BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF026I12

Length=698
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDO99096.1|  unnamed protein product                                406   2e-140   Coffea canephora [robusta coffee]
ref|XP_011090682.1|  PREDICTED: 40S ribosomal protein S3a               405   3e-140   Sesamum indicum [beniseed]
ref|NP_001275164.1|  40S ribosomal protein S3a-like protein             398   2e-137   Solanum tuberosum [potatoes]
sp|P33444.4|RS3A_CATRO  RecName: Full=40S ribosomal protein S3a; ...    397   1e-136   Catharanthus roseus [chatas]
ref|XP_004247589.1|  PREDICTED: 40S ribosomal protein S3a               396   1e-136   Solanum lycopersicum
gb|AFK33413.1|  unknown                                                 391   1e-134   Lotus japonicus
ref|XP_002283142.1|  PREDICTED: 40S ribosomal protein S3a-1             391   2e-134   Vitis vinifera
ref|XP_010034641.1|  PREDICTED: 40S ribosomal protein S3a               390   4e-134   Eucalyptus grandis [rose gum]
ref|XP_003610736.1|  40S ribosomal protein S3a-like protein             389   1e-133   Medicago truncatula
ref|XP_010553319.1|  PREDICTED: 40S ribosomal protein S3a-1-like        389   1e-133   Tarenaya hassleriana [spider flower]
gb|KHN30486.1|  40S ribosomal protein S3a                               388   1e-133   Glycine soja [wild soybean]
ref|XP_011073454.1|  PREDICTED: 40S ribosomal protein S3a-like          389   1e-133   Sesamum indicum [beniseed]
gb|EPS71864.1|  hypothetical protein M569_02887                         389   1e-133   Genlisea aurea
ref|NP_001241005.1|  uncharacterized protein LOC100805519               389   1e-133   Glycine max [soybeans]
ref|XP_010274385.1|  PREDICTED: 40S ribosomal protein S3a-like          388   2e-133   Nelumbo nucifera [Indian lotus]
ref|NP_001239858.1|  uncharacterized protein LOC100808747               388   3e-133   Glycine max [soybeans]
gb|AFS65104.1|  40S ribosomal protein S3a-like protein                  387   4e-133   Elaeis guineensis
ref|XP_010942777.1|  PREDICTED: 40S ribosomal protein S3a               387   4e-133   Elaeis guineensis
gb|KDP23643.1|  hypothetical protein JCGZ_23476                         387   5e-133   Jatropha curcas
ref|XP_004496691.1|  PREDICTED: 40S ribosomal protein S3a-like          387   7e-133   Cicer arietinum [garbanzo]
ref|XP_010024230.1|  PREDICTED: 40S ribosomal protein S3a-like          387   9e-133   Eucalyptus grandis [rose gum]
ref|XP_010938988.1|  PREDICTED: 40S ribosomal protein S3a-like          387   1e-132   Elaeis guineensis
ref|XP_008438626.1|  PREDICTED: 40S ribosomal protein S3a               386   1e-132   Cucumis melo [Oriental melon]
ref|XP_010090259.1|  40S ribosomal protein S3a                          386   1e-132   Morus notabilis
ref|XP_004134125.1|  PREDICTED: 40S ribosomal protein S3a-like          386   1e-132   Cucumis sativus [cucumbers]
ref|XP_007157117.1|  hypothetical protein PHAVU_002G044200g             386   2e-132   Phaseolus vulgaris [French bean]
ref|XP_006382773.1|  40S ribosomal protein S3A                          385   2e-132   Populus trichocarpa [western balsam poplar]
ref|XP_010553762.1|  PREDICTED: 40S ribosomal protein S3a-1-like        385   3e-132   Tarenaya hassleriana [spider flower]
ref|XP_011032434.1|  PREDICTED: 40S ribosomal protein S3a               385   4e-132   Populus euphratica
ref|NP_001241430.1|  uncharacterized protein LOC100813273               385   4e-132   Glycine max [soybeans]
ref|XP_007030615.1|  Ribosomal protein S3Ae                             385   5e-132   
ref|XP_006382772.1|  hypothetical protein POPTR_0005s05280g             385   6e-132   
ref|XP_004145387.1|  PREDICTED: 40S ribosomal protein S3a-like          384   7e-132   
ref|XP_008449325.1|  PREDICTED: 40S ribosomal protein S3a-like          384   7e-132   Cucumis melo [Oriental melon]
gb|ACU18272.1|  unknown                                                 384   7e-132   Glycine max [soybeans]
gb|KHN02741.1|  40S ribosomal protein S3a                               384   1e-131   Glycine soja [wild soybean]
gb|EYU23687.1|  hypothetical protein MIMGU_mgv1a012196mg                384   1e-131   Erythranthe guttata [common monkey flower]
ref|XP_010550935.1|  PREDICTED: 40S ribosomal protein S3a-2-like        384   2e-131   Tarenaya hassleriana [spider flower]
ref|XP_010272784.1|  PREDICTED: 40S ribosomal protein S3a-like          384   2e-131   Nelumbo nucifera [Indian lotus]
ref|NP_001265990.1|  40S ribosomal protein S3a                          383   2e-131   Cicer arietinum [garbanzo]
ref|XP_009628663.1|  PREDICTED: 40S ribosomal protein S3a {ECO:00...    382   5e-131   Nicotiana tomentosiformis
ref|XP_009779517.1|  PREDICTED: 40S ribosomal protein S3a               382   5e-131   Nicotiana sylvestris
gb|ABK93399.1|  unknown                                                 382   6e-131   Populus trichocarpa [western balsam poplar]
ref|XP_010259119.1|  PREDICTED: 40S ribosomal protein S3a-1             382   9e-131   Nelumbo nucifera [Indian lotus]
ref|XP_011026951.1|  PREDICTED: 40S ribosomal protein S3a-2             381   1e-130   Populus euphratica
ref|XP_006284351.1|  hypothetical protein CARUB_v10005523mg             381   1e-130   Capsella rubella
ref|NP_001276152.1|  40S ribosomal protein S3a-like                     381   1e-130   
ref|XP_008804511.1|  PREDICTED: 40S ribosomal protein S3a               381   2e-130   Phoenix dactylifera
ref|XP_006848758.1|  hypothetical protein AMTR_s00026p00042160          381   2e-130   Amborella trichopoda
ref|XP_008811659.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...    380   2e-130   Phoenix dactylifera
ref|XP_002517085.1|  40S ribosomal protein S3a, putative                380   2e-130   Ricinus communis
ref|XP_009775368.1|  PREDICTED: 40S ribosomal protein S3a-like          380   3e-130   Nicotiana sylvestris
ref|XP_009591686.1|  PREDICTED: 40S ribosomal protein S3a {ECO:00...    380   3e-130   Nicotiana tomentosiformis
gb|ABK56834.1|  RPS3                                                    380   3e-130   Cymbidium hybrid cultivar
ref|XP_004235324.1|  PREDICTED: 40S ribosomal protein S3a               380   3e-130   Solanum lycopersicum
ref|XP_010432386.1|  PREDICTED: 40S ribosomal protein S3a-2-like        380   4e-130   Camelina sativa [gold-of-pleasure]
ref|XP_002314671.2|  ribosomal protein S3a                              380   4e-130   Populus trichocarpa [western balsam poplar]
ref|XP_007137418.1|  hypothetical protein PHAVU_009G125400g             380   5e-130   Phaseolus vulgaris [French bean]
ref|XP_006379849.1|  hypothetical protein POPTR_0008s15610g             379   6e-130   Populus trichocarpa [western balsam poplar]
ref|NP_195193.1|  40S ribosomal protein S3a-2                           380   6e-130   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011030646.1|  PREDICTED: 40S ribosomal protein S3a-2-like        379   7e-130   Populus euphratica
ref|XP_010256142.1|  PREDICTED: 40S ribosomal protein S3a-1-like        379   7e-130   Nelumbo nucifera [Indian lotus]
ref|XP_007034836.1|  Ribosomal protein S3Ae isoform 2                   379   7e-130   
ref|XP_002512232.1|  40S ribosomal protein S3a, putative                379   7e-130   Ricinus communis
ref|XP_007034835.1|  Ribosomal protein S3Ae isoform 1                   379   8e-130   Theobroma cacao [chocolate]
ref|XP_006408143.1|  hypothetical protein EUTSA_v10021341mg             379   9e-130   Eutrema salsugineum [saltwater cress]
ref|XP_009618011.1|  PREDICTED: 40S ribosomal protein S3a {ECO:00...    379   1e-129   Nicotiana tomentosiformis
ref|XP_010437575.1|  PREDICTED: 40S ribosomal protein S3a-2             379   1e-129   Camelina sativa [gold-of-pleasure]
ref|XP_003638196.1|  40S ribosomal protein S3a                          378   1e-129   
gb|ACJ85751.1|  unknown                                                 378   2e-129   Medicago truncatula
ref|XP_010447045.1|  PREDICTED: 40S ribosomal protein S3a-2-like        378   2e-129   Camelina sativa [gold-of-pleasure]
ref|XP_010524908.1|  PREDICTED: 40S ribosomal protein S3a-2             378   2e-129   Tarenaya hassleriana [spider flower]
sp|Q9MBB3.1|RS3A_DAUCA  RecName: Full=40S ribosomal protein S3a; ...    378   3e-129   Daucus carota [carrots]
sp|P49198.2|RS3A_HELAN  RecName: Full=40S ribosomal protein S3a         377   5e-129   Helianthus annuus
emb|CDO98656.1|  unnamed protein product                                377   6e-129   Coffea canephora [robusta coffee]
ref|XP_004168031.1|  PREDICTED: 40S ribosomal protein S3a-like          375   6e-129   
ref|XP_007143300.1|  hypothetical protein PHAVU_007G060700g             377   8e-129   Phaseolus vulgaris [French bean]
ref|XP_009394355.1|  PREDICTED: 40S ribosomal protein S3a {ECO:00...    376   1e-128   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010675082.1|  PREDICTED: 40S ribosomal protein S3a               376   1e-128   Beta vulgaris subsp. vulgaris [field beet]
gb|KHG05975.1|  40S ribosomal S3a                                       376   1e-128   Gossypium arboreum [tree cotton]
ref|XP_010546607.1|  PREDICTED: 40S ribosomal protein S3a-1-like        376   1e-128   Tarenaya hassleriana [spider flower]
gb|EYU41450.1|  hypothetical protein MIMGU_mgv1a002668mg                389   2e-128   Erythranthe guttata [common monkey flower]
ref|XP_006412198.1|  hypothetical protein EUTSA_v10026006mg             376   2e-128   Eutrema salsugineum [saltwater cress]
gb|KJB34507.1|  hypothetical protein B456_006G069600                    375   2e-128   Gossypium raimondii
ref|XP_010485869.1|  PREDICTED: 40S ribosomal protein S3a-1             375   3e-128   Camelina sativa [gold-of-pleasure]
ref|NP_001066631.1|  Os12g0406200                                       375   3e-128   
ref|XP_002882377.1|  40S ribosomal protein S3A                          375   4e-128   
gb|KJB72261.1|  hypothetical protein B456_011G167500                    375   4e-128   Gossypium raimondii
ref|XP_010419205.1|  PREDICTED: 40S ribosomal protein S3a-1-like        375   4e-128   Camelina sativa [gold-of-pleasure]
ref|XP_002312545.2|  ribosomal protein S3a                              374   6e-128   
gb|KHG19560.1|  40S ribosomal S3a                                       374   1e-127   Gossypium arboreum [tree cotton]
gb|KDP40219.1|  hypothetical protein JCGZ_02217                         374   1e-127   Jatropha curcas
ref|XP_002869131.1|  40S ribosomal protein S3A                          373   2e-127   Arabidopsis lyrata subsp. lyrata
ref|XP_003559021.1|  PREDICTED: 40S ribosomal protein S3a-like          374   2e-127   Brachypodium distachyon [annual false brome]
emb|CDX75453.1|  BnaA01g02490D                                          373   2e-127   
ref|XP_006663973.1|  PREDICTED: 40S ribosomal protein S3a-like          373   2e-127   Oryza brachyantha
ref|NP_187135.1|  40S ribosomal protein S3a-1                           373   2e-127   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006663971.1|  PREDICTED: 40S ribosomal protein S3a-like          373   2e-127   Oryza brachyantha
ref|XP_003572000.1|  PREDICTED: 40S ribosomal protein S3a               373   2e-127   Brachypodium distachyon [annual false brome]
ref|XP_010463973.1|  PREDICTED: 40S ribosomal protein S3a-1-like        373   3e-127   Camelina sativa [gold-of-pleasure]
ref|XP_006663974.1|  PREDICTED: 40S ribosomal protein S3a-like          373   3e-127   Oryza brachyantha
emb|CDX76296.1|  BnaA08g11040D                                          372   3e-127   
emb|CDX69078.1|  BnaC01g03750D                                          372   5e-127   
dbj|BAA00860.1|  cyc07                                                  371   5e-127   Catharanthus roseus [chatas]
ref|XP_006838990.1|  hypothetical protein AMTR_s00002p00271660          372   6e-127   
ref|XP_004241461.1|  PREDICTED: 40S ribosomal protein S3a               372   7e-127   Solanum lycopersicum
ref|XP_009108713.1|  PREDICTED: 40S ribosomal protein S3a-2-like        372   8e-127   Brassica rapa
ref|NP_001275123.1|  cyc07-like protein                                 372   9e-127   Solanum tuberosum [potatoes]
ref|XP_002277791.1|  PREDICTED: 40S ribosomal protein S3a-2-like        371   9e-127   Vitis vinifera
ref|XP_009408135.1|  PREDICTED: 40S ribosomal protein S3a {ECO:00...    371   1e-126   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008218237.1|  PREDICTED: 40S ribosomal protein S3a-2             371   1e-126   Prunus mume [ume]
ref|XP_009400022.1|  PREDICTED: 40S ribosomal protein S3a {ECO:00...    371   2e-126   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001049289.1|  Os03g0200500                                       371   2e-126   
ref|NP_001274913.1|  40S ribosomal protein S3a-like                     370   2e-126   Solanum tuberosum [potatoes]
gb|KJB38202.1|  hypothetical protein B456_006G241700                    370   2e-126   Gossypium raimondii
ref|XP_006298355.1|  hypothetical protein CARUB_v10014425mg             370   2e-126   Capsella rubella
ref|XP_009110285.1|  PREDICTED: 40S ribosomal protein S3a-2             370   2e-126   Brassica rapa
gb|ABB55362.1|  cyc07-like                                              370   3e-126   Solanum tuberosum [potatoes]
emb|CDY50760.1|  BnaAnng10670D                                          370   3e-126   Brassica napus [oilseed rape]
emb|CDY21109.1|  BnaA01g33400D                                          370   3e-126   Brassica napus [oilseed rape]
emb|CDY30019.1|  BnaC01g39890D                                          372   3e-126   Brassica napus [oilseed rape]
ref|XP_004958212.1|  PREDICTED: 40S ribosomal protein S3a-like          370   4e-126   Setaria italica
gb|ABK22319.1|  unknown                                                 369   4e-126   Picea sitchensis
ref|XP_006649574.1|  PREDICTED: 40S ribosomal protein S3a-like          370   4e-126   Oryza brachyantha
dbj|BAA05057.1|  cyc07                                                  369   6e-126   Catharanthus roseus [chatas]
gb|ABB72808.1|  cyc07-like protein                                      369   7e-126   Solanum tuberosum [potatoes]
ref|XP_010229024.1|  PREDICTED: 40S ribosomal protein S3a-like          369   7e-126   Brachypodium distachyon [annual false brome]
emb|CDY40680.1|  BnaC03g33960D                                          369   9e-126   Brassica napus [oilseed rape]
ref|XP_009138316.1|  PREDICTED: 40S ribosomal protein S3a-2-like        369   1e-125   Brassica rapa
gb|KHG11221.1|  40S ribosomal S3a                                       369   1e-125   Gossypium arboreum [tree cotton]
emb|CDX74165.1|  BnaA03g28820D                                          368   2e-125   
ref|XP_010092425.1|  40S ribosomal protein S3a                          368   2e-125   
ref|XP_009124201.1|  PREDICTED: 40S ribosomal protein S3a-2             368   2e-125   Brassica rapa
ref|XP_003526635.1|  PREDICTED: 40S ribosomal protein S3a-like          368   2e-125   Glycine max [soybeans]
ref|XP_004985319.1|  PREDICTED: 40S ribosomal protein S3a-like is...    368   2e-125   Setaria italica
ref|XP_009134791.1|  PREDICTED: 40S ribosomal protein S3a-2-like        368   3e-125   Brassica rapa
ref|NP_001046578.1|  Os02g0287000                                       367   3e-125   
ref|XP_006420004.1|  hypothetical protein CICLE_v10005663mg             367   5e-125   Citrus clementina [clementine]
gb|KFK30101.1|  hypothetical protein AALP_AA7G217000                    367   6e-125   Arabis alpina [alpine rockcress]
gb|EEE56753.1|  hypothetical protein OsJ_06287                          372   7e-125   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007205738.1|  hypothetical protein PRUPE_ppa010179mg             366   8e-125   Prunus persica
gb|AFW89329.1|  hypothetical protein ZEAMMB73_166147                    365   1e-124   
ref|XP_002987274.1|  hypothetical protein SELMODRAFT_271906             366   2e-124   Selaginella moellendorffii
gb|KDO43437.1|  hypothetical protein CISIN_1g040060mg                   365   2e-124   Citrus sinensis [apfelsine]
ref|XP_009406016.1|  PREDICTED: 40S ribosomal protein S3a {ECO:00...    365   3e-124   Musa acuminata subsp. malaccensis [pisang utan]
gb|KEH32959.1|  40S ribosomal protein S3a-1                             365   3e-124   Medicago truncatula
gb|KDO37446.1|  hypothetical protein CISIN_1g045491mg                   364   3e-124   Citrus sinensis [apfelsine]
ref|XP_006428321.1|  hypothetical protein CICLE_v10012508mg             365   3e-124   Citrus clementina [clementine]
dbj|BAJ93929.1|  predicted protein                                      364   6e-124   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004302028.1|  PREDICTED: 40S ribosomal protein S3a-2             364   8e-124   Fragaria vesca subsp. vesca
ref|NP_001152574.1|  40S ribosomal protein S3a                          363   9e-124   Zea mays [maize]
ref|XP_004296667.1|  PREDICTED: 40S ribosomal protein S3a               363   2e-123   Fragaria vesca subsp. vesca
gb|ACN40078.1|  unknown                                                 363   2e-123   Picea sitchensis
gb|KFK37895.1|  hypothetical protein AALP_AA3G043200                    363   2e-123   Arabis alpina [alpine rockcress]
ref|XP_001761018.1|  predicted protein                                  363   3e-123   
ref|XP_002463137.1|  hypothetical protein SORBIDRAFT_02g038365          362   3e-123   Sorghum bicolor [broomcorn]
ref|XP_002463138.1|  hypothetical protein SORBIDRAFT_02g038370          362   3e-123   Sorghum bicolor [broomcorn]
ref|NP_001141038.1|  hypothetical protein                               362   4e-123   Zea mays [maize]
gb|ABE66401.1|  S phase protein                                         359   4e-123   Striga asiatica [witchweed]
gb|AFW89330.1|  40S ribosomal protein S3a                               365   5e-123   
ref|NP_001288829.1|  40S ribosomal protein S3a                          362   5e-123   Brassica rapa
gb|AFW89335.1|  40S ribosomal protein S3a                               365   5e-123   
ref|NP_001149096.1|  40S ribosomal protein S3a                          361   8e-123   Zea mays [maize]
ref|XP_001765967.1|  predicted protein                                  361   1e-122   
gb|AGT16352.1|  40S ribosomal protein S3a                               360   3e-122   Saccharum hybrid cultivar R570
gb|ACG33267.1|  40S ribosomal protein S3a                               359   8e-122   Zea mays [maize]
ref|XP_001767326.1|  predicted protein                                  358   1e-121   
gb|ACG34058.1|  40S ribosomal protein S3a                               358   1e-121   Zea mays [maize]
gb|KJB38201.1|  hypothetical protein B456_006G241700                    357   3e-121   Gossypium raimondii
gb|EEE53089.1|  hypothetical protein OsJ_35850                          373   6e-121   Oryza sativa Japonica Group [Japonica rice]
gb|EEC69140.1|  hypothetical protein OsI_38068                          374   8e-121   Oryza sativa Indica Group [Indian rice]
gb|EMT30223.1|  40S ribosomal protein S3a                               355   2e-120   
gb|EYU30365.1|  hypothetical protein MIMGU_mgv1a021183mg                353   2e-120   Erythranthe guttata [common monkey flower]
ref|XP_008224264.1|  PREDICTED: 40S ribosomal protein S3a               355   4e-120   Prunus mume [ume]
gb|KJB28385.1|  hypothetical protein B456_005G045000                    354   5e-120   Gossypium raimondii
gb|EYU26004.1|  hypothetical protein MIMGU_mgv1a019927mg                352   6e-120   Erythranthe guttata [common monkey flower]
gb|AAX55706.1|  cyc07                                                   352   2e-119   Vitis vinifera
gb|AAC98779.1|  S-phase-specific ribosomal protein                      352   5e-119   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004985318.1|  PREDICTED: 40S ribosomal protein S3a-like is...    353   6e-119   
ref|XP_001774632.1|  predicted protein                                  350   4e-118   
ref|XP_001755439.1|  predicted protein                                  348   1e-117   
gb|KJB28386.1|  hypothetical protein B456_005G045000                    348   2e-117   Gossypium raimondii
ref|XP_001777314.1|  predicted protein                                  347   8e-117   
ref|XP_008391001.1|  PREDICTED: 40S ribosomal protein S3a-2-like        344   5e-116   Malus domestica [apple tree]
ref|XP_008390932.1|  PREDICTED: 40S ribosomal protein S3a-2-like        343   8e-116   Malus domestica [apple tree]
gb|KCW60693.1|  hypothetical protein EUGRSUZ_H03423                     342   1e-115   Eucalyptus grandis [rose gum]
ref|XP_009335287.1|  PREDICTED: 40S ribosomal protein S3a-2-like        342   4e-115   Pyrus x bretschneideri [bai li]
sp|A7Q5X9.1|RS3A2_VITVI  RecName: Full=40S ribosomal protein S3a-2      340   5e-115   Vitis vinifera
ref|XP_007226551.1|  hypothetical protein PRUPE_ppa024854mg             353   1e-114   
gb|ACU17112.1|  unknown                                                 337   8e-114   Glycine max [soybeans]
gb|KJB28382.1|  hypothetical protein B456_005G045000                    337   2e-113   Gossypium raimondii
ref|XP_002949135.1|  component of cytosolic 80S ribosome and 40S ...    332   2e-111   Volvox carteri f. nagariensis
emb|CDY17474.1|  BnaC03g65890D                                          330   6e-111   Brassica napus [oilseed rape]
gb|KHN21710.1|  40S ribosomal protein S3a                               333   2e-110   Glycine soja [wild soybean]
ref|XP_001693710.1|  ribosomal protein S3a, component of cytosoli...    328   1e-109   Chlamydomonas reinhardtii
gb|KDO74488.1|  hypothetical protein CISIN_1g024879mg                   325   1e-108   Citrus sinensis [apfelsine]
ref|XP_001774288.1|  predicted protein                                  325   2e-108   
ref|XP_009406018.1|  PREDICTED: 40S ribosomal protein S3a {ECO:00...    320   5e-107   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_005650618.1|  ribosomal protein S3Ae                             321   5e-107   Coccomyxa subellipsoidea C-169
ref|XP_001765908.1|  predicted protein                                  320   9e-107   
ref|XP_002465526.1|  hypothetical protein SORBIDRAFT_01g040570          319   3e-106   
gb|KHG19561.1|  40S ribosomal S3a                                       317   2e-105   Gossypium arboreum [tree cotton]
gb|AAP80855.1|  cyc07                                                   313   5e-104   Triticum aestivum [Canadian hard winter wheat]
emb|CBX25071.1|  40S ribosomal protein S3a                              312   2e-103   Polytomella sp. Pringsheim 198.80
emb|CEG00819.1|  Ribosomal protein S3Ae                                 309   4e-102   Ostreococcus tauri
ref|XP_001422366.1|  Ribosomal protein S3a, component of cytosoli...    308   5e-102   Ostreococcus lucimarinus CCE9901
sp|Q9XEG7.3|RS3A_TORRU  RecName: Full=40S ribosomal protein S3a         306   2e-101   Syntrichia ruralis
ref|XP_002505259.1|  predicted protein                                  303   1e-99    Micromonas commoda
ref|XP_007508881.1|  predicted protein                                  301   3e-99    Bathycoccus prasinos
gb|AFW89333.1|  hypothetical protein ZEAMMB73_166147                    303   4e-99    
ref|XP_003060358.1|  predicted protein                                  294   2e-96    Micromonas pusilla CCMP1545
ref|XP_011395666.1|  40S ribosomal protein S3a                          294   3e-96    Auxenochlorella protothecoides
emb|CBI34197.3|  unnamed protein product                                290   1e-95    Vitis vinifera
gb|ERZ98268.1|  hypothetical protein GLOINDRAFT_339726                  287   1e-93    
ref|XP_003038024.1|  40S ribosomal protein S1                           286   2e-93    Schizophyllum commune H4-8
ref|XP_007862325.1|  40S ribosomal protein S1                           286   4e-93    Gloeophyllum trabeum ATCC 11539
gb|KIY51600.1|  ribosomal protein S3Ae                                  285   6e-93    Fistulina hepatica ATCC 64428
ref|XP_003638197.1|  40S ribosomal protein S3a                          281   7e-93    
gb|KIK48635.1|  hypothetical protein CY34DRAFT_797777                   285   9e-93    Suillus luteus UH-Slu-Lm8-n1
gb|ABI52667.1|  40S ribosomal protein S3a                               285   1e-92    Argas monolakensis
gb|EMD41078.1|  hypothetical protein CERSUDRAFT_80722                   284   1e-92    Gelatoporia subvermispora B
ref|XP_008671813.1|  PREDICTED: 40S ribosomal protein S3a-like          283   1e-92    Zea mays [maize]
ref|XP_007268611.1|  40S ribosomal protein S1                           283   3e-92    Fomitiporia mediterranea MF3/22
ref|XP_007315533.1|  hypothetical protein SERLADRAFT_382295             283   4e-92    Serpula lacrymans var. lacrymans S7.9
ref|XP_007843081.1|  40s ribosomal protein s3ae                         283   5e-92    
ref|XP_007382215.1|  S-phase-specific ribosomal protein cyc07           283   5e-92    Punctularia strigosozonata HHB-11173 SS5
ref|XP_007767741.1|  ribosomal protein S3Ae                             283   6e-92    Coniophora puteana RWD-64-598 SS2
gb|KIM46265.1|  hypothetical protein M413DRAFT_441346                   282   8e-92    Hebeloma cylindrosporum h7
gb|ABW23199.1|  ribosomal protein rps3a                                 283   8e-92    Eurythoe complanata
gb|KJB28384.1|  hypothetical protein B456_005G045000                    281   1e-91    Gossypium raimondii
gb|KIJ70171.1|  hypothetical protein HYDPIDRAFT_104846                  282   1e-91    Hydnomerulius pinastri MD-312
sp|B0CY45.2|RS3A_LACBS  RecName: Full=40S ribosomal protein S1          282   1e-91    Laccaria bicolor S238N-H82
gb|KIK30608.1|  hypothetical protein PISMIDRAFT_670675                  281   2e-91    Pisolithus microcarpus 441
gb|KIM33406.1|  hypothetical protein M408DRAFT_153936                   281   2e-91    Serendipita vermifera MAFF 305830
gb|KDD76342.1|  ribosomal protein S3Ae                                  281   2e-91    Helicosporidium sp. ATCC 50920
ref|XP_002428136.1|  40S ribosomal protein S3A, putative                281   2e-91    Pediculus humanus corporis [human body lice]
sp|Q764D2.1|RS3A_LENED  RecName: Full=40S ribosomal protein S1; A...    281   2e-91    Lentinula edodes
gb|EXX58553.1|  ribosomal 40S subunit protein S1A                       281   3e-91    Rhizophagus irregularis DAOM 197198w
ref|XP_007392195.1|  hypothetical protein PHACADRAFT_250267             281   3e-91    Phanerochaete carnosa HHB-10118-sp
gb|KIJ20179.1|  hypothetical protein PAXINDRAFT_166304                  281   3e-91    Paxillus involutus ATCC 200175
gb|KIK65348.1|  hypothetical protein GYMLUDRAFT_38796                   281   3e-91    Gymnopus luxurians FD-317 M1
gb|AFU72288.1|  40S ribosomal protein S1                                280   3e-91    Amanita strobiliformis
gb|KIM68608.1|  hypothetical protein SCLCIDRAFT_1208801                 281   3e-91    Scleroderma citrinum Foug A
gb|KIK06774.1|  hypothetical protein K443DRAFT_674057                   281   4e-91    Laccaria amethystina LaAM-08-1
gb|KJA29982.1|  hypothetical protein HYPSUDRAFT_81601                   281   4e-91    Hypholoma sublateritium FD-334 SS-4
gb|KIY73683.1|  putative S-phase-specific ribosomal protein cyc07       280   5e-91    Cylindrobasidium torrendii FP15055 ss-10
ref|XP_001877091.1|  40S ribosomal protein S1                           281   5e-91    Laccaria bicolor S238N-H82
gb|KIM90711.1|  hypothetical protein PILCRDRAFT_811171                  280   5e-91    Piloderma croceum F 1598
ref|XP_001837102.1|  40S ribosomal protein S1                           280   7e-91    Coprinopsis cinerea okayama7#130
gb|EPS95373.1|  hypothetical protein FOMPIDRAFT_157719                  280   7e-91    Fomitopsis pinicola FP-58527 SS1
gb|KCW84167.1|  hypothetical protein EUGRSUZ_B01030                     279   8e-91    Eucalyptus grandis [rose gum]
gb|KDQ64848.1|  hypothetical protein JAAARDRAFT_28494                   280   8e-91    Jaapia argillacea MUCL 33604
emb|CCM04869.1|  predicted protein                                      280   1e-90    Fibroporia radiculosa
ref|XP_002475466.1|  40S ribosomal protein S3A                          280   1e-90    
ref|XP_005710608.1|  40S ribosomal protein S3A                          280   1e-90    Chondrus crispus [carageen]
emb|CDO74072.1|  hypothetical protein BN946_scf185043.g122              279   1e-90    Trametes cinnabarina
gb|KDQ14611.1|  hypothetical protein BOTBODRAFT_65919                   279   1e-90    Botryobasidium botryosum FD-172 SS1
gb|KIP10648.1|  hypothetical protein PHLGIDRAFT_84595                   279   2e-90    Phlebiopsis gigantea 11061_1 CR5-6
gb|KII94785.1|  hypothetical protein PLICRDRAFT_33595                   279   2e-90    Plicaturopsis crispa FD-325 SS-3
gb|KHG08611.1|  40S ribosomal S3a                                       275   2e-90    Gossypium arboreum [tree cotton]
ref|XP_008035602.1|  40S ribosomal protein S1                           278   5e-90    Trametes versicolor FP-101664 SS1
ref|XP_007302916.1|  S-phase-specific ribosomal protein cyc07           277   8e-90    Stereum hirsutum FP-91666 SS1
emb|CCA67212.1|  probable ribosomal protein 10, cytosolic               277   9e-90    Serendipita indica DSM 11827
ref|XP_008619762.1|  40S ribosomal protein S3a-2                        277   1e-89    Saprolegnia diclina VS20
ref|XP_002598366.1|  hypothetical protein BRAFLDRAFT_69722              277   1e-89    Branchiostoma floridae
gb|KIO12878.1|  hypothetical protein M404DRAFT_699665                   276   1e-89    Pisolithus tinctorius Marx 270
gb|KDO28449.1|  40S ribosomal protein S3a-2                             276   2e-89    Saprolegnia parasitica CBS 223.65
ref|XP_007329524.1|  hypothetical protein AGABI1DRAFT_106559            276   2e-89    Agaricus bisporus var. burnettii JB137-S8
ref|XP_006460029.1|  hypothetical protein AGABI2DRAFT_191800            276   2e-89    Agaricus bisporus var. bisporus H97
gb|KDR83823.1|  hypothetical protein GALMADRAFT_676836                  276   2e-89    Galerina marginata CBS 339.88
ref|XP_009040503.1|  hypothetical protein AURANDRAFT_38843              276   3e-89    Aureococcus anophagefferens
ref|XP_010773841.1|  PREDICTED: 40S ribosomal protein S3a               276   4e-89    Notothenia coriiceps [yellowbelly rockcod]
ref|XP_007338149.1|  40S ribosomal protein S1                           275   5e-89    
sp|Q5G5C4.1|RS3A_PERAM  RecName: Full=40S ribosomal protein S3a         275   8e-89    Periplaneta americana
gb|KDN43521.1|  40S ribosomal protein S1                                275   9e-89    Rhizoctonia solani AG-8 WAC10335
gb|EDM00797.1|  rCG62728, isoform CRA_b                                 274   1e-88    Rattus norvegicus [brown rat]
gb|AAT81418.1|  ribosomal protein S3a                                   273   1e-88    Felis catus [cat]
ref|XP_005707378.1|  40S ribosomal protein S3A isoform 2                274   1e-88    Galdieria sulphuraria
sp|Q4PM31.1|RS3A_IXOSC  RecName: Full=40S ribosomal protein S3a         275   2e-88    Ixodes scapularis [blacklegged tick]
ref|XP_007364341.1|  40S ribosomal protein S1                           274   2e-88    
ref|XP_009994185.1|  PREDICTED: 40S ribosomal protein S3a               273   2e-88    
gb|EIT72263.1|  40S ribosomal protein S3A                               273   2e-88    
gb|AGM32131.1|  40S ribosomal protein S3a                               274   2e-88    
ref|NP_001134789.1|  40S ribosomal protein S3a                          274   2e-88    
gb|ABY28374.1|  ribosomal protein S3a                                   274   2e-88    
gb|KDR16079.1|  40S ribosomal protein S3a                               274   2e-88    
ref|XP_001817129.1|  40S ribosomal protein S1                           274   2e-88    
ref|XP_009935259.1|  PREDICTED: 40S ribosomal protein S3a               272   2e-88    
ref|XP_009472997.1|  PREDICTED: 40S ribosomal protein S3a               272   2e-88    
gb|ELW69964.1|  40S ribosomal protein S3a                               274   2e-88    
gb|KIJ56726.1|  hypothetical protein M422DRAFT_72882                    273   3e-88    
ref|XP_001276080.1|  40S ribosomal protein S1                           273   3e-88    
dbj|BAF83764.1|  unnamed protein product                                273   3e-88    
ref|XP_008047613.1|  PREDICTED: 40S ribosomal protein S3a               273   3e-88    
gb|KDQ29255.1|  hypothetical protein PLEOSDRAFT_1089059                 273   3e-88    
gb|EDL15382.1|  mCG1128, isoform CRA_a                                  272   3e-88    
gb|KFP00832.1|  40S ribosomal protein S3a                               273   4e-88    
ref|XP_754085.1|  40S ribosomal protein S3Ae                            273   4e-88    
emb|CCO27311.1|  40S ribosomal protein S1 AltName: Full=Protein c...    273   4e-88    
gb|EAW77577.1|  hCG33299, isoform CRA_a                                 273   4e-88    
ref|XP_004655919.1|  PREDICTED: 40S ribosomal protein S3a               273   4e-88    
ref|XP_008492080.1|  PREDICTED: 40S ribosomal protein S3a               273   4e-88    
ref|XP_009544052.1|  hypothetical protein HETIRDRAFT_458158             273   5e-88    
ref|XP_009896517.1|  PREDICTED: 40S ribosomal protein S3a               273   5e-88    
gb|AAT76631.1|  ribosomal protein S3a                                   272   5e-88    
sp|A2R9S1.1|RS3A_ASPNC  RecName: Full=40S ribosomal protein S1          273   5e-88    
ref|XP_001218106.1|  40S ribosomal protein S1                           273   6e-88    
ref|XP_009687533.1|  PREDICTED: 40S ribosomal protein S3a               271   6e-88    
gb|EFB26537.1|  hypothetical protein PANDA_001716                       272   6e-88    
ref|XP_006735747.1|  PREDICTED: 40S ribosomal protein S3a-like is...    272   6e-88    
gb|EUC65367.1|  40s ribosomal protein s3ae                              272   6e-88    
ref|XP_001366653.1|  PREDICTED: 40S ribosomal protein S3a               273   7e-88    
ref|XP_009075160.1|  PREDICTED: 40S ribosomal protein S3a               272   7e-88    
gb|KFO84143.1|  40S ribosomal protein S3a                               272   7e-88    
ref|NP_001291168.1|  ribosomal protein S3A                              273   7e-88    
ref|NP_058849.1|  40S ribosomal protein S3a                             273   7e-88    
sp|Q6EV04.1|RS3A_BIPLU  RecName: Full=40S ribosomal protein S3a         273   7e-88    
gb|KFW97162.1|  40S ribosomal protein S3a                               272   8e-88    
ref|XP_003473456.1|  PREDICTED: 40S ribosomal protein S3a-like          272   8e-88    
dbj|BAE88391.1|  unnamed protein product                                272   8e-88    
gb|EMC77645.1|  40S ribosomal protein S3a                               271   8e-88    
ref|XP_004017251.1|  PREDICTED: 40S ribosomal protein S3a               272   8e-88    
gb|KFR12636.1|  40S ribosomal protein S3a                               271   8e-88    
gb|KFM10230.1|  40S ribosomal protein S3a                               271   8e-88    
ref|XP_010707850.1|  PREDICTED: 40S ribosomal protein S3a isoform X2    271   8e-88    
ref|XP_010203978.1|  PREDICTED: 40S ribosomal protein S3a               271   9e-88    
ref|XP_006174472.1|  PREDICTED: 40S ribosomal protein S3a               272   1e-87    
ref|XP_008933878.1|  PREDICTED: 40S ribosomal protein S3a               271   1e-87    
gb|AAA35682.1|  ribosmal protein small subunit                          272   1e-87    
ref|XP_009977023.1|  PREDICTED: 40S ribosomal protein S3a               271   1e-87    
ref|XP_004323125.1|  PREDICTED: 40S ribosomal protein S3a-like          272   1e-87    
sp|P61246.1|RS3A_FELCA  RecName: Full=40S ribosomal protein S3a         272   1e-87    
ref|XP_006884543.1|  PREDICTED: 40S ribosomal protein S3a-like          272   1e-87    
gb|KFP91786.1|  40S ribosomal protein S3a                               271   1e-87    
ref|XP_011421732.1|  PREDICTED: 40S ribosomal protein S3a-like          272   1e-87    
ref|XP_010016125.1|  PREDICTED: 40S ribosomal protein S3a               272   1e-87    
ref|XP_003923833.1|  PREDICTED: 40S ribosomal protein S3a               272   1e-87    
ref|XP_006040183.1|  PREDICTED: 40S ribosomal protein S3a-like          272   1e-87    
ref|XP_010311392.1|  PREDICTED: 40S ribosomal protein S3a               271   1e-87    
ref|XP_005415772.1|  PREDICTED: 40S ribosomal protein S3a               271   1e-87    
gb|AAH66926.1|  Ribosomal protein S3A                                   272   1e-87    
gb|KIL70132.1|  hypothetical protein M378DRAFT_605469                   271   1e-87    
ref|XP_008633930.1|  PREDICTED: 40S ribosomal protein S3a               272   1e-87    
ref|XP_005149010.1|  PREDICTED: 40S ribosomal protein S3a isoform X1    272   1e-87    
ref|XP_001514859.1|  PREDICTED: 40S ribosomal protein S3a               272   1e-87    
ref|NP_000997.1|  40S ribosomal protein S3a isoform 1                   272   1e-87    
ref|XP_004055608.1|  PREDICTED: 40S ribosomal protein S3a-like          272   1e-87    
gb|KFH70745.1|  40S ribosomal protein S1                                271   1e-87    
ref|XP_003221796.1|  PREDICTED: 40S ribosomal protein S3a               272   1e-87    
ref|XP_009873775.1|  PREDICTED: 40S ribosomal protein S3a               271   1e-87    
ref|XP_003797009.1|  PREDICTED: 40S ribosomal protein S3a-like is...    272   1e-87    
ref|XP_005809444.1|  PREDICTED: 40S ribosomal protein S3a-like          272   1e-87    
dbj|BAE87927.1|  unnamed protein product                                272   2e-87    
ref|XP_009969079.1|  PREDICTED: 40S ribosomal protein S3a               271   2e-87    
ref|NP_001008075.1|  40S ribosomal protein S3a                          271   2e-87    
ref|XP_009281624.1|  PREDICTED: 40S ribosomal protein S3a               271   2e-87    
ref|NP_001185510.1|  40S ribosomal protein S3a                          271   2e-87    
ref|XP_005045047.1|  PREDICTED: 40S ribosomal protein S3a               271   2e-87    
ref|XP_009099772.1|  PREDICTED: 40S ribosomal protein S3a               271   2e-87    
ref|XP_004411050.1|  PREDICTED: 40S ribosomal protein S3a-like          272   2e-87    
sp|Q6DV02.3|RS3A_GECJA  RecName: Full=40S ribosomal protein S3a         271   2e-87    
ref|XP_006693334.1|  hypothetical protein CTHT_0028780                  271   2e-87    
ref|XP_008285008.1|  PREDICTED: 40S ribosomal protein S3a               271   2e-87    
sp|A2Q0R8.1|RS3A_SOLSE  RecName: Full=40S ribosomal protein S3a         271   2e-87    
ref|XP_008931489.1|  PREDICTED: 40S ribosomal protein S3a               271   2e-87    
ref|XP_011421723.1|  PREDICTED: 40S ribosomal protein S3a-like          271   2e-87    
ref|XP_005436755.1|  PREDICTED: 40S ribosomal protein S3a               271   2e-87    
gb|EOB04964.1|  40S ribosomal protein S3a                               271   2e-87    
gb|KJB28383.1|  hypothetical protein B456_005G045000                    270   2e-87    
gb|EKC30815.1|  40S ribosomal protein S3a                               273   2e-87    
gb|ACQ58827.1|  40S ribosomal protein S3a                               271   2e-87    
ref|XP_006779434.1|  PREDICTED: LOW QUALITY PROTEIN: ribosomal pr...    271   2e-87    
ref|NP_058655.3|  40S ribosomal protein S3a                             271   2e-87    
ref|XP_007437219.1|  PREDICTED: 40S ribosomal protein S3a-like          271   2e-87    
ref|XP_007927383.1|  hypothetical protein MYCFIDRAFT_87079              271   2e-87    
dbj|BAE32029.1|  unnamed protein product                                271   2e-87    
ref|XP_006985395.1|  PREDICTED: 40S ribosomal protein S3a-like          271   2e-87    
ref|XP_003797010.1|  PREDICTED: 40S ribosomal protein S3a-like is...    271   3e-87    
ref|XP_008872125.1|  hypothetical protein H310_08228                    271   3e-87    
ref|XP_003972468.1|  PREDICTED: 40S ribosomal protein S3a-like is...    270   3e-87    
dbj|BAE30393.1|  unnamed protein product                                271   3e-87    
ref|XP_009520284.1|  hypothetical protein PHYSODRAFT_285013             271   3e-87    
ref|XP_005014766.1|  PREDICTED: 40S ribosomal protein S3a               270   3e-87    
ref|XP_007230303.1|  PREDICTED: 40S ribosomal protein S3a               271   3e-87    
ref|XP_009509149.1|  PREDICTED: 40S ribosomal protein S3a               271   3e-87    
ref|NP_001080325.1|  40S ribosomal protein S3a-A                        271   4e-87    
ref|XP_003417586.1|  PREDICTED: 40S ribosomal protein S3a               271   4e-87    
sp|O43999.3|RS3A_EIMTE  RecName: Full=40S ribosomal protein S3a; ...    271   4e-87    
ref|XP_002901276.1|  40S ribosomal protein S3a                          270   4e-87    
ref|NP_001104210.1|  40S ribosomal protein S3a-B                        271   4e-87    
gb|ETE70827.1|  40S ribosomal protein S3a                               271   4e-87    
ref|XP_005330207.1|  PREDICTED: 40S ribosomal protein S3a-like          271   4e-87    
ref|XP_008900376.1|  40S ribosomal protein S3a                          270   4e-87    
ref|NP_001075886.1|  ribosomal protein S3A                              270   5e-87    
gb|ABS44871.1|  ribosomal protein S3Ae                                  270   5e-87    
ref|XP_009827334.1|  hypothetical protein H257_04494                    270   5e-87    
emb|CAD91420.1|  ribosomal protein S3a                                  270   5e-87    
ref|XP_001931333.1|  40S ribosomal protein S1                           270   5e-87    
dbj|BAB22611.1|  unnamed protein product                                270   5e-87    
ref|XP_005307414.1|  PREDICTED: 40S ribosomal protein S3a               270   5e-87    
ref|XP_009480002.1|  PREDICTED: 40S ribosomal protein S3a               270   5e-87    
ref|XP_001601315.1|  PREDICTED: 40S ribosomal protein S3a               270   6e-87    
ref|NP_001279332.1|  ribosomal protein S3A                              270   6e-87    
gb|AFM90263.1|  40S ribosomal protein S3a                               270   6e-87    
ref|XP_003205487.1|  PREDICTED: 40S ribosomal protein S3a isoform X1    270   6e-87    
ref|XP_007902210.1|  PREDICTED: 40S ribosomal protein S3a               270   6e-87    
ref|XP_007469965.1|  PREDICTED: 40S ribosomal protein S3a               270   6e-87    
ref|XP_008314924.1|  PREDICTED: 40S ribosomal protein S3a               270   7e-87    
ref|XP_008852472.1|  PREDICTED: 40S ribosomal protein S3a               270   7e-87    
ref|XP_006629554.1|  PREDICTED: 40S ribosomal protein S3a-like          270   7e-87    
ref|XP_005500910.1|  PREDICTED: 40S ribosomal protein S3a               270   7e-87    
gb|EAX04989.1|  ribosomal protein S3A, isoform CRA_b                    269   7e-87    
ref|XP_003267670.1|  PREDICTED: 40S ribosomal protein S3a-like          270   8e-87    
ref|NP_001270826.1|  40S ribosomal protein S3a                          270   8e-87    
ref|XP_005692628.1|  PREDICTED: 40S ribosomal protein S3a-like          270   8e-87    
ref|NP_956353.1|  40S ribosomal protein S3a                             270   9e-87    
ref|XP_006262711.1|  PREDICTED: 40S ribosomal protein S3a               270   9e-87    
gb|ELW50426.1|  40S ribosomal protein S3a                               271   9e-87    
ref|XP_005955989.1|  PREDICTED: 40S ribosomal protein S3a-like is...    270   9e-87    
gb|KIV90937.1|  40S ribosomal protein S1                                270   9e-87    
ref|XP_010410434.1|  PREDICTED: 40S ribosomal protein S3a               270   1e-86    
ref|XP_007686274.1|  hypothetical protein COCMIDRAFT_90741              269   1e-86    
ref|XP_004337280.1|  40S ribosomal protein S3a, putative                269   1e-86    
ref|XP_003740510.1|  PREDICTED: 40S ribosomal protein S3a-like          269   1e-86    
ref|XP_005538843.1|  40S ribosomal protein S3A                          270   1e-86    
dbj|BAE27060.1|  unnamed protein product                                269   2e-86    
gb|AEM37761.1|  V-Fos transformation effector-like protein              267   2e-86    
ref|XP_010559325.1|  PREDICTED: 40S ribosomal protein S3a               271   2e-86    
ref|XP_003972467.1|  PREDICTED: 40S ribosomal protein S3a-like is...    269   2e-86    
ref|XP_001501524.2|  PREDICTED: 40S ribosomal protein S3a               273   2e-86    
dbj|BAF75056.1|  40S ribosome protein                                   267   2e-86    
gb|ACL53942.1|  unknown                                                 265   2e-86    
tpg|DAA12651.1|  TPA: ribosomal protein S3a-like                        269   2e-86    
ref|XP_003945196.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...    269   2e-86    
ref|XP_005542823.1|  PREDICTED: 40S ribosomal protein S3a-like          269   2e-86    
gb|AFM88910.1|  40S ribosomal protein S3a                               269   2e-86    
ref|XP_007696626.1|  hypothetical protein COCSADRAFT_34493              268   3e-86    
gb|EME43162.1|  hypothetical protein DOTSEDRAFT_72517                   268   3e-86    
gb|AFM85626.1|  40S ribosomal protein S3a                               268   3e-86    
gb|KEQ76235.1|  ribosomal protein S3Ae                                  268   3e-86    
ref|XP_005871471.1|  PREDICTED: 40S ribosomal protein S3a               272   3e-86    
ref|XP_007707649.1|  hypothetical protein COCCADRAFT_83997              268   3e-86    
gb|EMD91948.1|  hypothetical protein COCHEDRAFT_1173335                 268   3e-86    
ref|XP_682139.1|  hypothetical protein AN8870.2                         268   3e-86    
gb|EPS27387.1|  hypothetical protein PDE_02330                          268   4e-86    
ref|XP_008023145.1|  hypothetical protein SETTUDRAFT_176044             268   4e-86    
ref|XP_005996413.1|  PREDICTED: 40S ribosomal protein S3a               268   4e-86    
gb|KEQ61803.1|  ribosomal protein S3Ae                                  268   4e-86    
sp|Q98TX2.3|RS3A_OPHHA  RecName: Full=40S ribosomal protein S3a         268   4e-86    
ref|XP_002482424.1|  40S ribosomal protein S1                           268   4e-86    
ref|XP_005954137.1|  PREDICTED: 40S ribosomal protein S3a-like is...    268   5e-86    
gb|ACD61705.1|  ribosomal protein S3                                    268   5e-86    
ref|XP_009328112.1|  PREDICTED: 40S ribosomal protein S3a               270   5e-86    
dbj|GAM40150.1|  ribosomal protein 10 of the small 40S subunit          268   5e-86    
ref|XP_003773191.1|  PREDICTED: 40S ribosomal protein S3a               274   5e-86    
emb|CBJ29379.1|  conserved unknown protein                              268   5e-86    
sp|Q4T8S6.3|RS3A_TETNG  RecName: Full=40S ribosomal protein S3a         268   6e-86    
gb|ADO29317.1|  40S ribosomal protein s3a                               268   6e-86    
emb|CDR40922.1|  RHTO0S05e08922g1_1                                     267   6e-86    
gb|KGO73156.1|  Ribosomal protein S3Ae                                  267   6e-86    
gb|EYE99542.1|  40S ribosomal protein S3aE                              267   6e-86    
ref|XP_002562607.1|  Pc20g00440                                         267   6e-86    
ref|XP_004349214.1|  ribosomal protein S3a                              268   7e-86    
ref|NP_001098311.1|  40S ribosomal protein S3a                          268   7e-86    
ref|XP_007874563.1|  hypothetical protein PNEG_02550                    267   7e-86    
ref|XP_006879080.1|  PREDICTED: 40S ribosomal protein S3a-like          267   7e-86    
gb|EKV05302.1|  40S ribosomal protein S1                                267   8e-86    
ref|XP_003449725.1|  PREDICTED: 40S ribosomal protein S3a-like          267   8e-86    
ref|XP_002148168.1|  40S ribosomal protein S1                           267   8e-86    
ref|XP_010727857.1|  PREDICTED: 40S ribosomal protein S3a isoform X1    267   9e-86    
ref|XP_007291650.1|  40S ribosomal protein S3                           267   9e-86    
ref|XP_001099771.1|  PREDICTED: 40S ribosomal protein S3a-like          267   1e-85    
ref|XP_007528141.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...    267   1e-85    
ref|XP_003850287.1|  40S ribosomal protein S1                           266   1e-85    
gb|KDE09348.1|  40S ribosomal protein S1                                267   1e-85    
gb|AAT44427.1|  V-Fos transformation effector-like protein              266   1e-85    
ref|XP_006958032.1|  40S ribosomal protein S1                           266   1e-85    
ref|XP_004045861.1|  PREDICTED: 40S ribosomal protein S3a-like is...    266   1e-85    
ref|XP_005954900.1|  PREDICTED: 40S ribosomal protein S3a-like          266   2e-85    
ref|XP_005967889.1|  PREDICTED: 40S ribosomal protein S3a-like          266   2e-85    
pdb|4KZX|B  Chain B, Rabbit 40s Ribosomal Subunit In Complex With...    266   2e-85    
gb|EMF12040.1|  40S ribosomal protein S3aE-A                            266   2e-85    
ref|XP_009024124.1|  hypothetical protein HELRODRAFT_185887             266   2e-85    
dbj|GAD95806.1|  40S ribosomal protein S1                               266   2e-85    
gb|AFM88988.1|  ribosomal protein S3a                                   266   2e-85    
emb|CDM28082.1|  40S ribosomal protein S1                               266   2e-85    
ref|XP_003883511.1|  hypothetical protein NCLIV_032660                  266   2e-85    
gb|EHH24109.1|  hypothetical protein EGK_07706                          265   3e-85    
ref|NP_001131091.1|  40S ribosomal protein S3a                          266   3e-85    
gb|AEE62515.1|  unknown                                                 266   3e-85    
gb|EJT50838.1|  40s ribosomal protein s3ae-a (s1-a)                     266   3e-85    
ref|XP_007635341.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...    266   4e-85    
ref|XP_005971156.1|  PREDICTED: 40S ribosomal protein S3a-like          266   4e-85    
ref|XP_008717456.1|  40S ribosomal protein S1                           265   4e-85    
gb|KIM94998.1|  hypothetical protein OIDMADRAFT_21260                   265   4e-85    
emb|CDP25519.1|  Putative cytosolic 40S ribosomal protein Rps3a         265   4e-85    
ref|XP_008079199.1|  40S ribosomal protein S3                           265   4e-85    
ref|XP_008588996.1|  PREDICTED: 40S ribosomal protein S3a-like          267   4e-85    
ref|XP_007800525.1|  40S ribosomal protein S1                           265   5e-85    
gb|AGQ03805.1|  ribosomal protein S3A                                   265   5e-85    



