYDMELY W +
Sbjct  379  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGQEIPPFVMEECYDMELYNWTK  438

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VD++D  QKERV+QMIED EPFEGE LLDAKCFK
Sbjct  439  VDLSDENQKERVNQMIEDQEPFEGEVLLDAKCFK  472



>ref|XP_010475805.1| PREDICTED: probable elongation factor 1-gamma 1 isoform X2 [Camelina 
sativa]
Length=435

 Score =   294 bits (752),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 136/154 (88%), Positives = 145/154 (94%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPS M+LD+WKRLYSNTK+NFREVAIKGFWDMYDPEGYSLWFCDYKYNDEN VSFVT+N
Sbjct  282  LPPSPMVLDDWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENMVSFVTLN  341

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKY+FGKML+ GSE PFKVKGLWLFRG EIPKF++DE YDMELYEW +
Sbjct  342  KVGGFLQRMDLARKYSFGKMLICGSEGPFKVKGLWLFRGPEIPKFIMDEVYDMELYEWTK  401

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI D AQKERVSQMIEDAEPFEGEALLDAKCFK
Sbjct  402  VDITDEAQKERVSQMIEDAEPFEGEALLDAKCFK  435



>gb|AGC13144.1| EF1Bgamma class glutathione S-transferase [Pinus tabuliformis]
Length=421

 Score =   292 bits (748),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 136/154 (88%), Positives = 144/154 (94%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFC+YKYNDENTVSFVT+N
Sbjct  268  LPPSKMILDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCEYKYNDENTVSFVTLN  327

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KV GFLQRMDLARKYAFGKML+IG E PFKVKGLWLFRG EIPKFV+DECYDMELYEW +
Sbjct  328  KVTGFLQRMDLARKYAFGKMLIIGKEGPFKVKGLWLFRGPEIPKFVMDECYDMELYEWTK  387

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDIND AQ+ER + MIED EPFEGE LLDAKCFK
Sbjct  388  VDINDDAQRERANAMIEDQEPFEGEPLLDAKCFK  421



>ref|XP_003563720.1| PREDICTED: elongation factor 1-gamma 3 [Brachypodium distachyon]
Length=413

 Score =   291 bits (746),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 135/154 (88%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKM+LD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKY DENTVS+VT+N
Sbjct  260  LPPSKMVLDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYQDENTVSYVTLN  319

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDL RKYAFGKMLVIG+E PFKVKGLWLFRG++IPKFV+DE YDMELYEW +
Sbjct  320  KVGGFLQRMDLCRKYAFGKMLVIGTEAPFKVKGLWLFRGQDIPKFVMDEVYDMELYEWTK  379

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D AQKERVS MIED EPFEG+ALLDAKCFK
Sbjct  380  VDISDEAQKERVSAMIEDLEPFEGQALLDAKCFK  413



>ref|XP_010475804.1| PREDICTED: probable elongation factor 1-gamma 1 isoform X1 [Camelina 
sativa]
Length=415

 Score =   291 bits (745),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 135/154 (88%), Positives = 144/154 (94%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPS M+LD+WKRLYSNTK+NFR VAIKGFWDMYDPEGYSLWFCDYKYNDEN VSFVT+N
Sbjct  262  LPPSPMVLDDWKRLYSNTKSNFRGVAIKGFWDMYDPEGYSLWFCDYKYNDENMVSFVTLN  321

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKY+FGKML+ GSE PFKVKGLWLFRG EIPKF++DE YDMELYEW +
Sbjct  322  KVGGFLQRMDLARKYSFGKMLICGSEGPFKVKGLWLFRGPEIPKFIMDEVYDMELYEWTK  381

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI D AQKERVSQMIEDAEPFEGEALLDAKCFK
Sbjct  382  VDITDEAQKERVSQMIEDAEPFEGEALLDAKCFK  415



>gb|AHC03515.1| gamma class glutathione S-transferase [Larix kaempferi]
Length=422

 Score =   290 bits (742),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 135/154 (88%), Positives = 144/154 (94%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFC+YKYN+ENTVSFVT+N
Sbjct  269  LPPSKMILDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCEYKYNEENTVSFVTLN  328

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KV GFLQRMDLARKYAFGKML+IG   PFKVKGLWLFRG EIPKFV+DECYDMELYEW +
Sbjct  329  KVTGFLQRMDLARKYAFGKMLIIGENGPFKVKGLWLFRGPEIPKFVMDECYDMELYEWTK  388

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDIND AQ+ERV+ MIED EPFEGE LLDAKCFK
Sbjct  389  VDINDEAQRERVNTMIEDQEPFEGEPLLDAKCFK  422



>ref|XP_010458260.1| PREDICTED: probable elongation factor 1-gamma 1 [Camelina sativa]
Length=415

 Score =   290 bits (741),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 134/154 (87%), Positives = 144/154 (94%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPS M+LD+WKRLYSNTK+NFR VAIKGFWDMYDPEGYSLWFCDYKYNDEN VSFVT+N
Sbjct  262  LPPSPMVLDDWKRLYSNTKSNFRGVAIKGFWDMYDPEGYSLWFCDYKYNDENMVSFVTLN  321

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKY+FGKML+ GSE PFKV GLWLFRG EIPKF++DE YDMELYEW +
Sbjct  322  KVGGFLQRMDLARKYSFGKMLICGSEGPFKVTGLWLFRGPEIPKFIMDEVYDMELYEWTK  381

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D AQKERVSQMIEDAEPFEGEALLDAKCFK
Sbjct  382  VDISDEAQKERVSQMIEDAEPFEGEALLDAKCFK  415



>gb|ACJ84953.1| unknown [Medicago truncatula]
Length=149

 Score =   280 bits (716),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 134/149 (90%), Positives = 140/149 (94%), Gaps = 0/149 (0%)
 Frame = -2

Query  620  MILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVGGF  441
            MILD+WKRLYSNTK NFREVAIKGFWDMYDPEGYSLWFCDYKYNDEN VSFV +NKVGGF
Sbjct  1    MILDDWKRLYSNTKNNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENAVSFVALNKVGGF  60

Query  440  LQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDIND  261
            LQRMDLARKYAFGKMLVIG EPPFKVKGLWLFRG+EIPKFV+DECYDMELYEW +VDI+D
Sbjct  61   LQRMDLARKYAFGKMLVIGFEPPFKVKGLWLFRGQEIPKFVMDECYDMELYEWTKVDISD  120

Query  260  PAQKERVSQMIEDAEPFEGEALLDAKCFK  174
             AQKERV QMIED EPFEGE LLDAKCFK
Sbjct  121  EAQKERVGQMIEDFEPFEGEPLLDAKCFK  149



>ref|XP_003571724.1| PREDICTED: elongation factor 1-gamma 2 [Brachypodium distachyon]
Length=417

 Score =   289 bits (740),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 135/154 (88%), Positives = 145/154 (94%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILD+WK+LYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKY++ENTVS+VT+N
Sbjct  264  LPPSKMILDDWKKLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYDEENTVSYVTLN  323

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDL RKYAFGKMLVIGSE PFKVKGLWLFRG EIPKFVL+E YDMELYEW +
Sbjct  324  KVGGFLQRMDLCRKYAFGKMLVIGSEAPFKVKGLWLFRGTEIPKFVLEEVYDMELYEWTK  383

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D AQKER S MIED EPF+GEALLDAKCFK
Sbjct  384  VDISDEAQKERASAMIEDLEPFDGEALLDAKCFK  417



>emb|CDY20681.1| BnaC08g13770D [Brassica napus]
Length=558

 Score =   293 bits (751),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 137/153 (90%), Positives = 144/153 (94%), Gaps = 0/153 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPS M+LDEWKRLYSNTK+NFREVAIKGFWDMYDPEGYSLWFCDYKYNDEN VSFVT+N
Sbjct  259  LPPSPMVLDEWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENMVSFVTLN  318

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKYAFGKML+ GSE PFK KGLWLFRG EIPKFV+DE YDMELYEW +
Sbjct  319  KVGGFLQRMDLARKYAFGKMLICGSEGPFKAKGLWLFRGPEIPKFVMDEVYDMELYEWTK  378

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCF  177
            VDI+D AQKERVSQMIEDAEPFEGEALLDAKCF
Sbjct  379  VDISDEAQKERVSQMIEDAEPFEGEALLDAKCF  411



>dbj|BAD94347.1| hypothetical protein [Arabidopsis thaliana]
Length=149

 Score =   280 bits (715),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 132/149 (89%), Positives = 142/149 (95%), Gaps = 0/149 (0%)
 Frame = -2

Query  620  MILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVGGF  441
            M+LD+WKRLYSNTK+NFREVAIKGFWDMYDPEGYSLWFCDYKYNDEN VSFVT+NKVGGF
Sbjct  1    MVLDDWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENMVSFVTLNKVGGF  60

Query  440  LQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDIND  261
            LQRMDLARKY+FGKML+ GSE PFKVKGLWLFRG EIPKF++DE YDMELYEW +VDI+D
Sbjct  61   LQRMDLARKYSFGKMLICGSEGPFKVKGLWLFRGPEIPKFIMDEVYDMELYEWTKVDISD  120

Query  260  PAQKERVSQMIEDAEPFEGEALLDAKCFK  174
             AQKERVSQMIEDAEPFEGEALLDAKCFK
Sbjct  121  EAQKERVSQMIEDAEPFEGEALLDAKCFK  149



>gb|ABK25057.1| unknown [Picea sitchensis]
Length=424

 Score =   288 bits (737),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 134/154 (87%), Positives = 143/154 (93%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKM+LD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFC+YKYNDENTVSFVT+N
Sbjct  271  LPPSKMVLDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCEYKYNDENTVSFVTLN  330

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KV GFLQRMDLARKYAFGKML+IG E PFKVKGLWLFRG EIPKF +DECYDMELYEW +
Sbjct  331  KVTGFLQRMDLARKYAFGKMLIIGKEGPFKVKGLWLFRGPEIPKFFVDECYDMELYEWTK  390

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VD+ND AQKE V+ MIED EPFEGE LLDAKCFK
Sbjct  391  VDLNDEAQKELVNAMIEDQEPFEGEPLLDAKCFK  424



>emb|CBI29691.3| unnamed protein product [Vitis vinifera]
Length=149

 Score =   276 bits (707),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 132/149 (89%), Positives = 139/149 (93%), Gaps = 0/149 (0%)
 Frame = -2

Query  620  MILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVGGF  441
            MILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYN ENTVSFVT+ KV GF
Sbjct  1    MILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNAENTVSFVTLIKVDGF  60

Query  440  LQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDIND  261
            LQRMDLA KYAFGKMLVIGSE PFKVKGLWLFRG+EIP+F++DECYDME YEWK+VDI+D
Sbjct  61   LQRMDLAHKYAFGKMLVIGSEAPFKVKGLWLFRGQEIPQFIIDECYDMEHYEWKKVDISD  120

Query  260  PAQKERVSQMIEDAEPFEGEALLDAKCFK  174
             AQK RV QMIED EPFEGEALLDAKCFK
Sbjct  121  EAQKGRVIQMIEDQEPFEGEALLDAKCFK  149



>gb|EMT01475.1| Elongation factor 1-gamma 2 [Aegilops tauschii]
Length=604

 Score =   291 bits (744),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 135/154 (88%), Positives = 145/154 (94%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILDEWK+LYSNTKTNFREVAIKGFWDMYDPEGYSLWFCD+KYN+ENTVSFVTMN
Sbjct  451  LPPSKMILDEWKKLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDFKYNEENTVSFVTMN  510

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFL RMDL RKYAFGKMLVIGSEPPFKVKGLWLFRG +IPKFV++E YDM LY+W +
Sbjct  511  KVGGFLLRMDLCRKYAFGKMLVIGSEPPFKVKGLWLFRGPKIPKFVMEEVYDMALYDWAK  570

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VD++D AQKERVS MIED EPFEGEALLDAKCFK
Sbjct  571  VDLSDAAQKERVSAMIEDLEPFEGEALLDAKCFK  604



>gb|KGN56266.1| hypothetical protein Csa_3G110630 [Cucumis sativus]
Length=402

 Score =   283 bits (724),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 135/154 (88%), Positives = 141/154 (92%), Gaps = 7/154 (5%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPS MILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+N
Sbjct  256  LPPSSMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLN  315

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMD+ARKYA G MLVI       + GLWLFRGKEIP+FVLDECYDMELYEWK+
Sbjct  316  KVGGFLQRMDIARKYALGNMLVI-------LSGLWLFRGKEIPQFVLDECYDMELYEWKK  368

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D AQKERVSQMIED EPFEGEALLDAKCFK
Sbjct  369  VDISDEAQKERVSQMIEDQEPFEGEALLDAKCFK  402



>ref|NP_001235707.1| elongation factor 1-gamma [Glycine max]
 gb|AAL82617.1|AF475939_1 elongation factor 1-gamma [Glycine max]
Length=420

 Score =   283 bits (725),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 133/154 (86%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPS MILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYK +DENTVSFVT+N
Sbjct  267  LPPSPMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKNHDENTVSFVTLN  326

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFL RMDLA KY FGKMLVIGS PPFKVKGLWLFRG+EIPKFV+DECYDM+L+ W +
Sbjct  327  KVGGFLHRMDLAPKYPFGKMLVIGSVPPFKVKGLWLFRGQEIPKFVIDECYDMDLHGWTK  386

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D A KER +QMIED EPFEGEALLDAKCFK
Sbjct  387  VDISDEAPKERFNQMIEDYEPFEGEALLDAKCFK  420



>gb|EMS60520.1| Elongation factor 1-gamma 2 [Triticum urartu]
Length=413

 Score =   276 bits (706),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 126/154 (82%), Positives = 144/154 (94%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKM+LD+WKRLYSNTK+NF +VAIKGFW+MYDPEGYSLWFCDYKY +ENTVS+VT+N
Sbjct  260  LPPSKMVLDDWKRLYSNTKSNFHDVAIKGFWEMYDPEGYSLWFCDYKYQEENTVSYVTLN  319

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDL RKYAFGKMLVIGSE PFKVKGLWLFRG++IP+FV++E YDMELYEW +
Sbjct  320  KVGGFLQRMDLCRKYAFGKMLVIGSEAPFKVKGLWLFRGQDIPEFVMNEVYDMELYEWTK  379

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VD++D AQK+RV  MIED EPFEG+ALLDAKCFK
Sbjct  380  VDLSDEAQKKRVEAMIEDLEPFEGQALLDAKCFK  413



>gb|EMT20600.1| Elongation factor 1-gamma 2 [Aegilops tauschii]
Length=413

 Score =   276 bits (705),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 144/154 (94%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKM+LD+WKRLYSNTK+NF +VA+KGFW+MYDPEGYSLWFCDYKY +ENTVS+VT+N
Sbjct  260  LPPSKMVLDDWKRLYSNTKSNFHDVAVKGFWEMYDPEGYSLWFCDYKYQEENTVSYVTLN  319

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDL RKYAFGKMLVIGSE PFKVKGLWLFRG++IP+FV++E YDMELYEW +
Sbjct  320  KVGGFLQRMDLCRKYAFGKMLVIGSEAPFKVKGLWLFRGQDIPEFVMNEVYDMELYEWTK  379

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VD++D AQK+RV  MIED EPFEG+ALLDAKCFK
Sbjct  380  VDLSDEAQKKRVEAMIEDLEPFEGQALLDAKCFK  413



>gb|AIW07751.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07752.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07753.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07754.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07755.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07756.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07757.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07758.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07761.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07762.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07763.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07764.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07765.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07766.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07767.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07768.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07771.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07772.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07773.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07774.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07775.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07776.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07779.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07780.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07783.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07784.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07785.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07786.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07787.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07788.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07789.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07790.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07791.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07792.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07793.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07794.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07795.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07796.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07797.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07798.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07799.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07800.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07801.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07802.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07803.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07804.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07805.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07806.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07807.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07808.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07809.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07810.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07811.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07813.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07814.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07815.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07816.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07817.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07818.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07819.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07820.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07821.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07822.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07823.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07824.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07825.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07826.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07827.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07828.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07829.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07830.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07831.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07832.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07833.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07834.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07837.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07838.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07841.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07842.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07844.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07845.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07846.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07847.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07848.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07849.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07850.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07851.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07852.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07853.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07854.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07855.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07856.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07857.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07858.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07859.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07860.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07861.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07862.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07864.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
Length=182

 Score =   268 bits (684),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 126/143 (88%), Positives = 135/143 (94%), Gaps = 0/143 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFC+YKYNDENTVS+VT+N
Sbjct  40   LPPSKMILDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCEYKYNDENTVSYVTLN  99

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KV GFLQRMDLARKYAFGKML+IG + PFKVKGLWLFRG EIPKFV+DECYDMELYEW +
Sbjct  100  KVTGFLQRMDLARKYAFGKMLIIGEKGPFKVKGLWLFRGPEIPKFVIDECYDMELYEWTK  159

Query  275  VDINDPAQKERVSQMIEDAEPFE  207
            VDIND AQKERV+ MIED EPFE
Sbjct  160  VDINDEAQKERVNAMIEDQEPFE  182



>gb|AIW07759.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07760.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07769.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07770.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07781.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07782.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07812.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07835.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07836.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07839.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07840.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07843.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07863.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
Length=182

 Score =   267 bits (683),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 126/143 (88%), Positives = 135/143 (94%), Gaps = 0/143 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFC+YKYNDENTVS+VT+N
Sbjct  40   LPPSKMILDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCEYKYNDENTVSYVTLN  99

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KV GFLQRMDLARKYAFGKML+IG + PFKVKGLWLFRG EIPKFV+DECYDMELYEW +
Sbjct  100  KVTGFLQRMDLARKYAFGKMLIIGEKGPFKVKGLWLFRGPEIPKFVIDECYDMELYEWTK  159

Query  275  VDINDPAQKERVSQMIEDAEPFE  207
            VDIND AQKERV+ MIED EPFE
Sbjct  160  VDINDDAQKERVNAMIEDQEPFE  182



>gb|EEC80835.1| hypothetical protein OsI_23436 [Oryza sativa Indica Group]
Length=458

 Score =   275 bits (704),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 138/196 (70%), Positives = 146/196 (74%), Gaps = 42/196 (21%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIK--------------------------------  552
            LPPSKMILDEWKRLYSNTKTNFRE+AIK                                
Sbjct  263  LPPSKMILDEWKRLYSNTKTNFREIAIKAPAPAPPLLELELSQTVSAPPKLGVELGGALS  322

Query  551  ----------GFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVGGFLQRMDLARKYAFG  402
                      GFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVGGFLQRMDL RKYAFG
Sbjct  323  QNRHYHVYFPGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVGGFLQRMDLCRKYAFG  382

Query  401  KMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDINDPAQKERVSQMIED  222
            KMLVIGS PPFKVKGLWLFRG++IPKFV+DE YDMELYEW +VD++D AQKERV+ MIED
Sbjct  383  KMLVIGSTPPFKVKGLWLFRGQDIPKFVMDEVYDMELYEWTKVDLSDEAQKERVNAMIED  442

Query  221  AEPFEGEALLDAKCFK  174
             EPFEGE LLDAKCFK
Sbjct  443  QEPFEGEDLLDAKCFK  458



>gb|AIW07777.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07778.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
Length=182

 Score =   266 bits (679),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 125/143 (87%), Positives = 134/143 (94%), Gaps = 0/143 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFC+YKYNDENTVS+VT+N
Sbjct  40   LPPSKMILDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCEYKYNDENTVSYVTLN  99

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KV GFLQRMDLARKYAF KML+IG + PFKVKGLWLFRG EIPKFV+DECYDMELYEW +
Sbjct  100  KVTGFLQRMDLARKYAFAKMLIIGEKGPFKVKGLWLFRGPEIPKFVIDECYDMELYEWTK  159

Query  275  VDINDPAQKERVSQMIEDAEPFE  207
            VDIND AQKERV+ MIED EPFE
Sbjct  160  VDINDEAQKERVNAMIEDQEPFE  182



>dbj|BAH56923.1| AT1G57720 [Arabidopsis thaliana]
Length=391

 Score =   245 bits (626),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 118/154 (77%), Positives = 127/154 (82%), Gaps = 22/154 (14%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPS M+LD+WKRLYSNTK+NFREVAIKGFWDMYDPEGYSLWFCDYKYNDEN VSFVT+N
Sbjct  260  LPPSPMVLDDWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENMVSFVTLN  319

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKY+FGK                      IPKF++DE YDMELYEW +
Sbjct  320  KVGGFLQRMDLARKYSFGK----------------------IPKFIMDEVYDMELYEWTK  357

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D AQKERVSQMIEDAEPFEGEALLDAKCFK
Sbjct  358  VDISDEAQKERVSQMIEDAEPFEGEALLDAKCFK  391



>ref|XP_011099002.1| PREDICTED: elongation factor 1-gamma 2-like [Sesamum indicum]
Length=391

 Score =   239 bits (611),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 118/154 (77%), Positives = 124/154 (81%), Gaps = 27/154 (18%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+N
Sbjct  265  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLN  324

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KV GFLQRMDLARKYAFGKML+IGSE P+K                           WK+
Sbjct  325  KVSGFLQRMDLARKYAFGKMLIIGSEAPYK---------------------------WKK  357

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VD+ND AQKERV+QMIEDAEPFEGEALLDAKCFK
Sbjct  358  VDVNDEAQKERVNQMIEDAEPFEGEALLDAKCFK  391



>ref|XP_002973046.1| hypothetical protein SELMODRAFT_98733, partial [Selaginella moellendorffii]
 gb|EFJ26267.1| hypothetical protein SELMODRAFT_98733, partial [Selaginella moellendorffii]
Length=418

 Score =   238 bits (606),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 108/155 (70%), Positives = 127/155 (82%), Gaps = 1/155 (1%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKT-NFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTM  459
            LPPS M+LD+WKRLYSNTK  +F EVA+KGFWDMYDPEGYSLWFCDYKYNDENTV FVTM
Sbjct  264  LPPSPMVLDDWKRLYSNTKAKDFAEVALKGFWDMYDPEGYSLWFCDYKYNDENTVPFVTM  323

Query  458  NKVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWK  279
            NKV GFLQRMD  RKYAF K+ ++G +PP+K+KG+WLFRG EIP+ V DECYD+ELYEW 
Sbjct  324  NKVSGFLQRMDFIRKYAFAKICILGDQPPYKIKGVWLFRGPEIPQQVRDECYDLELYEWT  383

Query  278  QVDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            + D  D   KER++   E+ +  EGE LL+AKCFK
Sbjct  384  KADPTDHVHKERINAYFEEPDVIEGEKLLEAKCFK  418



>ref|XP_002984514.1| hypothetical protein SELMODRAFT_156635 [Selaginella moellendorffii]
 gb|EFJ14564.1| hypothetical protein SELMODRAFT_156635 [Selaginella moellendorffii]
Length=430