>emb|CDO99096.1| unnamed protein product [Coffea canephora]
Length=260

 Score =   406 bits (1043),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 194/211 (92%), Positives = 205/211 (97%), Gaps = 1/211 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQ DE++AFRKIRLRAEDVQG+NVLTNFWGMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQGDEEHAFRKIRLRAEDVQGKNVLTNFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQSLIEAHVDVKTTDNY+LR+FCIGFTKKR+NQQKRTCYAQSSQIRQIRRKMRE
Sbjct  111  RSLVRKWQSLIEAHVDVKTTDNYSLRLFCIGFTKKRLNQQKRTCYAQSSQIRQIRRKMRE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IMVNQAQSCDLKDLVLKFIPE IGREIEKATSSIYPLQNVFIRK KILKAPKFDLGKLME
Sbjct  171  IMVNQAQSCDLKDLVLKFIPELIGREIEKATSSIYPLQNVFIRKAKILKAPKFDLGKLME  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEATEPVGA  64
            VHGDY+EDVG K+DRP A+EP+AEATE VGA
Sbjct  231  VHGDYSEDVGVKVDRP-AEEPVAEATEVVGA  260



>ref|XP_011090682.1| PREDICTED: 40S ribosomal protein S3a [Sesamum indicum]
Length=260

 Score =   405 bits (1042),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 196/211 (93%), Positives = 203/211 (96%), Gaps = 1/211 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQ DED+AFRKIRLRAEDVQG+NVLTNFWGMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQGDEDHAFRKIRLRAEDVQGKNVLTNFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQSLIEAHVDVKTTDNYTLRMFCI FTKKRVNQQKRTCYAQSSQIRQIRRKMRE
Sbjct  111  RSLVRKWQSLIEAHVDVKTTDNYTLRMFCIAFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IMVNQAQSCDLKDLV KFIPESIG+EIEKATSSIYPLQNVFIRKVKILKAPKFDLG+LME
Sbjct  171  IMVNQAQSCDLKDLVQKFIPESIGKEIEKATSSIYPLQNVFIRKVKILKAPKFDLGRLME  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEATEPVGA  64
            VHGDY+EDVG KLDRP A+EP AE TE VGA
Sbjct  231  VHGDYSEDVGVKLDRP-AEEPAAEPTEVVGA  260



>ref|NP_001275164.1| 40S ribosomal protein S3a-like protein [Solanum tuberosum]
 gb|ABB72801.1| 40S ribosomal protein S3a-like protein [Solanum tuberosum]
Length=260

 Score =   398 bits (1023),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 195/211 (92%), Positives = 201/211 (95%), Gaps = 1/211 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQNDED++FRKIRLRAEDVQGRNVLTNF GMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQNDEDHSFRKIRLRAEDVQGRNVLTNFHGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLVKKWQSLIEAHVDVKTTD+YTLRMFCIGFTKKR NQQKRTCYAQSSQIRQIRRKMRE
Sbjct  111  RSLVKKWQSLIEAHVDVKTTDSYTLRMFCIGFTKKRPNQQKRTCYAQSSQIRQIRRKMRE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLG+LME
Sbjct  171  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGRLME  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEATEPVGA  64
            VHGDY+EDVG K+DRPA D    E TE VGA
Sbjct  231  VHGDYSEDVGVKVDRPAEDVA-TEPTEVVGA  260



>sp|P33444.4|RS3A_CATRO RecName: Full=40S ribosomal protein S3a; AltName: Full=CYC07 
protein [Catharanthus roseus]
Length=261

 Score =   397 bits (1019),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 191/212 (90%), Positives = 203/212 (96%), Gaps = 2/212 (1%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGL+HRVFE+SLADLQ DED++FRKIRLRAED+QG+NVLTNFWGMDFTTDKL
Sbjct  51   TQGTKIASEGLEHRVFEISLADLQGDEDHSFRKIRLRAEDIQGKNVLTNFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQSLIEAHVDVKTTD+YTLRMFCIGFTKKR NQQKRTCYAQSSQIRQIRRKMRE
Sbjct  111  RSLVRKWQSLIEAHVDVKTTDSYTLRMFCIGFTKKRANQQKRTCYAQSSQIRQIRRKMRE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IMVNQAQSCDLKDLV KFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  171  IMVNQAQSCDLKDLVQKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYTE-DVGTKLDRPAADEPIAEATEPVGA  64
            VHGDY E D+GTKLDRP A+E +AE TE +GA
Sbjct  231  VHGDYNEDDIGTKLDRP-AEEAVAEPTEVIGA  261



>ref|XP_004247589.1| PREDICTED: 40S ribosomal protein S3a [Solanum lycopersicum]
Length=260

 Score =   396 bits (1018),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 196/212 (92%), Positives = 202/212 (95%), Gaps = 3/212 (1%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQNDED++FRKIRLRAEDVQGRNVLTNF GMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQNDEDHSFRKIRLRAEDVQGRNVLTNFHGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLVKKWQSLIEAHVDVKTTD+YTLRMFCIGFTKKR NQQKRTCYAQSSQIRQIRRKMRE
Sbjct  111  RSLVKKWQSLIEAHVDVKTTDSYTLRMFCIGFTKKRPNQQKRTCYAQSSQIRQIRRKMRE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IMVNQAQSCDLKDL LKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLG+LME
Sbjct  171  IMVNQAQSCDLKDLALKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGRLME  230

Query  156  VHGDYTEDVGTKLDRPAADEPIA-EATEPVGA  64
            VHGDY+EDVG K+DRPA D  IA E TE VGA
Sbjct  231  VHGDYSEDVGVKVDRPAED--IATEPTEVVGA  260



>gb|AFK33413.1| unknown [Lotus japonicus]
Length=261

 Score =   391 bits (1005),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 187/211 (89%), Positives = 198/211 (94%), Gaps = 0/211 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQ DEDNAFRKIRLRAEDVQG+NVLTNFWGMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQGDEDNAFRKIRLRAEDVQGKNVLTNFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTDNYTLRMFCI FTK+R NQ KRTCYAQSSQIRQIRRKMRE
Sbjct  111  RSLVRKWQTLIEAHVDVKTTDNYTLRMFCIAFTKRRSNQVKRTCYAQSSQIRQIRRKMRE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM+NQA SCDLK+LV KFIPE IG+EIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  171  IMINQATSCDLKELVRKFIPEMIGKEIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEATEPVGA  64
            VHGDY+EDVGTK+DRPA +  +  ATE VGA
Sbjct  231  VHGDYSEDVGTKVDRPADETVVEGATEVVGA  261



>ref|XP_002283142.1| PREDICTED: 40S ribosomal protein S3a-1 [Vitis vinifera]
 sp|A5B4K1.1|RS3A1_VITVI RecName: Full=40S ribosomal protein S3a-1 [Vitis vinifera]
 emb|CAN67522.1| hypothetical protein VITISV_020206 [Vitis vinifera]
 emb|CBI26295.3| unnamed protein product [Vitis vinifera]
Length=261

 Score =   391 bits (1004),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 188/212 (89%), Positives = 200/212 (94%), Gaps = 2/212 (1%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFE+SLADLQ DED A+RKIRLRAEDVQGRNVLTNFWGMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEISLADLQADEDQAYRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTDNYTLR+FCI FTKKRVNQ K+TCYAQSSQIRQIRRKMRE
Sbjct  111  RSLVRKWQTLIEAHVDVKTTDNYTLRLFCIAFTKKRVNQNKKTCYAQSSQIRQIRRKMRE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM N A SCDLK+LV KFIPESIGREIEKATSSIYPLQNV+IRKVKILKAPKFDLGKLME
Sbjct  171  IMTNMATSCDLKELVKKFIPESIGREIEKATSSIYPLQNVYIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEA-TEPVGA  64
            VHGDY+EDVGTKL+RP ADEP+AE  TE +GA
Sbjct  231  VHGDYSEDVGTKLERP-ADEPVAEGVTEVIGA  261



>ref|XP_010034641.1| PREDICTED: 40S ribosomal protein S3a [Eucalyptus grandis]
Length=261

 Score =   390 bits (1002),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 188/212 (89%), Positives = 201/212 (95%), Gaps = 2/212 (1%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQ DED+A+RKIRLR+EDVQGRNVLTNFWGMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQGDEDHAYRKIRLRSEDVQGRNVLTNFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQSSQIRQIRRKMRE
Sbjct  111  RSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRPNQVKRTCYAQSSQIRQIRRKMRE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IMVNQA +CDLK+LV KFIPE IG+EIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  171  IMVNQATTCDLKELVRKFIPEMIGKEIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEA-TEPVGA  64
            VHGDY+ED+G KLDRP ADEP+AE  TE +GA
Sbjct  231  VHGDYSEDIGVKLDRP-ADEPVAEVPTEVIGA  261



>ref|XP_003610736.1| 40S ribosomal protein S3a-like protein [Medicago truncatula]
 gb|AES93694.1| 40S ribosomal protein S3a-1 [Medicago truncatula]
Length=261

 Score =   389 bits (999),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 189/212 (89%), Positives = 200/212 (94%), Gaps = 2/212 (1%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQ DEDNAFRKIRLRAEDVQG+N+LTNFWGMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQGDEDNAFRKIRLRAEDVQGKNLLTNFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQSSQIRQIRRKMRE
Sbjct  111  RSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRSNQVKRTCYAQSSQIRQIRRKMRE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM+NQA SCDLKDLV KFIPE IG+EIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  171  IMINQATSCDLKDLVRKFIPEMIGKEIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEAT-EPVGA  64
            VHGDY+EDVGTK++RP ADE + E T E VGA
Sbjct  231  VHGDYSEDVGTKVERP-ADETMVEGTPEIVGA  261



>ref|XP_010553319.1| PREDICTED: 40S ribosomal protein S3a-1-like [Tarenaya hassleriana]
Length=261

 Score =   389 bits (999),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 188/212 (89%), Positives = 199/212 (94%), Gaps = 2/212 (1%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLRAEDVQGRNVLTNFWGMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQGDEDNAYRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLVKKWQ+LIEAHVDVKTTDNYTLR+FCI FTK+R NQ KRTCYAQSSQIRQIRRKMRE
Sbjct  111  RSLVKKWQTLIEAHVDVKTTDNYTLRLFCIAFTKRRANQVKRTCYAQSSQIRQIRRKMRE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IMV +A SCDLKDLV KFIPE+IGREIEKAT SIYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  171  IMVKEASSCDLKDLVAKFIPEAIGREIEKATQSIYPLQNVFIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYTEDVGTKLDRPAADEPIA-EATEPVGA  64
            VHGDY+EDVG K++RP ADEP+A E TE +GA
Sbjct  231  VHGDYSEDVGVKVERP-ADEPMAEEPTEVIGA  261



>gb|KHN30486.1| 40S ribosomal protein S3a, partial [Glycine soja]
Length=242

 Score =   388 bits (997),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 185/211 (88%), Positives = 198/211 (94%), Gaps = 0/211 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQ DED+AF+KIRLRAEDVQG+NVLTNFWGMDFTTDKL
Sbjct  32   TQGTKIASEGLKHRVFEVSLADLQGDEDHAFKKIRLRAEDVQGKNVLTNFWGMDFTTDKL  91

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQSSQ+RQIRRKMRE
Sbjct  92   RSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRSNQVKRTCYAQSSQVRQIRRKMRE  151

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IMVNQA +CDLK+LV KFIPE IG+EIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  152  IMVNQAAACDLKELVRKFIPEMIGKEIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  211

Query  156  VHGDYTEDVGTKLDRPAADEPIAEATEPVGA  64
            VHGDY+EDVG K+DRPA +    EATE VGA
Sbjct  212  VHGDYSEDVGAKVDRPADETLAEEATEVVGA  242



>ref|XP_011073454.1| PREDICTED: 40S ribosomal protein S3a-like [Sesamum indicum]
Length=260

 Score =   389 bits (999),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 186/195 (95%), Positives = 191/195 (98%), Gaps = 0/195 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQ DED+AFRKIRLRAEDVQG+NVLTNFWGMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQGDEDHAFRKIRLRAEDVQGKNVLTNFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQSLIEAHVDVKTTDNYTLRMFCI FTKKRVNQQKRTCYAQSSQIRQIRRKMRE
Sbjct  111  RSLVRKWQSLIEAHVDVKTTDNYTLRMFCIAFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IMVNQAQSCDLKDLV KFIPESIG+EIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  171  IMVNQAQSCDLKDLVQKFIPESIGKEIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYTEDVGTKLDR  112
            VHGDY+EDVG KLDR
Sbjct  231  VHGDYSEDVGVKLDR  245



>gb|EPS71864.1| hypothetical protein M569_02887, partial [Genlisea aurea]
Length=266

 Score =   389 bits (999),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 188/211 (89%), Positives = 199/211 (94%), Gaps = 1/211 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQNDED++FRKIRLRAEDVQG++VLTNFWGMDFTTDKL
Sbjct  57   TQGTKIASEGLKHRVFEVSLADLQNDEDHSFRKIRLRAEDVQGKSVLTNFWGMDFTTDKL  116

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQSLIEAHVDVKTTDNYTLR+FCI FTKKR NQQKRTCYAQSSQIRQIRRKMRE
Sbjct  117  RSLVRKWQSLIEAHVDVKTTDNYTLRLFCIAFTKKRANQQKRTCYAQSSQIRQIRRKMRE  176

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM+NQAQS DLKDLV KFIPESIG+EIEKATS IYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  177  IMINQAQSSDLKDLVQKFIPESIGKEIEKATSGIYPLQNVFIRKVKILKAPKFDLGKLME  236

Query  156  VHGDYTEDVGTKLDRPAADEPIAEATEPVGA  64
            VHGDY+EDVGTKL+RP A+E  AE  E  GA
Sbjct  237  VHGDYSEDVGTKLERP-AEESTAEPVEVPGA  266



>ref|NP_001241005.1| uncharacterized protein LOC100805519 [Glycine max]
 gb|ACU23898.1| unknown [Glycine max]
Length=261

 Score =   389 bits (998),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 185/211 (88%), Positives = 198/211 (94%), Gaps = 0/211 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQ DED+AF+KIRLRAEDVQG+NVLTNFWGMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQGDEDHAFKKIRLRAEDVQGKNVLTNFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQSSQ+RQIRRKMRE
Sbjct  111  RSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRSNQVKRTCYAQSSQVRQIRRKMRE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IMVNQA +CDLK+LV KFIPE IG+EIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  171  IMVNQAAACDLKELVRKFIPEMIGKEIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEATEPVGA  64
            VHGDY+EDVG K+DRPA +    EATE VGA
Sbjct  231  VHGDYSEDVGAKVDRPADETLAEEATEVVGA  261



>ref|XP_010274385.1| PREDICTED: 40S ribosomal protein S3a-like [Nelumbo nucifera]
Length=261

 Score =   388 bits (997),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 183/211 (87%), Positives = 197/211 (93%), Gaps = 0/211 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEV LADLQND+D ++RKIRLRAEDVQGRNVLTNFWGMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVCLADLQNDDDQSYRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFT++R NQ KRTCYAQSSQIRQIRRKMRE
Sbjct  111  RSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTRRRPNQVKRTCYAQSSQIRQIRRKMRE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IMVNQA SCDLK+LV KFIPE IG+EIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  171  IMVNQATSCDLKELVQKFIPEVIGKEIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEATEPVGA  64
            VHGDY+ED+G K+DRPA D P+   TE +GA
Sbjct  231  VHGDYSEDIGVKVDRPAEDAPVEGETEVIGA  261



>ref|NP_001239858.1| uncharacterized protein LOC100808747 [Glycine max]
 gb|ACU23875.1| unknown [Glycine max]
 gb|KHN35171.1| 40S ribosomal protein S3a [Glycine soja]
Length=261

 Score =   388 bits (996),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 185/211 (88%), Positives = 198/211 (94%), Gaps = 0/211 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQ DED++F+KIRLRAEDVQG+NVLTNFWGMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQGDEDHSFKKIRLRAEDVQGKNVLTNFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQSSQIRQIRRKMRE
Sbjct  111  RSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRSNQVKRTCYAQSSQIRQIRRKMRE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IMVNQA +CDLK+LV KFIPE IG+EIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  171  IMVNQATACDLKELVRKFIPEMIGKEIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEATEPVGA  64
            VHGDY+EDVG K+DRPA +    EATE VGA
Sbjct  231  VHGDYSEDVGAKVDRPADETLAEEATEVVGA  261