 Score =   237 bits (605),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 108/155 (70%), Positives = 127/155 (82%), Gaps = 1/155 (1%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKT-NFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTM  459
            LPPS M+LD+WKRLYSNTK  +F EVA+KGFW+MYDPEGYSLWFCDYKYNDENTV FVTM
Sbjct  276  LPPSPMVLDDWKRLYSNTKAKDFAEVALKGFWEMYDPEGYSLWFCDYKYNDENTVPFVTM  335

Query  458  NKVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWK  279
            NKV GFLQRMD  RKYAF K+ ++G +PPFK+KG+WLFRG EIP+ V DECYD+ELYEW 
Sbjct  336  NKVSGFLQRMDFIRKYAFAKICILGDQPPFKIKGVWLFRGPEIPQQVRDECYDLELYEWT  395

Query  278  QVDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            + D  D   KER++   E+ +  EGE LL+AKCFK
Sbjct  396  KADPTDHVHKERINAYFEEPDVIEGEKLLEAKCFK  430



>ref|XP_001771013.1| predicted protein [Physcomitrella patens]
 gb|EDQ64168.1| predicted protein [Physcomitrella patens]
 gb|AFZ39147.1| EF1Bgamma class glutathione S-transferase [Physcomitrella patens]
Length=431

 Score =   229 bits (585),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 104/154 (68%), Positives = 124/154 (81%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPS M+LD WKRLYSNTK     +AI GFW+M+D EGYSLWFCDYKYNDEN V+FVTMN
Sbjct  278  LPPSPMVLDNWKRLYSNTKAKDFHLAISGFWEMFDAEGYSLWFCDYKYNDENQVTFVTMN  337

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDL RKYAFGKM ++G E P+K+KG+WLFRG E+P+ VLDE YD ELY+W +
Sbjct  338  KVGGFLQRMDLMRKYAFGKMCILGEEAPYKIKGVWLFRGLEMPQMVLDEVYDAELYDWTK  397

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDIN+  QK  V+   E+ +  +GE LL+AKCFK
Sbjct  398  VDINNEEQKALVNAYFEEPDTIQGEKLLEAKCFK  431



>gb|KGN56265.1| hypothetical protein Csa_3G110620 [Cucumis sativus]
Length=379

 Score =   226 bits (577),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 113/154 (73%), Positives = 118/154 (77%), Gaps = 31/154 (20%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPS MILDEWK LYSNTK+NFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+N
Sbjct  257  LPPSSMILDEWKCLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLN  316

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMD+AR                                VLDECYDMELYEWK+
Sbjct  317  KVGGFLQRMDIARN-------------------------------VLDECYDMELYEWKK  345

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI+D AQKERVSQMIED EPFEGEALLDAKCFK
Sbjct  346  VDISDEAQKERVSQMIEDQEPFEGEALLDAKCFK  379



>ref|XP_001758671.1| predicted protein [Physcomitrella patens]
 gb|EDQ76649.1| predicted protein [Physcomitrella patens]
 gb|AFZ39148.1| EF1Bgamma class glutathione S-transferase [Physcomitrella patens]
Length=428

 Score =   227 bits (578),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 101/154 (66%), Positives = 125/154 (81%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPS M+LD WKRLYSNTK     +AI GFW+M+D EGYSLWFCDYKYNDEN V+FVTMN
Sbjct  275  LPPSPMVLDNWKRLYSNTKAKDFHLAISGFWEMFDAEGYSLWFCDYKYNDENQVTFVTMN  334

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDL RKYAFGKM ++G E PFK++G+WLFRG+++P+ V+DE YD ELY+W +
Sbjct  335  KVGGFLQRMDLVRKYAFGKMCILGEEAPFKIRGVWLFRGQDMPQMVMDEVYDAELYDWTK  394

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI++  QK  V+   E+ +  +GE LL+AKCFK
Sbjct  395  VDISNEEQKTLVNAYFEEPDTIQGEKLLEAKCFK  428



>ref|XP_001774148.1| predicted protein [Physcomitrella patens]
 gb|EDQ61062.1| predicted protein [Physcomitrella patens]
 gb|AFZ39149.1| EF1Bgamma class glutathione S-transferase [Physcomitrella patens]
Length=428

 Score =   226 bits (576),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 101/154 (66%), Positives = 124/154 (81%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPP+ M+LD WKRLYSNTK     +AI GFW+M+D EG+SLWFCDYKYNDEN V+FVTMN
Sbjct  275  LPPTPMVLDNWKRLYSNTKAKDFHLAISGFWEMFDAEGWSLWFCDYKYNDENQVTFVTMN  334

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDLARKY+FGKM ++G  PP+K+KG+WLFRG ++P+ VLDE YD ELYEW +
Sbjct  335  KVGGFLQRMDLARKYSFGKMCILGENPPYKIKGVWLFRGLDVPQMVLDEVYDAELYEWTK  394

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VDI +  QK  V+   E+ +  +GE LL+AKCFK
Sbjct  395  VDITNEEQKALVNAYFEEPDTIQGEKLLEAKCFK  428



>ref|XP_004172027.1| PREDICTED: LOW QUALITY PROTEIN: elongation factor 1-gamma-like, 
partial [Cucumis sativus]
Length=363

 Score =   222 bits (566),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 103/108 (95%), Positives = 106/108 (98%), Gaps = 0/108 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPS MILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+N
Sbjct  256  LPPSSMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLN  315

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLD  312
            KVGGFLQRMD+ARKYAFGKMLVIGSE P+KVKGLWLFRGKEIPKFVLD
Sbjct  316  KVGGFLQRMDIARKYAFGKMLVIGSEAPYKVKGLWLFRGKEIPKFVLD  363



>gb|AFP90271.1| elongation factor 1-gamma 1, partial [Pinus yunnanensis]
Length=117

 Score =   214 bits (544),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 100/116 (86%), Positives = 108/116 (93%), Gaps = 0/116 (0%)
 Frame = -2

Query  548  FWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVGGFLQRMDLARKYAFGKMLVIGSEPPF  369
            FWDMYDPEGYSLWFC+YKYNDENTVS+VT+NKV GFLQRMDLARKYAFGKML+IG + PF
Sbjct  1    FWDMYDPEGYSLWFCEYKYNDENTVSYVTLNKVTGFLQRMDLARKYAFGKMLIIGEKAPF  60

Query  368  KVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDINDPAQKERVSQMIEDAEPFEGE  201
            KVKGLWLFRG EIPKFV+DECYDMELYEW +VDIND AQKERV+ MIED EPFEGE
Sbjct  61   KVKGLWLFRGPEIPKFVMDECYDMELYEWTKVDINDEAQKERVNAMIEDQEPFEGE  116



>gb|AFP90278.1| elongation factor 1-gamma 1, partial [Pinus yunnanensis]
Length=117

 Score =   213 bits (543),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 100/116 (86%), Positives = 108/116 (93%), Gaps = 0/116 (0%)
 Frame = -2

Query  548  FWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVGGFLQRMDLARKYAFGKMLVIGSEPPF  369
            FWDMYDPEGYSLWFC+YKYNDENTVS+VT+NKV GFLQRMDLARKYAFGKML+IG + PF
Sbjct  1    FWDMYDPEGYSLWFCEYKYNDENTVSYVTLNKVTGFLQRMDLARKYAFGKMLIIGEKSPF  60

Query  368  KVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDINDPAQKERVSQMIEDAEPFEGE  201
            KVKGLWLFRG EIPKFV+DECYDMELYEW +VDIND AQKERV+ MIED EPFEGE
Sbjct  61   KVKGLWLFRGPEIPKFVMDECYDMELYEWTKVDINDEAQKERVNAMIEDQEPFEGE  116



>gb|AFP90281.1| elongation factor 1-gamma 1, partial [Pinus yunnanensis]
Length=117

 Score =   213 bits (541),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 100/116 (86%), Positives = 108/116 (93%), Gaps = 0/116 (0%)
 Frame = -2

Query  548  FWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVGGFLQRMDLARKYAFGKMLVIGSEPPF  369
            FWDMYDPEGYSLWFC+YKYNDENTVS+VT+NKV GFLQRMDLARKYAFGKML+IG + PF
Sbjct  1    FWDMYDPEGYSLWFCEYKYNDENTVSYVTLNKVTGFLQRMDLARKYAFGKMLIIGEKGPF  60

Query  368  KVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDINDPAQKERVSQMIEDAEPFEGE  201
            KVKGLWLFRG EIPKFV+DECYDMELYEW +VDIND AQKERV+ MIED EPFEGE
Sbjct  61   KVKGLWLFRGPEIPKFVMDECYDMELYEWTKVDINDQAQKERVNAMIEDQEPFEGE  116



>gb|AFP90241.1| elongation factor 1-gamma 1, partial [Pinus tabuliformis]
 gb|AFP90242.1| elongation factor 1-gamma 1, partial [Pinus tabuliformis]
 gb|AFP90243.1| elongation factor 1-gamma 1, partial [Pinus tabuliformis]
 gb|AFP90245.1| elongation factor 1-gamma 1, partial [Pinus densata]
 gb|AFP90248.1| elongation factor 1-gamma 1, partial [Pinus tabuliformis]
 gb|AFP90249.1| elongation factor 1-gamma 1, partial [Pinus tabuliformis]
 gb|AFP90250.1| elongation factor 1-gamma 1, partial [Pinus tabuliformis]
 gb|AFP90251.1| elongation factor 1-gamma 1, partial [Pinus densata]
 gb|AFP90252.1| elongation factor 1-gamma 1, partial [Pinus tabuliformis]
 gb|AFP90256.1| elongation factor 1-gamma 1, partial [Pinus tabuliformis]
 gb|AFP90257.1| elongation factor 1-gamma 1, partial [Pinus tabuliformis]
 gb|AFP90259.1| elongation factor 1-gamma 1, partial [Pinus tabuliformis]
 gb|AFP90260.1| elongation factor 1-gamma 1, partial [Pinus tabuliformis]
 gb|AFP90261.1| elongation factor 1-gamma 1, partial [Pinus yunnanensis]
 gb|AFP90262.1| elongation factor 1-gamma 1, partial [Pinus densata]
 gb|AFP90263.1| elongation factor 1-gamma 1, partial [Pinus tabuliformis]
 gb|AFP90266.1| elongation factor 1-gamma 1, partial [Pinus tabuliformis]
 gb|AFP90267.1| elongation factor 1-gamma 1, partial [Pinus densata]
 gb|AFP90269.1| elongation factor 1-gamma 1, partial [Pinus densata]
 gb|AFP90270.1| elongation factor 1-gamma 1, partial [Pinus densata]
 gb|AFP90272.1| elongation factor 1-gamma 1, partial [Pinus densata]
 gb|AFP90273.1| elongation factor 1-gamma 1, partial [Pinus densata]
 gb|AFP90274.1| elongation factor 1-gamma 1, partial [Pinus densata]
 gb|AFP90279.1| elongation factor 1-gamma 1, partial [Pinus densata]
 gb|AFP90280.1| elongation factor 1-gamma 1, partial [Pinus yunnanensis]
 gb|AFP90283.1| elongation factor 1-gamma 1, partial [Pinus densata]
 gb|AFP90284.1| elongation factor 1-gamma 1, partial [Pinus densata]
 gb|AFP90285.1| elongation factor 1-gamma 1, partial [Pinus densata]
 gb|AFP90286.1| elongation factor 1-gamma 1, partial [Pinus densata]
 gb|AFP90287.1| elongation factor 1-gamma 1, partial [Pinus armandii]
Length=117

 Score =   213 bits (541),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 100/116 (86%), Positives = 108/116 (93%), Gaps = 0/116 (0%)
 Frame = -2