>gb|AFS65104.1| 40S ribosomal protein S3a-like protein [Elaeis guineensis]
Length=261

 Score =   387 bits (995),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 185/211 (88%), Positives = 196/211 (93%), Gaps = 0/211 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFE+SLADLQNDED A+RKIRLRAEDVQG+NVLTNFWGMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEISLADLQNDEDQAYRKIRLRAEDVQGKNVLTNFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQ+SQIRQIRRKMRE
Sbjct  111  RSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRPNQVKRTCYAQTSQIRQIRRKMRE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IMVNQA SCDLKDLV KFIPE IG+EIEKAT+SIYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  171  IMVNQAASCDLKDLVQKFIPEVIGKEIEKATTSIYPLQNVFIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEATEPVGA  64
            VHGDY EDVG K+DRPA D P+    E VGA
Sbjct  231  VHGDYKEDVGVKIDRPADDVPMEGEPEVVGA  261



>ref|XP_010942777.1| PREDICTED: 40S ribosomal protein S3a [Elaeis guineensis]
Length=261

 Score =   387 bits (995),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 185/211 (88%), Positives = 196/211 (93%), Gaps = 0/211 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFE+SLADLQNDED A+RKIRLRAEDVQG+NVLTNFWGMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEISLADLQNDEDQAYRKIRLRAEDVQGKNVLTNFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQ+SQIRQIRRKMRE
Sbjct  111  RSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRPNQVKRTCYAQTSQIRQIRRKMRE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IMVNQA SCDLKDLV KFIPE IG+EIEKAT+SIYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  171  IMVNQATSCDLKDLVQKFIPEVIGKEIEKATTSIYPLQNVFIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEATEPVGA  64
            VHGDY EDVG K+DRPA D P+    E VGA
Sbjct  231  VHGDYKEDVGVKIDRPADDVPMEGEPEVVGA  261



>gb|KDP23643.1| hypothetical protein JCGZ_23476 [Jatropha curcas]
Length=263

 Score =   387 bits (995),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 189/213 (89%), Positives = 200/213 (94%), Gaps = 3/213 (1%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLRAEDVQGRNVLTNFWGMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQKDEDNAYRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTDNYTLR+FCI FTK+R NQ KRTCYAQSSQIRQIRRKMRE
Sbjct  111  RSLVRKWQTLIEAHVDVKTTDNYTLRLFCIAFTKRRANQVKRTCYAQSSQIRQIRRKMRE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM+NQA SCDLK+LV KFIPE IGREIEKATSSIYPLQNV+IRKVKILKAPKFDLGKLME
Sbjct  171  IMINQASSCDLKELVAKFIPEMIGREIEKATSSIYPLQNVYIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYT-EDVGTKLDRPAADEPIAEA-TEPVGA  64
            VHGDY+ +D+G KLDRP ADE IAEA TE VGA
Sbjct  231  VHGDYSADDIGVKLDRP-ADETIAEAETEVVGA  262



>ref|XP_004496691.1| PREDICTED: 40S ribosomal protein S3a-like [Cicer arietinum]
 ref|XP_004517272.1| PREDICTED: 40S ribosomal protein S3a-like [Cicer arietinum]
Length=261

 Score =   387 bits (994),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 187/212 (88%), Positives = 201/212 (95%), Gaps = 2/212 (1%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQ DE++AF+KIRLRAEDVQG+NVLTNFWGM+FTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQGDEEHAFKKIRLRAEDVQGKNVLTNFWGMNFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQSLIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQSSQIRQIRRKMRE
Sbjct  111  RSLVRKWQSLIEAHVDVKTTDNYTLRMFCIGFTKRRANQVKRTCYAQSSQIRQIRRKMRE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM+NQA SCDLK+LV KFIPE IG+EIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  171  IMINQATSCDLKELVRKFIPEMIGKEIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYTEDVGTKLDRPAADEPIA-EATEPVGA  64
            VHGDY++D+GTK+DRP ADE IA E TE VGA
Sbjct  231  VHGDYSDDIGTKVDRP-ADETIAEETTEVVGA  261



>ref|XP_010024230.1| PREDICTED: 40S ribosomal protein S3a-like [Eucalyptus grandis]
 gb|KCW60692.1| hypothetical protein EUGRSUZ_H03423 [Eucalyptus grandis]
Length=261

 Score =   387 bits (993),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 187/212 (88%), Positives = 200/212 (94%), Gaps = 2/212 (1%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFE SLADLQ DED+++RKIRLR EDVQGRNVLTNFWGM+FTTDKL
Sbjct  51   TQGTKIASEGLKHRVFETSLADLQGDEDHSYRKIRLRCEDVQGRNVLTNFWGMNFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQSSQIRQIRRKMRE
Sbjct  111  RSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRPNQVKRTCYAQSSQIRQIRRKMRE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IMVNQA SCDLK+LV KFIPESIG+EIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  171  IMVNQATSCDLKELVRKFIPESIGKEIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEA-TEPVGA  64
            VHGDY+ED+G KLDRP ADE +AEA TE +GA
Sbjct  231  VHGDYSEDIGVKLDRP-ADETVAEAPTEVIGA  261



>ref|XP_010938988.1| PREDICTED: 40S ribosomal protein S3a-like [Elaeis guineensis]
Length=261

 Score =   387 bits (993),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 186/211 (88%), Positives = 195/211 (92%), Gaps = 0/211 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFE+SLADLQNDED A+RKIRLRAEDVQG+NVLTNFWGMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEISLADLQNDEDQAYRKIRLRAEDVQGKNVLTNFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQSLIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQ+SQIRQIRRKMRE
Sbjct  111  RSLVRKWQSLIEAHVDVKTTDNYTLRMFCIGFTKRRPNQVKRTCYAQTSQIRQIRRKMRE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IMVNQA SCDLKDLV KFIPE IG+EIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  171  IMVNQATSCDLKDLVQKFIPEVIGKEIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEATEPVGA  64
            VHGDY EDVG K+DRPA D  +    E VGA
Sbjct  231  VHGDYKEDVGVKIDRPADDVQMEGEPEVVGA  261



>ref|XP_008438626.1| PREDICTED: 40S ribosomal protein S3a [Cucumis melo]
Length=261

 Score =   386 bits (992),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 183/211 (87%), Positives = 198/211 (94%), Gaps = 0/211 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFE+SLADLQ DE++A+RKIRLRAEDVQGRNVLTNFWGM+FTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEISLADLQEDEEHAYRKIRLRAEDVQGRNVLTNFWGMNFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KW +LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQSSQIRQIRRKMRE
Sbjct  111  RSLVRKWHTLIEAHVDVKTTDNYTLRMFCIGFTKRRPNQVKRTCYAQSSQIRQIRRKMRE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IMVNQA SCDLK+LV KFIPESIG+EIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  171  IMVNQASSCDLKELVRKFIPESIGKEIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEATEPVGA  64
            VHGDY+EDVG K++RPA +  +  ATE VGA
Sbjct  231  VHGDYSEDVGVKVERPADEAAVEGATEVVGA  261



>ref|XP_010090259.1| 40S ribosomal protein S3a [Morus notabilis]
 gb|EXB39197.1| 40S ribosomal protein S3a [Morus notabilis]
Length=262

 Score =   386 bits (992),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 188/213 (88%), Positives = 198/213 (93%), Gaps = 3/213 (1%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQ DED+A+RKIRLRAEDVQG+NVLTNFWGMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQKDEDHAYRKIRLRAEDVQGKNVLTNFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTDNYTLRMFCI FT++R NQ KRTCYAQSSQIRQIRRKMRE
Sbjct  111  RSLVRKWQTLIEAHVDVKTTDNYTLRMFCIAFTRRRANQVKRTCYAQSSQIRQIRRKMRE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM+NQA SCDLKDLV KFIPE IGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  171  IMINQATSCDLKDLVNKFIPEMIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYTEDVGTKLDRPAADEPI--AEATEPVGA  64
            VHGDY+EDVG K+DRP ADE I   E TE VGA
Sbjct  231  VHGDYSEDVGVKVDRP-ADETIVEGEVTEVVGA  262



>ref|XP_004134125.1| PREDICTED: 40S ribosomal protein S3a-like [Cucumis sativus]
 ref|XP_004166384.1| PREDICTED: 40S ribosomal protein S3a-like [Cucumis sativus]
 gb|KGN56950.1| hypothetical protein Csa_3G146360 [Cucumis sativus]
Length=261

 Score =   386 bits (992),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 183/211 (87%), Positives = 198/211 (94%), Gaps = 0/211 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFE+SLADLQ DE++A+RKIRLRAEDVQGRNVLTNFWGM+FTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEISLADLQEDEEHAYRKIRLRAEDVQGRNVLTNFWGMNFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KW +LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQSSQIRQIRRKMRE
Sbjct  111  RSLVRKWHTLIEAHVDVKTTDNYTLRMFCIGFTKRRPNQVKRTCYAQSSQIRQIRRKMRE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IMVNQA SCDLK+LV KFIPESIG+EIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  171  IMVNQASSCDLKELVRKFIPESIGKEIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEATEPVGA  64
            VHGDY+EDVG K++RPA +  +  ATE VGA
Sbjct  231  VHGDYSEDVGVKVERPADETAVEGATEVVGA  261



>ref|XP_007157117.1| hypothetical protein PHAVU_002G044200g [Phaseolus vulgaris]
 gb|AGZ15363.1| 40S ribosomal protein S3a-like protein [Phaseolus vulgaris]
 gb|ESW29111.1| hypothetical protein PHAVU_002G044200g [Phaseolus vulgaris]
Length=261

 Score =   386 bits (991),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 183/211 (87%), Positives = 199/211 (94%), Gaps = 0/211 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQ DED++F+KIRLRAEDVQG+NVLTNFWGMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQGDEDHSFKKIRLRAEDVQGKNVLTNFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTD+YTLRMFCIGFTK+R NQ KRTCYAQSSQIRQIRRKMRE
Sbjct  111  RSLVRKWQTLIEAHVDVKTTDSYTLRMFCIGFTKRRSNQVKRTCYAQSSQIRQIRRKMRE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IMVNQA +CDLK+LV KFIPE IG+EIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  171  IMVNQATACDLKELVRKFIPEMIGKEIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEATEPVGA  64
            VHGDY+EDVGTK++RPA +  +  ATE VGA
Sbjct  231  VHGDYSEDVGTKVERPAEETVVEGATEVVGA  261



>ref|XP_006382773.1| 40S ribosomal protein S3A [Populus trichocarpa]
 gb|ERP60570.1| 40S ribosomal protein S3A [Populus trichocarpa]
Length=261

 Score =   385 bits (990),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 187/212 (88%), Positives = 198/212 (93%), Gaps = 2/212 (1%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQNDED+AFRKIRLRAEDVQGRNVLTNFWGM FTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQNDEDHAFRKIRLRAEDVQGRNVLTNFWGMSFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTDNYTLRMFCI FTK+R NQ KRTCYAQSSQIRQIRRKMRE
Sbjct  111  RSLVRKWQTLIEAHVDVKTTDNYTLRMFCIAFTKRRPNQVKRTCYAQSSQIRQIRRKMRE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IMVNQA SCDLKDLV KFIPE IG+EIEKAT+ IYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  171  IMVNQASSCDLKDLVQKFIPEVIGKEIEKATTGIYPLQNVFIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEA-TEPVGA  64
            VHGDY++D+G K+DRP ADE +AE  TE VGA
Sbjct  231  VHGDYSQDIGVKIDRP-ADETVAEGETEVVGA  261



>ref|XP_010553762.1| PREDICTED: 40S ribosomal protein S3a-1-like [Tarenaya hassleriana]
Length=261

 Score =   385 bits (989),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 182/211 (86%), Positives = 195/211 (92%), Gaps = 0/211 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFE+SLADLQ DEDNA+RKIRLRAEDVQGRNVLTNFWGMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEISLADLQGDEDNAYRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLVKKWQ+LIEAHVDVKTTDNYTLR+FCI FTK+R NQ KRTCYAQSSQIRQIRRKMRE
Sbjct  111  RSLVKKWQTLIEAHVDVKTTDNYTLRLFCIAFTKRRANQVKRTCYAQSSQIRQIRRKMRE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IMV +A SCDLK+LV KFIPE+IGREIEKAT SIYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  171  IMVKEASSCDLKELVAKFIPEAIGREIEKATQSIYPLQNVFIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEATEPVGA  64
            VHGDY+EDVG K++RPA +    E TE +GA
Sbjct  231  VHGDYSEDVGVKVERPADESMAEEPTEVIGA  261



>ref|XP_011032434.1| PREDICTED: 40S ribosomal protein S3a [Populus euphratica]
Length=261

 Score =   385 bits (989),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 187/212 (88%), Positives = 198/212 (93%), Gaps = 2/212 (1%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQNDED+AFRKIRLRAEDVQGRNVLTNFWGM FTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQNDEDHAFRKIRLRAEDVQGRNVLTNFWGMSFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTDNYTLRMFCI FTK+R NQ KRTCYAQSSQIRQIRRKMRE
Sbjct  111  RSLVRKWQTLIEAHVDVKTTDNYTLRMFCIAFTKRRPNQVKRTCYAQSSQIRQIRRKMRE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IMVNQA SCDLKDLV KFIPE IG+EIEKAT+ IYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  171  IMVNQASSCDLKDLVQKFIPEVIGKEIEKATTGIYPLQNVFIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEA-TEPVGA  64
            VHGDY++D+G K+DRP ADE +AE  TE VGA
Sbjct  231  VHGDYSQDIGVKIDRP-ADETMAEGETEVVGA  261



>ref|NP_001241430.1| uncharacterized protein LOC100813273 [Glycine max]
 gb|ACU21516.1| unknown [Glycine max]
 gb|KHN15736.1| 40S ribosomal protein S3a [Glycine soja]
Length=261

 Score =   385 bits (989),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 187/212 (88%), Positives = 199/212 (94%), Gaps = 2/212 (1%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQ DED+AF+KIRLRAEDVQG+NVLTNFWGMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQGDEDHAFKKIRLRAEDVQGKNVLTNFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQSSQIRQIRRKMRE
Sbjct  111  RSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRANQVKRTCYAQSSQIRQIRRKMRE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM NQA SCDLK+LV KFIPE IG+EIEKATSSIYPLQNVF+RKVKILKAPKFDLGKLME
Sbjct  171  IMTNQATSCDLKELVRKFIPEIIGKEIEKATSSIYPLQNVFVRKVKILKAPKFDLGKLME  230

Query  156  VHGDYTEDVGTKLDRPAADEPIA-EATEPVGA  64
            VHGDY+EDVG K+DRP ADE +A E TE VGA
Sbjct  231  VHGDYSEDVGAKVDRP-ADEIVAEEPTEIVGA  261



>ref|XP_007030615.1| Ribosomal protein S3Ae [Theobroma cacao]
 gb|EOY11117.1| Ribosomal protein S3Ae [Theobroma cacao]
Length=261

 Score =   385 bits (988),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 187/212 (88%), Positives = 197/212 (93%), Gaps = 2/212 (1%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQ DED A+RKIRLRAEDVQGRNVLTNFWGMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQKDEDQAYRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIE+HVDVKTTDNY+LR+FCI FTK+R NQ KRTCYAQSSQIRQIRRKMRE
Sbjct  111  RSLVRKWQTLIESHVDVKTTDNYSLRLFCIAFTKRRANQVKRTCYAQSSQIRQIRRKMRE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IMVNQA SCDLK+LV KFIPE IGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  171  IMVNQASSCDLKELVAKFIPEVIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEA-TEPVGA  64
            VHGDY+EDVG KL+RP ADE  AE  TE VGA
Sbjct  231  VHGDYSEDVGVKLERP-ADETTAEGETEVVGA  261



>ref|XP_006382772.1| hypothetical protein POPTR_0005s05280g [Populus trichocarpa]
 gb|ERP60569.1| hypothetical protein POPTR_0005s05280g [Populus trichocarpa]
Length=265

 Score =   385 bits (988),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 187/212 (88%), Positives = 198/212 (93%), Gaps = 2/212 (1%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQNDED+AFRKIRLRAEDVQGRNVLTNFWGM FTTDKL
Sbjct  55   TQGTKIASEGLKHRVFEVSLADLQNDEDHAFRKIRLRAEDVQGRNVLTNFWGMSFTTDKL  114

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTDNYTLRMFCI FTK+R NQ KRTCYAQSSQIRQIRRKMRE
Sbjct  115  RSLVRKWQTLIEAHVDVKTTDNYTLRMFCIAFTKRRPNQVKRTCYAQSSQIRQIRRKMRE  174

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IMVNQA SCDLKDLV KFIPE IG+EIEKAT+ IYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  175  IMVNQASSCDLKDLVQKFIPEVIGKEIEKATTGIYPLQNVFIRKVKILKAPKFDLGKLME  234

Query  156  VHGDYTEDVGTKLDRPAADEPIAEA-TEPVGA  64
            VHGDY++D+G K+DRP ADE +AE  TE VGA
Sbjct  235  VHGDYSQDIGVKIDRP-ADETVAEGETEVVGA  265



>ref|XP_004145387.1| PREDICTED: 40S ribosomal protein S3a-like [Cucumis sativus]
 ref|XP_004153483.1| PREDICTED: 40S ribosomal protein S3a-like [Cucumis sativus]
 gb|KGN61672.1| hypothetical protein Csa_2G223140 [Cucumis sativus]
Length=260

 Score =   384 bits (987),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 185/211 (88%), Positives = 199/211 (94%), Gaps = 1/211 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQ DE++A+RKIRLRAEDVQGRNVLTNFWGM+FTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQEDEEHAYRKIRLRAEDVQGRNVLTNFWGMNFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KW +LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQSSQIRQIRRKMRE
Sbjct  111  RSLVRKWHTLIEAHVDVKTTDNYTLRMFCIGFTKRRPNQVKRTCYAQSSQIRQIRRKMRE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IMVNQA SCDLK+LV KFIPESIG++IEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  171  IMVNQATSCDLKELVRKFIPESIGKDIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEATEPVGA  64
            VHGDY+EDVG K+DRP A+E +  ATE VGA
Sbjct  231  VHGDYSEDVGVKVDRP-AEEAVEGATEVVGA  260



>ref|XP_008449325.1| PREDICTED: 40S ribosomal protein S3a-like [Cucumis melo]
Length=260

 Score =   384 bits (987),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 185/211 (88%), Positives = 199/211 (94%), Gaps = 1/211 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQ DE++A+RKIRLRAEDVQGRNVLTNFWGM+FTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQEDEEHAYRKIRLRAEDVQGRNVLTNFWGMNFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KW +LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQSSQIRQIRRKMRE
Sbjct  111  RSLVRKWHTLIEAHVDVKTTDNYTLRMFCIGFTKRRPNQVKRTCYAQSSQIRQIRRKMRE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IMVNQA SCDLK+LV KFIPESIG++IEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  171  IMVNQATSCDLKELVRKFIPESIGKDIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEATEPVGA  64
            VHGDY+EDVG K+DRP A+E +  ATE VGA
Sbjct  231  VHGDYSEDVGVKVDRP-AEEAVEGATEIVGA  260



>gb|ACU18272.1| unknown [Glycine max]
Length=261

 Score =   384 bits (987),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 183/211 (87%), Positives = 196/211 (93%), Gaps = 0/211 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTK ASEGLKHRVFEVSLADLQ DED+AF+KIRLRAEDVQG+NVLTNFWGMDFTTDKL
Sbjct  51   TQGTKTASEGLKHRVFEVSLADLQGDEDHAFKKIRLRAEDVQGKNVLTNFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIG TK+R NQ KRTCYAQSSQ+RQIRRKMRE
Sbjct  111  RSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGLTKRRSNQVKRTCYAQSSQVRQIRRKMRE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IMVNQA +CDLK+LV KFIPE IG+EIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  171  IMVNQAAACDLKELVRKFIPEMIGKEIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEATEPVGA  64
            VHGDY+EDVG K+DRPA +    EATE VGA
Sbjct  231  VHGDYSEDVGAKVDRPADETLAEEATEVVGA  261



>gb|KHN02741.1| 40S ribosomal protein S3a [Glycine soja]
Length=261

 Score =   384 bits (986),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 186/212 (88%), Positives = 199/212 (94%), Gaps = 2/212 (1%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQ DED+AF+KIRLRAEDVQG+NVLTNFWGMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQGDEDHAFKKIRLRAEDVQGKNVLTNFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQSSQIRQIRRKMRE
Sbjct  111  RSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRANQVKRTCYAQSSQIRQIRRKMRE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM NQA +CDLK+LV KFIPE IG+EIEKATSSIYPLQNVF+RKVKILKAPKFDLGKLME
Sbjct  171  IMTNQATACDLKELVRKFIPEIIGKEIEKATSSIYPLQNVFVRKVKILKAPKFDLGKLME  230

Query  156  VHGDYTEDVGTKLDRPAADEPIA-EATEPVGA  64
            VHGDY+EDVG K+DRP ADE +A E TE VGA
Sbjct  231  VHGDYSEDVGAKVDRP-ADEIVAEEPTEIVGA  261



>gb|EYU23687.1| hypothetical protein MIMGU_mgv1a012196mg [Erythranthe guttata]
Length=259

 Score =   384 bits (985),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 185/211 (88%), Positives = 198/211 (94%), Gaps = 2/211 (1%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQ DED+AFRKIRLRAEDVQG+NVLTNFWGMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQGDEDHAFRKIRLRAEDVQGKNVLTNFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTD+YTLR+FCI FTKKR NQQKRTCYAQSSQIRQIRRKM E
Sbjct  111  RSLVRKWQTLIEAHVDVKTTDSYTLRLFCIAFTKKRANQQKRTCYAQSSQIRQIRRKMHE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IMV QAQSCDLK+LV KFIPESIG+EIEKATSSIYPLQNV+IRKVKILKAPKFDLGKLME
Sbjct  171  IMVAQAQSCDLKELVQKFIPESIGKEIEKATSSIYPLQNVYIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEATEPVGA  64
            VHGDYTE+VG K++R  A+E  AE TE VGA
Sbjct  231  VHGDYTEEVGVKVER--AEETAAEPTEVVGA  259



>ref|XP_010550935.1| PREDICTED: 40S ribosomal protein S3a-2-like [Tarenaya hassleriana]
Length=261

 Score =   384 bits (985),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 181/211 (86%), Positives = 195/211 (92%), Gaps = 0/211 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFE+SLADLQ DEDNA+RKIRLRAEDVQGRNVLTNFWGMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEISLADLQGDEDNAYRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTDNYTLR+FCI FTK+R NQ KRTCYAQSSQIRQIRRKMRE
Sbjct  111  RSLVRKWQTLIEAHVDVKTTDNYTLRLFCIAFTKRRANQVKRTCYAQSSQIRQIRRKMRE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IMV +A SCDLK+LV KFIPE+IGREIEKAT SIYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  171  IMVKEASSCDLKELVAKFIPEAIGREIEKATQSIYPLQNVFIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEATEPVGA  64
            VHGDY+EDVG K++RPA +    E TE +GA
Sbjct  231  VHGDYSEDVGVKVERPADETMAEEPTEVIGA  261



>ref|XP_010272784.1| PREDICTED: 40S ribosomal protein S3a-like [Nelumbo nucifera]
Length=261

 Score =   384 bits (985),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 183/211 (87%), Positives = 196/211 (93%), Gaps = 0/211 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEV LADLQND+D ++RKIRLRAEDVQGRNVLTNFWGMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVCLADLQNDDDQSYRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFT++R NQ KRTCYAQ+SQIRQIRRKMRE
Sbjct  111  RSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTRRRPNQVKRTCYAQTSQIRQIRRKMRE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IMVNQA SCDLK+LV KFIPE IG+EIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  171  IMVNQATSCDLKELVQKFIPEVIGKEIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEATEPVGA  64
            VHGDY+EDVG K+DRPA D  +   TE VGA
Sbjct  231  VHGDYSEDVGVKVDRPADDTQMEGETEIVGA  261



>ref|NP_001265990.1| 40S ribosomal protein S3a [Cicer arietinum]
 sp|Q8GTE3.1|RS3A_CICAR RecName: Full=40S ribosomal protein S3a [Cicer arietinum]
 emb|CAD56219.1| ribosomal protein S3a [Cicer arietinum]
Length=261

 Score =   383 bits (984),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 186/212 (88%), Positives = 199/212 (94%), Gaps = 2/212 (1%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFE+SLADLQ DEDNAFRKIRLRAEDVQG+NVLTNF+GMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEISLADLQGDEDNAFRKIRLRAEDVQGKNVLTNFYGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQSSQIRQIRRKMRE
Sbjct  111  RSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRSNQVKRTCYAQSSQIRQIRRKMRE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IMVNQA SCDLK+LV KFIPE IG+EIEKATSSIYPLQNVFIRKVKILK+PKFDLGKLME
Sbjct  171  IMVNQATSCDLKELVRKFIPEMIGKEIEKATSSIYPLQNVFIRKVKILKSPKFDLGKLME  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEAT-EPVGA  64
            VHGDY+EDVGTK++ P ADE + E T E VGA
Sbjct  231  VHGDYSEDVGTKVESP-ADETVVEGTPEIVGA  261



>ref|XP_009628663.1| PREDICTED: 40S ribosomal protein S3a {ECO:0000255|HAMAP-Rule:MF_03122} 
[Nicotiana tomentosiformis]
 ref|XP_009763951.1| PREDICTED: 40S ribosomal protein S3a-like [Nicotiana sylvestris]
Length=261

 Score =   382 bits (982),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 186/208 (89%), Positives = 196/208 (94%), Gaps = 2/208 (1%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQ DED AFRKIRLRAEDVQG+NVLTNFWGMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQKDEDQAFRKIRLRAEDVQGKNVLTNFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTD+YTLRMFCI FTKKR NQQKRTCYAQSSQIRQIRRKM E
Sbjct  111  RSLVRKWQTLIEAHVDVKTTDSYTLRMFCIAFTKKRPNQQKRTCYAQSSQIRQIRRKMVE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM NQA SCDLK+LV KFIPESIGREIEKATSSI+PLQNV+IRKVKILKAPKFD+GKLME
Sbjct  171  IMRNQASSCDLKELVAKFIPESIGREIEKATSSIFPLQNVYIRKVKILKAPKFDIGKLME  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEATEP  73
            VHGDY+EDVG KLDRP ADE +AEA EP
Sbjct  231  VHGDYSEDVGVKLDRP-ADETVAEA-EP  256



>ref|XP_009779517.1| PREDICTED: 40S ribosomal protein S3a [Nicotiana sylvestris]
 sp|Q285L8.1|RS3A_TOBAC RecName: Full=40S ribosomal protein S3a; AltName: Full=Protein 
cyc07 [Nicotiana tabacum]
 gb|ABA41527.1| cyc07 [Nicotiana tabacum]
Length=261

 Score =   382 bits (982),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 186/208 (89%), Positives = 196/208 (94%), Gaps = 2/208 (1%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQ DED +FRKIRLRAEDVQG+NVLTNFWGMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQKDEDQSFRKIRLRAEDVQGKNVLTNFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLVKKWQ+LIEAHVDVKTTD+YTLRMFCI FTKKR NQQKRTCYAQSSQIRQIRRKM E
Sbjct  111  RSLVKKWQTLIEAHVDVKTTDSYTLRMFCIAFTKKRPNQQKRTCYAQSSQIRQIRRKMVE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM NQA SCDLK+LV KFIPESIGREIEKATSSI+PLQNV+IRKVKILKAPKFD+GKLME
Sbjct  171  IMRNQASSCDLKELVAKFIPESIGREIEKATSSIFPLQNVYIRKVKILKAPKFDIGKLME  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEATEP  73
            VHGDY+EDVG KLDRP ADE +AEA EP
Sbjct  231  VHGDYSEDVGVKLDRP-ADETVAEA-EP  256



>gb|ABK93399.1| unknown [Populus trichocarpa]
Length=261

 Score =   382 bits (981),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 186/212 (88%), Positives = 197/212 (93%), Gaps = 2/212 (1%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQNDED+AFRKIRLRAEDVQGRNVLTNFWGM FTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQNDEDHAFRKIRLRAEDVQGRNVLTNFWGMSFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTDNYTLRMFCI FTK+  NQ KRTCYAQSSQIRQIRRKMRE
Sbjct  111  RSLVRKWQTLIEAHVDVKTTDNYTLRMFCIAFTKRCPNQVKRTCYAQSSQIRQIRRKMRE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IMVNQA SCDLKDLV KFIPE IG+EIEKAT+ IYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  171  IMVNQASSCDLKDLVQKFIPEVIGKEIEKATTGIYPLQNVFIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEA-TEPVGA  64
            VHGDY++D+G K+DRP ADE +AE  TE VGA
Sbjct  231  VHGDYSQDIGVKIDRP-ADETVAEGETEVVGA  261



>ref|XP_010259119.1| PREDICTED: 40S ribosomal protein S3a-1 [Nelumbo nucifera]
Length=261

 Score =   382 bits (980),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 182/211 (86%), Positives = 196/211 (93%), Gaps = 0/211 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFE+SLADLQ D+D ++RKIRLRAEDVQGRNVLTNFWGM+FTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEISLADLQADDDQSYRKIRLRAEDVQGRNVLTNFWGMNFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQSSQIRQIRRKMRE
Sbjct  111  RSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRPNQVKRTCYAQSSQIRQIRRKMRE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IMVNQA SCDLK+LV KFIPE IG+EIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  171  IMVNQATSCDLKELVQKFIPEVIGKEIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEATEPVGA  64
            VHGDY+EDVG K++RPA D+     TE VGA
Sbjct  231  VHGDYSEDVGVKMERPADDQIAEGETEVVGA  261



>ref|XP_011026951.1| PREDICTED: 40S ribosomal protein S3a-2 [Populus euphratica]
Length=259

 Score =   381 bits (979),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 184/205 (90%), Positives = 194/205 (95%), Gaps = 1/205 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLRAEDVQGRNVLTNFWGM+FTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQGDEDNAYRKIRLRAEDVQGRNVLTNFWGMNFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRT YAQSSQIRQIRRKMRE
Sbjct  111  RSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRPNQVKRTTYAQSSQIRQIRRKMRE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM  QA SCDLK+LV KFIPESIG+EIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  171  IMTAQAASCDLKELVRKFIPESIGKEIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEA  82
            VHGDY+EDVG KLDRP A+E +AEA
Sbjct  231  VHGDYSEDVGVKLDRP-AEETMAEA  254



>ref|XP_006284351.1| hypothetical protein CARUB_v10005523mg [Capsella rubella]
 gb|EOA17249.1| hypothetical protein CARUB_v10005523mg [Capsella rubella]
Length=262

 Score =   381 bits (979),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 184/212 (87%), Positives = 194/212 (92%), Gaps = 1/212 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQNDEDNA+RKIRLRAEDVQGRNVLT FWGMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQNDEDNAYRKIRLRAEDVQGRNVLTQFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLVKKWQSLIEAHVDVKT+D YTLRMFCIGFTK+R NQ KRTCYAQSSQIRQIRRKM E
Sbjct  111  RSLVKKWQSLIEAHVDVKTSDGYTLRMFCIGFTKRRANQVKRTCYAQSSQIRQIRRKMSE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IMV +A SCDLK+LV KFIPE+IG+EIEKAT SIYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  171  IMVKEASSCDLKELVAKFIPEAIGKEIEKATQSIYPLQNVFIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYT-EDVGTKLDRPAADEPIAEATEPVGA  64
            VHGDYT EDVG K+DRPA +    E TE +GA
Sbjct  231  VHGDYTAEDVGVKVDRPAEETVAEEPTEIIGA  262



>ref|NP_001276152.1| 40S ribosomal protein S3a-like [Glycine max]
 gb|ACU22108.1| unknown [Glycine max]
Length=261

 Score =   381 bits (979),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 185/212 (87%), Positives = 198/212 (93%), Gaps = 2/212 (1%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQ D D+AF+KIRLRAEDVQG+NVLTNFWGMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQGDGDHAFKKIRLRAEDVQGKNVLTNFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQSSQIRQIRRKMRE
Sbjct  111  RSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRANQVKRTCYAQSSQIRQIRRKMRE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM NQA +CDLK+LV KFIPE IG+EIEKATSSIYPLQNVF+RKVKILKAPKFDLGKLME
Sbjct  171  IMTNQATACDLKELVRKFIPEIIGKEIEKATSSIYPLQNVFVRKVKILKAPKFDLGKLME  230

Query  156  VHGDYTEDVGTKLDRPAADEPIA-EATEPVGA  64
            VHGDY+EDVG K+DRP ADE +A E TE VGA
Sbjct  231  VHGDYSEDVGAKVDRP-ADEIVAEEPTEIVGA  261



>ref|XP_008804511.1| PREDICTED: 40S ribosomal protein S3a [Phoenix dactylifera]
Length=261

 Score =   381 bits (978),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 182/211 (86%), Positives = 196/211 (93%), Gaps = 0/211 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQNDED A+RKIRLRAEDVQG+NVLTNFWGM+FTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQNDEDQAYRKIRLRAEDVQGKNVLTNFWGMNFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTD+YTLRMFCIGFTK+R NQ KRTCYAQ+SQIRQIRRKMRE
Sbjct  111  RSLVRKWQTLIEAHVDVKTTDSYTLRMFCIGFTKRRPNQVKRTCYAQTSQIRQIRRKMRE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            I+VNQA SCDLKDLV KFIPE IG+EIEKAT+SIYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  171  IVVNQATSCDLKDLVQKFIPEVIGKEIEKATTSIYPLQNVFIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEATEPVGA  64
            VHGDY EDVG K++RPA D P+    E VGA
Sbjct  231  VHGDYKEDVGVKIERPADDVPMEGEPEVVGA  261



>ref|XP_006848758.1| hypothetical protein AMTR_s00026p00042160 [Amborella trichopoda]
 gb|ERN10339.1| hypothetical protein AMTR_s00026p00042160 [Amborella trichopoda]
Length=261

 Score =   381 bits (978),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 179/211 (85%), Positives = 194/211 (92%), Gaps = 0/211 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFE  LADLQNDED A++KIRLRAED+QGRNVLTNFWGMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFECCLADLQNDEDQAYKKIRLRAEDIQGRNVLTNFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQ+SQIRQIRRKMRE
Sbjct  111  RSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRPNQVKRTCYAQTSQIRQIRRKMRE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            +M+NQA SCDLK+LV KFIPE IG+EIEK T SIYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  171  VMINQATSCDLKELVQKFIPEVIGKEIEKVTMSIYPLQNVFIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEATEPVGA  64
            VHGDY++DVG K+DRPA D P+   TE VGA
Sbjct  231  VHGDYSDDVGVKVDRPAEDVPLEGVTEVVGA  261



>ref|XP_008811659.1| PREDICTED: LOW QUALITY PROTEIN: 40S ribosomal protein S3a-like 
[Phoenix dactylifera]
Length=261

 Score =   380 bits (977),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 183/211 (87%), Positives = 194/211 (92%), Gaps = 0/211 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQNDED A+RKIRLRAEDVQG+NVLTNFWGM+FTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQNDEDQAYRKIRLRAEDVQGKNVLTNFWGMNFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQ+SQIRQIRRKMRE
Sbjct  111  RSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRPNQVKRTCYAQTSQIRQIRRKMRE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IMVNQA SCDLKDLV KFIPE IG+EIEKAT+SIYPLQNVFIRKVKILKAPKFD GKLME
Sbjct  171  IMVNQAASCDLKDLVQKFIPEVIGKEIEKATTSIYPLQNVFIRKVKILKAPKFDXGKLME  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEATEPVGA  64
            VHGDY EDVG K+DRPA D  +    E VGA
Sbjct  231  VHGDYKEDVGVKIDRPADDVQMEGEPEVVGA  261



>ref|XP_002517085.1| 40S ribosomal protein S3a, putative [Ricinus communis]
 gb|EEF45248.1| 40S ribosomal protein S3a, putative [Ricinus communis]
Length=260

 Score =   380 bits (977),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 181/205 (88%), Positives = 195/205 (95%), Gaps = 1/205 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFE+SLADLQ DED+A+RKIRLRAEDVQG+NVLTNFWGMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEISLADLQGDEDHAYRKIRLRAEDVQGKNVLTNFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQSSQI QIRRKMRE
Sbjct  111  RSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRPNQIKRTCYAQSSQIGQIRRKMRE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM  QA SCDLK+LV KFIPE+IG+EIEKATSSIYPLQNV+IRKVKILKAPKFDLGKLME
Sbjct  171  IMTAQAASCDLKELVRKFIPETIGKEIEKATSSIYPLQNVYIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEA  82
            VHGDY+EDVG KL+RP ADEP+AEA
Sbjct  231  VHGDYSEDVGVKLERP-ADEPMAEA  254



>ref|XP_009775368.1| PREDICTED: 40S ribosomal protein S3a-like [Nicotiana sylvestris]
Length=261

 Score =   380 bits (977),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 185/208 (89%), Positives = 195/208 (94%), Gaps = 2/208 (1%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQ DED AFRKIRLRAEDVQG+NVLTNFWGMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQKDEDQAFRKIRLRAEDVQGKNVLTNFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTD+YTLRMFCI FTKKR NQQKRTCYAQSSQIRQIRRKM E
Sbjct  111  RSLVRKWQTLIEAHVDVKTTDSYTLRMFCIAFTKKRPNQQKRTCYAQSSQIRQIRRKMVE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM NQA SCDLK+LV KFIPESIGREIEKATSSI+PLQNV+IRKVKILKAPKFD+GKLME
Sbjct  171  IMRNQASSCDLKELVAKFIPESIGREIEKATSSIFPLQNVYIRKVKILKAPKFDIGKLME  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEATEP  73
            VHGDY+EDVG KLDRP  DE +AEA EP
Sbjct  231  VHGDYSEDVGVKLDRP-VDETVAEA-EP  256



>ref|XP_009591686.1| PREDICTED: 40S ribosomal protein S3a {ECO:0000255|HAMAP-Rule:MF_03122}-like 
[Nicotiana tomentosiformis]
Length=261

 Score =   380 bits (977),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 185/208 (89%), Positives = 195/208 (94%), Gaps = 2/208 (1%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQ DED AFRKIRLRAEDVQG+NVLTNFWGMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQKDEDQAFRKIRLRAEDVQGKNVLTNFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTD+YTLRMFCI FTKKR NQQKRTCYAQSSQIRQIRRKM E
Sbjct  111  RSLVRKWQTLIEAHVDVKTTDSYTLRMFCIAFTKKRPNQQKRTCYAQSSQIRQIRRKMVE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM NQA SCDLK+LV KFIPESIGREIEKATSSI+PLQNV+IRKVKILKAPKFD+GKLME
Sbjct  171  IMRNQASSCDLKELVAKFIPESIGREIEKATSSIFPLQNVYIRKVKILKAPKFDIGKLME  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEATEP  73
            VHGDY+EDVG KLDRP  DE +AEA EP
Sbjct  231  VHGDYSEDVGVKLDRP-TDETVAEA-EP  256



>gb|ABK56834.1| RPS3 [Cymbidium hybrid cultivar]
Length=261

 Score =   380 bits (977),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 179/211 (85%), Positives = 193/211 (91%), Gaps = 0/211 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFE+SLADLQNDED ++RKIRLRAEDVQG+NVLTNFWGMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEISLADLQNDEDQSYRKIRLRAEDVQGKNVLTNFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAH+DVKTTDNYTLR+FCIGFTK+R NQ KRTCYAQ+SQIRQIRRKMRE
Sbjct  111  RSLVRKWQTLIEAHIDVKTTDNYTLRLFCIGFTKRRPNQVKRTCYAQTSQIRQIRRKMRE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM NQA SCDLK+LV KFIPE IG+EIEKAT+SIYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  171  IMTNQASSCDLKELVQKFIPEVIGKEIEKATTSIYPLQNVFIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEATEPVGA  64
            VHGDY ED G KLDRP  D P+    E VGA
Sbjct  231  VHGDYKEDFGVKLDRPGEDVPVEGEAEVVGA  261



>ref|XP_004235324.1| PREDICTED: 40S ribosomal protein S3a [Solanum lycopersicum]
Length=261

 Score =   380 bits (976),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 186/209 (89%), Positives = 194/209 (93%), Gaps = 1/209 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQ DED AFRKIRLRAEDVQGRNVLTNF GMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQKDEDQAFRKIRLRAEDVQGRNVLTNFHGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTD+YTLRMFCI FTKKR NQQKRTCYAQSSQIRQIRRKM E
Sbjct  111  RSLVRKWQTLIEAHVDVKTTDSYTLRMFCIAFTKKRPNQQKRTCYAQSSQIRQIRRKMVE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM NQA SCDLK+LV KFIPESIGREIEKATSSI+PLQNV+IRKVKILKAPKFDLGKLME
Sbjct  171  IMRNQASSCDLKELVAKFIPESIGREIEKATSSIFPLQNVYIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEATEPV  70
            VHGDY+EDVG KLDRP ADE +AEA   V
Sbjct  231  VHGDYSEDVGVKLDRP-ADETVAEAEAEV  258



>ref|XP_010432386.1| PREDICTED: 40S ribosomal protein S3a-2-like [Camelina sativa]
Length=262

 Score =   380 bits (976),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 187/213 (88%), Positives = 197/213 (92%), Gaps = 3/213 (1%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLRAEDVQGRNVLT FWGMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQGDEDNAYRKIRLRAEDVQGRNVLTQFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLVKKWQ+LIEAHVDVKTTD +TLR+FCI FTK+R NQ KRTCYAQSSQIRQIRRKM E
Sbjct  111  RSLVKKWQTLIEAHVDVKTTDGFTLRLFCIAFTKRRANQVKRTCYAQSSQIRQIRRKMSE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IMV +A SCDLKDLV KFIPE+IGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  171  IMVKEASSCDLKDLVAKFIPEAIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYT-EDVGTKLDRPAADEPIA-EATEPVGA  64
            VHGDYT EDVG K+DR AADEP+A E TE +GA
Sbjct  231  VHGDYTAEDVGVKVDR-AADEPVAEEPTEIIGA  262



>ref|XP_002314671.2| ribosomal protein S3a [Populus trichocarpa]
 gb|ABK93373.1| unknown [Populus trichocarpa]
 gb|ABK93864.1| unknown [Populus trichocarpa]
 gb|EEF00842.2| ribosomal protein S3a [Populus trichocarpa]
Length=260

 Score =   380 bits (976),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 183/211 (87%), Positives = 195/211 (92%), Gaps = 1/211 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFE+SLADLQ DED+A+RKIRLRAEDVQG+NVLTNFWGM+FT DKL
Sbjct  51   TQGTKIASEGLKHRVFEISLADLQGDEDHAYRKIRLRAEDVQGKNVLTNFWGMNFTNDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRT YAQSSQIRQIRRKMRE
Sbjct  111  RSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRPNQIKRTTYAQSSQIRQIRRKMRE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM  QA SCDLK+LV KFIPESIG+EIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  171  IMTAQATSCDLKELVRKFIPESIGKEIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEATEPVGA  64
            VHGDY+EDVG KL+RP ADEPIAEA     A
Sbjct  231  VHGDYSEDVGVKLERP-ADEPIAEAPAETAA  260



>ref|XP_007137418.1| hypothetical protein PHAVU_009G125400g [Phaseolus vulgaris]
 gb|ESW09412.1| hypothetical protein PHAVU_009G125400g [Phaseolus vulgaris]
Length=261

 Score =   380 bits (975),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 177/211 (84%), Positives = 196/211 (93%), Gaps = 0/211 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIAS+GLKHRVFEVSLADLQ DED+AF+KIRLRAEDVQG+NVLTNFWGMDFT DKL
Sbjct  51   TQGTKIASDGLKHRVFEVSLADLQGDEDHAFKKIRLRAEDVQGKNVLTNFWGMDFTNDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAH DVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQSSQ+RQIRRKMRE
Sbjct  111  RSLVRKWQTLIEAHADVKTTDNYTLRMFCIGFTKRRSNQVKRTCYAQSSQVRQIRRKMRE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM+NQA SCDLK+LV KFIPE IG+EIEKATSS+YPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  171  IMINQATSCDLKELVRKFIPEMIGKEIEKATSSVYPLQNVFIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEATEPVGA  64
            +HGDY+ED+GTK++RP  +  +  ATE VGA
Sbjct  231  IHGDYSEDIGTKVERPVDETMVEGATEVVGA  261



>ref|XP_006379849.1| hypothetical protein POPTR_0008s15610g [Populus trichocarpa]
 gb|ABK95865.1| unknown [Populus trichocarpa]
 gb|ERP57646.1| hypothetical protein POPTR_0008s15610g [Populus trichocarpa]
Length=259

 Score =   379 bits (974),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 183/205 (89%), Positives = 193/205 (94%), Gaps = 1/205 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLRAEDVQGRNVLTNFWGM+FT DKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQGDEDNAYRKIRLRAEDVQGRNVLTNFWGMNFTNDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRT YAQSSQIRQIRRKMRE
Sbjct  111  RSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRPNQVKRTTYAQSSQIRQIRRKMRE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM  QA SCDLK+LV KFIPESIG+EIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  171  IMTAQAASCDLKELVRKFIPESIGKEIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEA  82
            VHGDY+EDVG KLDRP A+E +AEA
Sbjct  231  VHGDYSEDVGVKLDRP-AEETMAEA  254



>ref|NP_195193.1| 40S ribosomal protein S3a-2 [Arabidopsis thaliana]
 sp|Q42262.3|RS3A2_ARATH RecName: Full=40S ribosomal protein S3a-2 [Arabidopsis thaliana]
 emb|CAA04689.1| Putative S-phase-specific ribosomal protein [Arabidopsis thaliana]
 emb|CAA18846.1| Putative S-phase-specific ribosomal protein [Arabidopsis thaliana]
 emb|CAB80184.1| Putative S-phase-specific ribosomal protein [Arabidopsis thaliana]
 gb|AAL32578.1| Putative S-phase-specific ribosomal protein [Arabidopsis thaliana]
 gb|AEE86408.1| 40S ribosomal protein S3a-2 [Arabidopsis thaliana]
Length=262

 Score =   380 bits (975),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 183/212 (86%), Positives = 193/212 (91%), Gaps = 1/212 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQNDEDNA+RKIRLRAEDVQGRNVLT FWGMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQNDEDNAYRKIRLRAEDVQGRNVLTQFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLVKKWQ+LIEAHVDVKTTD YTLRMFCI FTK+R NQ KRTCYAQSSQIRQIRRKM E
Sbjct  111  RSLVKKWQTLIEAHVDVKTTDGYTLRMFCIAFTKRRANQVKRTCYAQSSQIRQIRRKMSE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IMV +A SCDLK+LV KFIPE+IGREIEKAT  IYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  171  IMVKEASSCDLKELVAKFIPEAIGREIEKATQGIYPLQNVFIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYT-EDVGTKLDRPAADEPIAEATEPVGA  64
            VHGDYT EDVG K+DRPA +  + E TE +GA
Sbjct  231  VHGDYTAEDVGVKVDRPADETMVEEPTEIIGA  262



>ref|XP_011030646.1| PREDICTED: 40S ribosomal protein S3a-2-like [Populus euphratica]
Length=259

 Score =   379 bits (974),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 182/205 (89%), Positives = 193/205 (94%), Gaps = 1/205 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFE+SLADLQ DED+A+RKIRLRAEDVQGRNVLTNFWGM+FT DKL
Sbjct  51   TQGTKIASEGLKHRVFEISLADLQGDEDHAYRKIRLRAEDVQGRNVLTNFWGMNFTNDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRT YAQSSQIRQIRRKMRE
Sbjct  111  RSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRPNQIKRTTYAQSSQIRQIRRKMRE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM  QA SCDLK+LV KFIPESIG+EIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  171  IMTAQATSCDLKELVRKFIPESIGKEIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEA  82
            VHGDY+EDVG KL+RP  DEPIAEA
Sbjct  231  VHGDYSEDVGVKLERP-VDEPIAEA  254



>ref|XP_010256142.1| PREDICTED: 40S ribosomal protein S3a-1-like [Nelumbo nucifera]
Length=261

 Score =   379 bits (974),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 183/212 (86%), Positives = 199/212 (94%), Gaps = 2/212 (1%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFE+SLADLQ D+D ++RKIRLRAEDVQGRNVLTNFWGM+FTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEISLADLQADDDQSYRKIRLRAEDVQGRNVLTNFWGMNFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQSSQIRQIRRKMRE
Sbjct  111  RSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRPNQVKRTCYAQSSQIRQIRRKMRE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IMVNQA SCDLK+LV KFIPE IG+EIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  171  IMVNQATSCDLKELVQKFIPEVIGKEIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEA-TEPVGA  64
            VHGDY+ED+G K++RP A+E +AE  TE VGA
Sbjct  231  VHGDYSEDIGIKMERP-AEETMAEGETEVVGA  261



>ref|XP_007034836.1| Ribosomal protein S3Ae isoform 2 [Theobroma cacao]
 gb|EOY05762.1| Ribosomal protein S3Ae isoform 2 [Theobroma cacao]
Length=246

 Score =   379 bits (972),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 188/213 (88%), Positives = 198/213 (93%), Gaps = 3/213 (1%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQN-DEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDK  520
            TQGTKIASEGLKHRVFE+SLADLQ  DED+A+RKIRLRAEDVQGRNVLTNFWGMDFTTDK
Sbjct  35   TQGTKIASEGLKHRVFEISLADLQGGDEDHAYRKIRLRAEDVQGRNVLTNFWGMDFTTDK  94

Query  519  LRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMR  340
            LRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQSSQIRQIRRKMR
Sbjct  95   LRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRPNQVKRTCYAQSSQIRQIRRKMR  154

Query  339  EIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLM  160
            EIM  QA SCDLK+LV KFIPE IG+EIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLM
Sbjct  155  EIMTAQATSCDLKELVQKFIPEMIGKEIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLM  214

Query  159  EVHGDYTEDVGTKLDRPAADEPIAEA-TEPVGA  64
            EVHGDY EDVG KL+RP ADE +AEA TE VGA
Sbjct  215  EVHGDYGEDVGVKLERP-ADETMAEATTEVVGA  246



>ref|XP_002512232.1| 40S ribosomal protein S3a, putative [Ricinus communis]
 gb|EEF49684.1| 40S ribosomal protein S3a, putative [Ricinus communis]
Length=263

 Score =   379 bits (974),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 184/213 (86%), Positives = 201/213 (94%), Gaps = 3/213 (1%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQ DED+A+RKIRLRAEDVQG+NVLTNFWGMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQKDEDHAYRKIRLRAEDVQGKNVLTNFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIE+HVDVKTTDNYTLR+FCI FTK+R NQ KRTCYAQSSQIRQIRRKMRE
Sbjct  111  RSLVRKWQTLIESHVDVKTTDNYTLRLFCIAFTKRRANQVKRTCYAQSSQIRQIRRKMRE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            I++NQA SCDLK+LVLKFIPESIGREIEKATSSIYPLQNV+IRKVKILKAPKFDLGKLME
Sbjct  171  ILINQAASCDLKELVLKFIPESIGREIEKATSSIYPLQNVYIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYT-EDVGTKLDRPAADEPIAEA-TEPVGA  64
            VHGDY+ +D+G KL+RP ADE +AE  TE VGA
Sbjct  231  VHGDYSADDIGVKLERP-ADELMAEGETEVVGA  262



>ref|XP_007034835.1| Ribosomal protein S3Ae isoform 1 [Theobroma cacao]
 gb|EOY05761.1| Ribosomal protein S3Ae isoform 1 [Theobroma cacao]
Length=262

 Score =   379 bits (974),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 188/213 (88%), Positives = 198/213 (93%), Gaps = 3/213 (1%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQN-DEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDK  520
            TQGTKIASEGLKHRVFE+SLADLQ  DED+A+RKIRLRAEDVQGRNVLTNFWGMDFTTDK
Sbjct  51   TQGTKIASEGLKHRVFEISLADLQGGDEDHAYRKIRLRAEDVQGRNVLTNFWGMDFTTDK  110

Query  519  LRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMR  340
            LRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQSSQIRQIRRKMR
Sbjct  111  LRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRPNQVKRTCYAQSSQIRQIRRKMR  170

Query  339  EIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLM  160
            EIM  QA SCDLK+LV KFIPE IG+EIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLM
Sbjct  171  EIMTAQATSCDLKELVQKFIPEMIGKEIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLM  230

Query  159  EVHGDYTEDVGTKLDRPAADEPIAEA-TEPVGA  64
            EVHGDY EDVG KL+RP ADE +AEA TE VGA
Sbjct  231  EVHGDYGEDVGVKLERP-ADETMAEATTEVVGA  262



>ref|XP_006408143.1| hypothetical protein EUTSA_v10021341mg [Eutrema salsugineum]
 gb|ESQ49596.1| hypothetical protein EUTSA_v10021341mg [Eutrema salsugineum]
Length=262

 Score =   379 bits (973),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 182/212 (86%), Positives = 195/212 (92%), Gaps = 1/212 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQNDEDNA+RKIRLRAEDVQGRNVL  FWGMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQNDEDNAYRKIRLRAEDVQGRNVLCQFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLVKKWQ+LIEAHVDVKTTD+YTLR+FCI FTK+R NQ KRTCYAQSSQIRQIRRKMRE
Sbjct  111  RSLVKKWQTLIEAHVDVKTTDSYTLRLFCIAFTKRRANQVKRTCYAQSSQIRQIRRKMRE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IMV +A SCDLKDLV KFIPE+IGREIEKAT +IYPLQNVFIRKVKILK+PKFDLGKLME
Sbjct  171  IMVKEASSCDLKDLVAKFIPEAIGREIEKATQNIYPLQNVFIRKVKILKSPKFDLGKLME  230

Query  156  VHGDYT-EDVGTKLDRPAADEPIAEATEPVGA  64
            VHGDYT EDVG K+DRPA +  + E TE +GA
Sbjct  231  VHGDYTAEDVGVKVDRPADETVVEEPTEIIGA  262



>ref|XP_009618011.1| PREDICTED: 40S ribosomal protein S3a {ECO:0000255|HAMAP-Rule:MF_03122}-like 
[Nicotiana tomentosiformis]
Length=260

 Score =   379 bits (973),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 184/211 (87%), Positives = 194/211 (92%), Gaps = 1/211 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQ DED +FRKIRLRAEDVQG+NVLTNFWGMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQKDEDQSFRKIRLRAEDVQGKNVLTNFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLVKKWQ+LIEAHVDVKTTD+YTLRMFCI FTKKR NQQKRTCYAQSSQIRQIRRKM E
Sbjct  111  RSLVKKWQTLIEAHVDVKTTDSYTLRMFCIAFTKKRPNQQKRTCYAQSSQIRQIRRKMVE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM NQA SCDLK+LV KFIPESIGREIEKATSSI+PLQNV+IRKVKILKAPKFD+GKLME
Sbjct  171  IMRNQASSCDLKELVAKFIPESIGREIEKATSSIFPLQNVYIRKVKILKAPKFDIGKLME  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEATEPVGA  64
            VHGDY+EDVG KLDRP ADE +    E  GA
Sbjct  231  VHGDYSEDVGVKLDRP-ADETVEAEPEIPGA  260



>ref|XP_010437575.1| PREDICTED: 40S ribosomal protein S3a-2 [Camelina sativa]
Length=262

 Score =   379 bits (973),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 187/213 (88%), Positives = 197/213 (92%), Gaps = 3/213 (1%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLRAEDVQGRNVLT FWGMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQVDEDNAYRKIRLRAEDVQGRNVLTQFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLVKKWQ+LIEAHVDVKTTD +TLR+FCI FTK+R NQ KRTCYAQSSQIRQIRRKM E
Sbjct  111  RSLVKKWQTLIEAHVDVKTTDGFTLRLFCIAFTKRRANQVKRTCYAQSSQIRQIRRKMSE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IMV +A SCDLKDLV KFIPE+IGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  171  IMVKEASSCDLKDLVAKFIPEAIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYT-EDVGTKLDRPAADEPIA-EATEPVGA  64
            VHGDYT EDVG K+DR AADEP+A E TE +GA
Sbjct  231  VHGDYTAEDVGVKVDR-AADEPVAEEPTEIIGA  262



>ref|XP_003638196.1| 40S ribosomal protein S3a [Medicago truncatula]
Length=244

 Score =   378 bits (970),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 181/211 (86%), Positives = 195/211 (92%), Gaps = 0/211 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIAS+GLKHRVFEVSLADLQ DE++AFRKIRLRAEDVQG+N+LTNFWGM+FTTDKL
Sbjct  34   TQGTKIASDGLKHRVFEVSLADLQGDEEHAFRKIRLRAEDVQGKNLLTNFWGMNFTTDKL  93

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQSSQIRQIRRKM E
Sbjct  94   RSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRANQVKRTCYAQSSQIRQIRRKMVE  153

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM+NQA SCDLK LV KFIPE IG+EIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  154  IMINQASSCDLKGLVHKFIPEMIGKEIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  213

Query  156  VHGDYTEDVGTKLDRPAADEPIAEATEPVGA  64
            VHGDY EDVGTK++RPA +    E TE VGA
Sbjct  214  VHGDYNEDVGTKVERPADEMVTEEPTEIVGA  244



>gb|ACJ85751.1| unknown [Medicago truncatula]
 gb|AFK34441.1| unknown [Medicago truncatula]
 gb|KEH43817.1| 40S ribosomal protein S3a-1 [Medicago truncatula]
Length=261

 Score =   378 bits (971),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 181/211 (86%), Positives = 195/211 (92%), Gaps = 0/211 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIAS+GLKHRVFEVSLADLQ DE++AFRKIRLRAEDVQG+N+LTNFWGM+FTTDKL
Sbjct  51   TQGTKIASDGLKHRVFEVSLADLQGDEEHAFRKIRLRAEDVQGKNLLTNFWGMNFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQSSQIRQIRRKM E
Sbjct  111  RSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRANQVKRTCYAQSSQIRQIRRKMVE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM+NQA SCDLK LV KFIPE IG+EIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  171  IMINQASSCDLKGLVHKFIPEMIGKEIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEATEPVGA  64
            VHGDY EDVGTK++RPA +    E TE VGA
Sbjct  231  VHGDYNEDVGTKVERPADEMVTEEPTEIVGA  261



>ref|XP_010447045.1| PREDICTED: 40S ribosomal protein S3a-2-like [Camelina sativa]
Length=262

 Score =   378 bits (971),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 186/213 (87%), Positives = 196/213 (92%), Gaps = 3/213 (1%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLRAEDVQGRNVLT FWGMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQGDEDNAYRKIRLRAEDVQGRNVLTQFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLVKKWQ+LIEAHVDVKTTD +T R+FCI FTK+R NQ KRTCYAQSSQIRQIRRKM E
Sbjct  111  RSLVKKWQTLIEAHVDVKTTDGFTFRLFCIAFTKRRANQVKRTCYAQSSQIRQIRRKMSE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IMV +A SCDLKDLV KFIPE+IGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  171  IMVKEASSCDLKDLVAKFIPEAIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYT-EDVGTKLDRPAADEPIA-EATEPVGA  64
            VHGDYT EDVG K+DR AADEP+A E TE +GA
Sbjct  231  VHGDYTAEDVGVKVDR-AADEPVAEEPTEIIGA  262



>ref|XP_010524908.1| PREDICTED: 40S ribosomal protein S3a-2 [Tarenaya hassleriana]
 ref|XP_010524909.1| PREDICTED: 40S ribosomal protein S3a-2 [Tarenaya hassleriana]
Length=262

 Score =   378 bits (971),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 181/212 (85%), Positives = 195/212 (92%), Gaps = 1/212 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFE+SLADLQ DEDNA+RKIRLRAEDVQGRNVLTNFWGMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEISLADLQGDEDNAYRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIE+HVDVKTTDNYTLR+FCI FTK+R NQ KRTCYAQSSQIRQIRRKMRE
Sbjct  111  RSLVRKWQTLIESHVDVKTTDNYTLRLFCIAFTKRRANQVKRTCYAQSSQIRQIRRKMRE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IMV +A SCDLK+LV KFIPE+IGREIEKAT SIYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  171  IMVKEASSCDLKELVAKFIPEAIGREIEKATQSIYPLQNVFIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYT-EDVGTKLDRPAADEPIAEATEPVGA  64
            VHGDY+ EDVG K++RPA +    E TE VGA
Sbjct  231  VHGDYSAEDVGVKVERPADETMAEEPTEIVGA  262



>sp|Q9MBB3.1|RS3A_DAUCA RecName: Full=40S ribosomal protein S3a; AltName: Full=Protein 
cyc07 [Daucus carota]
 dbj|BAA89498.1| cyc07 [Daucus carota]
Length=261

 Score =   378 bits (970),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 181/211 (86%), Positives = 194/211 (92%), Gaps = 0/211 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEV LADLQ DED A+RKIRLRAEDVQG+NVLTNF+GMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVCLADLQGDEDQAYRKIRLRAEDVQGKNVLTNFYGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTD+YTLRMFCIGFTKKR NQQKRTCYAQSSQIRQIRRKM E
Sbjct  111  RSLVRKWQTLIEAHVDVKTTDSYTLRMFCIGFTKKRANQQKRTCYAQSSQIRQIRRKMVE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM NQA SCDLK+LV KFIPESIGREIEKATSSI+PLQNVFIRKVKILKAPKFD+GKLME
Sbjct  171  IMRNQASSCDLKELVAKFIPESIGREIEKATSSIFPLQNVFIRKVKILKAPKFDIGKLME  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEATEPVGA  64
            VHGDY+EDVG KL+RP  +  +   TE VGA
Sbjct  231  VHGDYSEDVGVKLERPIEETMVEGETEVVGA  261



>sp|P49198.2|RS3A_HELAN RecName: Full=40S ribosomal protein S3a [Helianthus annuus]
 gb|AAA80978.1| ribosomal protein S3a [Helianthus annuus]
Length=260

 Score =   377 bits (968),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 179/195 (92%), Positives = 189/195 (97%), Gaps = 0/195 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQNDED+++RKIRLRAEDVQG+NVLTNFWGMD TTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQNDEDHSYRKIRLRAEDVQGKNVLTNFWGMDVTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLVKKWQSLIEAHVDVKTTDN+TLRMFCIGFTKKR NQ KRTCYAQSSQI+QIRRKMRE
Sbjct  111  RSLVKKWQSLIEAHVDVKTTDNFTLRMFCIGFTKKRANQVKRTCYAQSSQIKQIRRKMRE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IMV QAQ+CDLK+LV KFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFD+GKLME
Sbjct  171  IMVTQAQTCDLKELVQKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDIGKLME  230

Query  156  VHGDYTEDVGTKLDR  112
            VHGDY+EDVG KLDR
Sbjct  231  VHGDYSEDVGVKLDR  245



>emb|CDO98656.1| unnamed protein product [Coffea canephora]
Length=261

 Score =   377 bits (968),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 181/212 (85%), Positives = 199/212 (94%), Gaps = 2/212 (1%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQ DED+AF+KIRLRAEDVQG+NVLTNFWGM+FTTDK+
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQKDEDHAFKKIRLRAEDVQGKNVLTNFWGMNFTTDKV  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTKKR NQ+KRTCYAQSSQIRQIR+KM E
Sbjct  111  RSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKKRANQRKRTCYAQSSQIRQIRKKMVE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM NQA SCDLK+LV K IPESIGREIEK+T+SI+PLQNV+IRKVKILKAPKFDLGKLME
Sbjct  171  IMRNQASSCDLKELVAKIIPESIGREIEKSTTSIFPLQNVYIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEA-TEPVGA  64
            VHGDY+EDVG KLDRP A+E +AE  TE VG+
Sbjct  231  VHGDYSEDVGVKLDRP-AEETVAEGETEVVGS  261



>ref|XP_004168031.1| PREDICTED: 40S ribosomal protein S3a-like, partial [Cucumis sativus]
Length=208

 Score =   375 bits (962),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 180/207 (87%), Positives = 195/207 (94%), Gaps = 1/207 (0%)
 Frame = -3

Query  684  KIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLRSLV  505
            +IASEGLKHRVFEVSLADLQ DE++A+RKIRLRAEDVQGRNVLTNFWGM+FTTDKLRSLV
Sbjct  3    QIASEGLKHRVFEVSLADLQEDEEHAYRKIRLRAEDVQGRNVLTNFWGMNFTTDKLRSLV  62

Query  504  KKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREIMVN  325
            +KW +LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQSSQIRQIRRKMREIMVN
Sbjct  63   RKWHTLIEAHVDVKTTDNYTLRMFCIGFTKRRPNQVKRTCYAQSSQIRQIRRKMREIMVN  122

Query  324  QAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEVHGD  145
            QA SCDLK+LV KFIPESIG++IEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEVHGD
Sbjct  123  QATSCDLKELVRKFIPESIGKDIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEVHGD  182

Query  144  YTEDVGTKLDRPAADEPIAEATEPVGA  64
            Y+EDVG K+DRP A+E +  ATE VGA
Sbjct  183  YSEDVGVKVDRP-AEEAVEGATEVVGA  208



>ref|XP_007143300.1| hypothetical protein PHAVU_007G060700g [Phaseolus vulgaris]
 gb|ESW15294.1| hypothetical protein PHAVU_007G060700g [Phaseolus vulgaris]
Length=261

 Score =   377 bits (967),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 182/211 (86%), Positives = 196/211 (93%), Gaps = 0/211 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQ DED++FRKIRLRAED+QG+NVLTNFWGMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQGDEDHSFRKIRLRAEDIQGKNVLTNFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTD+YTLRMFCIGFTK+R NQ KRTCYAQSSQIRQIRRKMRE
Sbjct  111  RSLVRKWQTLIEAHVDVKTTDSYTLRMFCIGFTKRRANQVKRTCYAQSSQIRQIRRKMRE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM NQA SCDLK+LV KFIPE IG+EIEKATSSIYPLQNVF+RKVKILKAPKFDLGKLME
Sbjct  171  IMSNQATSCDLKELVRKFIPEIIGKEIEKATSSIYPLQNVFVRKVKILKAPKFDLGKLME  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEATEPVGA  64
            VHGDY+EDVGTK+DRP  +    E TE VGA
Sbjct  231  VHGDYSEDVGTKVDRPVEETTAEEPTEIVGA  261



>ref|XP_009394355.1| PREDICTED: 40S ribosomal protein S3a {ECO:0000255|HAMAP-Rule:MF_03122} 
[Musa acuminata subsp. malaccensis]
Length=261

 Score =   376 bits (966),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 180/211 (85%), Positives = 192/211 (91%), Gaps = 0/211 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQNDED A RKIRLRAEDVQG+NVLTNFWGMD TTDK+
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQNDEDQAHRKIRLRAEDVQGKNVLTNFWGMDLTTDKV  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            R LV+KWQ+LIEAHVDVKTTDNYTLR+FC GFTK+R NQ KRTCYAQSSQIRQIRRKMRE
Sbjct  111  RYLVRKWQTLIEAHVDVKTTDNYTLRLFCFGFTKRRPNQVKRTCYAQSSQIRQIRRKMRE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IMVNQA SCDLKDLVLKFIPE IG+EIEKAT+SI+PLQNVFIRKVKILKAPKFDLGKLME
Sbjct  171  IMVNQASSCDLKDLVLKFIPEVIGKEIEKATASIFPLQNVFIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEATEPVGA  64
            VHGDY EDVG K++RPA D  +    E VGA
Sbjct  231  VHGDYKEDVGVKMERPAEDVQMEGEAEVVGA  261



>ref|XP_010675082.1| PREDICTED: 40S ribosomal protein S3a [Beta vulgaris subsp. vulgaris]
Length=262

 Score =   376 bits (966),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 184/213 (86%), Positives = 196/213 (92%), Gaps = 3/213 (1%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFE+SLADLQNDED  FRKIRLRAEDVQGRNVLTNF+GMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEISLADLQNDEDQFFRKIRLRAEDVQGRNVLTNFYGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTDN+TLRMFCI FTK+R NQ KRT YAQSSQIRQIRRKMRE
Sbjct  111  RSLVRKWQTLIEAHVDVKTTDNFTLRMFCIAFTKRRPNQVKRTTYAQSSQIRQIRRKMRE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IMVNQA SCDLKDLV KFIPESIG+EIEKAT  IYPLQNV+IRKVKILK+PKFDLGKLME
Sbjct  171  IMVNQASSCDLKDLVAKFIPESIGKEIEKATMGIYPLQNVYIRKVKILKSPKFDLGKLME  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEA--TEPVGA  64
            VHGDY+EDVG KLDRP A+E +AE   TE VGA
Sbjct  231  VHGDYSEDVGVKLDRP-AEETMAEGETTEVVGA  262



>gb|KHG05975.1| 40S ribosomal S3a [Gossypium arboreum]
 gb|KHG27725.1| 40S ribosomal S3a [Gossypium arboreum]
Length=262

 Score =   376 bits (966),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 186/213 (87%), Positives = 198/213 (93%), Gaps = 3/213 (1%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQN-DEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDK  520
            TQGTKIASEGLKHRVFEVSLADLQ  DED+A+RKIRLRAEDVQG+NVLTNFWGM+FTTDK
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQGGDEDHAYRKIRLRAEDVQGKNVLTNFWGMNFTTDK  110

Query  519  LRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMR  340
            LRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQSSQIRQIRRKMR
Sbjct  111  LRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRPNQVKRTCYAQSSQIRQIRRKMR  170

Query  339  EIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLM  160
            EIM  QA SCDLK+LV KFIPE IG+EIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLM
Sbjct  171  EIMTAQATSCDLKELVQKFIPEMIGKEIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLM  230

Query  159  EVHGDYTEDVGTKLDRPAADEPIAEA-TEPVGA  64
            EVHGDY+EDVG KL+RP ADE +AEA  E VGA
Sbjct  231  EVHGDYSEDVGVKLERP-ADETMAEAPAEVVGA  262



>ref|XP_010546607.1| PREDICTED: 40S ribosomal protein S3a-1-like [Tarenaya hassleriana]
Length=262