Query  548  FWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVGGFLQRMDLARKYAFGKMLVIGSEPPF  369
            FWDMYDPEGYSLWFC+YKYNDENTVS+VT+NKV GFLQRMDLARKYAFGKML+IG + PF
Sbjct  1    FWDMYDPEGYSLWFCEYKYNDENTVSYVTLNKVTGFLQRMDLARKYAFGKMLIIGEKGPF  60

Query  368  KVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDINDPAQKERVSQMIEDAEPFEGE  201
            KVKGLWLFRG EIPKFV+DECYDMELYEW +VDIND AQKERV+ MIED EPFEGE
Sbjct  61   KVKGLWLFRGPEIPKFVMDECYDMELYEWTKVDINDEAQKERVNAMIEDQEPFEGE  116



>gb|AFP90255.1| elongation factor 1-gamma 1, partial [Pinus tabuliformis]
Length=117

 Score =   212 bits (539),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 108/116 (93%), Gaps = 0/116 (0%)
 Frame = -2

Query  548  FWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVGGFLQRMDLARKYAFGKMLVIGSEPPF  369
            FWDMYDPEGYSLWFC+YKYNDENTVS+VT+NKV GFLQRMDLARKYAFGKML+IG + PF
Sbjct  1    FWDMYDPEGYSLWFCEYKYNDENTVSYVTLNKVTGFLQRMDLARKYAFGKMLIIGEKGPF  60

Query  368  KVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDINDPAQKERVSQMIEDAEPFEGE  201
            KVKGLWLFRG EIPKFV+DECYDME+YEW +VDIND AQKERV+ MIED EPFEGE
Sbjct  61   KVKGLWLFRGPEIPKFVMDECYDMEMYEWTKVDINDEAQKERVNAMIEDQEPFEGE  116



>gb|AFP90268.1| elongation factor 1-gamma 1, partial [Pinus densata]
Length=117

 Score =   211 bits (538),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 100/116 (86%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = -2

Query  548  FWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVGGFLQRMDLARKYAFGKMLVIGSEPPF  369
            FWDMYDPEGYSLWFC+YKYNDENTVS+VT+NKV GFLQRMDLARKYAFGKML+IG + PF
Sbjct  1    FWDMYDPEGYSLWFCEYKYNDENTVSYVTLNKVTGFLQRMDLARKYAFGKMLIIGEKGPF  60

Query  368  KVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDINDPAQKERVSQMIEDAEPFEGE  201
            KVKGLWLFRG EIPKFV+DECYDMELYEW +VDIND AQKERV  MIED EPFEGE
Sbjct  61   KVKGLWLFRGPEIPKFVMDECYDMELYEWTKVDINDEAQKERVYAMIEDQEPFEGE  116



>gb|AFP90265.1| elongation factor 1-gamma 1, partial [Pinus densata]
Length=117

 Score =   211 bits (537),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 108/116 (93%), Gaps = 0/116 (0%)
 Frame = -2

Query  548  FWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVGGFLQRMDLARKYAFGKMLVIGSEPPF  369
            FWDMYDPEGYSLWFC+YKYNDENTVS+VT+NKV GFLQRMDLARKYAFGKML++G + PF
Sbjct  1    FWDMYDPEGYSLWFCEYKYNDENTVSYVTLNKVTGFLQRMDLARKYAFGKMLIMGEKGPF  60

Query  368  KVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDINDPAQKERVSQMIEDAEPFEGE  201
            KVKGLWLFRG EIPKFV+DECYDMELYEW +VDIND AQKERV+ MIED EPFEGE
Sbjct  61   KVKGLWLFRGPEIPKFVMDECYDMELYEWTKVDINDEAQKERVNAMIEDQEPFEGE  116



>gb|AFP90276.1| elongation factor 1-gamma 1, partial [Pinus densata]
 gb|AFP90277.1| elongation factor 1-gamma 1, partial [Pinus yunnanensis]
Length=117

 Score =   211 bits (537),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = -2

Query  548  FWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVGGFLQRMDLARKYAFGKMLVIGSEPPF  369
            FWDMYDPEGYSLWFC+YKYNDENTVS+VT+NKV GFLQRMDLARKYAFGKML+IG + PF
Sbjct  1    FWDMYDPEGYSLWFCEYKYNDENTVSYVTLNKVTGFLQRMDLARKYAFGKMLIIGEKGPF  60

Query  368  KVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDINDPAQKERVSQMIEDAEPFEGE  201
            KVKGLWLFRG EIPKFV+DECYDMELYEW +VDIND A KERV+ MIED EPFEGE
Sbjct  61   KVKGLWLFRGPEIPKFVMDECYDMELYEWTKVDINDEAHKERVNAMIEDQEPFEGE  116



>gb|AFP90258.1| elongation factor 1-gamma 1, partial [Pinus densata]
Length=117

 Score =   211 bits (536),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = -2

Query  548  FWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVGGFLQRMDLARKYAFGKMLVIGSEPPF  369
            FWDMYDPEGYSLW C+YKYNDENTVS+VT+NKV GFLQRMDLARKYAFGKML+IG + PF
Sbjct  1    FWDMYDPEGYSLWICEYKYNDENTVSYVTLNKVTGFLQRMDLARKYAFGKMLIIGEKGPF  60

Query  368  KVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDINDPAQKERVSQMIEDAEPFEGE  201
            KVKGLWLFRG EIPKFV+DECYDMELYEW +VDIND AQKERV+ MIED EPFEGE
Sbjct  61   KVKGLWLFRGPEIPKFVMDECYDMELYEWTKVDINDEAQKERVNAMIEDQEPFEGE  116



>gb|AFP90247.1| elongation factor 1-gamma 1, partial [Pinus tabuliformis]
Length=117

 Score =   210 bits (534),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = -2

Query  548  FWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVGGFLQRMDLARKYAFGKMLVIGSEPPF  369
            FWDMYDPEGYSLWFC+YKYNDENTVS+VT+NKV GFLQRMDLARKYAFGKML+IG + PF
Sbjct  1    FWDMYDPEGYSLWFCEYKYNDENTVSYVTLNKVTGFLQRMDLARKYAFGKMLIIGEKGPF  60

Query  368  KVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDINDPAQKERVSQMIEDAEPFEGE  201
            KVKGLWLFRG EIPKFV+DECYD ELYEW +VDIND AQKERV+ MIED EPFEGE
Sbjct  61   KVKGLWLFRGPEIPKFVMDECYDKELYEWTKVDINDEAQKERVNAMIEDQEPFEGE  116



>gb|AFP90264.1| elongation factor 1-gamma 1, partial [Pinus densata]
Length=117

 Score =   210 bits (534),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = -2

Query  548  FWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVGGFLQRMDLARKYAFGKMLVIGSEPPF  369
            FWDMYDPEGYSLWFC+YKYNDENTVS+VT+NKV GFLQRMDLARKYAFGKML+IG + PF
Sbjct  1    FWDMYDPEGYSLWFCEYKYNDENTVSYVTLNKVTGFLQRMDLARKYAFGKMLIIGEKGPF  60

Query  368  KVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDINDPAQKERVSQMIEDAEPFEGE  201
            KVKGLWLFRG EIPKFV+DECYDMELY W +VDIND AQKERV+ MIED EPFEGE
Sbjct  61   KVKGLWLFRGPEIPKFVMDECYDMELYGWTKVDINDEAQKERVNAMIEDQEPFEGE  116



>gb|AFP90253.1| elongation factor 1-gamma 1, partial [Pinus tabuliformis]
Length=117

 Score =   209 bits (533),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = -2

Query  548  FWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVGGFLQRMDLARKYAFGKMLVIGSEPPF  369
            FWDMYDPEGYSLWFC+YKYNDENTVS+VT+NKV GFLQRMDLARKYAFGKML+IG + PF
Sbjct  1    FWDMYDPEGYSLWFCEYKYNDENTVSYVTLNKVTGFLQRMDLARKYAFGKMLIIGEKGPF  60

Query  368  KVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDINDPAQKERVSQMIEDAEPFEGE  201
            KVKGLWLF G EIPKFV+DECYDMELYEW +VDIND AQKERV+ MIED EPFEGE
Sbjct  61   KVKGLWLFLGPEIPKFVMDECYDMELYEWTKVDINDEAQKERVNAMIEDQEPFEGE  116



>gb|AFP90275.1| elongation factor 1-gamma 1, partial [Pinus densata]
Length=117

 Score =   209 bits (533),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = -2

Query  548  FWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVGGFLQRMDLARKYAFGKMLVIGSEPPF  369
            FWDMYDPEGYSLWFC+YKYNDENTVS+VT+NKV GFLQRMDLARKYAFGKML+IG + PF
Sbjct  1    FWDMYDPEGYSLWFCEYKYNDENTVSYVTLNKVTGFLQRMDLARKYAFGKMLIIGEKGPF  60

Query  368  KVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDINDPAQKERVSQMIEDAEPFEGE  201
            KVKGLWLFRG EIPKFV+DEC DMELYEW +VDIND AQKERV+ MIED EPFEGE
Sbjct  61   KVKGLWLFRGPEIPKFVMDECNDMELYEWTKVDINDEAQKERVNAMIEDQEPFEGE  116



>gb|AFP90246.1| elongation factor 1-gamma 1, partial [Pinus densata]
Length=117

 Score =   209 bits (533),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = -2

Query  548  FWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVGGFLQRMDLARKYAFGKMLVIGSEPPF  369
            FWDMYDPEGYSLWFC+YKYNDENTVS+VT+NKV GFLQRMDLARKYAFGKML+IG +  F
Sbjct  1    FWDMYDPEGYSLWFCEYKYNDENTVSYVTLNKVTGFLQRMDLARKYAFGKMLIIGEKGLF  60

Query  368  KVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDINDPAQKERVSQMIEDAEPFEGE  201
            KVKGLWLFRG EIPKFV+DECYDMELYEW +VDIND AQKERV+ MIED EPFEGE
Sbjct  61   KVKGLWLFRGPEIPKFVMDECYDMELYEWTKVDINDEAQKERVNAMIEDQEPFEGE  116



>gb|AFP90254.1| elongation factor 1-gamma 1, partial [Pinus tabuliformis]
Length=117

 Score =   209 bits (532),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = -2

Query  548  FWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVGGFLQRMDLARKYAFGKMLVIGSEPPF  369
            FWDMYDPEGYSLWFC+YKYNDENTVS+VT+NKV GFLQRMDLARKYAFGKML+IG + PF
Sbjct  1    FWDMYDPEGYSLWFCEYKYNDENTVSYVTLNKVTGFLQRMDLARKYAFGKMLIIGEKGPF  60

Query  368  KVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDINDPAQKERVSQMIEDAEPFEGE  201
            KVKGLWLFRG EIPKFV+DECYDMELYEW +VDIND AQKE V+ MIED EPFEGE
Sbjct  61   KVKGLWLFRGPEIPKFVMDECYDMELYEWTKVDINDEAQKECVNAMIEDQEPFEGE  116



>gb|AFP90282.1| elongation factor 1-gamma 1, partial [Pinus densata]
Length=117

 Score =   209 bits (532),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = -2

Query  548  FWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVGGFLQRMDLARKYAFGKMLVIGSEPPF  369
            FWDMYDPEGYSLWFC+YKYNDENTVS+VT+NKV GFLQRMDLARKYAFGKML+IG + PF
Sbjct  1    FWDMYDPEGYSLWFCEYKYNDENTVSYVTLNKVTGFLQRMDLARKYAFGKMLIIGEKGPF  60