 Score =   376 bits (965),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 183/213 (86%), Positives = 196/213 (92%), Gaps = 3/213 (1%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFE+SLADLQ DEDNA+RKIRLRAEDVQGRNVLTNFWGMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEISLADLQGDEDNAYRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLVKKWQ+LIEAH+DVKTTDNYTLR+FCI FTK+R NQ KRTCYAQSSQIRQIRRKMRE
Sbjct  111  RSLVKKWQTLIEAHIDVKTTDNYTLRLFCIAFTKRRANQVKRTCYAQSSQIRQIRRKMRE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM  +A SCDLK+LV KFIPE+IGREIEKAT SIYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  171  IMAKEASSCDLKELVAKFIPEAIGREIEKATQSIYPLQNVFIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYT-EDVGTKLDRPAADEPIA-EATEPVGA  64
            VHGDY+ EDVG K+DRP  DE +A E TE +GA
Sbjct  231  VHGDYSAEDVGVKVDRP-TDEIMADEPTEVIGA  262



>gb|EYU41450.1| hypothetical protein MIMGU_mgv1a002668mg [Erythranthe guttata]
Length=648

 Score =   389 bits (1000),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 188/211 (89%), Positives = 201/211 (95%), Gaps = 1/211 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQ+DED+AFRKIRLRAEDVQG+NVLTNFWGMDFTTDKL
Sbjct  439  TQGTKIASEGLKHRVFEVSLADLQSDEDHAFRKIRLRAEDVQGKNVLTNFWGMDFTTDKL  498

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTD+YTLR+FCI FTKKR NQQKRTCYAQSSQIRQIRRKM E
Sbjct  499  RSLVRKWQTLIEAHVDVKTTDSYTLRLFCIAFTKKRANQQKRTCYAQSSQIRQIRRKMME  558

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IMV Q+QSCDLK+LV KFIPESIG+EIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  559  IMVAQSQSCDLKELVQKFIPESIGKEIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  618

Query  156  VHGDYTEDVGTKLDRPAADEPIAEATEPVGA  64
            VHGDYTE+VG KLDR AA+E +AE TE VGA
Sbjct  619  VHGDYTEEVGVKLDR-AAEEAVAEPTELVGA  648



>ref|XP_006412198.1| hypothetical protein EUTSA_v10026006mg [Eutrema salsugineum]
 gb|ESQ53651.1| hypothetical protein EUTSA_v10026006mg [Eutrema salsugineum]
Length=262

 Score =   376 bits (965),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 182/212 (86%), Positives = 193/212 (91%), Gaps = 1/212 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQ DEDNA RKIRLRAEDVQGRNVLT FWGMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQGDEDNAHRKIRLRAEDVQGRNVLTQFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLVKKWQ+LIEAHVDVKTTD+YTLR+FCI FTK+R NQ KRTCYAQSSQIRQIRRKMRE
Sbjct  111  RSLVKKWQTLIEAHVDVKTTDSYTLRLFCIAFTKRRANQVKRTCYAQSSQIRQIRRKMRE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IMV +A SCDLK+LV KFIPE+IGREIEKAT +IYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  171  IMVKEASSCDLKELVAKFIPEAIGREIEKATQNIYPLQNVFIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYT-EDVGTKLDRPAADEPIAEATEPVGA  64
            VHGDYT EDVG K+DRPA +    E TE +GA
Sbjct  231  VHGDYTAEDVGVKVDRPADETMAEEPTEIIGA  262



>gb|KJB34507.1| hypothetical protein B456_006G069600 [Gossypium raimondii]
Length=262

 Score =   375 bits (964),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 185/213 (87%), Positives = 198/213 (93%), Gaps = 3/213 (1%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQN-DEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDK  520
            TQGTKIASEGLKHRVFEVSLADLQ  DED+AFRKIRLRAEDVQG+NVLTNFWGM+FTTDK
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQGGDEDHAFRKIRLRAEDVQGKNVLTNFWGMNFTTDK  110

Query  519  LRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMR  340
            LRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQSSQIRQIRRKMR
Sbjct  111  LRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRPNQVKRTCYAQSSQIRQIRRKMR  170

Query  339  EIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLM  160
            EIM  QA SCDLK+LV KFIPE IG+EIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLM
Sbjct  171  EIMTAQATSCDLKELVQKFIPEMIGKEIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLM  230

Query  159  EVHGDYTEDVGTKLDRPAADEPIAEAT-EPVGA  64
            EVHGDY+EDVG K++RP ADE +AEA  E +GA
Sbjct  231  EVHGDYSEDVGVKIERP-ADETMAEAAPEVIGA  262



>ref|XP_010485869.1| PREDICTED: 40S ribosomal protein S3a-1 [Camelina sativa]
Length=262

 Score =   375 bits (963),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 180/212 (85%), Positives = 192/212 (91%), Gaps = 1/212 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLRAEDVQGRNVL  FWGMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQGDEDNAYRKIRLRAEDVQGRNVLCQFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLVKKWQ+LIEAHVDVKTTD YTLR+FCI FTK+R NQ KRTCYAQSSQIRQIRRKM E
Sbjct  111  RSLVKKWQTLIEAHVDVKTTDGYTLRLFCIAFTKRRANQVKRTCYAQSSQIRQIRRKMSE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IMV +A SCDLKDLV KFIPE+IGREIEKAT SIYPLQNVFIRKVKILKAPKFDLGKLM+
Sbjct  171  IMVKEASSCDLKDLVAKFIPEAIGREIEKATQSIYPLQNVFIRKVKILKAPKFDLGKLMD  230

Query  156  VHGDYT-EDVGTKLDRPAADEPIAEATEPVGA  64
            +HGDYT EDVG K+DRPA +  + E TE +GA
Sbjct  231  IHGDYTAEDVGVKVDRPAEEMAVEEPTEIIGA  262



>ref|NP_001066631.1| Os12g0406200 [Oryza sativa Japonica Group]
 gb|ABG21991.1| 40S ribosomal protein S3a, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF29650.1| Os12g0406200 [Oryza sativa Japonica Group]
Length=260

 Score =   375 bits (963),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 178/202 (88%), Positives = 190/202 (94%), Gaps = 0/202 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQNDED A+RKIRLRAEDVQG+NVLTNFWGM FTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQNDEDQAYRKIRLRAEDVQGKNVLTNFWGMSFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLVKKWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R NQ KRTCYAQ+SQIRQIRRKM E
Sbjct  111  RSLVKKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRPNQVKRTCYAQASQIRQIRRKMVE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IMVNQA SCDLK+LV KFIPE IG+EIEKATSSI+PLQNVF+RKVKILKAPKFDLGKLME
Sbjct  171  IMVNQASSCDLKELVSKFIPEVIGKEIEKATSSIFPLQNVFVRKVKILKAPKFDLGKLME  230

Query  156  VHGDYTEDVGTKLDRPAADEPI  91
            VHGDY EDVGTKL+RPA DE +
Sbjct  231  VHGDYKEDVGTKLERPAEDEVV  252



>ref|XP_002882377.1| 40S ribosomal protein S3A [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58636.1| 40S ribosomal protein S3A [Arabidopsis lyrata subsp. lyrata]
Length=262

 Score =   375 bits (963),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 180/212 (85%), Positives = 193/212 (91%), Gaps = 1/212 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLRAEDVQGRNVL  FWGMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQVDEDNAYRKIRLRAEDVQGRNVLCQFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLVKKWQ+LIEAHVDVKTTDNYTLR+FCI FTK+R NQ KRTCYAQSSQIRQIRRKMR+
Sbjct  111  RSLVKKWQTLIEAHVDVKTTDNYTLRLFCIAFTKRRANQVKRTCYAQSSQIRQIRRKMRD  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM+ +A SCDLKDLV KFIPE+IGREIEKAT  IYPLQNVFIRKVKILKAPKFDLGKLM+
Sbjct  171  IMIKEASSCDLKDLVAKFIPEAIGREIEKATQGIYPLQNVFIRKVKILKAPKFDLGKLMD  230

Query  156  VHGDYT-EDVGTKLDRPAADEPIAEATEPVGA  64
            VHGDYT EDVG K+DRPA +  + E TE +GA
Sbjct  231  VHGDYTAEDVGVKVDRPADEMAVEEPTEIIGA  262



>gb|KJB72261.1| hypothetical protein B456_011G167500 [Gossypium raimondii]
Length=262

 Score =   375 bits (962),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 185/213 (87%), Positives = 199/213 (93%), Gaps = 3/213 (1%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQN-DEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDK  520
            TQGTKIASEGLKHRVFEVSLADLQ  DED+A+RKIRLRAEDVQG+NVLTNFWGM+FTTDK
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQGGDEDHAYRKIRLRAEDVQGKNVLTNFWGMNFTTDK  110

Query  519  LRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMR  340
            LRSLV+KWQ+LIEAHVDVKTTD+YTLRMFCIGFTK+R NQ KRTCYAQSSQIRQIRRKMR
Sbjct  111  LRSLVRKWQTLIEAHVDVKTTDSYTLRMFCIGFTKRRPNQVKRTCYAQSSQIRQIRRKMR  170

Query  339  EIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLM  160
            EIM  QA SCDLK+LV KFIPE IG+EIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLM
Sbjct  171  EIMTAQATSCDLKELVQKFIPEMIGKEIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLM  230

Query  159  EVHGDYTEDVGTKLDRPAADEPIAEAT-EPVGA  64
            EVHGDY+EDVG KL+RP ADE +AE+T E VGA
Sbjct  231  EVHGDYSEDVGVKLERP-ADETMAESTPEVVGA  262



>ref|XP_010419205.1| PREDICTED: 40S ribosomal protein S3a-1-like [Camelina sativa]
Length=262

 Score =   375 bits (962),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 180/212 (85%), Positives = 192/212 (91%), Gaps = 1/212 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLRAEDVQGRNVL  FWGMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQGDEDNAYRKIRLRAEDVQGRNVLCQFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLVKKWQ+LIEAHVDVKTTD YTLR+FCI FTK+R NQ KRTCYAQSSQIRQIRRKM E
Sbjct  111  RSLVKKWQTLIEAHVDVKTTDGYTLRLFCIAFTKRRANQVKRTCYAQSSQIRQIRRKMSE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IMV +A SCDLKDLV KFIPE+IGREIEKAT SIYPLQNV+IRKVKILKAPKFDLGKLM+
Sbjct  171  IMVKEASSCDLKDLVAKFIPEAIGREIEKATQSIYPLQNVYIRKVKILKAPKFDLGKLMD  230

Query  156  VHGDYT-EDVGTKLDRPAADEPIAEATEPVGA  64
            VHGDYT EDVG K+DRPA +  + E TE +GA
Sbjct  231  VHGDYTAEDVGVKVDRPAEEMAVEEPTEIIGA  262



>ref|XP_002312545.2| ribosomal protein S3a [Populus trichocarpa]
 gb|EEE89912.2| ribosomal protein S3a [Populus trichocarpa]
Length=262

 Score =   374 bits (961),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 183/208 (88%), Positives = 193/208 (93%), Gaps = 4/208 (2%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLRAEDVQGRNVLTNFWGM+FT DKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQGDEDNAYRKIRLRAEDVQGRNVLTNFWGMNFTNDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRT YAQSSQIRQIRRKMRE
Sbjct  111  RSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRPNQVKRTTYAQSSQIRQIRRKMRE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM  QA SCDLK+LV KFIPESIG+EIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  171  IMTAQAASCDLKELVRKFIPESIGKEIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  230

Query  156  ---VHGDYTEDVGTKLDRPAADEPIAEA  82
               VHGDY+EDVG KLDRP A+E +AEA
Sbjct  231  ASIVHGDYSEDVGVKLDRP-AEETMAEA  257



>gb|KHG19560.1| 40S ribosomal S3a [Gossypium arboreum]
 gb|KJB28387.1| hypothetical protein B456_005G045000 [Gossypium raimondii]
Length=262

 Score =   374 bits (960),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 184/213 (86%), Positives = 198/213 (93%), Gaps = 3/213 (1%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQN-DEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDK  520
            TQGTKIASEGLKHRVFEVSLADLQ  DED+A+RKIRLRAEDVQG+NVLTNFWGM+FTTDK
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQGGDEDHAYRKIRLRAEDVQGKNVLTNFWGMNFTTDK  110

Query  519  LRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMR  340
            LRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQSSQIRQIRRKMR
Sbjct  111  LRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRPNQVKRTCYAQSSQIRQIRRKMR  170

Query  339  EIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLM  160
            EIM  QA SCDLK+LV KFIPE IG+EIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLM
Sbjct  171  EIMTAQATSCDLKELVQKFIPEMIGKEIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLM  230

Query  159  EVHGDYTEDVGTKLDRPAADEPIAEAT-EPVGA  64
            EVHGDY+EDVG K++RP ADE +AE T E +GA
Sbjct  231  EVHGDYSEDVGVKIERP-ADETMAEPTPEVIGA  262



>gb|KDP40219.1| hypothetical protein JCGZ_02217 [Jatropha curcas]
Length=262

 Score =   374 bits (960),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 177/197 (90%), Positives = 188/197 (95%), Gaps = 0/197 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVF++SLADLQ DED AFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFDISLADLQGDEDYAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQSSQIRQIRRKMRE
Sbjct  111  RSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRPNQIKRTCYAQSSQIRQIRRKMRE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM  QA SCDLK+LV KFIPE IG+EIEKATSSIYPLQNV++RKVKILKAPKFDLGKLME
Sbjct  171  IMTAQATSCDLKELVRKFIPEIIGKEIEKATSSIYPLQNVYVRKVKILKAPKFDLGKLME  230

Query  156  VHGDYTEDVGTKLDRPA  106
            VHGDY+EDVGTKL+RPA
Sbjct  231  VHGDYSEDVGTKLERPA  247



>ref|XP_002869131.1| 40S ribosomal protein S3A [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45390.1| 40S ribosomal protein S3A [Arabidopsis lyrata subsp. lyrata]
Length=262

 Score =   373 bits (958),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 181/212 (85%), Positives = 191/212 (90%), Gaps = 1/212 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLRAEDVQGRNVLT FWGMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQVDEDNAYRKIRLRAEDVQGRNVLTQFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLVKKWQ+LIEAHVDVKTTD YTLR+FCI FTK+R NQ KRTCYAQSSQIRQIRRKM E
Sbjct  111  RSLVKKWQTLIEAHVDVKTTDGYTLRLFCIAFTKRRANQVKRTCYAQSSQIRQIRRKMSE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IMV +A SCDLK+LV KFIPE+IGREIEKAT  IYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  171  IMVKEASSCDLKELVAKFIPEAIGREIEKATQGIYPLQNVFIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYT-EDVGTKLDRPAADEPIAEATEPVGA  64
            VHGDYT EDVG K+DRPA +    E TE +GA
Sbjct  231  VHGDYTAEDVGVKVDRPADETMAEEPTEIIGA  262



>ref|XP_003559021.1| PREDICTED: 40S ribosomal protein S3a-like [Brachypodium distachyon]
Length=265

 Score =   374 bits (959),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 181/212 (85%), Positives = 192/212 (91%), Gaps = 1/212 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQ DED A+RKIRLRAEDVQG+NVLTNFWGMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQADEDQAYRKIRLRAEDVQGKNVLTNFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTDNY LRMFCIGFTK+R NQ KRTCYAQSSQIRQIRRKM E
Sbjct  111  RSLVRKWQTLIEAHVDVKTTDNYMLRMFCIGFTKRRPNQVKRTCYAQSSQIRQIRRKMVE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IMVNQA SCDLK+LV KFIPE IG+EIEKATSSI+PLQ+VF+RKVKILKAPKFDLGKLME
Sbjct  171  IMVNQATSCDLKELVQKFIPEVIGKEIEKATSSIFPLQSVFVRKVKILKAPKFDLGKLME  230

Query  156  VHGDYTEDVGTKLDRPA-ADEPIAEATEPVGA  64
            VHGDY EDVG K+DRPA  DE I    E V A
Sbjct  231  VHGDYKEDVGMKVDRPAEGDEAIIPGAEDVAA  262



>emb|CDX75453.1| BnaA01g02490D [Brassica napus]
Length=262

 Score =   373 bits (958),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 180/212 (85%), Positives = 193/212 (91%), Gaps = 1/212 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQ DED+++RKIRLRAEDVQGRNVLT FWGMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQGDEDHSYRKIRLRAEDVQGRNVLTQFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLVKKWQ+LIEAHVDVKTTD+YTLR+FCIGFTK+R NQ KRTCYAQSSQIRQIRRKM E
Sbjct  111  RSLVKKWQTLIEAHVDVKTTDSYTLRLFCIGFTKRRANQVKRTCYAQSSQIRQIRRKMSE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IMV +A SCDLK+LV KFIPESIGR+IEKA  SIYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  171  IMVKEASSCDLKELVAKFIPESIGRDIEKAVQSIYPLQNVFIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYT-EDVGTKLDRPAADEPIAEATEPVGA  64
            VHGDYT EDVG K+DRPA +    E TE +GA
Sbjct  231  VHGDYTAEDVGVKVDRPADEATAEEPTEIIGA  262



>ref|XP_006663973.1| PREDICTED: 40S ribosomal protein S3a-like [Oryza brachyantha]
Length=261

 Score =   373 bits (957),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 178/204 (87%), Positives = 191/204 (94%), Gaps = 1/204 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQNDED A+RKIRLRAEDVQG+NVLTNFWGMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQNDEDQAYRKIRLRAEDVQGKNVLTNFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLVKKWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R NQ KRTCYAQ+SQIRQIRRKM E
Sbjct  111  RSLVKKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRPNQVKRTCYAQASQIRQIRRKMVE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM NQA SCDLK+LV KFIPE IG+EIEK+TSSI+PLQNVF+RKVKILKAPKFDLGKLME
Sbjct  171  IMANQASSCDLKELVSKFIPEVIGKEIEKSTSSIFPLQNVFVRKVKILKAPKFDLGKLME  230

Query  156  VHGDYT-EDVGTKLDRPAADEPIA  88
            VHGDYT EDVG KL+RPA DE +A
Sbjct  231  VHGDYTKEDVGMKLERPAEDEAVA  254



>ref|NP_187135.1| 40S ribosomal protein S3a-1 [Arabidopsis thaliana]
 sp|Q9CAV0.3|RS3A1_ARATH RecName: Full=40S ribosomal protein S3a-1 [Arabidopsis thaliana]
 gb|AAG51414.1|AC009465_14 putative 40S ribosomal protein S3A (S phase specific); 75194-73527 
[Arabidopsis thaliana]
 gb|AAL32874.1| putative 40S ribosomal protein S3A (S phase specific) [Arabidopsis 
thaliana]
 gb|AAM10147.1| putative 40S ribosomal protein S3A (S phase specific) [Arabidopsis 
thaliana]
 gb|AAM63004.1| putative 40S ribosomal protein S3A (S phase specific) [Arabidopsis 
thaliana]
 gb|AEE74143.1| 40S ribosomal protein S3a-1 [Arabidopsis thaliana]
Length=262

 Score =   373 bits (957),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 179/212 (84%), Positives = 193/212 (91%), Gaps = 1/212 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLRAEDVQGRNVL  FWGMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQGDEDNAYRKIRLRAEDVQGRNVLCQFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLVKKWQ+LIEAHVDVKTTD+YTLR+FCI FTK+R NQ KRTCYAQSSQIRQIRRKMR+
Sbjct  111  RSLVKKWQTLIEAHVDVKTTDSYTLRLFCIAFTKRRANQVKRTCYAQSSQIRQIRRKMRD  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IMV +A SCDLKDLV KFIPE+IGREIEKAT  IYPLQNVFIRKVKILKAPKFDLGKLM+
Sbjct  171  IMVREASSCDLKDLVAKFIPEAIGREIEKATQGIYPLQNVFIRKVKILKAPKFDLGKLMD  230

Query  156  VHGDYT-EDVGTKLDRPAADEPIAEATEPVGA  64
            VHGDY+ EDVG K+DRPA +  + E TE +GA
Sbjct  231  VHGDYSAEDVGVKVDRPADEMAVEEPTEIIGA  262



>ref|XP_006663971.1| PREDICTED: 40S ribosomal protein S3a-like [Oryza brachyantha]
Length=261

 Score =   373 bits (957),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 178/204 (87%), Positives = 191/204 (94%), Gaps = 1/204 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQNDED A+RKIRLRAEDVQG+NVLTNFWGMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQNDEDQAYRKIRLRAEDVQGKNVLTNFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLVKKWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R NQ KRTCYAQ+SQIRQIRRKM E
Sbjct  111  RSLVKKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRPNQVKRTCYAQASQIRQIRRKMVE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM NQA SCDLK+LV KFIPE IG+EIEK+TSSI+PLQNVF+RKVKILKAPKFDLGKLME
Sbjct  171  IMANQASSCDLKELVSKFIPEVIGKEIEKSTSSIFPLQNVFVRKVKILKAPKFDLGKLME  230

Query  156  VHGDYT-EDVGTKLDRPAADEPIA  88
            VHGDYT EDVG KL+RPA DE +A
Sbjct  231  VHGDYTKEDVGMKLERPAEDEAVA  254



>ref|XP_003572000.1| PREDICTED: 40S ribosomal protein S3a [Brachypodium distachyon]
Length=265

 Score =   373 bits (958),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 182/209 (87%), Positives = 192/209 (92%), Gaps = 2/209 (1%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQNDED A+RKIRLRAEDVQGRNVLTNFWGMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQNDEDQAYRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLVKKWQ+LIEAHVDVKTTDNY +RMFCIGFTK+R NQ KRTCYAQSSQIRQIRRKM E
Sbjct  111  RSLVKKWQTLIEAHVDVKTTDNYMIRMFCIGFTKRRPNQVKRTCYAQSSQIRQIRRKMVE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM+NQA SCDLK+LV KFIPE IG+EIEKATSSI+PLQNV++RKVKILKAPKFDLGKLME
Sbjct  171  IMINQAASCDLKELVAKFIPEVIGKEIEKATSSIFPLQNVYVRKVKILKAPKFDLGKLME  230

Query  156  VHGDY-TEDVGTKLDRPA-ADEPIAEATE  76
            VHGDY  EDVG KLDRPA  DE I  A E
Sbjct  231  VHGDYGKEDVGVKLDRPAEGDEAIPGAEE  259



>ref|XP_010463973.1| PREDICTED: 40S ribosomal protein S3a-1-like [Camelina sativa]
Length=261

 Score =   373 bits (957),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 181/212 (85%), Positives = 193/212 (91%), Gaps = 2/212 (1%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLRAEDVQGRNVL  FWGMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQGDEDNAYRKIRLRAEDVQGRNVLCQFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLVKKWQ+LIEAHVDVKTTD YTLR+FCI FTK+R NQ KRTCYAQSSQIRQIRRKM E
Sbjct  111  RSLVKKWQTLIEAHVDVKTTDAYTLRLFCIAFTKRRANQVKRTCYAQSSQIRQIRRKMTE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IMV +A SCDLKDLV KFIPE+IGREIEKAT SIYPLQNVFIRKVKILKAPKFDLGKLM+
Sbjct  171  IMVKEASSCDLKDLVAKFIPEAIGREIEKATQSIYPLQNVFIRKVKILKAPKFDLGKLMD  230

Query  156  VHGDYT-EDVGTKLDRPAADEPIAEATEPVGA  64
            +HGDYT EDVG K+DRP A+E + E TE +GA
Sbjct  231  IHGDYTAEDVGVKVDRP-AEEVVEEPTEIIGA  261



>ref|XP_006663974.1| PREDICTED: 40S ribosomal protein S3a-like [Oryza brachyantha]
Length=261

 Score =   373 bits (957),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 178/204 (87%), Positives = 191/204 (94%), Gaps = 1/204 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQNDED A+RKIRLRAEDVQG+NVLTNFWGMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQNDEDQAYRKIRLRAEDVQGKNVLTNFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLVKKWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R NQ KRTCYAQ+SQIRQIRRKM E
Sbjct  111  RSLVKKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRPNQVKRTCYAQASQIRQIRRKMVE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM NQA SCDLK+LV KFIPE IG+EIEK+TSSI+PLQNVF+RKVKILKAPKFDLGKLME
Sbjct  171  IMANQASSCDLKELVSKFIPEVIGKEIEKSTSSIFPLQNVFVRKVKILKAPKFDLGKLME  230

Query  156  VHGDYT-EDVGTKLDRPAADEPIA  88
            VHGDYT EDVG KL+RPA DE +A
Sbjct  231  VHGDYTKEDVGMKLERPAEDEAVA  254



>emb|CDX76296.1| BnaA08g11040D [Brassica napus]
Length=261

 Score =   372 bits (956),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 180/212 (85%), Positives = 196/212 (92%), Gaps = 2/212 (1%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQ+DED+++RKIRLRAEDVQGRNVLT FWGM+FTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQSDEDHSYRKIRLRAEDVQGRNVLTQFWGMNFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLVKKWQ+LIEAHVDVKTTD+YTLRMFCIGFTK+R NQ KRTCYAQSSQ+RQIRRKM E
Sbjct  111  RSLVKKWQTLIEAHVDVKTTDSYTLRMFCIGFTKRRANQVKRTCYAQSSQVRQIRRKMSE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IMV +A SCDLK+LV KFIPE+IG+EIEKAT +IYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  171  IMVKEASSCDLKELVAKFIPEAIGKEIEKATQNIYPLQNVFIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYT-EDVGTKLDRPAADEPIAEATEPVGA  64
            VHGDYT EDVG K+DRP ADE   E TE +GA
Sbjct  231  VHGDYTAEDVGVKVDRP-ADETAEEPTEIIGA  261



>emb|CDX69078.1| BnaC01g03750D [Brassica napus]
Length=262

 Score =   372 bits (955),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 179/212 (84%), Positives = 193/212 (91%), Gaps = 1/212 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQ DED+++RKIRLRAEDVQGRNVLT FWGMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQGDEDHSYRKIRLRAEDVQGRNVLTQFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLVKKWQ+LIEAHVDVKTTD+YTLR+FCIGFTK+R NQ KRTCYAQSSQIRQIRRKM E
Sbjct  111  RSLVKKWQTLIEAHVDVKTTDSYTLRLFCIGFTKRRANQVKRTCYAQSSQIRQIRRKMSE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IMV +A SCDLK+LV KFIPE+IGR+IEKA  SIYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  171  IMVKEASSCDLKELVAKFIPEAIGRDIEKAVQSIYPLQNVFIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYT-EDVGTKLDRPAADEPIAEATEPVGA  64
            VHGDYT EDVG K+DRPA +    E TE +GA
Sbjct  231  VHGDYTAEDVGVKVDRPADEATAEEPTEIIGA  262



>dbj|BAA00860.1| cyc07 [Catharanthus roseus]
Length=245

 Score =   371 bits (953),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 176/188 (94%), Positives = 184/188 (98%), Gaps = 0/188 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGL+HRVFE+SLADLQ DED++FRKIRLRAED+QG+NVLTNFWGMDFTTDKL
Sbjct  51   TQGTKIASEGLEHRVFEISLADLQGDEDHSFRKIRLRAEDIQGKNVLTNFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQSLIEAHVDVKTTD+YTLRMFCIGFTKKR NQQKRTCYAQSSQIRQIRRKMRE
Sbjct  111  RSLVRKWQSLIEAHVDVKTTDSYTLRMFCIGFTKKRANQQKRTCYAQSSQIRQIRRKMRE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IMVNQAQSCDLKDLV KFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  171  IMVNQAQSCDLKDLVQKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYTED  133
            VHGDY ED
Sbjct  231  VHGDYNED  238



>ref|XP_006838990.1| hypothetical protein AMTR_s00002p00271660 [Amborella trichopoda]
 gb|ERN01559.1| hypothetical protein AMTR_s00002p00271660 [Amborella trichopoda]
Length=265

 Score =   372 bits (955),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 176/207 (85%), Positives = 192/207 (93%), Gaps = 0/207 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFE +LADLQ DED ++RKIRLRAED+QGRNVLTNFWGMDFTTDKL
Sbjct  56   TQGTKIASEGLKHRVFECNLADLQADEDQSYRKIRLRAEDIQGRNVLTNFWGMDFTTDKL  115

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTDNYTLR+FCIGFTK+R NQ KRTCYAQ+SQIRQIRRKMRE
Sbjct  116  RSLVRKWQTLIEAHVDVKTTDNYTLRLFCIGFTKRRPNQVKRTCYAQTSQIRQIRRKMRE  175

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IMVNQA SCDLK+LV KFIPE IG+EIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  176  IMVNQATSCDLKELVQKFIPEVIGKEIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  235

Query  156  VHGDYTEDVGTKLDRPAADEPIAEATE  76
            VHGDY++DVG K++RPA D  +   TE
Sbjct  236  VHGDYSDDVGVKVERPAEDVAMDGETE  262



>ref|XP_004241461.1| PREDICTED: 40S ribosomal protein S3a [Solanum lycopersicum]
Length=261

 Score =   372 bits (954),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 179/196 (91%), Positives = 186/196 (95%), Gaps = 0/196 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQ DED AFRKIRLRAEDVQGRNVLTNF GMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQKDEDQAFRKIRLRAEDVQGRNVLTNFHGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTD+YTLRMFCI FTKKR NQQKRTCYAQSSQIRQIRRKM E
Sbjct  111  RSLVRKWQTLIEAHVDVKTTDSYTLRMFCIAFTKKRPNQQKRTCYAQSSQIRQIRRKMVE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM NQA SCDLK+LV KFIPESIGREIEKATSSI+PLQNV+IRKVKILKAPKFDLGKLME
Sbjct  171  IMRNQASSCDLKELVAKFIPESIGREIEKATSSIFPLQNVYIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYTEDVGTKLDRP  109
            VHGDY+EDVG KLDRP
Sbjct  231  VHGDYSEDVGVKLDRP  246



>ref|XP_009108713.1| PREDICTED: 40S ribosomal protein S3a-2-like [Brassica rapa]
Length=261

 Score =   372 bits (954),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 179/212 (84%), Positives = 196/212 (92%), Gaps = 2/212 (1%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQ+DED+++RKIRLRAEDVQGRNVLT FWGM+FTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQSDEDHSYRKIRLRAEDVQGRNVLTQFWGMNFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLVKKWQ+LIEAHVDVKTTD+YTLRMFCIGFTK+R NQ KRTCYAQSSQ+RQIRRKM E
Sbjct  111  RSLVKKWQTLIEAHVDVKTTDSYTLRMFCIGFTKRRANQVKRTCYAQSSQVRQIRRKMSE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IMV +A SCDLK+LV KFIPE+IG+EIEKAT +IYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  171  IMVKEASSCDLKELVAKFIPEAIGKEIEKATQNIYPLQNVFIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYT-EDVGTKLDRPAADEPIAEATEPVGA  64
            VHGDYT EDVG ++DRP ADE   E TE +GA
Sbjct  231  VHGDYTAEDVGVRVDRP-ADETAEEPTEIIGA  261



>ref|NP_001275123.1| cyc07-like protein [Solanum tuberosum]
 gb|ABB87133.1| 40S ribosomal protein S3a-like [Solanum tuberosum]
Length=261

 Score =   372 bits (954),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 179/196 (91%), Positives = 186/196 (95%), Gaps = 0/196 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQ DED AFRKIRLRAEDVQGRNVLTNF GMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQKDEDQAFRKIRLRAEDVQGRNVLTNFHGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTD+YTLRMFCI FTKKR NQQKRTCYAQSSQIRQIRRKM E
Sbjct  111  RSLVRKWQTLIEAHVDVKTTDSYTLRMFCIAFTKKRPNQQKRTCYAQSSQIRQIRRKMVE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM NQA SCDLK+LV KFIPESIGREIEKATSSI+PLQNV+IRKVKILKAPKFDLGKLME
Sbjct  171  IMRNQASSCDLKELVAKFIPESIGREIEKATSSIFPLQNVYIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYTEDVGTKLDRP  109
            VHGDY+EDVG KLDRP
Sbjct  231  VHGDYSEDVGVKLDRP  246



>ref|XP_002277791.1| PREDICTED: 40S ribosomal protein S3a-2-like [Vitis vinifera]
Length=261

 Score =   371 bits (953),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 175/196 (89%), Positives = 186/196 (95%), Gaps = 0/196 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFE+SLADLQNDED+A+RKIRLRAEDVQG+NVLTNFWGMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEISLADLQNDEDHAYRKIRLRAEDVQGKNVLTNFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTDNYTLRMFCI FTKKR NQ K+T YAQSSQIRQIRRKMRE
Sbjct  111  RSLVRKWQTLIEAHVDVKTTDNYTLRMFCIAFTKKRQNQNKKTSYAQSSQIRQIRRKMRE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM  QA SCDLK+LV KFIPE IGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  171  IMTTQAASCDLKELVRKFIPEMIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYTEDVGTKLDRP  109
            VHGDY+EDVG K++RP
Sbjct  231  VHGDYSEDVGVKMERP  246



>ref|XP_009408135.1| PREDICTED: 40S ribosomal protein S3a {ECO:0000255|HAMAP-Rule:MF_03122}-like 
[Musa acuminata subsp. malaccensis]
Length=261

 Score =   371 bits (953),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 176/211 (83%), Positives = 192/211 (91%), Gaps = 0/211 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQNDED A RKIRLR+EDVQG+NVLTNFWGMD TTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQNDEDQAHRKIRLRSEDVQGKNVLTNFWGMDLTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            R +V++WQ+LIEAHVDVKTTDNYTLR+FCI FTK+R NQ KRTCYAQSSQIRQIRRKMRE
Sbjct  111  RHIVRRWQTLIEAHVDVKTTDNYTLRLFCIAFTKRRPNQVKRTCYAQSSQIRQIRRKMRE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IMVNQA +CDLKDLVLKFIP+ IG+EIEKATSSI+PLQNV+IRKVKILKAPKFDLGKLME
Sbjct  171  IMVNQATTCDLKDLVLKFIPDVIGKEIEKATSSIFPLQNVYIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEATEPVGA  64
            VHGDY EDVG K+DRPA D  +   +E  GA
Sbjct  231  VHGDYKEDVGVKVDRPAEDVQMEGESEVAGA  261



>ref|XP_008218237.1| PREDICTED: 40S ribosomal protein S3a-2 [Prunus mume]
Length=260

 Score =   371 bits (953),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 184/212 (87%), Positives = 195/212 (92%), Gaps = 3/212 (1%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQ DE++A+RKIRLRAEDVQGRNVLTNFWGMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQKDEEHAYRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTDNYTLRMFCI FTK+R NQ KRTCYAQSSQIRQIRRKMRE
Sbjct  111  RSLVRKWQTLIEAHVDVKTTDNYTLRMFCIAFTKRRTNQVKRTCYAQSSQIRQIRRKMRE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM+NQA SCDLKDLV KFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDL KLME
Sbjct  171  IMINQAASCDLKDLVAKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLPKLME  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEA-TEPVGA  64
            VHG   EDVG K+DR +A+E + E  TE VGA
Sbjct  231  VHGG-KEDVGVKVDR-SAEETVPEGETEVVGA  260



>ref|XP_009400022.1| PREDICTED: 40S ribosomal protein S3a {ECO:0000255|HAMAP-Rule:MF_03122}-like 
[Musa acuminata subsp. malaccensis]
Length=261