Query  368  KVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDINDPAQKERVSQMIEDAEPFEGE  201
            KVKGLWLFRG EIPKFV+DECYDMELYEW  VDIND AQKERV+ MIED E FEGE
Sbjct  61   KVKGLWLFRGPEIPKFVMDECYDMELYEWTNVDINDEAQKERVNAMIEDQELFEGE  116



>gb|AFP90244.1| elongation factor 1-gamma 1, partial [Pinus densata]
Length=117

 Score =   208 bits (529),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = -2

Query  548  FWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVGGFLQRMDLARKYAFGKMLVIGSEPPF  369
            FWDMYDPEGYSLWFC+YKYNDENTVS+VT+NKV GFLQRMDLARKYAFGKML+IG + PF
Sbjct  1    FWDMYDPEGYSLWFCEYKYNDENTVSYVTLNKVTGFLQRMDLARKYAFGKMLIIGEKGPF  60

Query  368  KVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDINDPAQKERVSQMIEDAEPFEGE  201
            KVKGLW FRG EIPKFV+DECYD+ELYEW +VDIND AQKERV+ MIED EPFEGE
Sbjct  61   KVKGLWPFRGPEIPKFVMDECYDVELYEWTKVDINDEAQKERVNAMIEDQEPFEGE  116



>ref|XP_004134257.1| PREDICTED: elongation factor 1-gamma-like [Cucumis sativus]
Length=364

 Score =   210 bits (534),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 97/105 (92%), Positives = 102/105 (97%), Gaps = 0/105 (0%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPS MILDEWK LYSNTK+NFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+N
Sbjct  257  LPPSSMILDEWKCLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLN  316

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKF  321
            KVGGFLQRMD+ARKYAFGKMLVIGSE P+KVKGLWLFRGKEIP+F
Sbjct  317  KVGGFLQRMDIARKYAFGKMLVIGSEAPYKVKGLWLFRGKEIPQF  361



>dbj|BAD94101.1| hypothetical protein [Arabidopsis thaliana]
Length=102

 Score =   182 bits (461),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 87/101 (86%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = -2

Query  476  VSFVTMNKVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDM  297
            VSFVT+NKVGGFLQRMDLARKY+FGKML+ GSE PFKVKGLWLFRG EIPKF++DE YDM
Sbjct  2    VSFVTLNKVGGFLQRMDLARKYSFGKMLICGSEGPFKVKGLWLFRGPEIPKFIMDEVYDM  61

Query  296  ELYEWKQVDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            ELYEW +VDI+D AQKERVSQ+IEDAEPFEGEALLDAKCFK
Sbjct  62   ELYEWTKVDISDEAQKERVSQVIEDAEPFEGEALLDAKCFK  102



>ref|NP_001167773.1| hypothetical protein [Zea mays]
 gb|ACN26025.1| unknown [Zea mays]
Length=96

 Score =   173 bits (438),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/96 (86%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = -2

Query  461  MNKVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEW  282
            MNKVGGFLQRMDL RKYAFGKMLV+GSEPPFKVKGLWLFRG EIPKFV+DE YDMELYEW
Sbjct  1    MNKVGGFLQRMDLCRKYAFGKMLVVGSEPPFKVKGLWLFRGPEIPKFVMDEVYDMELYEW  60

Query  281  KQVDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
             +VD++D AQKERV+ MIED EPFEGEALLDAKCFK
Sbjct  61   TKVDLSDEAQKERVNAMIEDQEPFEGEALLDAKCFK  96



>ref|XP_007041191.1| Elongation factor 1-gamma 3, putative [Theobroma cacao]
 gb|EOX97022.1| Elongation factor 1-gamma 3, putative [Theobroma cacao]
Length=231

 Score =   170 bits (431),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 89/133 (67%), Positives = 95/133 (71%), Gaps = 34/133 (26%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSKMILDEWKR YSNT+TNFREVAIKG                               
Sbjct  133  LPPSKMILDEWKRPYSNTETNFREVAIKG-------------------------------  161

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
               GFLQRMDLARKYAFGKMLVIGSEPPFKVKGL LFRG+EIP+FVLDECYD+ELYEWK+
Sbjct  162  ---GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLLLFRGQEIPQFVLDECYDVELYEWKK  218

Query  275  VDINDPAQKERVS  237
            VDI+  AQKERVS
Sbjct  219  VDISAEAQKERVS  231



>gb|ABR25394.1| elongation factor 1-gamma 3 [Oryza sativa Indica Group]
Length=94

 Score =   165 bits (417),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 79/94 (84%), Positives = 86/94 (91%), Gaps = 0/94 (0%)
 Frame = -2

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
            KVGGFLQRMDL RKYAFGKMLVIGS PPFKVKGLWLFRG++IPKFV+DE YDMELYEW +
Sbjct  1    KVGGFLQRMDLCRKYAFGKMLVIGSTPPFKVKGLWLFRGQDIPKFVMDEVYDMELYEWTK  60

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VD++D AQKERV+ MIED EPFEGE LLDAKCFK
Sbjct  61   VDLSDEAQKERVNAMIEDQEPFEGEDLLDAKCFK  94



>ref|XP_005645852.1| glutathione S-transferase [Coccomyxa subellipsoidea C-169]
 gb|EIE21308.1| glutathione S-transferase [Coccomyxa subellipsoidea C-169]
Length=441

 Score =   169 bits (427),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 80/173 (46%), Positives = 117/173 (68%), Gaps = 19/173 (11%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTK-TNFREVAIKGFWDM-----------YDPEGYSLWFCDYKY  492
            LPPSKMI+D WKRLYSNT    F+E+ + G W+            +DPEGYS+WFC+YKY
Sbjct  269  LPPSKMIMDSWKRLYSNTPGAKFKEICVNGLWNGADIPNSPNNEGFDPEGYSIWFCEYKY  328

Query  491  NDENTVSFVTMNK------VGGFLQRMDLARKYAFGKMLVIGSEP-PFKVKGLWLFRGKE  333
             +ENTV+F+ MNK      VGGFLQR+D  RK+AF  M ++  +   F ++G+W+FRG+E
Sbjct  329  PEENTVNFIVMNKACTSPPVGGFLQRIDYVRKHAFAVMSILKDDKGQFPIRGMWIFRGQE  388

Query  332  IPKFVLDECYDMELYEWKQVDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            IP  +++EC+D+ LYEW +VD +D A +ER+S ++ + +  +G   ++ K FK
Sbjct  389  IPAIMVEECFDLPLYEWNKVDTSDAAVRERISSLLCEEDKIDGLENVEVKVFK  441



>ref|XP_004341586.1| elongation factor 1-gamma family protein [Acanthamoeba castellanii 
str. Neff]
 gb|ELR19500.1| elongation factor 1-gamma family protein [Acanthamoeba castellanii 
str. Neff]
Length=408

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 92/132 (70%), Gaps = 3/132 (2%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPP+K+ LDEWKR YSN   +  +VA+  FW+ +D EG+SLW  DYKYNDE T  F+T N
Sbjct  257  LPPTKLDLDEWKRTYSNN--DILKVAMPWFWEHFDAEGWSLWLSDYKYNDELTKMFMTSN  314

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
             VGGFLQRMD  RKY FG +L+ G EP  ++ GLWLFRG E+P+  L E  D E + W +
Sbjct  315  LVGGFLQRMDKLRKYGFGSLLIFGEEPKLQIGGLWLFRGTELPE-ELWENPDAEHHTWTK  373

Query  275  VDINDPAQKERV  240
            VD  DPAQ++ V
Sbjct  374  VDHADPAQRKLV  385



>gb|EXX52334.1| Tef4p [Rhizophagus irregularis DAOM 197198w]
Length=292

 Score =   136 bits (342),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 69/154 (45%), Positives = 95/154 (62%), Gaps = 3/154 (2%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPS + L+EWKR+YSN  T  R  AI  FW+ +DPEGYS+W  DYKYNDE T  F++ N
Sbjct  142  LPPSSLNLEEWKRVYSNNDT--RPTAINWFWENFDPEGYSIWRVDYKYNDELTKVFMSSN  199

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
             +GGF  R++ ARKYAFG ++V+G +    + G ++ RG+E+P+ V D   D E Y + +
Sbjct  200  LIGGFFNRLERARKYAFGSLVVLGEDNANSIAGYFVIRGQEVPEEVYDAA-DFESYTFNK  258

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VD  DP+ K      I      +G+   D K FK
Sbjct  259  VDHTDPSVKSSFEDYIAWDGHLDGKKYADGKIFK  292



>emb|CBK20805.2| unnamed protein product [Blastocystis hominis]
Length=248

 Score =   134 bits (337),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 71/156 (46%), Positives = 98/156 (63%), Gaps = 4/156 (3%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPS   LD WKR+YSNT ++F  V  K FW MYD EG+S W CDY YN+ENT  F+T N
Sbjct  95   LPPSPFDLDNWKRIYSNTHSDFYSVMDK-FWPMYDQEGWSCWICDYMYNEENTRGFMTAN  153

Query  455  KVGGFLQRMDLARKYAFGKMLVI--GSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEW  282
             V GF+QR D  RKYAFG M ++   +EP ++V G WL RG  I + +LDE  D   Y W
Sbjct  154  LVSGFIQRSDSLRKYAFGNMNILKDANEPFYRVMGGWLIRGTAI-QPMLDENPDAAYYNW  212

Query  281  KQVDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            ++VD+ +   K+ ++ +   +E  +G+ +   + FK
Sbjct  213  RKVDVTNEDDKKLLADLWCASETIQGKEINSNEVFK  248



>gb|ETL96568.1| hypothetical protein L917_05966, partial [Phytophthora parasitica]
Length=149

 Score =   131 bits (329),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/153 (48%), Positives = 95/153 (62%), Gaps = 5/153 (3%)
 Frame = -2

Query  629  PSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKV  450
            PS + LD WK  YSNTK N  + A+  FW+  D EGYSLWFCDY YN ENT  F+T N V
Sbjct  1    PSSLNLDAWKVQYSNTK-NLAD-AMTWFWEHLDTEGYSLWFCDYNYNSENTKMFMTCNAV  58

Query  449  GGFLQRMDLARKYAFGKMLVIGSE-PPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQV  273
            GGFLQR +  RKYAFG M V G+E     + G WLFRG +  K +++   D E Y WK+ 
Sbjct  59   GGFLQRSEAMRKYAFGVMDVCGAEGSEIIITGCWLFRG-DSEKHMIEANPDAEYYTWKKA  117

Query  272  DINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            ++ND   K RV+    + +  EG+ + D+K FK
Sbjct  118  ELNDET-KARVAAYWCNEDELEGKPIADSKVFK  149



>gb|ESA05922.1| hypothetical protein GLOINDRAFT_349960 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX52332.1| Tef4p [Rhizophagus irregularis DAOM 197198w]
Length=413

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 69/154 (45%), Positives = 95/154 (62%), Gaps = 3/154 (2%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPS + L+EWKR+YSN  T  R  AI  FW+ +DPEGYS+W  DYKYNDE T  F++ N
Sbjct  263  LPPSSLNLEEWKRVYSNNDT--RPTAINWFWENFDPEGYSIWRVDYKYNDELTKVFMSSN  320

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
             +GGF  R++ ARKYAFG ++V+G +    + G ++ RG+E+P+ V D   D E Y + +
Sbjct  321  LIGGFFNRLERARKYAFGSLVVLGEDNANSIAGYFVIRGQEVPEEVYDAA-DFESYTFNK  379

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VD  DP+ K      I      +G+   D K FK
Sbjct  380  VDHTDPSVKSSFEDYIAWDGHLDGKKYADGKIFK  413



>emb|CCI44608.1| unnamed protein product [Albugo candida]
Length=407

 Score =   136 bits (343),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 72/153 (47%), Positives = 93/153 (61%), Gaps = 4/153 (3%)
 Frame = -2

Query  629  PSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKV  450
            PSKM+LDEWK  YSNTK      ++K FWD +D EGYS+W CDY YNDEN V F+T N +
Sbjct  258  PSKMVLDEWKVQYSNTKPVID--SMKWFWDNFDSEGYSIWMCDYNYNDENKVLFMTSNAI  315

Query  449  GGFLQRMDLARKYAFGKMLVIGSE-PPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQV  273
             GF+QR +  RK+AFG M + G E     + G WLFRG  I   +++   D E Y WK+V
Sbjct  316  NGFIQRSEGVRKFAFGVMHICGKEGSKLNITGCWLFRGDTI-DHMMEANPDAEYYTWKRV  374

Query  272  DINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
               D A K R++    +    EGE L D++ FK
Sbjct  375  ATFDDASKARIAAYWCNDNELEGEPLADSRVFK  407



>gb|ETM49712.1| hypothetical protein L914_06089, partial [Phytophthora parasitica]
Length=191

 Score =   130 bits (327),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 74/153 (48%), Positives = 95/153 (62%), Gaps = 5/153 (3%)
 Frame = -2

Query  629  PSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKV  450
            PS + LD WK  YSNTK N  + A+  FW+  D EGYSLWFCDY YN ENT  F+T N V
Sbjct  43   PSSLNLDAWKVQYSNTK-NLAD-AMTWFWEHLDTEGYSLWFCDYNYNSENTKMFMTCNAV  100

Query  449  GGFLQRMDLARKYAFGKMLVIGSE-PPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQV  273
            GGFLQR +  RKYAFG M V G+E     + G WLFRG +  K +++   D E Y WK+ 
Sbjct  101  GGFLQRSEAMRKYAFGVMDVCGAEGSEIIITGCWLFRG-DSEKHMIEANPDAEYYTWKKA  159

Query  272  DINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            ++ND   K RV+    + +  EG+ + D+K FK
Sbjct  160  ELNDET-KARVAAYWCNEDELEGKPIADSKVFK  191



>emb|CBK21757.2| unnamed protein product [Blastocystis hominis]
Length=392

 Score =   134 bits (338),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 71/156 (46%), Positives = 98/156 (63%), Gaps = 4/156 (3%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPS   LD WKR+YSNT ++F  V  K FW MYD EG+S W CDY YN+ENT  F+T N
Sbjct  239  LPPSPFDLDNWKRIYSNTHSDFYSVMDK-FWPMYDQEGWSCWICDYMYNEENTRGFMTAN  297

Query  455  KVGGFLQRMDLARKYAFGKMLVI--GSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEW  282
             V GF+QR D  RKYAFG M ++   +EP ++V G WL RG  I + +LDE  D   Y W
Sbjct  298  LVSGFIQRSDSLRKYAFGNMNILKDANEPFYRVMGGWLIRGTAI-QPMLDENPDAAYYNW  356

Query  281  KQVDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            ++VD+ +   K+ ++ +   +E  +G+ +   + FK
Sbjct  357  RKVDVTNEDDKKLLADLWCASETIQGKEINSNEVFK  392



>gb|ETK89973.1| hypothetical protein L915_06156, partial [Phytophthora parasitica]
 gb|ETL43374.1| hypothetical protein L916_06091, partial [Phytophthora parasitica]
Length=235

 Score =   130 bits (327),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 74/153 (48%), Positives = 95/153 (62%), Gaps = 5/153 (3%)
 Frame = -2

Query  629  PSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKV  450
            PS + LD WK  YSNTK N  + A+  FW+  D EGYSLWFCDY YN ENT  F+T N V
Sbjct  87   PSSLNLDAWKVQYSNTK-NLAD-AMTWFWEHLDTEGYSLWFCDYNYNSENTKMFMTCNAV  144

Query  449  GGFLQRMDLARKYAFGKMLVIGSE-PPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQV  273
            GGFLQR +  RKYAFG M V G+E     + G WLFRG +  K +++   D E Y WK+ 
Sbjct  145  GGFLQRSEAMRKYAFGVMDVCGAEGSEIIITGCWLFRG-DSEKHMIEANPDAEYYTWKKA  203

Query  272  DINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            ++ND   K RV+    + +  EG+ + D+K FK
Sbjct  204  ELNDET-KARVAAYWCNEDELEGKPIADSKVFK  235



>emb|CCA15330.1| calciumdependent protein 1 putative [Albugo laibachii Nc14]
Length=422

 Score =   133 bits (335),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 70/153 (46%), Positives = 93/153 (61%), Gaps = 4/153 (3%)
 Frame = -2

Query  629  PSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKV  450
            PSKM+LDEWK  YSNTK      ++K FWD +D EGYS+W CDY YN+EN V F+T N V
Sbjct  273  PSKMVLDEWKVQYSNTKP--VSDSMKWFWDNFDSEGYSIWMCDYNYNEENKVLFMTSNAV  330

Query  449  GGFLQRMDLARKYAFGKMLVIGSE-PPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQV  273
             GF+QR +  RK+AFG M + G E     + G WLFRG  + + +++   D E Y WK+V
Sbjct  331  NGFIQRSEGVRKFAFGVMHICGEEGSKLDITGCWLFRGDTV-EHIMEANPDAEYYTWKRV  389

Query  272  DINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
               D A K R++    +    EG  L D++ FK
Sbjct  390  TTFDDASKARIAAYWCNDAELEGRPLADSRVFK  422



>ref|XP_008867564.1| hypothetical protein H310_04829 [Aphanomyces invadans]
 gb|ETW03335.1| hypothetical protein H310_04829 [Aphanomyces invadans]
Length=418

 Score =   131 bits (329),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 67/153 (44%), Positives = 94/153 (61%), Gaps = 4/153 (3%)
 Frame = -2

Query  629  PSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKV  450
            PSK+  D+WK  YSNTK   +  A++  WD YDPEGYS WFC Y YN ENT  F+T N V
Sbjct  269  PSKLKFDDWKVTYSNTKPLSK--AMQWLWDNYDPEGYSFWFCTYNYNQENTKLFMTCNAV  326

Query  449  GGFLQRMDLARKYAFGKMLVIGSEPPF-KVKGLWLFRGKEIPKFVLDECYDMELYEWKQV  273
             GFLQR +  RK++FG   V+G+E    ++ G W+FRG+ + + +L+   D E Y W +V
Sbjct  327  SGFLQRSEAMRKFSFGVQSVLGAEGGLIEIVGCWMFRGQSV-EHMLEANPDAEYYTWTKV  385

Query  272  DINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            ++ D A K R+ +     E  +G+ + D K FK
Sbjct  386  EVLDDAAKARIEEYFCSEETIDGKVIADGKVFK  418



>ref|XP_006680023.1| hypothetical protein BATDEDRAFT_37118 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF79252.1| hypothetical protein BATDEDRAFT_37118 [Batrachochytrium dendrobatidis 
JAM81]
Length=411

 Score =   130 bits (328),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 65/154 (42%), Positives = 97/154 (63%), Gaps = 3/154 (2%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LP S M+LDEWKR+YSN  T  R  A+  FW  +DP+GYS++  DYKYN E  + F++ N
Sbjct  261  LPKSSMVLDEWKRVYSNNDT--RPTAVDWFWANFDPQGYSIYKVDYKYNSELAMVFMSSN  318

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
             VGGF QR++ +RKYAFG ++++G +   ++ G ++FRG+ IP F + +C D E Y++ +
Sbjct  319  LVGGFFQRLESSRKYAFGSLVILGEDGNNQITGYFVFRGQGIP-FEVSDCPDFESYDFVK  377

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            VD  D A +     ++   E   G+   D K FK
Sbjct  378  VDHTDSAVRAEFEAVLAWDETINGKKCADGKIFK  411



>gb|ETK89994.1| hypothetical protein L915_06152 [Phytophthora parasitica]
 gb|ETL43394.1| hypothetical protein L916_06088 [Phytophthora parasitica]
Length=404

 Score =   130 bits (327),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 74/153 (48%), Positives = 95/153 (62%), Gaps = 5/153 (3%)
 Frame = -2

Query  629  PSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKV  450
            PS + LD WK  YSNTK N  + A+  FW+  D EGYSLWFCDY YN ENT  F+T N V
Sbjct  256  PSSLNLDAWKVQYSNTK-NLAD-AMTWFWEHLDTEGYSLWFCDYNYNSENTKMFMTCNAV  313

Query  449  GGFLQRMDLARKYAFGKMLVIGSE-PPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQV  273
            GGFLQR +  RKYAFG M V G+E     + G WLFRG +  K +++   D E Y WK+ 
Sbjct  314  GGFLQRSEAMRKYAFGVMDVCGAEGSEIIITGCWLFRG-DSEKHMIEANPDAEYYTWKKA  372

Query  272  DINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            ++ND   K RV+    + +  EG+ + D+K FK
Sbjct  373  ELNDET-KARVAAYWCNEDELEGKPIADSKVFK  404



>gb|ETP19871.1| hypothetical protein F441_06281 [Phytophthora parasitica CJ01A1]
Length=407

 Score =   130 bits (327),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 74/153 (48%), Positives = 95/153 (62%), Gaps = 5/153 (3%)
 Frame = -2

Query  629  PSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKV  450
            PS + LD WK  YSNTK N  + A+  FW+  D EGYSLWFCDY YN ENT  F+T N V
Sbjct  259  PSSLNLDAWKVQYSNTK-NLAD-AMTWFWEHLDTEGYSLWFCDYNYNSENTKMFMTCNAV  316

Query  449  GGFLQRMDLARKYAFGKMLVIGSE-PPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQV  273
            GGFLQR +  RKYAFG M V G+E     + G WLFRG +  K +++   D E Y WK+ 
Sbjct  317  GGFLQRSEAMRKYAFGVMDVCGAEGSEIIITGCWLFRG-DSEKHMIEANPDAEYYTWKKA  375

Query  272  DINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            ++ND   K RV+    + +  EG+ + D+K FK
Sbjct  376  ELNDET-KARVAAYWCNEDELEGKPIADSKVFK  407



>ref|XP_008891718.1| hypothetical protein PPTG_02398 [Phytophthora parasitica INRA-310]
 gb|ETL43385.1| hypothetical protein L916_06090 [Phytophthora parasitica]
 gb|ETN22469.1| hypothetical protein PPTG_02398 [Phytophthora parasitica INRA-310]
 gb|ETO78816.1| hypothetical protein F444_06339 [Phytophthora parasitica P1976]
 gb|ETP19873.1| hypothetical protein F441_06283 [Phytophthora parasitica CJ01A1]
Length=406

 Score =   130 bits (326),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 74/153 (48%), Positives = 95/153 (62%), Gaps = 5/153 (3%)
 Frame = -2

Query  629  PSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKV  450
            PS + LD WK  YSNTK N  + A+  FW+  D EGYSLWFCDY YN ENT  F+T N V
Sbjct  258  PSSLNLDAWKVQYSNTK-NLAD-AMTWFWEHLDTEGYSLWFCDYNYNSENTKMFMTCNAV  315

Query  449  GGFLQRMDLARKYAFGKMLVIGSE-PPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQV  273
            GGFLQR +  RKYAFG M V G+E     + G WLFRG +  K +++   D E Y WK+ 
Sbjct  316  GGFLQRSEAMRKYAFGVMDVCGAEGSEIIITGCWLFRG-DSEKHMIEANPDAEYYTWKKA  374