 Score =   371 bits (952),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 177/211 (84%), Positives = 191/211 (91%), Gaps = 0/211 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQNDED A RKIRLRAEDVQG+NVLTNFWGMD TTDK+
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQNDEDQAHRKIRLRAEDVQGKNVLTNFWGMDLTTDKV  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            R +V+KW +LIEAHVDVKTTDNYTLRMFCI FTK+R NQ KRTCYAQSSQIRQIRRKMRE
Sbjct  111  RYIVRKWLTLIEAHVDVKTTDNYTLRMFCIAFTKRRPNQVKRTCYAQSSQIRQIRRKMRE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IMVNQA +CDLKDLVLKFIP+ IG+EIEKATSSI+PLQNV+IRKVKILK+PKFDLGKLME
Sbjct  171  IMVNQATTCDLKDLVLKFIPDVIGKEIEKATSSIFPLQNVYIRKVKILKSPKFDLGKLME  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEATEPVGA  64
            VHGDY EDVG K+DRPA D P+      VGA
Sbjct  231  VHGDYKEDVGVKVDRPAEDVPMEGEEVVVGA  261



>ref|NP_001049289.1| Os03g0200500 [Oryza sativa Japonica Group]
 sp|P49397.2|RS3A_ORYSJ RecName: Full=40S ribosomal protein S3a; AltName: Full=CYC07 
protein [Oryza sativa Japonica Group]
 pdb|3J60|B Chain B, Localization Of The Small Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
 dbj|BAA05059.1| cyc07 [Oryza sativa]
 gb|ABF94491.1| 40S ribosomal protein S3a, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11203.1| Os03g0200500 [Oryza sativa Japonica Group]
 gb|EAY88924.1| hypothetical protein OsI_10409 [Oryza sativa Indica Group]
 gb|EAZ25948.1| hypothetical protein OsJ_09804 [Oryza sativa Japonica Group]
 dbj|BAG91340.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96538.1| unnamed protein product [Oryza sativa Japonica Group]
Length=262

 Score =   371 bits (952),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 177/204 (87%), Positives = 189/204 (93%), Gaps = 1/204 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQNDED A+RKIRLRAEDVQG+NVLTNFWGM FTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQNDEDQAYRKIRLRAEDVQGKNVLTNFWGMSFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLVKKWQ+LIEAHVDVKTTD Y LR+FCIGFTK+R NQ KRTCYAQ+SQIRQIRRKM E
Sbjct  111  RSLVKKWQTLIEAHVDVKTTDGYMLRLFCIGFTKRRPNQVKRTCYAQASQIRQIRRKMVE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM NQA SCDLK+LV KFIPE IG+EIEKATSSI+PLQNVF+RKVKILKAPKFDLGKLME
Sbjct  171  IMANQASSCDLKELVSKFIPEVIGKEIEKATSSIFPLQNVFVRKVKILKAPKFDLGKLME  230

Query  156  VHGDYT-EDVGTKLDRPAADEPIA  88
            VHGDY  ED+GTKLDRPA DE +A
Sbjct  231  VHGDYAKEDIGTKLDRPAEDEAMA  254



>ref|NP_001274913.1| 40S ribosomal protein S3a-like [Solanum tuberosum]
 gb|ABB55367.1| cyc07-like [Solanum tuberosum]
 gb|ABB72794.1| cyc07-like protein [Solanum tuberosum]
Length=261

 Score =   370 bits (951),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 178/196 (91%), Positives = 186/196 (95%), Gaps = 0/196 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQ DED A+RKIRLRAEDVQGRNVLTNF GMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQKDEDQAYRKIRLRAEDVQGRNVLTNFHGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTD+YTLRMFCI FTKKR NQQKRTCYAQSSQIRQIRRKM E
Sbjct  111  RSLVRKWQTLIEAHVDVKTTDSYTLRMFCIAFTKKRPNQQKRTCYAQSSQIRQIRRKMVE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM NQA SCDLK+LV KFIPESIGREIEKATSSI+PLQNV+IRKVKILKAPKFDLGKLME
Sbjct  171  IMRNQASSCDLKELVAKFIPESIGREIEKATSSIFPLQNVYIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYTEDVGTKLDRP  109
            VHGDY+EDVG KLDRP
Sbjct  231  VHGDYSEDVGVKLDRP  246



>gb|KJB38202.1| hypothetical protein B456_006G241700 [Gossypium raimondii]
Length=262

 Score =   370 bits (951),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 183/213 (86%), Positives = 197/213 (92%), Gaps = 3/213 (1%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQN-DEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDK  520
            TQGTKIASEGLKHRVFEV LADLQ  DED+A+RKIRLRAEDVQG+NVLTNFWGM+FTTD+
Sbjct  51   TQGTKIASEGLKHRVFEVFLADLQGGDEDHAYRKIRLRAEDVQGKNVLTNFWGMNFTTDR  110

Query  519  LRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMR  340
            LRSLV+KWQ+LIEAHVDVKTTDNYTLR+FCIGFTK+R NQ KRTCYAQSSQIRQIRRKMR
Sbjct  111  LRSLVRKWQTLIEAHVDVKTTDNYTLRLFCIGFTKRRPNQVKRTCYAQSSQIRQIRRKMR  170

Query  339  EIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLM  160
            EIM  QA SCDLK+LV KFIPE IG+EIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLM
Sbjct  171  EIMTAQATSCDLKELVQKFIPEVIGKEIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLM  230

Query  159  EVHGDYTEDVGTKLDRPAADEPIAEA-TEPVGA  64
            EVHGDY+EDVG KL+RP ADE +AEA  E VGA
Sbjct  231  EVHGDYSEDVGVKLERP-ADETMAEAPAEVVGA  262



>ref|XP_006298355.1| hypothetical protein CARUB_v10014425mg [Capsella rubella]
 gb|EOA31253.1| hypothetical protein CARUB_v10014425mg [Capsella rubella]
Length=261

 Score =   370 bits (951),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 178/212 (84%), Positives = 195/212 (92%), Gaps = 2/212 (1%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLRAEDVQGRNVL  FWGMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQGDEDNAYRKIRLRAEDVQGRNVLCQFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLVKKWQ+LIEAHVDVKTTD+YTLR+FCI FTK+R NQ KRTCYAQSSQ+RQIRRKMR+
Sbjct  111  RSLVKKWQTLIEAHVDVKTTDSYTLRLFCIAFTKRRANQVKRTCYAQSSQVRQIRRKMRD  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IMV +A SCDLK+LV KFIPE+IG+EIEKAT +IYPLQNVFIRKVKILKAPKFDLGKLM+
Sbjct  171  IMVKEASSCDLKELVAKFIPEAIGKEIEKATQNIYPLQNVFIRKVKILKAPKFDLGKLMD  230

Query  156  VHGDYT-EDVGTKLDRPAADEPIAEATEPVGA  64
            VHGDYT EDVG K+DRP A+E + E TE +GA
Sbjct  231  VHGDYTAEDVGVKVDRP-AEETVEEPTEIIGA  261



>ref|XP_009110285.1| PREDICTED: 40S ribosomal protein S3a-2 [Brassica rapa]
Length=262

 Score =   370 bits (951),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 179/212 (84%), Positives = 192/212 (91%), Gaps = 1/212 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQ DED+++RKIRLRAEDVQGRNVLT FWGMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQGDEDHSYRKIRLRAEDVQGRNVLTQFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLVKKWQ+LIEAHVDVKTTD+YTLR+FCIGFTK+R NQ KRTCYAQSSQIRQIRRKM E
Sbjct  111  RSLVKKWQTLIEAHVDVKTTDSYTLRLFCIGFTKRRANQVKRTCYAQSSQIRQIRRKMSE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IMV +A SCDLK+LV KFIPESIGR+IEKA  SIYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  171  IMVKEASSCDLKELVAKFIPESIGRDIEKAVQSIYPLQNVFIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYT-EDVGTKLDRPAADEPIAEATEPVGA  64
            VHGDYT ED G K+DRPA +    E TE +GA
Sbjct  231  VHGDYTAEDGGVKVDRPADEATAEEPTEIIGA  262



>gb|ABB55362.1| cyc07-like [Solanum tuberosum]
 gb|ABB72815.1| cyc07-like protein [Solanum tuberosum]
Length=261

 Score =   370 bits (950),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 178/196 (91%), Positives = 186/196 (95%), Gaps = 0/196 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIAS+GLKHRVFEVSLADLQ DED AFRKIRLRAEDVQGRNVLTNF GMDFTTDKL
Sbjct  51   TQGTKIASDGLKHRVFEVSLADLQKDEDQAFRKIRLRAEDVQGRNVLTNFHGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTD+YTLRMFCI FTKKR NQQKRTCYAQSSQIRQIRRKM E
Sbjct  111  RSLVRKWQTLIEAHVDVKTTDSYTLRMFCIAFTKKRPNQQKRTCYAQSSQIRQIRRKMVE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM NQA SCDLK+LV KFIPESIGREIEKATSSI+PLQNV+IRKVKILKAPKFDLGKLME
Sbjct  171  IMRNQASSCDLKELVAKFIPESIGREIEKATSSIFPLQNVYIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYTEDVGTKLDRP  109
            VHGDY+EDVG KLDRP
Sbjct  231  VHGDYSEDVGVKLDRP  246



>emb|CDY50760.1| BnaAnng10670D [Brassica napus]
 emb|CDY41904.1| BnaC05g47000D [Brassica napus]
Length=262

 Score =   370 bits (950),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 177/212 (83%), Positives = 192/212 (91%), Gaps = 1/212 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQ DED+A+RKIRLRAEDVQGRNVLT FWGMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQGDEDHAYRKIRLRAEDVQGRNVLTQFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLVKKWQ+LIE+HVDVKTTDNYTLR+FCI FTK+R NQ KRTCYAQSSQIRQIR KMRE
Sbjct  111  RSLVKKWQTLIESHVDVKTTDNYTLRLFCIAFTKRRANQVKRTCYAQSSQIRQIRSKMRE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM+ +A SCDLK+LV KFIPE+IG++IEKAT  IYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  171  IMIKEASSCDLKELVAKFIPEAIGKDIEKATQGIYPLQNVFIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYT-EDVGTKLDRPAADEPIAEATEPVGA  64
            VHGDYT EDVG K+DRPA +    E TE +GA
Sbjct  231  VHGDYTAEDVGVKVDRPADETAAEEPTEIIGA  262



>emb|CDY21109.1| BnaA01g33400D [Brassica napus]
Length=261

 Score =   370 bits (950),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 179/212 (84%), Positives = 192/212 (91%), Gaps = 2/212 (1%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADL  DED A+RKIRLRAEDVQGRNVLT FWGMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLNKDEDQAYRKIRLRAEDVQGRNVLTQFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLVKKWQ+LIE+HVDVKTTDNYTLR+FCI FTK+R NQ KRTCYAQSSQIRQIR KMRE
Sbjct  111  RSLVKKWQTLIESHVDVKTTDNYTLRLFCIAFTKRRANQVKRTCYAQSSQIRQIRSKMRE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM+ +A SCDLK+LV KFIPESIG++IEKAT  IYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  171  IMIKEASSCDLKELVAKFIPESIGKDIEKATQGIYPLQNVFIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYT-EDVGTKLDRPAADEPIAEATEPVGA  64
            VHGDYT EDVG K+DRP ADE + E TE +GA
Sbjct  231  VHGDYTAEDVGVKVDRP-ADEVVEEPTEIIGA  261



>emb|CDY30019.1| BnaC01g39890D [Brassica napus]
Length=302

 Score =   372 bits (954),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 179/212 (84%), Positives = 192/212 (91%), Gaps = 2/212 (1%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADL  DED A+RKIRLRAEDVQGRNVLT FWGMDFTTDKL
Sbjct  92   TQGTKIASEGLKHRVFEVSLADLNKDEDQAYRKIRLRAEDVQGRNVLTQFWGMDFTTDKL  151

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLVKKWQ+LIE+HVDVKTTDNYTLR+FCI FTK+R NQ KRTCYAQSSQIRQIR KMRE
Sbjct  152  RSLVKKWQTLIESHVDVKTTDNYTLRLFCIAFTKRRANQVKRTCYAQSSQIRQIRSKMRE  211

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM+ +A SCDLK+LV KFIPESIG++IEKAT  IYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  212  IMIKEASSCDLKELVAKFIPESIGKDIEKATQGIYPLQNVFIRKVKILKAPKFDLGKLME  271

Query  156  VHGDYT-EDVGTKLDRPAADEPIAEATEPVGA  64
            VHGDYT EDVG K+DRP ADE + E TE +GA
Sbjct  272  VHGDYTAEDVGVKVDRP-ADEVVEEPTEIIGA  302



>ref|XP_004958212.1| PREDICTED: 40S ribosomal protein S3a-like [Setaria italica]
Length=262

 Score =   370 bits (950),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 176/204 (86%), Positives = 191/204 (94%), Gaps = 1/204 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQ+DED A+RKIRLRAEDVQG+NVLTNFWGMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQSDEDQAYRKIRLRAEDVQGKNVLTNFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLVKKWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R NQ KRTCYAQ+SQIRQIRRKM E
Sbjct  111  RSLVKKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRPNQVKRTCYAQASQIRQIRRKMVE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM NQA +CDLK+LV KFIPE IG+E+EKATSSI+PLQNVFIRKVKILKAPKFDLGKLME
Sbjct  171  IMTNQASTCDLKELVSKFIPEVIGKEVEKATSSIFPLQNVFIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYTEDVGTKLDRPA-ADEPIA  88
            VHGDY EDVGTK++RPA ADE + 
Sbjct  231  VHGDYKEDVGTKVERPAEADEAMG  254



>gb|ABK22319.1| unknown [Picea sitchensis]
Length=245

 Score =   369 bits (948),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 179/211 (85%), Positives = 192/211 (91%), Gaps = 0/211 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFE+SLADLQNDED AFRKI+LRAEDVQGRNVLTNFWGMDFTTDKL
Sbjct  35   TQGTKIASEGLKHRVFELSLADLQNDEDQAFRKIKLRAEDVQGRNVLTNFWGMDFTTDKL  94

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTD+YTLRMFCIGFTK+R NQ KRTCYAQSSQIRQIRRKM E
Sbjct  95   RSLVRKWQTLIEAHVDVKTTDSYTLRMFCIGFTKRRPNQVKRTCYAQSSQIRQIRRKMTE  154

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM+ +A SCDLK+LV KFIPE IG+EIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  155  IMIREASSCDLKELVAKFIPEVIGKEIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  214

Query  156  VHGDYTEDVGTKLDRPAADEPIAEATEPVGA  64
            VHGDY+EDVG K+DR   + P     E VGA
Sbjct  215  VHGDYSEDVGVKVDRTTEEAPAEAEAELVGA  245



>ref|XP_006649574.1| PREDICTED: 40S ribosomal protein S3a-like [Oryza brachyantha]
Length=260

 Score =   370 bits (949),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 173/202 (86%), Positives = 190/202 (94%), Gaps = 0/202 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQNDED A+RKIRLRAEDVQG+NVLTNFWGMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQNDEDQAYRKIRLRAEDVQGKNVLTNFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLVKKWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R NQ KRTCYAQ+SQIRQIRRKM E
Sbjct  111  RSLVKKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRPNQVKRTCYAQASQIRQIRRKMVE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM NQA +CDLK+LV KFIPE IG++IEKATSSI+PLQNVF+RKVKILKAPKFDLGKLME
Sbjct  171  IMANQASTCDLKELVSKFIPEVIGKDIEKATSSIFPLQNVFVRKVKILKAPKFDLGKLME  230

Query  156  VHGDYTEDVGTKLDRPAADEPI  91
            VHGDY +D+GTK++RPA DE +
Sbjct  231  VHGDYKDDIGTKVERPAEDEAM  252



>dbj|BAA05057.1| cyc07 [Catharanthus roseus]
Length=245

 Score =   369 bits (946),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 175/188 (93%), Positives = 182/188 (97%), Gaps = 0/188 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFE+SLADLQ DED++FRKIRLRAED+QG+NVLTNFWGMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEISLADLQGDEDHSFRKIRLRAEDIQGKNVLTNFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQSLIEAHVDVKTTD+YTLRMFCIGFTKKR NQQKRTCYAQSSQIRQIRRKMRE
Sbjct  111  RSLVRKWQSLIEAHVDVKTTDSYTLRMFCIGFTKKRANQQKRTCYAQSSQIRQIRRKMRE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IMVNQA SCDLKDLV KFIPESIGREIEKAT SIYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  171  IMVNQAPSCDLKDLVQKFIPESIGREIEKATPSIYPLQNVFIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYTED  133
            VHGDY ED
Sbjct  231  VHGDYNED  238



>gb|ABB72808.1| cyc07-like protein [Solanum tuberosum]
Length=260

 Score =   369 bits (947),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 178/196 (91%), Positives = 186/196 (95%), Gaps = 0/196 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIAS+GLKHRVFEVSLADLQ DED AFRKIRLRAEDVQGRNVLTNF GMDFTTDKL
Sbjct  50   TQGTKIASDGLKHRVFEVSLADLQKDEDQAFRKIRLRAEDVQGRNVLTNFHGMDFTTDKL  109

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTD+YTLRMFCI FTKKR NQQKRTCYAQSSQIRQIRRKM E
Sbjct  110  RSLVRKWQTLIEAHVDVKTTDSYTLRMFCIAFTKKRPNQQKRTCYAQSSQIRQIRRKMVE  169

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM NQA SCDLK+LV KFIPESIGREIEKATSSI+PLQNV+IRKVKILKAPKFDLGKLME
Sbjct  170  IMRNQASSCDLKELVAKFIPESIGREIEKATSSIFPLQNVYIRKVKILKAPKFDLGKLME  229

Query  156  VHGDYTEDVGTKLDRP  109
            VHGDY+EDVG KLDRP
Sbjct  230  VHGDYSEDVGVKLDRP  245



>ref|XP_010229024.1| PREDICTED: 40S ribosomal protein S3a-like [Brachypodium distachyon]
Length=264

 Score =   369 bits (948),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 178/203 (88%), Positives = 188/203 (93%), Gaps = 1/203 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQ DED AFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQADEDQAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTDNY LRMFCIGFTK+R NQ KRTCYAQSSQIRQIRRKM E
Sbjct  111  RSLVRKWQTLIEAHVDVKTTDNYMLRMFCIGFTKRRPNQVKRTCYAQSSQIRQIRRKMVE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM NQA SCDLK+LV KFIPE IG+EIEKATSSI+PLQNV++RKVKILKAPKFDLGKLME
Sbjct  171  IMANQATSCDLKELVQKFIPEVIGKEIEKATSSIFPLQNVYVRKVKILKAPKFDLGKLME  230

Query  156  VHGDYTEDVGTKLDRPA-ADEPI  91
            VHGDY EDVG K+DRPA  DE +
Sbjct  231  VHGDYKEDVGMKVDRPADGDEAV  253



>emb|CDY40680.1| BnaC03g33960D [Brassica napus]
Length=262

 Score =   369 bits (947),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 177/212 (83%), Positives = 192/212 (91%), Gaps = 1/212 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLRAEDVQGRNVLT FWGMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQGDEDNAYRKIRLRAEDVQGRNVLTQFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLVKKWQ+LIE+HVDVKTTDN+TLR+FCI FTK+R NQ KRTCYAQSSQIRQIR KMRE
Sbjct  111  RSLVKKWQTLIESHVDVKTTDNFTLRLFCIAFTKRRANQVKRTCYAQSSQIRQIRSKMRE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM+ +A S DLK+LV KFIPESIG+EI+KAT  IYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  171  IMIKEASSSDLKELVAKFIPESIGKEIDKATQGIYPLQNVFIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYT-EDVGTKLDRPAADEPIAEATEPVGA  64
            VHGDYT EDVG K+DRPA +  + E TE +GA
Sbjct  231  VHGDYTAEDVGVKVDRPADETVVEEPTEIIGA  262



>ref|XP_009138316.1| PREDICTED: 40S ribosomal protein S3a-2-like [Brassica rapa]
 ref|XP_009138317.1| PREDICTED: 40S ribosomal protein S3a-2-like [Brassica rapa]
 emb|CDY45324.1| BnaA03g52970D [Brassica napus]
 emb|CDX72495.1| BnaC07g45170D [Brassica napus]
Length=261

 Score =   369 bits (946),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 181/213 (85%), Positives = 195/213 (92%), Gaps = 4/213 (2%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQ DED+++RKIRLRAEDVQGRNVLT FWGMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQGDEDHSYRKIRLRAEDVQGRNVLTQFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLVKKWQ+LIEAHVDVKTTD+YTLR+FCI FTK+R NQ KRTCYAQSSQIRQIRRKM E
Sbjct  111  RSLVKKWQTLIEAHVDVKTTDSYTLRLFCIAFTKRRANQVKRTCYAQSSQIRQIRRKMSE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IMV +A SCDLK+LV KFIPESIGR+IEKAT +IYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  171  IMVKEASSCDLKELVAKFIPESIGRDIEKATQNIYPLQNVFIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYT-EDVGTKLDRPAADEPIA-EATEPVGA  64
            VHGDYT EDVG K+DRP  DE +A E TE +GA
Sbjct  231  VHGDYTAEDVGVKVDRP--DETVAEEPTEIIGA  261



>gb|KHG11221.1| 40S ribosomal S3a [Gossypium arboreum]
Length=262

 Score =   369 bits (946),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 177/198 (89%), Positives = 188/198 (95%), Gaps = 1/198 (1%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQN-DEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDK  520
            TQGTKIASEGLKHRVFEVSLADLQ  DED+A+RKIRLRAEDVQG+NVLTNFWGM+FTTDK
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQGGDEDHAYRKIRLRAEDVQGKNVLTNFWGMNFTTDK  110

Query  519  LRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMR  340
            LRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQSSQIRQIRRKMR
Sbjct  111  LRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRPNQVKRTCYAQSSQIRQIRRKMR  170

Query  339  EIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLM  160
            EIM  QA SCDLK+LV KFIPE IG+EIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLM
Sbjct  171  EIMTAQATSCDLKELVQKFIPEMIGKEIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLM  230

Query  159  EVHGDYTEDVGTKLDRPA  106
            EVHGDY+EDVG KL+RPA
Sbjct  231  EVHGDYSEDVGVKLERPA  248



>emb|CDX74165.1| BnaA03g28820D [Brassica napus]
Length=262

 Score =   368 bits (945),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 177/212 (83%), Positives = 191/212 (90%), Gaps = 1/212 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLRAEDVQGRNVLT FWGMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQGDEDNAYRKIRLRAEDVQGRNVLTQFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLVKKWQ+LIE HVDVKTTDN+TLR+FCI FTK+R NQ KRTCYAQSSQIR+IR KMRE
Sbjct  111  RSLVKKWQTLIECHVDVKTTDNFTLRLFCIAFTKRRANQVKRTCYAQSSQIREIRSKMRE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM+ +A S DLK+LV KFIPESIG+EIEKAT  IYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  171  IMIKEASSSDLKELVAKFIPESIGKEIEKATQGIYPLQNVFIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYT-EDVGTKLDRPAADEPIAEATEPVGA  64
            VHGDYT EDVG K+DRPA +  + E TE +GA
Sbjct  231  VHGDYTAEDVGVKVDRPADETVVEEPTEIIGA  262



>ref|XP_010092425.1| 40S ribosomal protein S3a [Morus notabilis]
 gb|EXB51143.1| 40S ribosomal protein S3a [Morus notabilis]
Length=267

 Score =   368 bits (945),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 179/218 (82%), Positives = 200/218 (92%), Gaps = 8/218 (4%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFE+SLADLQ+DE++A+RKIRLR+EDVQG+NVLTNFWGMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEISLADLQDDEEHAYRKIRLRSEDVQGKNVLTNFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTDN+TLR+FCIGFT++R NQ KRTCYAQSSQIRQIRRKMRE
Sbjct  111  RSLVRKWQTLIEAHVDVKTTDNFTLRLFCIGFTRRRPNQVKRTCYAQSSQIRQIRRKMRE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IMVNQA SCDLK+LV KFIPE IG+EIEK T SI+PLQNVFIRKVKILKAPKFDLGKLME
Sbjct  171  IMVNQATSCDLKELVQKFIPEMIGKEIEKTTKSIFPLQNVFIRKVKILKAPKFDLGKLME  230

Query  156  ------VHGDYTEDVGTKLDRPAADEPIAEA-TEPVGA  64
                  VHGDY+ED+G K++RP ADE IAEA TE +GA
Sbjct  231  ASFLYPVHGDYSEDIGAKVERP-ADETIAEATTEVIGA  267



>ref|XP_009124201.1| PREDICTED: 40S ribosomal protein S3a-2 [Brassica rapa]
Length=262

 Score =   368 bits (944),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 176/212 (83%), Positives = 191/212 (90%), Gaps = 1/212 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQ DED+A+RKIRLRAEDVQGRNVLT FWGMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQGDEDHAYRKIRLRAEDVQGRNVLTQFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLVKKWQ+LIE+HVDVKTTDNYTLR+FCI FTK+R NQ KRTCYAQSSQIRQIR KMRE
Sbjct  111  RSLVKKWQTLIESHVDVKTTDNYTLRLFCIAFTKRRANQVKRTCYAQSSQIRQIRSKMRE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM+ +A SCDLK+LV KFIPE+IG++IEKAT  IYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  171  IMIKEASSCDLKELVAKFIPEAIGKDIEKATQGIYPLQNVFIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYT-EDVGTKLDRPAADEPIAEATEPVGA  64
            VHGDYT EDVG K+D PA +    E TE +GA
Sbjct  231  VHGDYTAEDVGVKVDSPADETAAEEPTEIIGA  262



>ref|XP_003526635.1| PREDICTED: 40S ribosomal protein S3a-like [Glycine max]
Length=261

 Score =   368 bits (944),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 177/212 (83%), Positives = 193/212 (91%), Gaps = 2/212 (1%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTK AS+GLKHRVFEVSLADLQ DED+AF+KIRLRAEDVQG+NVLTNFWGM FTTDKL
Sbjct  51   TQGTKTASDGLKHRVFEVSLADLQGDEDHAFKKIRLRAEDVQGKNVLTNFWGMSFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAH DVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQSSQ++QIRRKM E
Sbjct  111  RSLVRKWQTLIEAHADVKTTDNYTLRMFCIGFTKRRSNQVKRTCYAQSSQVKQIRRKMTE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IMVNQ  SCDLK++V K IPE IG+EIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  171  IMVNQTTSCDLKEVVRKLIPEMIGKEIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAE-ATEPVGA  64
            +HGDY+EDVG K+DRP  DE + E ATE VGA
Sbjct  231  IHGDYSEDVGVKVDRP-VDETMPEGATEVVGA  261



>ref|XP_004985319.1| PREDICTED: 40S ribosomal protein S3a-like isoform X2 [Setaria 
italica]
Length=263

 Score =   368 bits (944),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 177/212 (83%), Positives = 190/212 (90%), Gaps = 1/212 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQ+DED A+RKIRLRAED+QGRNVLTNFWGMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQSDEDQAYRKIRLRAEDIQGRNVLTNFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R NQ KRTCYAQ+SQIRQIRRKM E
Sbjct  111  RSLVRKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRPNQVKRTCYAQASQIRQIRRKMVE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM NQA +CDLK+LV KFIPE IG+EIEKATSSI+PLQNVFIRKVKILKAPKFDLGKLME
Sbjct  171  IMANQASTCDLKELVSKFIPEVIGKEIEKATSSIFPLQNVFIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYT-EDVGTKLDRPAADEPIAEATEPVGA  64
            VHGDYT EDVG KL+RPA  E      E   A
Sbjct  231  VHGDYTKEDVGVKLERPAEAEEAVVGQEAAAA  262



>ref|XP_009134791.1| PREDICTED: 40S ribosomal protein S3a-2-like [Brassica rapa]
Length=262

 Score =   368 bits (944),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 177/212 (83%), Positives = 190/212 (90%), Gaps = 1/212 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLRAEDVQGRNVLT FWGMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQGDEDNAYRKIRLRAEDVQGRNVLTQFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLVKKWQ+LIE HVDVKTTDN+TLR+FCI FTK+R NQ KRTCYAQSSQIRQIR KMRE
Sbjct  111  RSLVKKWQTLIECHVDVKTTDNFTLRLFCIAFTKRRANQVKRTCYAQSSQIRQIRSKMRE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM+ +A S DLK+LV KFIPESIG+EIEKAT  IYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  171  IMIKEASSSDLKELVAKFIPESIGKEIEKATQGIYPLQNVFIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYT-EDVGTKLDRPAADEPIAEATEPVGA  64
            VHGDYT EDVG K+DRPA +  + E  E +GA
Sbjct  231  VHGDYTAEDVGVKVDRPADETVVEEPAEIIGA  262



>ref|NP_001046578.1| Os02g0287000 [Oryza sativa Japonica Group]
 dbj|BAD21513.1| putative ribosomal protein S3a, cytosolic [Oryza sativa Japonica 
Group]
 dbj|BAD21711.1| putative ribosomal protein S3a, cytosolic [Oryza sativa Japonica 
Group]
 dbj|BAF08492.1| Os02g0287000 [Oryza sativa Japonica Group]
 gb|EAY85405.1| hypothetical protein OsI_06784 [Oryza sativa Indica Group]
Length=261

 Score =   367 bits (943),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 174/197 (88%), Positives = 185/197 (94%), Gaps = 0/197 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQNDED A+RK+RLRAEDVQGRNVLTNFWGM FTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQNDEDQAYRKVRLRAEDVQGRNVLTNFWGMSFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLVKKWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R NQ KRTCYAQ+SQIRQIRRKM E
Sbjct  111  RSLVKKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRPNQVKRTCYAQASQIRQIRRKMVE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM NQA +CDLK+LV KFIPE IG+EIEK+TSSI+PLQNVFIRKVKILKAPKFDLGKLME
Sbjct  171  IMANQASTCDLKELVSKFIPEVIGKEIEKSTSSIFPLQNVFIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYTEDVGTKLDRPA  106
            VHGDY EDVG KLDRPA
Sbjct  231  VHGDYKEDVGMKLDRPA  247



>ref|XP_006420004.1| hypothetical protein CICLE_v10005663mg [Citrus clementina]
 ref|XP_006489441.1| PREDICTED: 40S ribosomal protein S3a-like [Citrus sinensis]
 gb|ESR33244.1| hypothetical protein CICLE_v10005663mg [Citrus clementina]
 gb|KDO74487.1| hypothetical protein CISIN_1g024879mg [Citrus sinensis]
Length=261

 Score =   367 bits (942),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 179/212 (84%), Positives = 194/212 (92%), Gaps = 2/212 (1%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSL DL N+E++A+RKIRLRAEDVQG+NVLTNFWGMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLGDLHNEEEHAYRKIRLRAEDVQGKNVLTNFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KW +LIEA+VDVKTTDNYTLRMFCIGFTK+  NQ KRTCYAQ+SQIRQIRRKMRE
Sbjct  111  RSLVRKWHTLIEAYVDVKTTDNYTLRMFCIGFTKRLPNQVKRTCYAQASQIRQIRRKMRE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM+ QA SCDLK LV KFI E IGREIEKAT SIYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  171  IMIAQAASCDLKGLVEKFIAEIIGREIEKATLSIYPLQNVFIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEA-TEPVGA  64
            VHGDY+EDVG K++RP ADEPI EA TE +GA
Sbjct  231  VHGDYSEDVGVKMERP-ADEPIPEAPTEVIGA  261



>gb|KFK30101.1| hypothetical protein AALP_AA7G217000 [Arabis alpina]
Length=262

 Score =   367 bits (942),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 177/212 (83%), Positives = 187/212 (88%), Gaps = 1/212 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADL  DEDNA+RKIRLRAEDVQGRNVLT FWGMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLNGDEDNAYRKIRLRAEDVQGRNVLTQFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLVKKWQ+LIEAHVDVKTTDNYTLRMFCI FTK+R NQ KRTCYAQSSQ+RQIRRKM E
Sbjct  111  RSLVKKWQTLIEAHVDVKTTDNYTLRMFCIAFTKRRTNQVKRTCYAQSSQVRQIRRKMTE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM+ +A SCDLK LV KFIPESIGREIEK T +IYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  171  IMIKEASSCDLKQLVAKFIPESIGREIEKVTQNIYPLQNVFIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYT-EDVGTKLDRPAADEPIAEATEPVGA  64
            VH DYT EDVG K+DRP  +    E  E +GA
Sbjct  231  VHSDYTAEDVGVKVDRPEDETVAEEPAEIIGA  262



>gb|EEE56753.1| hypothetical protein OsJ_06287 [Oryza sativa Japonica Group]
Length=399

 Score =   372 bits (954),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 177/204 (87%), Positives = 189/204 (93%), Gaps = 1/204 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQNDED A+RK+RLRAEDVQGRNVLTNFWGM FTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQNDEDQAYRKVRLRAEDVQGRNVLTNFWGMSFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLVKKWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R NQ KRTCYAQ+SQIRQIRRKM E
Sbjct  111  RSLVKKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRPNQVKRTCYAQASQIRQIRRKMVE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM NQA +CDLK+LV KFIPE IG+EIEK+TSSI+PLQNVFIRKVKILKAPKFDLGKLME
Sbjct  171  IMANQASTCDLKELVSKFIPEVIGKEIEKSTSSIFPLQNVFIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYTEDVGTKLDRPA-ADEPIA  88
            VHGDY EDVG KLDRPA  DE +A
Sbjct  231  VHGDYKEDVGMKLDRPAETDEAVA  254



>ref|XP_007205738.1| hypothetical protein PRUPE_ppa010179mg [Prunus persica]
 gb|EMJ06937.1| hypothetical protein PRUPE_ppa010179mg [Prunus persica]
Length=260

 Score =   366 bits (940),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 180/210 (86%), Positives = 189/210 (90%), Gaps = 1/210 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQ DE++A+RKIRLRAEDVQGRNVLTNFWGMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQKDEEHAYRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTDNYTLRMFCI FTK+R NQ KRTCYAQSSQIRQIR KMRE
Sbjct  111  RSLVRKWQTLIEAHVDVKTTDNYTLRMFCIAFTKRRTNQVKRTCYAQSSQIRQIRLKMRE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM+NQA SCDLKDLV KFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDL KLME
Sbjct  171  IMINQAASCDLKDLVAKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLPKLME  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEATEPVG  67
            VHG   EDVG K+DR A +      TE VG
Sbjct  231  VHGG-KEDVGVKVDRSAEETAPEGETEVVG  259



>gb|AFW89329.1| hypothetical protein ZEAMMB73_166147 [Zea mays]
Length=231

 Score =   365 bits (936),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 173/205 (84%), Positives = 188/205 (92%), Gaps = 1/205 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGT+IASEGLKHRVFEV LADLQ DED A+RKIRLRAEDVQGRNVLTNFWGM+FTTDKL
Sbjct  22   TQGTRIASEGLKHRVFEVCLADLQGDEDQAYRKIRLRAEDVQGRNVLTNFWGMNFTTDKL  81

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLVKKWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R NQ KRTCYAQ+SQIRQIRRKM E
Sbjct  82   RSLVKKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRPNQVKRTCYAQASQIRQIRRKMVE  141

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM+NQA +CDLK+LV KFIPE IG+EIEK+TSSI+PLQNVFIRKVKILKAPKFDLGKLME
Sbjct  142  IMINQASTCDLKELVSKFIPEVIGKEIEKSTSSIFPLQNVFIRKVKILKAPKFDLGKLME  201

Query  156  VHGDYTEDVGTKLDRPA-ADEPIAE  85
            VHGDY EDVG KL+RP   DE + E
Sbjct  202  VHGDYKEDVGVKLERPVEGDEAVQE  226