Query  272  DINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            ++ND   K RV+    + +  EG+ + D+K FK
Sbjct  375  ELNDET-KARVAAYWCNEDELEGKPIADSKVFK  406



>ref|XP_002901767.1| elongation factor 1-gamma, putative [Phytophthora infestans T30-4]
 gb|EEY57157.1| elongation factor 1-gamma, putative [Phytophthora infestans T30-4]
Length=406

 Score =   130 bits (326),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 73/153 (48%), Positives = 96/153 (63%), Gaps = 5/153 (3%)
 Frame = -2

Query  629  PSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKV  450
            PS + LD WK  YSNT+ N  + A+  FW+  D EGYSLWFCDY YN+ENT  F+T N V
Sbjct  258  PSSLNLDAWKVQYSNTR-NLAD-AMTWFWEHLDTEGYSLWFCDYNYNNENTKMFMTCNAV  315

Query  449  GGFLQRMDLARKYAFGKMLVIGSE-PPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQV  273
            GGFLQR +  RKYAFG M V G+E     + G WLFRG +  K +++   D E Y WK+ 
Sbjct  316  GGFLQRSEAMRKYAFGVMDVCGAEGSEIIITGCWLFRG-DSEKHMIEANPDAEYYTWKKA  374

Query  272  DINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            ++ND   K RV+    + +  EG+ + D+K FK
Sbjct  375  ELNDET-KARVAAYWCNEDELEGKPIADSKVFK  406



>ref|XP_002901771.1| elongation factor 1-gamma, putative [Phytophthora infestans T30-4]
 gb|EEY57161.1| elongation factor 1-gamma, putative [Phytophthora infestans T30-4]
Length=367

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 97/156 (62%), Gaps = 6/156 (4%)
 Frame = -2

Query  629  PSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKV  450
            PS + LD WK  YSNT+ N  + A+  FW+  D EGYSLWFCDY YN+ENT  F+T N V
Sbjct  217  PSSLNLDAWKVQYSNTR-NLAD-AMTWFWEHLDTEGYSLWFCDYNYNNENTKMFMTCNAV  274

Query  449  GGFLQRMDLARKYAFGKMLVIGSE-PPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQV  273
            GGFLQR +  RKYAFG M V G+E     + G WLFRG +  K +++   D E Y WK+ 
Sbjct  275  GGFLQRSEAMRKYAFGVMDVCGAEGSEIIITGCWLFRG-DSEKHMIEANPDAEYYTWKKA  333

Query  272  DINDPAQKERVSQMIEDAEPFEGEALLDAKCFK*AH  165
            ++ND   K RV+    + +  EG+ + D+K F  AH
Sbjct  334  ELNDET-KARVAAYWCNEDELEGKPIADSKVFN-AH  367



>ref|XP_009519315.1| hypothetical protein PHYSODRAFT_284839 [Phytophthora sojae]
 gb|ACH68459.1| calcium-dependent protein 1 [Phytophthora sojae]
 gb|EGZ24027.1| hypothetical protein PHYSODRAFT_284839 [Phytophthora sojae]
Length=405

 Score =   129 bits (323),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 73/153 (48%), Positives = 93/153 (61%), Gaps = 5/153 (3%)
 Frame = -2

Query  629  PSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKV  450
            PS M LD WK  YSNTK      A+K FW+  D EGYSLWFCDY YN ENT  F+T N V
Sbjct  257  PSSMNLDAWKVQYSNTKD--LADAMKWFWEHLDTEGYSLWFCDYNYNKENTKMFMTCNAV  314

Query  449  GGFLQRMDLARKYAFGKMLVIGSE-PPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQV  273
            GGFLQR +  RKYAFG M V G+E     + G WLFRG +  K +++   D E Y W + 
Sbjct  315  GGFLQRSEAMRKYAFGVMDVCGAEGSEIIITGCWLFRG-DSEKHMVEANPDAEYYTWTKA  373

Query  272  DINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            ++ND   K R++    + +  EG+ + D+K FK
Sbjct  374  ELNDET-KARIAAYWCNEDELEGKPIADSKVFK  405



>gb|EPY23706.1| elongation factor 1-gamma [Strigomonas culicis]
Length=254

 Score =   125 bits (315),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 68/155 (44%), Positives = 99/155 (64%), Gaps = 6/155 (4%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSK++LD +KR YSN  T  R VA   F++ YDPEGY+ ++C YKYN++N V F+T N
Sbjct  105  LPPSKLVLDAFKREYSNNDT--RAVAAPWFFNNYDPEGYTCFWCKYKYNEDNKVPFMTAN  162

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
             V G+ QRM+  RKYAFG  L+IG E   ++ G W+FRGK +P+ V  E  D E ++W +
Sbjct  163  LVRGWFQRMEHTRKYAFGVALIIGEEKGHEIVGFWVFRGKGMPEIVT-EVVDTENFDWTE  221

Query  275  V-DINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            + DI    +KE+++  +    P     +L+ + FK
Sbjct  222  IADIQ--KEKEQITDYLAWEGPTIPRPVLEGRVFK  254



>ref|XP_009519320.1| hypothetical protein PHYSODRAFT_359164 [Phytophthora sojae]
 gb|EGZ24032.1| hypothetical protein PHYSODRAFT_359164 [Phytophthora sojae]
Length=451

 Score =   129 bits (323),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 73/153 (48%), Positives = 93/153 (61%), Gaps = 5/153 (3%)
 Frame = -2

Query  629  PSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKV  450
            PS M LD WK  YSNTK      A+K FW+  D EGYSLWFCDY YN ENT  F+T N V
Sbjct  303  PSSMNLDAWKVQYSNTKD--LADAMKWFWEHLDTEGYSLWFCDYNYNKENTKMFMTCNAV  360

Query  449  GGFLQRMDLARKYAFGKMLVIGSE-PPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQV  273
            GGFLQR +  RKYAFG M V G+E     + G WLFRG +  K +++   D E Y W + 
Sbjct  361  GGFLQRSEAMRKYAFGVMDVCGAEGSEIIITGCWLFRG-DSEKHMVEANPDAEYYTWTKA  419

Query  272  DINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            ++ND   K R++    + +  EG+ + D+K FK
Sbjct  420  ELNDET-KARIAAYWCNEDELEGKPIADSKVFK  451



>ref|XP_001562716.1| elongation factor-1 gamma [Leishmania braziliensis MHOM/BR/75/M2904]
 emb|CAM41841.1| elongation factor-1 gamma [Leishmania braziliensis MHOM/BR/75/M2904]
Length=403

 Score =   128 bits (322),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 68/154 (44%), Positives = 99/154 (64%), Gaps = 4/154 (3%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPS  +LD +KR YSNT T  R VA   F++ YD EGY+ ++  YKYN+EN   F+T N
Sbjct  254  LPPSNFVLDAYKREYSNTDT--RTVAAPYFFEHYDAEGYTCFWARYKYNEENKKQFMTAN  311

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
             V G+ QRM+  RKYAFG  L+IG +   ++ G W+FRGK +P+ V +E  D EL+EW++
Sbjct  312  LVRGWFQRMEHLRKYAFGIALIIGEDTAHELMGFWVFRGKGMPEIV-NEVVDTELFEWEE  370

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            +  N  A+KE+++  +    P     +L+ +CFK
Sbjct  371  IK-NVQAEKEKITDYLCWEGPTIPRPVLEGRCFK  403



>emb|CEP19706.1| hypothetical protein [Parasitella parasitica]
Length=411

 Score =   127 bits (319),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 69/154 (45%), Positives = 96/154 (62%), Gaps = 7/154 (5%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSK I+D+WKR YSN  TN   VAIK FWD +DPEGYS+W  DYKYNDE T++F++ N
Sbjct  265  LPPSKFIMDQWKREYSNNDTN---VAIKWFWDNFDPEGYSIWKVDYKYNDELTLTFMSNN  321

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
             +GGF  R++ A KYAFG M+V G      + G ++ RG+E+P F + +  D   Y +++
Sbjct  322  LIGGFYARLERAHKYAFGSMIVRGENNKNTISGYFVVRGQEVP-FEIYDAADYGSYNFQK  380

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            +   +PAQ E           ++ E  +D K FK
Sbjct  381  I---EPAQYEEKKDEFYKYLAWDFEDCVDGKVFK  411



>ref|NP_001184949.1| elongation factor EF-1 gamma subunit [Arabidopsis thaliana]
 dbj|BAH56947.1| AT1G09640 [Arabidopsis thaliana]
 gb|AEE28473.1| elongation factor EF-1 gamma subunit [Arabidopsis thaliana]
Length=265

 Score =   125 bits (313),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 66/74 (89%), Gaps = 1/74 (1%)
 Frame = -2

Query  392  VIGSEPPF-KVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDINDPAQKERVSQMIEDAE  216
             + ++P F KVKGLWLFRG EIPKF++DE YDMELYEW +VDI+D AQKERVSQMIEDAE
Sbjct  192  TVVNQPNFTKVKGLWLFRGPEIPKFIMDEVYDMELYEWTKVDISDEAQKERVSQMIEDAE  251

Query  215  PFEGEALLDAKCFK  174
            PFEGEALLDAKCFK
Sbjct  252  PFEGEALLDAKCFK  265



>gb|EPY29488.1| elongation factor 1-gamma [Strigomonas culicis]
Length=408

 Score =   126 bits (317),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 68/155 (44%), Positives = 99/155 (64%), Gaps = 6/155 (4%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSK++LD +KR YSN  T  R VA   F++ YDPEGY+ ++C YKYN++N V F+T N
Sbjct  259  LPPSKLVLDAFKREYSNNDT--RAVAAPWFFNNYDPEGYTCFWCKYKYNEDNKVPFMTAN  316

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
             V G+ QRM+  RKYAFG  L+IG E   ++ G W+FRGK +P+ V  E  D E ++W +
Sbjct  317  LVRGWFQRMEHTRKYAFGVALIIGEEKGHEIVGFWVFRGKGMPEIVT-EVVDTENFDWTE  375

Query  275  V-DINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            + DI    +KE+++  +    P     +L+ + FK
Sbjct  376  IADIQK--EKEQITDYLAWEGPTIPRPVLEGRVFK  408



>gb|EPY20606.1| elongation factor 1-gamma [Strigomonas culicis]
Length=483

 Score =   127 bits (318),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 68/155 (44%), Positives = 99/155 (64%), Gaps = 6/155 (4%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSK++LD +KR YSN  T  R VA   F++ YDPEGY+ ++C YKYN++N V F+T N
Sbjct  334  LPPSKLVLDAFKREYSNNDT--RAVAAPWFFNNYDPEGYTCFWCKYKYNEDNKVPFMTAN  391

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
             V G+ QRM+  RKYAFG  L+IG E   ++ G W+FRGK +P+ V  E  D E ++W +
Sbjct  392  LVRGWFQRMEHTRKYAFGVALIIGEEKGHEIVGFWVFRGKGMPEIV-TEVVDTENFDWTE  450

Query  275  V-DINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            + DI    +KE+++  +    P     +L+ + FK
Sbjct  451  IADIQK--EKEQITDYLAWEGPTIPRPVLEGRVFK  483



>emb|CDH60277.1| elongation factor 1 gamma domain-containingprotein [Lichtheimia 
corymbifera JMRC:FSU:9682]
Length=399

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 67/154 (44%), Positives = 93/154 (60%), Gaps = 7/154 (5%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LP S  +LDEWKR+YSN  T   +VA+K FW+ +D EG+S+W  DY+YNDE T+ F++ N
Sbjct  253  LPKSSFVLDEWKRMYSNNDT---DVAMKWFWENFDKEGWSIWRVDYRYNDELTLVFMSNN  309

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
             +GGF  R++ ARKYAFG MLV G+     + G ++ RG+E+P     E YD   Y   +
Sbjct  310  LIGGFFARLERARKYAFGSMLVTGTNNNNAISGYFIIRGQEVPY----EIYDAADYPSYK  365

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
             +  +P+Q E     IE    +E E   D K FK
Sbjct  366  FEKIEPSQYEEKKDEIEKYMAWEVEGFADGKIFK  399



>ref|XP_003872780.1| elongation factor-1 gamma [Leishmania mexicana MHOM/GT/2001/U1103]
 emb|CBZ24254.1| elongation factor-1 gamma [Leishmania mexicana MHOM/GT/2001/U1103]
Length=404

 Score =   125 bits (313),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 67/155 (43%), Positives = 99/155 (64%), Gaps = 6/155 (4%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPS  +LD +KR YSNT T  R VA   F++ YD EGY+ ++  YKYN++N   F+T N
Sbjct  255  LPPSSFVLDAYKREYSNTDT--RTVAAPYFFEHYDAEGYTCFWARYKYNEDNKKQFMTAN  312

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
             V G+ QRM+  RKYAFG  L+IG +   ++  LW+FRGK +P+ V  E  D EL+EW++
Sbjct  313  LVRGWFQRMEHVRKYAFGIALIIGEDAAHELTSLWVFRGKGMPEIV-SEVVDTELFEWEE  371

Query  275  V-DINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            + D+   A+KE+++  +    P     +L+ +CFK
Sbjct  372  IKDVQ--AEKEKITDYLCWEGPTIPRPVLEGRCFK  404



>ref|XP_010704334.1| elongation factor-1 gamma [Leishmania panamensis]
 gb|AIN96012.1| elongation factor-1 gamma [Leishmania panamensis]
Length=403

 Score =   125 bits (313),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 67/155 (43%), Positives = 99/155 (64%), Gaps = 6/155 (4%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPS  +LD +KR YSNT T  R VA   F++ YD EGY+ ++  YKYN+EN   F+T N
Sbjct  254  LPPSNFVLDAYKREYSNTDT--RTVAAPYFFEHYDAEGYTCFWARYKYNEENKKQFMTAN  311

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
             V G+ QRM+  RKYAFG  L+IG +   ++ G W+FRG  +P+ V +E  D EL+EW++
Sbjct  312  LVRGWFQRMEHLRKYAFGVALIIGEDTAHELMGFWVFRGTGMPEIV-NEVVDTELFEWEE  370

Query  275  V-DINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            + D+   A+KE+++  +    P     +L+ +CFK
Sbjct  371  IKDVQ--AEKEKITDYLCWEGPTIPRPVLEGRCFK  403



>gb|EPY38232.1| elongation factor 1-gamma [Angomonas deanei]
Length=286

 Score =   122 bits (307),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 68/155 (44%), Positives = 95/155 (61%), Gaps = 6/155 (4%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPS   LD +KR YSNT T  R VA    +  +D  G++ ++C YKYNDEN V F+T N
Sbjct  137  LPPSSFDLDSFKREYSNTDT--RTVAAPYLFSHFDAAGFTCFWCKYKYNDENKVPFMTAN  194

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
               G+ QRM+  RKYAFG  L+IG E    + GLW+FRGK +P+ V D   D E ++W +
Sbjct  195  LCRGWFQRMEHTRKYAFGVALIIGEEKQHDIVGLWVFRGKGMPEIVTD-VVDTENFDWTE  253

Query  275  V-DINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            + DIN  A+KE+++  +    P  G  +L+ + FK
Sbjct  254  IKDIN--AEKEKITDYLCWEGPTIGRPVLEGRTFK  286



>gb|EFA79702.1| glutathione S-transferase domain-containing protein [Polysphondylium 
pallidum PN500]
Length=432

 Score =   125 bits (313),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 65/159 (41%), Positives = 92/159 (58%), Gaps = 8/159 (5%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPSK  L+EWKR+YSN  T  R VA+  FW+ YD EG+S++F  YKYN E    F+T N
Sbjct  258  LPPSKFNLEEWKRMYSNNDT--RSVALPWFWENYDAEGFSVYFATYKYNSELGAQFMTSN  315

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFK-----VKGLWLFRGKEIPKFVLDECYDMEL  291
             +GG  QR++   K+AF  +L+ G +   K     V G+W+FRG ++P+  L EC D  +
Sbjct  316  LIGGMFQRLETLHKWAFASVLITGEDVEGKINNQEVTGIWIFRGADLPE-DLKECDDSIV  374

Query  290  YEWKQVDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            Y+WK +D+ DPA K  +           G   +  K +K
Sbjct  375  YDWKLLDVKDPATKTLIDDYFAWDGALGGRKFIQGKLYK  413



>emb|CDS05969.1| hypothetical protein LRAMOSA08497 [Absidia idahoensis var. thermophila]
Length=401

 Score =   124 bits (311),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 66/154 (43%), Positives = 95/154 (62%), Gaps = 7/154 (5%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LP S  +LDEWKR+YSN  T   +VA+K FW+ +D EG+S+W  DY+YNDE T+ F++ N
Sbjct  255  LPKSSFVLDEWKRMYSNNDT---DVAMKWFWENFDNEGWSIWRVDYRYNDELTLVFMSNN  311

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
             +GGF  R++ ARKYAFG MLV G+     + G ++ RG+E+P  + D   D   Y++++
Sbjct  312  LIGGFFARLERARKYAFGSMLVTGTNNNNAISGYFIIRGQEVPYEIYDAA-DYPSYKFEK  370

Query  275  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            V   +P+Q       IE    +E E   D K FK
Sbjct  371  V---EPSQYAEKKDEIEKYMAWEVEGFADGKIFK  401



>emb|CCC95849.1| unnamed protein product [Trypanosoma congolense IL3000]
Length=406

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 68/155 (44%), Positives = 97/155 (63%), Gaps = 6/155 (4%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPS  +LD +KR YSNT T  R VA   F+  YDP GY+ ++C YKYN++N + F+T N
Sbjct  257  LPPSPFVLDNFKREYSNTDT--RTVAAPYFFSNYDPNGYTTFWCRYKYNEDNKMQFMTAN  314

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
             V G+ QRM+  RKYAFG  L+IG E    +  LW+FRGK +P  V D   D EL++W++
Sbjct  315  LVRGWFQRMEHTRKYAFGVALIIGEEKRHDIVALWVFRGKGMPDIVKD-VEDTELFDWEE  373

Query  275  V-DINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            + D+   AQ+ER++       P   + +L+ + FK
Sbjct  374  IPDVK--AQRERITDYFCWEGPTIPKPVLEGRVFK  406



>gb|EPY35420.1| elongation factor 1-gamma [Angomonas deanei]
Length=405

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 68/155 (44%), Positives = 95/155 (61%), Gaps = 6/155 (4%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPS   LD +KR YSNT T  R VA    +  +D  G++ ++C YKYNDEN V F+T N
Sbjct  256  LPPSSFDLDSFKREYSNTDT--RTVAAPYLFSHFDAAGFTCFWCKYKYNDENKVPFMTAN  313

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
               G+ QRM+  RKYAFG  L+IG E    + GLW+FRGK +P+ V D   D E ++W +
Sbjct  314  LCRGWFQRMEHTRKYAFGVALIIGEEKQHDIVGLWVFRGKGMPEIVTD-VVDTENFDWTE  372

Query  275  V-DINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            + DIN  A+KE+++  +    P  G  +L+ + FK
Sbjct  373  IKDIN--AEKEKITDYLCWEGPTIGRPVLEGRTFK  405



>gb|EPY35413.1| elongation factor 1-gamma [Angomonas deanei]
Length=405

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 68/155 (44%), Positives = 95/155 (61%), Gaps = 6/155 (4%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPS   LD +KR YSNT T  R VA    +  +D  G++ ++C YKYNDEN V F+T N
Sbjct  256  LPPSSFDLDSFKREYSNTDT--RTVAAPYLFSHFDAAGFTCFWCKYKYNDENKVPFMTAN  313

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
               G+ QRM+  RKYAFG  L+IG E    + GLW+FRGK +P+ V D   D E ++W +
Sbjct  314  LCRGWFQRMEHTRKYAFGVALIIGEEKQHDIVGLWVFRGKGMPEIVTD-VVDTENFDWTE  372

Query  275  V-DINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            + DIN  A+KE+++  +    P  G  +L+ + FK
Sbjct  373  IKDIN--AEKEKITDYLCWEGPTIGRPVLEGRTFK  405



>emb|CCC95841.1| unnamed protein product [Trypanosoma congolense IL3000]
Length=406

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 69/155 (45%), Positives = 96/155 (62%), Gaps = 6/155 (4%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPS  +LD +KR YSNT T  R VA   F+  YDP GY+ ++C YKYN++N + F+T N
Sbjct  257  LPPSPFVLDNFKREYSNTDT--RTVAAPYFFSNYDPNGYTTFWCRYKYNEDNKMQFMTAN  314

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
             V G+ QRM+  RKYAFG  L+IG E    +  LW+FRGK +P  V D   D EL++W++
Sbjct  315  LVRGWFQRMEHTRKYAFGVALIIGEEKRHDIVALWVFRGKGMPDIVKD-VEDTELFDWEE  373

Query  275  V-DINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            + DI   AQ ER++       P   + +L+ + FK
Sbjct  374  IPDIK--AQSERITDYFCWEGPTIPKPVLEGRVFK  406



>gb|EPY28959.1| elongation factor 1-gamma [Angomonas deanei]
Length=405

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 68/155 (44%), Positives = 95/155 (61%), Gaps = 6/155 (4%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPS   LD +KR YSNT T  R VA    +  +D  G++ ++C YKYNDEN V F+T N
Sbjct  256  LPPSSFDLDSFKREYSNTDT--RTVAAPYLFSHFDAAGFTCFWCKYKYNDENKVPFMTAN  313

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
               G+ QRM+  RKYAFG  L+IG E    + GLW+FRGK +P+ V D   D E ++W +
Sbjct  314  LCRGWFQRMEHTRKYAFGVALIIGEEKQHDIVGLWVFRGKGMPEIVTD-VVDTENFDWTE  372

Query  275  V-DINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            + DIN  A+KE+++  +    P  G  +L+ + FK
Sbjct  373  IKDIN--AEKEKITDYLCWEGPTIGRPVLEGRTFK  405



>ref|XP_003858781.1| elongation factor-1 gamma [Leishmania donovani]
 emb|CBZ32061.1| elongation factor-1 gamma [Leishmania donovani]
Length=450

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/155 (43%), Positives = 98/155 (63%), Gaps = 6/155 (4%)
 Frame = -2

Query  635  LPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMN  456
            LPPS  +LD +KR YSNT T  R VA   F++ YD EGY+ ++  YKYN++N   F+T N
Sbjct  301  LPPSSFVLDAYKREYSNTDT--RTVAAPYFFEHYDTEGYTCFWARYKYNEDNKKQFMTAN  358

Query  455  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  276
             V G+ QRM+  RKYAFG  L+IG +   ++   W+FRGK +P+ V  E  D EL+EW++
Sbjct  359  LVRGWFQRMEHVRKYAFGVALIIGEDAAHELVSFWVFRGKGMPEIV-SEVVDTELFEWEE  417

Query  275  V-DINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  174
            + D+   A+KE+++  +    P     +L+ +CFK
Sbjct  418  IKDVQ--AEKEKITDYLCWEGPTIPRPVLEGRCFK  450



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 933768211125