>ref|XP_002987274.1| hypothetical protein SELMODRAFT_271906 [Selaginella moellendorffii]
 ref|XP_002987332.1| hypothetical protein SELMODRAFT_271907 [Selaginella moellendorffii]
 ref|XP_002989169.1| hypothetical protein SELMODRAFT_184408 [Selaginella moellendorffii]
 ref|XP_002989210.1| hypothetical protein SELMODRAFT_160008 [Selaginella moellendorffii]
 gb|EFJ09763.1| hypothetical protein SELMODRAFT_184408 [Selaginella moellendorffii]
 gb|EFJ09804.1| hypothetical protein SELMODRAFT_160008 [Selaginella moellendorffii]
 gb|EFJ11589.1| hypothetical protein SELMODRAFT_271906 [Selaginella moellendorffii]
 gb|EFJ11647.1| hypothetical protein SELMODRAFT_271907 [Selaginella moellendorffii]
Length=263

 Score =   366 bits (939),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 172/199 (86%), Positives = 186/199 (93%), Gaps = 0/199 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIAS+GLK RVFEVSLADLQNDED+AFRKI+LRAEDVQGRNVLTNFWGMDFTTDKL
Sbjct  51   TQGTKIASDGLKGRVFEVSLADLQNDEDHAFRKIKLRAEDVQGRNVLTNFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQSLIEAHVDVKTTDNYTLR+FCIGFTK+R NQ KRTCYAQSSQIRQIR+KMRE
Sbjct  111  RSLVRKWQSLIEAHVDVKTTDNYTLRLFCIGFTKRRPNQVKRTCYAQSSQIRQIRKKMRE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IMV +AQSCDLKDLV KFIPE IG+EIEK T+ IYPLQN +IRKVKILKAPKFDLGKLME
Sbjct  171  IMVREAQSCDLKDLVAKFIPEVIGKEIEKVTAGIYPLQNTYIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYTEDVGTKLDRPAAD  100
            VHGDY+ED G K++RP  D
Sbjct  231  VHGDYSEDTGVKVERPVGD  249



>gb|KDO43437.1| hypothetical protein CISIN_1g040060mg, partial [Citrus sinensis]
Length=241

 Score =   365 bits (937),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 179/212 (84%), Positives = 194/212 (92%), Gaps = 2/212 (1%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSL DL N+E++A+RKIRLRAEDVQG+NVLTNFWGM FTTDKL
Sbjct  31   TQGTKIASEGLKHRVFEVSLGDLLNEEEHAYRKIRLRAEDVQGKNVLTNFWGMSFTTDKL  90

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KW +LIEA+VDVKTTDN+TLR+FCIGFTK+  NQ KRTCYAQ+SQIRQIRRKMRE
Sbjct  91   RSLVRKWHTLIEAYVDVKTTDNFTLRLFCIGFTKRLPNQVKRTCYAQTSQIRQIRRKMRE  150

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IMV QA SCDLK LV KFI E IGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  151  IMVAQAASCDLKSLVEKFIAEVIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  210

Query  156  VHGDYTEDVGTKLDRPAADEPIAEA-TEPVGA  64
            VHGDY+EDVG K+DRP ADEPI EA TE +GA
Sbjct  211  VHGDYSEDVGVKVDRP-ADEPIPEAPTEVIGA  241



>ref|XP_009406016.1| PREDICTED: 40S ribosomal protein S3a {ECO:0000255|HAMAP-Rule:MF_03122}-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=260

 Score =   365 bits (937),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 178/211 (84%), Positives = 189/211 (90%), Gaps = 1/211 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEV LADLQNDED A RKIRLRAEDVQG+NVL NFWGMD TTDK+
Sbjct  51   TQGTKIASEGLKHRVFEVCLADLQNDEDQAHRKIRLRAEDVQGKNVLANFWGMDLTTDKV  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            R +V+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQSSQIRQIRRKMRE
Sbjct  111  RYVVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRPNQVKRTCYAQSSQIRQIRRKMRE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IMVNQA + DLKDLV KFIPE IG+EIEKAT+SIYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  171  IMVNQATTGDLKDLVQKFIPEVIGKEIEKATTSIYPLQNVFIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEATEPVGA  64
            VHGDY EDVG K+DRPA D  + E  E  GA
Sbjct  231  VHGDYKEDVGAKVDRPAEDVQM-EGEEVTGA  260



>gb|KEH32959.1| 40S ribosomal protein S3a-1 [Medicago truncatula]
Length=261

 Score =   365 bits (937),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 175/211 (83%), Positives = 190/211 (90%), Gaps = 0/211 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIA +GLKHRVFEVSL DLQ DE++AFRKIRLRAEDVQG+N+LTNFWGM+FTTDKL
Sbjct  51   TQGTKIALDGLKHRVFEVSLVDLQGDEEHAFRKIRLRAEDVQGKNLLTNFWGMNFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQSSQIRQIRRKM E
Sbjct  111  RSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRANQVKRTCYAQSSQIRQIRRKMVE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM+NQA SCDLK LV KFIPE IG+EIE ATSSIYPLQNVFIRKVKILKAPKF L KLME
Sbjct  171  IMINQASSCDLKGLVHKFIPEMIGKEIENATSSIYPLQNVFIRKVKILKAPKFHLEKLME  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEATEPVGA  64
            VHGDY+EDVGTK++ PA +    E TE VGA
Sbjct  231  VHGDYSEDVGTKVESPADEMVTEEPTEIVGA  261



>gb|KDO37446.1| hypothetical protein CISIN_1g045491mg, partial [Citrus sinensis]
Length=241

 Score =   364 bits (935),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 178/212 (84%), Positives = 195/212 (92%), Gaps = 2/212 (1%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSL DL N+E++A+RKIRLRAEDVQG+NVLTNFWGM+FTTDKL
Sbjct  31   TQGTKIASEGLKHRVFEVSLGDLLNEEEHAYRKIRLRAEDVQGKNVLTNFWGMNFTTDKL  90

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KW +LIEA+VDVKTTDN+TLR+FCIGFTK+  NQ KRTCYAQ+SQIRQIRRKMRE
Sbjct  91   RSLVRKWHTLIEAYVDVKTTDNFTLRLFCIGFTKRLPNQVKRTCYAQTSQIRQIRRKMRE  150

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IMV QA SCDLK LV KFI E IGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  151  IMVAQAASCDLKSLVEKFIAEVIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  210

Query  156  VHGDYTEDVGTKLDRPAADEPIAEA-TEPVGA  64
            VHGDY+EDVG K+DRP ADEP+ EA TE +GA
Sbjct  211  VHGDYSEDVGVKVDRP-ADEPMPEAPTEVIGA  241



>ref|XP_006428321.1| hypothetical protein CICLE_v10012508mg [Citrus clementina]
 ref|XP_006480359.1| PREDICTED: 40S ribosomal protein S3a-like [Citrus sinensis]
 gb|ESR41561.1| hypothetical protein CICLE_v10012508mg [Citrus clementina]
Length=261

 Score =   365 bits (936),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 178/212 (84%), Positives = 195/212 (92%), Gaps = 2/212 (1%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSL DL N+E++A+RKIRLRAEDVQG+NVLTNFWGM+FTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLGDLLNEEEHAYRKIRLRAEDVQGKNVLTNFWGMNFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KW +LIEA+VDVKTTDN+TLR+FCIGFTK+  NQ KRTCYAQ+SQIRQIRRKMRE
Sbjct  111  RSLVRKWHTLIEAYVDVKTTDNFTLRLFCIGFTKRLPNQVKRTCYAQTSQIRQIRRKMRE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IMV QA SCDLK LV KFI E IGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  171  IMVAQAASCDLKSLVEKFIAEVIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEA-TEPVGA  64
            VHGDY+EDVG K+DRP ADEP+ EA TE +GA
Sbjct  231  VHGDYSEDVGVKVDRP-ADEPMPEAPTEVIGA  261



>dbj|BAJ93929.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=262

 Score =   364 bits (935),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 176/210 (84%), Positives = 190/210 (90%), Gaps = 2/210 (1%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQ DED AFRKIRLRAEDVQG+NVLTNFWGMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQGDEDQAFRKIRLRAEDVQGKNVLTNFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R NQ KRTCYAQ+SQIRQIRRKM E
Sbjct  111  RSLVRKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRPNQVKRTCYAQASQIRQIRRKMVE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM NQA +CDLK+LV KFIPE IG+EIEKATSSI+PLQNV++RKVKILKAPKFD+GKLME
Sbjct  171  IMANQASTCDLKELVSKFIPEVIGKEIEKATSSIFPLQNVYVRKVKILKAPKFDIGKLME  230

Query  156  VHGDYT-EDVGTKLDRPA-ADEPIAEATEP  73
            VHGDY  EDVG KL+RPA ADE   E   P
Sbjct  231  VHGDYNKEDVGVKLERPAEADEAGVEVAAP  260



>ref|XP_004302028.1| PREDICTED: 40S ribosomal protein S3a-2 [Fragaria vesca subsp. 
vesca]
Length=259

 Score =   364 bits (934),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 177/211 (84%), Positives = 193/211 (91%), Gaps = 2/211 (1%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQ DED+A+RKIRLRAEDVQG++VLTNFWGMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQKDEDHAYRKIRLRAEDVQGKDVLTNFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTDNYTLR+FCI FTK+R NQ KRTCYAQSSQIRQIRRKMRE
Sbjct  111  RSLVRKWQTLIEAHVDVKTTDNYTLRLFCIAFTKRRANQVKRTCYAQSSQIRQIRRKMRE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM+NQA +CDLK+LV KFIPE IGREIEKATSSIYPLQ+VFIRK KILKAPKFDLGKLME
Sbjct  171  IMINQASACDLKELVQKFIPEMIGREIEKATSSIYPLQHVFIRKAKILKAPKFDLGKLME  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEATEPVGA  64
            VH +  EDVG K+DRP A+E + E T  VGA
Sbjct  231  VH-EKKEDVGVKIDRP-AEEIVPEETTIVGA  259



>ref|NP_001152574.1| 40S ribosomal protein S3a [Zea mays]
 gb|ACG48293.1| 40S ribosomal protein S3a [Zea mays]
 gb|AFW89328.1| 40S ribosomal protein S3a [Zea mays]
Length=260

 Score =   363 bits (933),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 173/207 (84%), Positives = 188/207 (91%), Gaps = 1/207 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGT+IASEGLKHRVFEV LADLQ DED A+RKIRLRAEDVQGRNVLTNFWGM+FTTDKL
Sbjct  51   TQGTRIASEGLKHRVFEVCLADLQGDEDQAYRKIRLRAEDVQGRNVLTNFWGMNFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLVKKWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R NQ KRTCYAQ+SQIRQIRRKM E
Sbjct  111  RSLVKKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRPNQVKRTCYAQASQIRQIRRKMVE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM+NQA +CDLK+LV KFIPE IG+EIEK+TSSI+PLQNVFIRKVKILKAPKFDLGKLME
Sbjct  171  IMINQASTCDLKELVSKFIPEVIGKEIEKSTSSIFPLQNVFIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYTEDVGTKLDRPA-ADEPIAEAT  79
            VHGDY EDVG KL+RP   DE + E  
Sbjct  231  VHGDYKEDVGVKLERPVEGDEAVQEVA  257



>ref|XP_004296667.1| PREDICTED: 40S ribosomal protein S3a [Fragaria vesca subsp. vesca]
Length=259

 Score =   363 bits (932),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 180/212 (85%), Positives = 194/212 (92%), Gaps = 4/212 (2%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFE SLADLQ DE++A+RK+RLRAEDVQGR VLTNFWGM+FTTDKL
Sbjct  51   TQGTKIASEGLKHRVFETSLADLQGDEEHAYRKMRLRAEDVQGRTVLTNFWGMNFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQSSQIRQIRRKM E
Sbjct  111  RSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRPNQVKRTCYAQSSQIRQIRRKMTE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IMV+QA SCDLKDLV KFI ESIG+EIEK T+SIYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  171  IMVSQASSCDLKDLVRKFIAESIGKEIEKQTTSIYPLQNVFIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEA-TEPVGA  64
            VHGD  EDVGTK+DRP A+E + EA  E VGA
Sbjct  231  VHGD--EDVGTKVDRP-AEEAVPEAPVEIVGA  259



>gb|ACN40078.1| unknown [Picea sitchensis]
Length=260

 Score =   363 bits (931),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 178/211 (84%), Positives = 191/211 (91%), Gaps = 1/211 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFE+SLADLQN ED AFRKI+LRAEDVQGRNVLTNFWGMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFELSLADLQN-EDQAFRKIKLRAEDVQGRNVLTNFWGMDFTTDKL  109

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTD+YTLRMFCIGFTK+R NQ KRTCYAQSSQIRQIRRKM E
Sbjct  110  RSLVRKWQTLIEAHVDVKTTDSYTLRMFCIGFTKRRPNQVKRTCYAQSSQIRQIRRKMTE  169

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM+ +A SCDLK+LV KFIPE IG+EIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  170  IMIREASSCDLKELVAKFIPEVIGKEIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  229

Query  156  VHGDYTEDVGTKLDRPAADEPIAEATEPVGA  64
            VHGDY+EDVG K+DR   + P     E VGA
Sbjct  230  VHGDYSEDVGVKVDRTTEEAPAEAEAELVGA  260



>gb|KFK37895.1| hypothetical protein AALP_AA3G043200 [Arabis alpina]
Length=261

 Score =   363 bits (931),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 175/212 (83%), Positives = 192/212 (91%), Gaps = 2/212 (1%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQNDEDNA+RKIRLRAEDVQG+NVLT FWGMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQNDEDNAYRKIRLRAEDVQGKNVLTQFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLVKKWQ+LIE HVDVKTTD+YTLRMFCI FTK+R NQ KRTCYAQSSQ+RQIRRKMR+
Sbjct  111  RSLVKKWQTLIECHVDVKTTDSYTLRMFCIAFTKRRANQVKRTCYAQSSQVRQIRRKMRD  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM+ +A S DLK+LV KFIPE+IG+EIEK+T +IYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  171  IMIKEASSVDLKELVKKFIPEAIGKEIEKSTQNIYPLQNVFIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYT-EDVGTKLDRPAADEPIAEATEPVGA  64
            VHGD T EDVG K+DRP  DE + E  E +GA
Sbjct  231  VHGDLTAEDVGVKVDRP-EDEAVEEPAEIIGA  261



>ref|XP_001761018.1| predicted protein [Physcomitrella patens]
 gb|EDQ74085.1| predicted protein [Physcomitrella patens]
Length=263

 Score =   363 bits (931),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 175/213 (82%), Positives = 189/213 (89%), Gaps = 2/213 (1%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            T GTKIAS+GLK RVFEVSLADLQNDED AFRKI+LRAEDVQG+NVLTNFWGMD TTDKL
Sbjct  51   TAGTKIASDGLKGRVFEVSLADLQNDEDQAFRKIKLRAEDVQGKNVLTNFWGMDLTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQSLIEAHVDVKTTDNY +RMFCI FTKKR NQ K+TCYAQSSQIRQIRRKMRE
Sbjct  111  RSLVRKWQSLIEAHVDVKTTDNYQIRMFCIAFTKKRPNQIKKTCYAQSSQIRQIRRKMRE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IMV +AQSCDLK+LV KFIPE IG+EIEKAT  IYPLQN FIRKVKILKAPKFDL KLME
Sbjct  171  IMVREAQSCDLKELVAKFIPEVIGKEIEKATQGIYPLQNTFIRKVKILKAPKFDLMKLME  230

Query  156  VHGDYTEDVGTKLDRPAAD--EPIAEATEPVGA  64
            VHGDY+E+VG K++RP  D  EP+AEA    GA
Sbjct  231  VHGDYSEEVGAKIERPVGDEAEPVAEAAPVPGA  263



>ref|XP_002463137.1| hypothetical protein SORBIDRAFT_02g038365 [Sorghum bicolor]
 gb|EER99658.1| hypothetical protein SORBIDRAFT_02g038365 [Sorghum bicolor]
Length=263

 Score =   362 bits (930),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 174/205 (85%), Positives = 188/205 (92%), Gaps = 2/205 (1%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQ+DED A+RKIRLRAED+QGRNVLTNFWGM FTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQSDEDQAYRKIRLRAEDIQGRNVLTNFWGMSFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLVKKWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R NQ KRTCYAQ+SQIRQIRRKM E
Sbjct  111  RSLVKKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRPNQVKRTCYAQASQIRQIRRKMTE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM NQA +CDLK+LV KFIPE IG+EIEKATSSI+PLQNVFIRKVKILKAPKFD+GKLME
Sbjct  171  IMSNQASTCDLKELVSKFIPEVIGKEIEKATSSIFPLQNVFIRKVKILKAPKFDIGKLME  230

Query  156  VHGDYT-EDVGTKLDRPA-ADEPIA  88
            VHGDY  EDVG K+DRPA  DE + 
Sbjct  231  VHGDYAKEDVGVKMDRPAEGDEAMG  255



>ref|XP_002463138.1| hypothetical protein SORBIDRAFT_02g038370 [Sorghum bicolor]
 gb|EER99659.1| hypothetical protein SORBIDRAFT_02g038370 [Sorghum bicolor]
Length=263

 Score =   362 bits (930),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 174/205 (85%), Positives = 188/205 (92%), Gaps = 2/205 (1%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQ+DED A+RKIRLRAED+QGRNVLTNFWGM FTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQSDEDQAYRKIRLRAEDIQGRNVLTNFWGMSFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLVKKWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R NQ KRTCYAQ+SQIRQIRRKM E
Sbjct  111  RSLVKKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRPNQVKRTCYAQASQIRQIRRKMTE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM NQA +CDLK+LV KFIPE IG+EIEKATSSI+PLQNVFIRKVKILKAPKFD+GKLME
Sbjct  171  IMSNQASTCDLKELVSKFIPEVIGKEIEKATSSIFPLQNVFIRKVKILKAPKFDIGKLME  230

Query  156  VHGDYT-EDVGTKLDRPA-ADEPIA  88
            VHGDY  EDVG K+DRPA  DE + 
Sbjct  231  VHGDYAKEDVGVKMDRPAEGDEAMG  255



>ref|NP_001141038.1| hypothetical protein [Zea mays]
 ref|XP_008660439.1| PREDICTED: 40S ribosomal protein S3a [Zea mays]
 gb|ACF79246.1| unknown [Zea mays]
 gb|ACF85254.1| unknown [Zea mays]
 gb|AFW89336.1| hypothetical protein ZEAMMB73_605321 [Zea mays]
Length=260

 Score =   362 bits (930),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 174/211 (82%), Positives = 190/211 (90%), Gaps = 3/211 (1%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGT+IASEGLKHRVFEV LADLQ DED A+RKIRLRAEDVQGRNVLTNFWGM+FTTDKL
Sbjct  51   TQGTRIASEGLKHRVFEVCLADLQGDEDQAYRKIRLRAEDVQGRNVLTNFWGMNFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLVKKWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R NQ KRTCYAQ+SQIRQIRRKM E
Sbjct  111  RSLVKKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRPNQVKRTCYAQASQIRQIRRKMVE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM+NQA +CDLK+LV KFIPE IG+EIEK+TSSI+PLQNVFIRKVKILKAPKFDLGKLME
Sbjct  171  IMINQASTCDLKELVSKFIPEVIGKEIEKSTSSIFPLQNVFIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEATEPVGA  64
            VHGDY EDVG KL+RP   +   EA + V A
Sbjct  231  VHGDYKEDVGVKLERPVEGD---EAGQEVAA  258



>gb|ABE66401.1| S phase protein [Striga asiatica]
Length=190

 Score =   359 bits (922),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 171/191 (90%), Positives = 184/191 (96%), Gaps = 1/191 (1%)
 Frame = -3

Query  687  TKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLRSL  508
            TKIASEGLKHRVFEVSLADLQ DED++FRKIRLRAEDVQG+NVLTNFWGMDFTTDKLRSL
Sbjct  1    TKIASEGLKHRVFEVSLADLQGDEDHSFRKIRLRAEDVQGKNVLTNFWGMDFTTDKLRSL  60

Query  507  VKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREIMV  328
            V+KWQSLIEAHVDVKTTDNYTLR+FCI FTKKRVNQQKRTCYAQSSQIRQIRRKMREIMV
Sbjct  61   VRKWQSLIEAHVDVKTTDNYTLRLFCIAFTKKRVNQQKRTCYAQSSQIRQIRRKMREIMV  120

Query  327  NQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEVHG  148
            NQAQSCDLKDLV KF+PESIG+EIEKAT SIYPLQNV+IRKVKILKAPKFDL +LMEVHG
Sbjct  121  NQAQSCDLKDLVQKFVPESIGKEIEKATQSIYPLQNVYIRKVKILKAPKFDLSRLMEVHG  180

Query  147  DYTEDVGTKLD  115
            D+ E++G KL+
Sbjct  181  DH-EEIGVKLE  190



>gb|AFW89330.1| 40S ribosomal protein S3a [Zea mays]
 gb|AFW89331.1| 40S ribosomal protein S3a [Zea mays]
 gb|AFW89332.1| 40S ribosomal protein S3a [Zea mays]
Length=330

 Score =   365 bits (936),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 173/205 (84%), Positives = 188/205 (92%), Gaps = 1/205 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGT+IASEGLKHRVFEV LADLQ DED A+RKIRLRAEDVQGRNVLTNFWGM+FTTDKL
Sbjct  121  TQGTRIASEGLKHRVFEVCLADLQGDEDQAYRKIRLRAEDVQGRNVLTNFWGMNFTTDKL  180

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLVKKWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R NQ KRTCYAQ+SQIRQIRRKM E
Sbjct  181  RSLVKKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRPNQVKRTCYAQASQIRQIRRKMVE  240

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM+NQA +CDLK+LV KFIPE IG+EIEK+TSSI+PLQNVFIRKVKILKAPKFDLGKLME
Sbjct  241  IMINQASTCDLKELVSKFIPEVIGKEIEKSTSSIFPLQNVFIRKVKILKAPKFDLGKLME  300

Query  156  VHGDYTEDVGTKLDRPA-ADEPIAE  85
            VHGDY EDVG KL+RP   DE + E
Sbjct  301  VHGDYKEDVGVKLERPVEGDEAVQE  325



>ref|NP_001288829.1| 40S ribosomal protein S3a [Brassica rapa]
 sp|P49396.2|RS3A_BRACM RecName: Full=40S ribosomal protein S3a; AltName: Full=S phase-specific 
protein BIS289 [Brassica rapa]
 gb|AAA33013.1| S-phase-specific protein [Brassica rapa]
 emb|CAA81030.1| unnamed protein product [Brassica rapa]
Length=262

 Score =   362 bits (929),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 178/213 (84%), Positives = 191/213 (90%), Gaps = 3/213 (1%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADL  DED A+RKIRLRAEDVQGRNVLT FWGMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLNKDEDQAYRKIRLRAEDVQGRNVLTQFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLVKKWQ+LIE+HVDVKTTDNYTLR+FCI FTK+R NQ KRTCYAQSSQIRQIR KMRE
Sbjct  111  RSLVKKWQTLIESHVDVKTTDNYTLRLFCIAFTKRRANQVKRTCYAQSSQIRQIRSKMRE  170

Query  336  IMV-NQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLM  160
            IM+  +A SCDLK+LV KFIPESIG++IEKAT  IYPLQNVFIRKVKILKAPKFDL KLM
Sbjct  171  IMIKEEASSCDLKELVAKFIPESIGKDIEKATQGIYPLQNVFIRKVKILKAPKFDLRKLM  230

Query  159  EVHGDYT-EDVGTKLDRPAADEPIAEATEPVGA  64
            EVHGDYT EDVG K+DRP ADE + E TE +GA
Sbjct  231  EVHGDYTAEDVGVKVDRP-ADEVVEEPTEIIGA  262



>gb|AFW89335.1| 40S ribosomal protein S3a [Zea mays]
Length=332

 Score =   365 bits (936),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 173/205 (84%), Positives = 188/205 (92%), Gaps = 1/205 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGT+IASEGLKHRVFEV LADLQ DED A+RKIRLRAEDVQGRNVLTNFWGM+FTTDKL
Sbjct  123  TQGTRIASEGLKHRVFEVCLADLQGDEDQAYRKIRLRAEDVQGRNVLTNFWGMNFTTDKL  182

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLVKKWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R NQ KRTCYAQ+SQIRQIRRKM E
Sbjct  183  RSLVKKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRPNQVKRTCYAQASQIRQIRRKMVE  242

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM+NQA +CDLK+LV KFIPE IG+EIEK+TSSI+PLQNVFIRKVKILKAPKFDLGKLME
Sbjct  243  IMINQASTCDLKELVSKFIPEVIGKEIEKSTSSIFPLQNVFIRKVKILKAPKFDLGKLME  302

Query  156  VHGDYTEDVGTKLDRPA-ADEPIAE  85
            VHGDY EDVG KL+RP   DE + E
Sbjct  303  VHGDYKEDVGVKLERPVEGDEAVQE  327



>ref|NP_001149096.1| 40S ribosomal protein S3a [Zea mays]
 gb|ACG34188.1| 40S ribosomal protein S3a [Zea mays]
 gb|ACN31605.1| unknown [Zea mays]
Length=260

 Score =   361 bits (927),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 172/207 (83%), Positives = 188/207 (91%), Gaps = 1/207 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGT+IAS+GLKHRVFEV LADLQ DED A+RKIRLRAEDVQGRNVLTNFWGM+FTTDKL
Sbjct  51   TQGTRIASDGLKHRVFEVCLADLQGDEDQAYRKIRLRAEDVQGRNVLTNFWGMNFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLVKKWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R NQ KRTCYAQ+SQIRQIRRKM E
Sbjct  111  RSLVKKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRPNQVKRTCYAQASQIRQIRRKMVE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM+NQA +CDLK+LV KFIPE IG+EIEK+TSSI+PLQNVFIRKVKILKAPKFDLGKLME
Sbjct  171  IMINQASTCDLKELVSKFIPEVIGKEIEKSTSSIFPLQNVFIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYTEDVGTKLDRPA-ADEPIAEAT  79
            VHGDY EDVG KL+RP   DE + E  
Sbjct  231  VHGDYKEDVGVKLERPVEGDEAMQEVA  257



>ref|XP_001765967.1| predicted protein [Physcomitrella patens]
 gb|EDQ69288.1| predicted protein [Physcomitrella patens]
Length=259

 Score =   361 bits (926),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 171/205 (83%), Positives = 185/205 (90%), Gaps = 0/205 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            T GTKIAS+GLK RVFEVSLADLQNDED AFRKI+LRAEDVQG+NVLTNFWGMD TTDKL
Sbjct  51   TAGTKIASDGLKGRVFEVSLADLQNDEDQAFRKIKLRAEDVQGKNVLTNFWGMDLTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQSLIE+HVDVKTTDNY LR+FCI FTKKR NQ K+TCYAQSSQIRQIRRKMRE
Sbjct  111  RSLVRKWQSLIESHVDVKTTDNYMLRIFCIAFTKKRPNQIKKTCYAQSSQIRQIRRKMRE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM  +AQSCDLK+LV KFIPE IG+EIEKAT  IYPLQN FIRKVKILKAPKFDL KLME
Sbjct  171  IMTREAQSCDLKELVAKFIPEVIGKEIEKATQGIYPLQNTFIRKVKILKAPKFDLMKLME  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEA  82
            VHGDY+E+VG K++RP  DEP AEA
Sbjct  231  VHGDYSEEVGAKIERPVGDEPAAEA  255



>gb|AGT16352.1| 40S ribosomal protein S3a [Saccharum hybrid cultivar R570]
Length=260

 Score =   360 bits (923),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 173/211 (82%), Positives = 188/211 (89%), Gaps = 3/211 (1%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGT+IASEGLKHRVFEV LADLQ DED A+RKIRLRAEDVQGRNVLTNFWGM FTTDKL
Sbjct  51   TQGTRIASEGLKHRVFEVCLADLQGDEDQAYRKIRLRAEDVQGRNVLTNFWGMSFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R NQ KRTCYAQ+SQIRQIRRKM E
Sbjct  111  RSLVRKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRPNQVKRTCYAQASQIRQIRRKMVE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM NQA +CDLK+LV KFIPE IG+EIEK+TSSI+PLQNVFIRKVKILKAPKFDLGKLME
Sbjct  171  IMANQASTCDLKELVSKFIPEVIGKEIEKSTSSIFPLQNVFIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEATEPVGA  64
            VHGDY EDVG KL+RP   +   EA + V A
Sbjct  231  VHGDYKEDVGVKLERPVEGD---EAGQEVAA  258



>gb|ACG33267.1| 40S ribosomal protein S3a [Zea mays]
Length=260

 Score =   359 bits (921),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 171/207 (83%), Positives = 187/207 (90%), Gaps = 1/207 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGT+IAS+GLKHRVFEV LADLQ DED A+RKIRLRAEDVQGRNVLTNFWGM+FTTDKL
Sbjct  51   TQGTRIASDGLKHRVFEVCLADLQGDEDQAYRKIRLRAEDVQGRNVLTNFWGMNFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLVKKWQ+LIEAHVDVKTT NY LR+FCIGFTK+R NQ KRTCYAQ+SQIRQIRRKM E
Sbjct  111  RSLVKKWQTLIEAHVDVKTTXNYMLRLFCIGFTKRRPNQVKRTCYAQASQIRQIRRKMVE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM+NQA +CDLK+LV KFIPE IG+EIEK+TSSI+PLQNVFIRKVKILKAPKFDLGKLME
Sbjct  171  IMINQASTCDLKELVSKFIPEVIGKEIEKSTSSIFPLQNVFIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYTEDVGTKLDRPA-ADEPIAEAT  79
            VHGDY EDVG KL+RP   DE + E  
Sbjct  231  VHGDYKEDVGVKLERPVEGDEAMQEVA  257



>ref|XP_001767326.1| predicted protein [Physcomitrella patens]
 gb|EDQ67817.1| predicted protein [Physcomitrella patens]
Length=263

 Score =   358 bits (920),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 173/210 (82%), Positives = 188/210 (90%), Gaps = 1/210 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            T GTKIAS+GLK RVFEVSLADLQNDED AFRKI+LRAEDVQG+NVLTNFWGMD TTDKL
Sbjct  51   TAGTKIASDGLKGRVFEVSLADLQNDEDQAFRKIKLRAEDVQGKNVLTNFWGMDLTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQSLIEAHVDVKTTDNY LR+FCI FTKKR NQ K+TCYAQSSQIRQIRRKMRE
Sbjct  111  RSLVRKWQSLIEAHVDVKTTDNYQLRIFCIAFTKKRPNQIKKTCYAQSSQIRQIRRKMRE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM  +AQSCDLK+LV KFIPE+IG+EIEKAT  IYPLQN FIRKVKILKAPKFDL KLME
Sbjct  171  IMTKEAQSCDLKELVGKFIPEAIGKEIEKATQGIYPLQNTFIRKVKILKAPKFDLMKLME  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEA-TEPV  70
            VHGDY+E+VG K++RP  D+   EA TEPV
Sbjct  231  VHGDYSEEVGAKIERPVGDDAETEAVTEPV  260



>gb|ACG34058.1| 40S ribosomal protein S3a [Zea mays]
Length=260

 Score =   358 bits (919),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 171/207 (83%), Positives = 187/207 (90%), Gaps = 1/207 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGT+IAS+GLKHRVFEV LADLQ DED A+RKIRLRAEDVQ RNVLTNFWGM+FTTDKL
Sbjct  51   TQGTRIASDGLKHRVFEVCLADLQGDEDQAYRKIRLRAEDVQDRNVLTNFWGMNFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLVKKWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R NQ KRTCYAQ+SQIRQIRRKM E
Sbjct  111  RSLVKKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRPNQVKRTCYAQASQIRQIRRKMVE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM+NQA +CDLK+LV KFIPE IG+EIEK+TSSI+PLQNVFIRKVKILKAPKFDLGKLME
Sbjct  171  IMINQASTCDLKELVSKFIPEVIGKEIEKSTSSIFPLQNVFIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYTEDVGTKLDRPA-ADEPIAEAT  79
            VHGDY EDVG KL+RP   DE + E  
Sbjct  231  VHGDYKEDVGVKLERPVEGDEAMQEVA  257



>gb|KJB38201.1| hypothetical protein B456_006G241700 [Gossypium raimondii]
Length=258

 Score =   357 bits (917),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 179/213 (84%), Positives = 193/213 (91%), Gaps = 7/213 (3%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQN-DEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDK  520
            TQGTKIASEGLKHRVFEV LADLQ  DED+A+RKIRLRAEDVQG+NVLTNFWGM+FTTD+
Sbjct  51   TQGTKIASEGLKHRVFEVFLADLQGGDEDHAYRKIRLRAEDVQGKNVLTNFWGMNFTTDR  110

Query  519  LRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMR  340
            LRSLV+KWQ+LIEAHVDVKTTDNYTLR+FCIGFTK+R NQ KRTCYAQSSQIRQ    MR
Sbjct  111  LRSLVRKWQTLIEAHVDVKTTDNYTLRLFCIGFTKRRPNQVKRTCYAQSSQIRQ----MR  166

Query  339  EIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLM  160
            EIM  QA SCDLK+LV KFIPE IG+EIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLM
Sbjct  167  EIMTAQATSCDLKELVQKFIPEVIGKEIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLM  226

Query  159  EVHGDYTEDVGTKLDRPAADEPIAEA-TEPVGA  64
            EVHGDY+EDVG KL+RP ADE +AEA  E VGA
Sbjct  227  EVHGDYSEDVGVKLERP-ADETMAEAPAEVVGA  258



>gb|EEE53089.1| hypothetical protein OsJ_35850 [Oryza sativa Japonica Group]
Length=764

 Score =   373 bits (958),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 183/222 (82%), Positives = 200/222 (90%), Gaps = 6/222 (3%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQNDED A+RKIRLRAEDVQG+NVLTNFWGM FTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQNDEDQAYRKIRLRAEDVQGKNVLTNFWGMSFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLVKKWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R NQ KRTCYAQ+SQIRQIRRKM E
Sbjct  111  RSLVKKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRPNQVKRTCYAQASQIRQIRRKMVE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IMVNQA SCDLK+LV KFIPE IG+EIEKATSSI+PLQNVF+RKVKILKAPKFDLGKLME
Sbjct  171  IMVNQASSCDLKELVSKFIPEVIGKEIEKATSSIFPLQNVFVRKVKILKAPKFDLGKLME  230

Query  156  VHGDYTEDVGTKLDRPAADE--PIAEATEPVGA*N*VLI*FW  37
            VHGDY EDVGTKL+RPA DE  P  ++T+ +     VL+ +W
Sbjct  231  VHGDYKEDVGTKLERPAEDEVVPWDKSTDVLH----VLLNYW  268



>gb|EEC69140.1| hypothetical protein OsI_38068 [Oryza sativa Indica Group]
Length=818

 Score =   374 bits (961),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 179/210 (85%), Positives = 193/210 (92%), Gaps = 0/210 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQNDED A+RKIRLRAEDVQG+NVLTNFWGM FTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQNDEDQAYRKIRLRAEDVQGKNVLTNFWGMSFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLVKKWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R NQ KRTCYAQ+SQIRQIRRKM E
Sbjct  111  RSLVKKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRPNQVKRTCYAQASQIRQIRRKMVE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IMVNQA SCDLK+LV KFIPE IG+EIEKATSSI+PLQNVF+RKVKILKAPKFDLGKLME
Sbjct  171  IMVNQASSCDLKELVSKFIPEVIGKEIEKATSSIFPLQNVFVRKVKILKAPKFDLGKLME  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEATEPVG  67
            VHGDY EDVGTKL+RPA DE +   +  +G
Sbjct  231  VHGDYKEDVGTKLERPAEDEVVERDSSIIG  260



>gb|EMT30223.1| 40S ribosomal protein S3a [Aegilops tauschii]
Length=257

 Score =   355 bits (911),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 170/203 (84%), Positives = 182/203 (90%), Gaps = 0/203 (0%)
 Frame = -3

Query  672  EGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQ  493
            EGLKHRVFEVSLADLQNDED A+RKIRLRAEDVQG NVLTNFWGMDFTTDKLRSLV+KWQ
Sbjct  53   EGLKHRVFEVSLADLQNDEDQAYRKIRLRAEDVQGMNVLTNFWGMDFTTDKLRSLVRKWQ  112

Query  492  SLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREIMVNQAQS  313
            +LIEAHVDVKTTDNY LRMF IGFTK+R NQ KRTCYAQ+SQIRQIRRKM EIMVNQA S
Sbjct  113  TLIEAHVDVKTTDNYMLRMFTIGFTKRRPNQVKRTCYAQASQIRQIRRKMVEIMVNQAAS  172

Query  312  CDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEVHGDYTED  133
            CDLK+LV KFIPE IG+EIEKATSSI+PLQNV++RKVKILKAPKFDLGKLMEVHGDY ED
Sbjct  173  CDLKELVNKFIPEVIGKEIEKATSSIFPLQNVYVRKVKILKAPKFDLGKLMEVHGDYKED  232

Query  132  VGTKLDRPAADEPIAEATEPVGA  64
            VG KLDRPA  + +    E V A
Sbjct  233  VGVKLDRPADGDEVIPGAEEVAA  255



>gb|EYU30365.1| hypothetical protein MIMGU_mgv1a021183mg, partial [Erythranthe 
guttata]
Length=206

 Score =   353 bits (906),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 175/211 (83%), Positives = 188/211 (89%), Gaps = 8/211 (4%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            T  TKIASEGLKHRVFEVSLADLQ+DED AFRKIRLRAEDVQG+NVLTNFWGMDFTTDKL
Sbjct  4    TLNTKIASEGLKHRVFEVSLADLQSDEDLAFRKIRLRAEDVQGKNVLTNFWGMDFTTDKL  63

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVK TD+YTL++FCI FTKKR NQQKRTCYAQSSQIRQIRRKM E
Sbjct  64   RSLVRKWQTLIEAHVDVKKTDSYTLKLFCIAFTKKRANQQKRTCYAQSSQIRQIRRKMME  123

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IMV Q+QSCDLK+LV KFIPESIG+EIEKATSSI PL NVFIRKVKILKAPKFDLGKLME
Sbjct  124  IMVAQSQSCDLKELVQKFIPESIGKEIEKATSSICPLHNVFIRKVKILKAPKFDLGKLME  183

Query  156  VHGDYTEDVGTKLDRPAADEPIAEATEPVGA  64
            VH       G KLDR +A+E +AE TE VGA
Sbjct  184  VH-------GVKLDR-SAEEAVAEPTELVGA  206



>ref|XP_008224264.1| PREDICTED: 40S ribosomal protein S3a [Prunus mume]
Length=260

 Score =   355 bits (910),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 175/211 (83%), Positives = 188/211 (89%), Gaps = 1/211 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQ DE++A+RK+RLRAEDVQGRNVLTNFWGM+FTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQGDEEHAYRKMRLRAEDVQGRNVLTNFWGMNFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTDNYTLR+FCIGFTK+R NQ KRTCYAQSSQIRQIRRKMRE
Sbjct  111  RSLVRKWQTLIEAHVDVKTTDNYTLRLFCIGFTKRRPNQVKRTCYAQSSQIRQIRRKMRE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IMV QA S DLKDLV KFI ESIG+EIEKAT SIYPLQNVFIRKVKILKAPKFDL KLME
Sbjct  171  IMVAQATSSDLKDLVRKFIAESIGKEIEKATMSIYPLQNVFIRKVKILKAPKFDLTKLME  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEATEPVGA  64
            VHG   EDVG K++RPA +       E VGA
Sbjct  231  VHGG-NEDVGQKVERPAEEAVTEPPPEIVGA  260



>gb|KJB28385.1| hypothetical protein B456_005G045000 [Gossypium raimondii]
Length=249

 Score =   354 bits (908),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 170/190 (89%), Positives = 182/190 (96%), Gaps = 1/190 (1%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQN-DEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDK  520
            TQGTKIASEGLKHRVFEVSLADLQ  DED+A+RKIRLRAEDVQG+NVLTNFWGM+FTTDK
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQGGDEDHAYRKIRLRAEDVQGKNVLTNFWGMNFTTDK  110

Query  519  LRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMR  340
            LRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQSSQIRQIRRKMR
Sbjct  111  LRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRPNQVKRTCYAQSSQIRQIRRKMR  170

Query  339  EIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLM  160
            EIM  QA SCDLK+LV KFIPE+IG+EIEKATSSIYPLQNVFIR+VKILKAPKFDLGKLM
Sbjct  171  EIMTAQATSCDLKELVQKFIPETIGKEIEKATSSIYPLQNVFIRQVKILKAPKFDLGKLM  230

Query  159  EVHGDYTEDV  130
            EVHGDY+EDV
Sbjct  231  EVHGDYSEDV  240



>gb|EYU26004.1| hypothetical protein MIMGU_mgv1a019927mg, partial [Erythranthe 
guttata]
Length=209

 Score =   352 bits (903),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 174/211 (82%), Positives = 188/211 (89%), Gaps = 8/211 (4%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            T  TKIASEGLKHRVFEVSLADLQ+DED+AFRKIRLRAEDVQG+NVLTNFWGMDFTTDKL
Sbjct  7    TLNTKIASEGLKHRVFEVSLADLQSDEDHAFRKIRLRAEDVQGKNVLTNFWGMDFTTDKL  66

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVK TD+YTL++FCI FTKKR NQQKRTCYAQSSQI QIRRKM E
Sbjct  67   RSLVRKWQTLIEAHVDVKKTDSYTLKLFCIAFTKKRANQQKRTCYAQSSQILQIRRKMME  126

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IMV Q+QSCDLK+LV KFIPESIG+EIEKATSSI PL NVFIRKVKILKAPKFDLGKLME
Sbjct  127  IMVAQSQSCDLKELVQKFIPESIGKEIEKATSSICPLHNVFIRKVKILKAPKFDLGKLME  186

Query  156  VHGDYTEDVGTKLDRPAADEPIAEATEPVGA  64
            VH       G KLDR +A+E +AE TE VGA
Sbjct  187  VH-------GVKLDR-SAEEAVAEPTELVGA  209



>gb|AAX55706.1| cyc07 [Vitis vinifera]
Length=237

 Score =   352 bits (903),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 169/196 (86%), Positives = 180/196 (92%), Gaps = 2/196 (1%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRV  +SLADLQNDED A+RKIRLRAEDVQG+NVLTNFWGMDFTTDKL
Sbjct  29   TQGTKIASEGLKHRVSGISLADLQNDEDRAYRKIRLRAEDVQGKNVLTNFWGMDFTTDKL  88

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTDNYTLRMFCI FTK+   Q  +T YAQSSQIRQIRRKMRE
Sbjct  89   RSLVRKWQTLIEAHVDVKTTDNYTLRMFCIAFTKRSTRQ--KTSYAQSSQIRQIRRKMRE  146

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM  QA SCDLK+LV KFIPE IGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  147  IMTTQAASCDLKELVRKFIPEMIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  206

Query  156  VHGDYTEDVGTKLDRP  109
            VHGDY+EDVG K++RP
Sbjct  207  VHGDYSEDVGVKMERP  222



>gb|AAC98779.1| S-phase-specific ribosomal protein [Oryza sativa Japonica Group]
Length=261

 Score =   352 bits (902),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 167/197 (85%), Positives = 181/197 (92%), Gaps = 0/197 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADL+NDED A+RK+RLRAEDVQGRNVLTNFWGM FTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLRNDEDQAYRKVRLRAEDVQGRNVLTNFWGMSFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLVKKWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R NQ KRTCYAQ ++  + RRKM E
Sbjct  111  RSLVKKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRPNQVKRTCYAQVARSGRSRRKMVE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM NQA +CDLK+LV KFIPE IG+EIEK+TSSI+PLQNVFIRKVKILKAPKFDLGKLME
Sbjct  171  IMANQASTCDLKELVSKFIPEVIGKEIEKSTSSIFPLQNVFIRKVKILKAPKFDLGKLME  230

Query  156  VHGDYTEDVGTKLDRPA  106
            VHGDY EDVG KLDRPA
Sbjct  231  VHGDYKEDVGMKLDRPA  247



>ref|XP_004985318.1| PREDICTED: 40S ribosomal protein S3a-like isoform X1 [Setaria 
italica]
Length=290

 Score =   353 bits (905),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 177/239 (74%), Positives = 190/239 (79%), Gaps = 28/239 (12%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQ+DED A+RKIRLRAED+QGRNVLTNFWGMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQSDEDQAYRKIRLRAEDIQGRNVLTNFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R NQ KRTCYAQ+SQIRQIRRKM E
Sbjct  111  RSLVRKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRPNQVKRTCYAQASQIRQIRRKMVE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM NQA +CDLK+LV KFIPE IG+EIEKATSSI+PLQNVFIRKVKILKAPKFDLGKLME
Sbjct  171  IMANQASTCDLKELVSKFIPEVIGKEIEKATSSIFPLQNVFIRKVKILKAPKFDLGKLME  230

Query  156  ---------------------------VHGDYT-EDVGTKLDRPAADEPIAEATEPVGA  64
                                       VHGDYT EDVG KL+RPA  E      E   A
Sbjct  231  VIPSDRAIMFFPAFLWPVILTLNIASQVHGDYTKEDVGVKLERPAEAEEAVVGQEAAAA  289



>ref|XP_001774632.1| predicted protein [Physcomitrella patens]
 gb|EDQ60566.1| predicted protein [Physcomitrella patens]
Length=264

 Score =   350 bits (897),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 166/198 (84%), Positives = 179/198 (90%), Gaps = 0/198 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            T GTKIAS+GLK RVFEVSLADLQNDED AFRKI+LRAEDVQG+NVLTNFWGMD TTDKL
Sbjct  51   TAGTKIASDGLKGRVFEVSLADLQNDEDQAFRKIKLRAEDVQGKNVLTNFWGMDLTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQSLIEAHVDVKTTDNY LR+FCI FTKKR NQ K+TCYAQSSQIRQIRRKMRE
Sbjct  111  RSLVRKWQSLIEAHVDVKTTDNYQLRIFCIAFTKKRPNQIKKTCYAQSSQIRQIRRKMRE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM  +AQ+CDLK+LV KFIPE IG+EIEKAT  IYPLQN FIRKVKILKAPKFDL KLME
Sbjct  171  IMTREAQTCDLKELVAKFIPEVIGKEIEKATQGIYPLQNTFIRKVKILKAPKFDLMKLME  230

Query  156  VHGDYTEDVGTKLDRPAA  103
            VHGDY+E+VG K+DRP  
Sbjct  231  VHGDYSEEVGAKIDRPVG  248



>ref|XP_001755439.1| predicted protein [Physcomitrella patens]
 gb|EDQ79919.1| predicted protein [Physcomitrella patens]
Length=265

 Score =   348 bits (893),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 165/198 (83%), Positives = 179/198 (90%), Gaps = 0/198 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            T GTKIAS+GLK RVFEVSLADLQNDED AFRKI+LRAEDVQG+NVLTNFWGMD TTDKL
Sbjct  51   TAGTKIASDGLKGRVFEVSLADLQNDEDQAFRKIKLRAEDVQGKNVLTNFWGMDLTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQSLIEAHVDVKTTDNY LR+FCI FTKKR NQ K+TCYAQSSQIRQIRRKMRE
Sbjct  111  RSLVRKWQSLIEAHVDVKTTDNYQLRIFCIAFTKKRPNQIKKTCYAQSSQIRQIRRKMRE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM  +AQ+CDLK+LV KFIPE IG+EIEKAT  IYPLQN FIRKVKILKAPKFDL KLME
Sbjct  171  IMTKEAQTCDLKELVAKFIPEVIGKEIEKATQGIYPLQNTFIRKVKILKAPKFDLMKLME  230

Query  156  VHGDYTEDVGTKLDRPAA  103
            VHGDY+E+VG K++RP  
Sbjct  231  VHGDYSEEVGAKIERPVG  248



>gb|KJB28386.1| hypothetical protein B456_005G045000 [Gossypium raimondii]
Length=255

 Score =   348 bits (892),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 175/213 (82%), Positives = 191/213 (90%), Gaps = 10/213 (5%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQN-DEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDK  520
            TQGTKIASEGLKHRVFEVSLADLQ  DED+A+RKIRLRAEDVQG+NVLTNFWGM+FTTDK
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQGGDEDHAYRKIRLRAEDVQGKNVLTNFWGMNFTTDK  110

Query  519  LRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMR  340
            LRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQSSQIRQIRRKMR
Sbjct  111  LRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRPNQVKRTCYAQSSQIRQIRRKMR  170

Query  339  EIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLM  160
            EIM  QA SCDLK+LV KFIPE+IG+EIEKATSSIYPLQNVFIR+VKILKAPKFDLGKLM
Sbjct  171  EIMTAQATSCDLKELVQKFIPETIGKEIEKATSSIYPLQNVFIRQVKILKAPKFDLGKLM  230

Query  159  EVHGDYTEDVGTKLDRPAADEPIAEAT-EPVGA  64
            E+        G K++RP ADE +AE T E +GA
Sbjct  231  EMF-------GVKIERP-ADETMAEPTPELIGA  255



>ref|XP_001777314.1| predicted protein [Physcomitrella patens]
 gb|EDQ57844.1| predicted protein [Physcomitrella patens]
Length=269

 Score =   347 bits (889),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 167/205 (81%), Positives = 181/205 (88%), Gaps = 6/205 (3%)
 Frame = -3

Query  696  TQGTK------IASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMD  535
            T GTK      IAS+GLK RVFEVSLADLQNDED AFRKI+LRAEDVQG+NVLTNFWGMD
Sbjct  51   TAGTKAISSSDIASDGLKGRVFEVSLADLQNDEDQAFRKIKLRAEDVQGKNVLTNFWGMD  110

Query  534  FTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQI  355
             TTDKLRSLV+KWQSLIEAHVDVKTTDNY +RMFCI FTKKR NQ K+TCYAQ+SQIRQI
Sbjct  111  LTTDKLRSLVRKWQSLIEAHVDVKTTDNYMIRMFCIAFTKKRPNQIKKTCYAQTSQIRQI  170

Query  354  RRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFD  175
            RRKMREIMV +AQSCDLK+LV KFIPE IG+EIEKAT  IYPLQN FIRKVKILKAPKFD
Sbjct  171  RRKMREIMVREAQSCDLKELVAKFIPEVIGKEIEKATQGIYPLQNTFIRKVKILKAPKFD  230

Query  174  LGKLMEVHGDYTEDVGTKLDRPAAD  100
            L KLMEVHGDY+E+VG K++RP  D
Sbjct  231  LMKLMEVHGDYSEEVGAKIERPVGD  255



>ref|XP_008391001.1| PREDICTED: 40S ribosomal protein S3a-2-like [Malus domestica]
 ref|XP_008360360.1| PREDICTED: 40S ribosomal protein S3a-2-like [Malus domestica]
 ref|XP_009371956.1| PREDICTED: 40S ribosomal protein S3a-2-like [Pyrus x bretschneideri]
Length=259

 Score =   344 bits (882),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 169/211 (80%), Positives = 185/211 (88%), Gaps = 2/211 (1%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQ DE++A+RK+RLRAEDVQG+ VLTNFWGM+FTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQGDEEHAYRKMRLRAEDVQGKTVLTNFWGMNFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQSSQ+RQIRRKM E
Sbjct  111  RSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRPNQVKRTCYAQSSQVRQIRRKMSE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM+ QA S DLK LV KFI ESIG+EIEKAT SIYPLQNVFIRKVKILKAPKFDL KLME
Sbjct  171  IMIAQATSSDLKGLVSKFIAESIGKEIEKATMSIYPLQNVFIRKVKILKAPKFDLTKLME  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEATEPVGA  64
            V+G   EDVG K++RPA +       E VGA
Sbjct  231  VYGG--EDVGVKVERPAEEAAPEVQQEIVGA  259



>ref|XP_008390932.1| PREDICTED: 40S ribosomal protein S3a-2-like [Malus domestica]
Length=259

 Score =   343 bits (881),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 169/211 (80%), Positives = 185/211 (88%), Gaps = 2/211 (1%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQ DE++A+RK+RLRAEDVQG+ VLTNFWGM+FTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQGDEEHAYRKMRLRAEDVQGKTVLTNFWGMNFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQSSQ+RQIRRKM E
Sbjct  111  RSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRPNQVKRTCYAQSSQVRQIRRKMSE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM+ QA S DLK LV KFI ESIG+EIEKAT SIYPLQNVFIRKVKILKAPKFDL KLME
Sbjct  171  IMIAQATSSDLKGLVNKFIAESIGKEIEKATMSIYPLQNVFIRKVKILKAPKFDLTKLME  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEATEPVGA  64
            V+G   EDVG K++RPA +       E VGA
Sbjct  231  VYGG--EDVGVKVERPAEEAAPEVQQEIVGA  259



>gb|KCW60693.1| hypothetical protein EUGRSUZ_H03423 [Eucalyptus grandis]
Length=237

 Score =   342 bits (878),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 163/181 (90%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFE SLADLQ DED+++RKIRLR EDVQGRNVLTNFWGM+FTTDKL
Sbjct  51   TQGTKIASEGLKHRVFETSLADLQGDEDHSYRKIRLRCEDVQGRNVLTNFWGMNFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQSSQIRQIRRKMRE
Sbjct  111  RSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRPNQVKRTCYAQSSQIRQIRRKMRE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IMVNQA SCDLK+LV KFIPESIG+EIEKATSSIYPLQNVFIRKVKILKAPKFDLGK ME
Sbjct  171  IMVNQATSCDLKELVRKFIPESIGKEIEKATSSIYPLQNVFIRKVKILKAPKFDLGKFME  230

Query  156  V  154
            +
Sbjct  231  I  231



>ref|XP_009335287.1| PREDICTED: 40S ribosomal protein S3a-2-like [Pyrus x bretschneideri]
Length=259

 Score =   342 bits (877),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 168/211 (80%), Positives = 184/211 (87%), Gaps = 2/211 (1%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQ DE++A+RK+RLRAEDVQG+ VLTNFWGM+FTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQGDEEHAYRKMRLRAEDVQGKTVLTNFWGMNFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQSSQ+RQIRRKM E
Sbjct  111  RSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRPNQVKRTCYAQSSQVRQIRRKMSE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM+ QA S DLK LV KFI ESIG+EIEKAT SIYPLQNVFIRKVKILKAPKFDL KLME
Sbjct  171  IMIAQATSSDLKGLVNKFIAESIGKEIEKATMSIYPLQNVFIRKVKILKAPKFDLTKLME  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEATEPVGA  64
            V+G   EDVG K++RP  +       E VGA
Sbjct  231  VYGG--EDVGVKVERPTEEAAPEVQQEIVGA  259



>sp|A7Q5X9.1|RS3A2_VITVI RecName: Full=40S ribosomal protein S3a-2 [Vitis vinifera]
Length=234

 Score =   340 bits (873),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 163/181 (90%), Positives = 171/181 (94%), Gaps = 0/181 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFE+SLADLQNDED+A+RKIRLRAEDVQG+NVLTNFWGMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEISLADLQNDEDHAYRKIRLRAEDVQGKNVLTNFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTDNYTLRMFCI FTKKR NQ K+T YAQSSQIRQIRRKMRE
Sbjct  111  RSLVRKWQTLIEAHVDVKTTDNYTLRMFCIAFTKKRQNQNKKTSYAQSSQIRQIRRKMRE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM  QA SCDLK+LV KFIPE IGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  171  IMTTQAASCDLKELVRKFIPEMIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  230

Query  156  V  154
             
Sbjct  231  A  231



>ref|XP_007226551.1| hypothetical protein PRUPE_ppa024854mg [Prunus persica]
 gb|EMJ27750.1| hypothetical protein PRUPE_ppa024854mg [Prunus persica]
Length=629

 Score =   353 bits (907),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 175/211 (83%), Positives = 188/211 (89%), Gaps = 1/211 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQ DE++A+RK+RLRAEDVQGRNVLTNFWGM+FTTDKL
Sbjct  420  TQGTKIASEGLKHRVFEVSLADLQGDEEHAYRKMRLRAEDVQGRNVLTNFWGMNFTTDKL  479

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTDNYTLR+FCIGFTK+R NQ KRTCYAQSSQIRQIRRKMRE
Sbjct  480  RSLVRKWQTLIEAHVDVKTTDNYTLRLFCIGFTKRRPNQVKRTCYAQSSQIRQIRRKMRE  539

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IMV QA S DLKDLV KFI ESIG+EIEKAT SIYPLQNVFIRKVKILKAPKFDL KLME
Sbjct  540  IMVAQATSSDLKDLVRKFIAESIGKEIEKATMSIYPLQNVFIRKVKILKAPKFDLTKLME  599

Query  156  VHGDYTEDVGTKLDRPAADEPIAEATEPVGA  64
            VHG   EDVG K++RPA +       E VGA
Sbjct  600  VHGG-NEDVGQKVERPAEEAVTEPPPEIVGA  629



>gb|ACU17112.1| unknown [Glycine max]
Length=227

 Score =   337 bits (865),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 160/176 (91%), Positives = 170/176 (97%), Gaps = 0/176 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQ DED+AF+KIRLRAEDVQG+NVLTNFWGMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQGDEDHAFKKIRLRAEDVQGKNVLTNFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQSSQ+RQIRRKMRE
Sbjct  111  RSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRSNQVKRTCYAQSSQVRQIRRKMRE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLG  169
            IMVNQA +CDLK+LV KFIPE IG+EIEKATSSIYPLQNVFIRKVKILKAPKFDLG
Sbjct  171  IMVNQAAACDLKELVRKFIPEMIGKEIEKATSSIYPLQNVFIRKVKILKAPKFDLG  226



>gb|KJB28382.1| hypothetical protein B456_005G045000 [Gossypium raimondii]
Length=248

 Score =   337 bits (864),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 174/182 (96%), Gaps = 1/182 (1%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQN-DEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDK  520
            TQGTKIASEGLKHRVFEVSLADLQ  DED+A+RKIRLRAEDVQG+NVLTNFWGM+FTTDK
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQGGDEDHAYRKIRLRAEDVQGKNVLTNFWGMNFTTDK  110

Query  519  LRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMR  340
            LRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQSSQIRQIRRKMR
Sbjct  111  LRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRPNQVKRTCYAQSSQIRQIRRKMR  170

Query  339  EIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLM  160
            EIM  QA SCDLK+LV KFIPE+IG+EIEKATSSIYPLQNVFIR+VKILKAPKFDLGKLM
Sbjct  171  EIMTAQATSCDLKELVQKFIPETIGKEIEKATSSIYPLQNVFIRQVKILKAPKFDLGKLM  230

Query  159  EV  154
            EV
Sbjct  231  EV  232



>ref|XP_002949135.1| component of cytosolic 80S ribosome and 40S small subunit [Volvox 
carteri f. nagariensis]
 gb|EFJ49628.1| component of cytosolic 80S ribosome and 40S small subunit [Volvox 
carteri f. nagariensis]
Length=257

 Score =   332 bits (852),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 157/195 (81%), Positives = 175/195 (90%), Gaps = 0/195 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASE LK RVFEVSLADLQ +ED+AFRK+RLR EDVQGRN LTNFWGMDFTTDKL
Sbjct  51   TQGTKIASEALKGRVFEVSLADLQKNEDDAFRKMRLRVEDVQGRNCLTNFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTD YTLR+FCI FTKKR  Q KRTCYAQS+QIRQIR+KM E
Sbjct  111  RSLVRKWQTLIEAHVDVKTTDGYTLRVFCISFTKKRQGQIKRTCYAQSAQIRQIRKKMTE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            I+  +A SCDLKDLV KFIPE+IG++IEK+   IYPLQN FIRKVK+LKAPKFD+ KLME
Sbjct  171  IITREATSCDLKDLVAKFIPEAIGKDIEKSCQGIYPLQNTFIRKVKVLKAPKFDITKLME  230

Query  156  VHGDYTEDVGTKLDR  112
            VHGDY+E+VGTKLDR
Sbjct  231  VHGDYSEEVGTKLDR  245



>emb|CDY17474.1| BnaC03g65890D [Brassica napus]
Length=245

 Score =   330 bits (847),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 165/212 (78%), Positives = 179/212 (84%), Gaps = 18/212 (8%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQ+DED+A+RKIRLRAEDVQGRNVLT FWGMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQSDEDHAYRKIRLRAEDVQGRNVLTQFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLVKKWQ+LIEAHVDVKTTD+YTLRMFCIGFTK+R NQ KRTCYAQSSQ+RQIRRKM E
Sbjct  111  RSLVKKWQTLIEAHVDVKTTDSYTLRMFCIGFTKRRANQVKRTCYAQSSQVRQIRRKMSE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IMV +A SCDLK+LV KFIPE+IG+EIEKAT +IYPLQNVFIRK                
Sbjct  171  IMVKEASSCDLKELVAKFIPEAIGKEIEKATQNIYPLQNVFIRK----------------  214

Query  156  VHGDYT-EDVGTKLDRPAADEPIAEATEPVGA  64
            VHGDYT EDVG K+DRP  DE   E TE +GA
Sbjct  215  VHGDYTAEDVGVKVDRP-DDETAEEPTEIIGA  245



>gb|KHN21710.1| 40S ribosomal protein S3a [Glycine soja]
Length=335

 Score =   333 bits (853),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 157/185 (85%), Positives = 171/185 (92%), Gaps = 0/185 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTK AS+GLKHRVFEVSLADLQ DED+AF+KIRLRAEDVQG+NVLTNFWGM FTTDKL
Sbjct  51   TQGTKTASDGLKHRVFEVSLADLQGDEDHAFKKIRLRAEDVQGKNVLTNFWGMSFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAH DVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQSSQ++QIRRKM E
Sbjct  111  RSLVRKWQTLIEAHADVKTTDNYTLRMFCIGFTKRRSNQVKRTCYAQSSQVKQIRRKMTE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IMVNQ  SCDLK++V K IPE IG+EIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  171  IMVNQTTSCDLKEVVRKLIPEMIGKEIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  230

Query  156  VHGDY  142
            +H  +
Sbjct  231  LHSIF  235



>ref|XP_001693710.1| ribosomal protein S3a, component of cytosolic 80S ribosome and 
40S small subunit [Chlamydomonas reinhardtii]
 sp|A8HS48.1|RS3A_CHLRE RecName: Full=40S ribosomal protein S3a [Chlamydomonas reinhardtii]
 gb|EDP08964.1| ribosomal protein S3a [Chlamydomonas reinhardtii]
Length=259

 Score =   328 bits (840),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 154/195 (79%), Positives = 174/195 (89%), Gaps = 0/195 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASE LK RVFEVSLADLQ +ED+AFRK+RLR EDVQGRN LTNFWGMDFTTDKL
Sbjct  51   TQGTKIASEALKGRVFEVSLADLQKNEDDAFRKMRLRVEDVQGRNCLTNFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTD YTLR+FCI FTKKR  Q KRTCYAQS+QIRQIR+KM E
Sbjct  111  RSLVRKWQTLIEAHVDVKTTDGYTLRVFCISFTKKRQGQIKRTCYAQSAQIRQIRKKMME  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            I+  +A SCDLK+LV KFIPESIG++IEK+   IYPLQN FIRKVK+LKAPKFD+ KLME
Sbjct  171  IITREATSCDLKELVAKFIPESIGKDIEKSCQGIYPLQNTFIRKVKVLKAPKFDITKLME  230

Query  156  VHGDYTEDVGTKLDR  112
            VHGDY+E+VG K++R
Sbjct  231  VHGDYSEEVGAKIER  245



>gb|KDO74488.1| hypothetical protein CISIN_1g024879mg [Citrus sinensis]
Length=245

 Score =   325 bits (832),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 157/181 (87%), Positives = 168/181 (93%), Gaps = 0/181 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSL DL N+E++A+RKIRLRAEDVQG+NVLTNFWGMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLGDLHNEEEHAYRKIRLRAEDVQGKNVLTNFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KW +LIEA+VDVKTTDNYTLRMFCIGFTK+  NQ KRTCYAQ+SQIRQIRRKMRE
Sbjct  111  RSLVRKWHTLIEAYVDVKTTDNYTLRMFCIGFTKRLPNQVKRTCYAQASQIRQIRRKMRE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM+ QA SCDLK LV KFI E IGREIEKAT SIYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  171  IMIAQAASCDLKGLVEKFIAEIIGREIEKATLSIYPLQNVFIRKVKILKAPKFDLGKLME  230

Query  156  V  154
            V
Sbjct  231  V  231



>ref|XP_001774288.1| predicted protein [Physcomitrella patens]
 gb|EDQ60924.1| predicted protein [Physcomitrella patens]
Length=254

 Score =   325 bits (832),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 161/211 (76%), Positives = 176/211 (83%), Gaps = 12/211 (6%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            T GTKIAS+GL+ RVFE          D AFRKI+LRAEDVQG+NVLTNFWGMD TTDKL
Sbjct  51   TAGTKIASDGLRGRVFE----------DQAFRKIKLRAEDVQGKNVLTNFWGMDLTTDKL  100

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQSLIEAHVDVKTTDNY LR+FCI  TKKR NQ K+TCYAQSSQIRQIRRKMRE
Sbjct  101  RSLVRKWQSLIEAHVDVKTTDNYQLRIFCIASTKKRPNQIKKTCYAQSSQIRQIRRKMRE  160

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM  +AQ+CDLKDLV KFIPE IG+EIEKAT  IYPLQN FIRKVKILKAPKFDL KLME
Sbjct  161  IMTREAQTCDLKDLVSKFIPEVIGKEIEKATQGIYPLQNTFIRKVKILKAPKFDLMKLME  220

Query  156  VHGDYTEDVGTKLDRPAAD--EPIAEATEPV  70
            VHGDY+E+VG+K++RP  D  E  A A EPV
Sbjct  221  VHGDYSEEVGSKIERPVGDVAETDAGAAEPV  251



>ref|XP_009406018.1| PREDICTED: 40S ribosomal protein S3a {ECO:0000255|HAMAP-Rule:MF_03122}-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=241

 Score =   320 bits (821),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 155/188 (82%), Positives = 167/188 (89%), Gaps = 1/188 (1%)
 Frame = -3

Query  627  QNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNY  448
            +NDED A RKIRLRAEDVQG+NVL NFWGMD TTDK+R +V+KWQ+LIEAHVDVKTTDNY
Sbjct  55   KNDEDQAHRKIRLRAEDVQGKNVLANFWGMDLTTDKVRYVVRKWQTLIEAHVDVKTTDNY  114

Query  447  TLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESI  268
            TLRMFCIGFTK+R NQ KRTCYAQSSQIRQIRRKMREIMVNQA + DLKDLV KFIPE I
Sbjct  115  TLRMFCIGFTKRRPNQVKRTCYAQSSQIRQIRRKMREIMVNQATTGDLKDLVQKFIPEVI  174

Query  267  GREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIA  88
            G+EIEKAT+SIYPLQNVFIRKVKILKAPKFDLGKLMEVHGDY EDVG K+DRPA D  + 
Sbjct  175  GKEIEKATTSIYPLQNVFIRKVKILKAPKFDLGKLMEVHGDYKEDVGAKVDRPAEDVQM-  233

Query  87   EATEPVGA  64
            E  E  GA
Sbjct  234  EGEEVTGA  241



>ref|XP_005650618.1| ribosomal protein S3Ae [Coccomyxa subellipsoidea C-169]
 gb|EIE26074.1| ribosomal protein S3Ae [Coccomyxa subellipsoidea C-169]
Length=259

 Score =   321 bits (823),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 155/208 (75%), Positives = 175/208 (84%), Gaps = 1/208 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIAS+GLK RVFEVSLADLQ +E +AFRKIRLR EDVQGRN LTNFWGMD+TTDKL
Sbjct  51   TQGTKIASDGLKGRVFEVSLADLQTNEADAFRKIRLRVEDVQGRNCLTNFWGMDYTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEA VDVKTTD Y LRMF I FTKKR  Q K+T YAQSSQIRQIR+KM E
Sbjct  111  RSLVRKWQTLIEAQVDVKTTDGYLLRMFAIAFTKKRTGQVKKTAYAQSSQIRQIRKKMVE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM  +A SCDLK+LV KFIPE+IG+EIEKAT  IYPLQN  IRKVKIL+APKFDL KL+E
Sbjct  171  IMTREASSCDLKELVGKFIPEAIGKEIEKATQGIYPLQNTAIRKVKILRAPKFDLTKLLE  230

Query  156  VHGDYTEDVGTKL-DRPAADEPIAEATE  76
            VHGDY+E+ G K+ ++PA + P A   E
Sbjct  231  VHGDYSEEAGAKIAEKPAEEIPGAATAE  258



>ref|XP_001765908.1| predicted protein [Physcomitrella patens]
 gb|EDQ69229.1| predicted protein [Physcomitrella patens]
Length=244

 Score =   320 bits (820),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 154/180 (86%), Positives = 164/180 (91%), Gaps = 0/180 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            T GTKIAS+GLK RVFEVSLADLQNDED AFRKI+LRAEDVQG+NVLTNFWGMD TTDKL
Sbjct  51   TAGTKIASDGLKGRVFEVSLADLQNDEDQAFRKIKLRAEDVQGKNVLTNFWGMDLTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQSLIE+HVDVKTTDNY LR+FCI FTKKR NQ K+TCYAQSSQIRQIRRKMRE
Sbjct  111  RSLVRKWQSLIESHVDVKTTDNYMLRIFCIAFTKKRPNQIKKTCYAQSSQIRQIRRKMRE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM  +AQSCDLK+LV KFIPE IG+EIEKAT  IYPLQN FIRKVKILKAPKFDL KLME
Sbjct  171  IMTREAQSCDLKELVAKFIPEVIGKEIEKATQGIYPLQNTFIRKVKILKAPKFDLMKLME  230



>ref|XP_002465526.1| hypothetical protein SORBIDRAFT_01g040570 [Sorghum bicolor]
 gb|EER92524.1| hypothetical protein SORBIDRAFT_01g040570 [Sorghum bicolor]
Length=254

 Score =   319 bits (817),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 160/206 (78%), Positives = 171/206 (83%), Gaps = 17/206 (8%)
 Frame = -3

Query  681  IASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLRSLVK  502
            IASEGLKHRVFEV LADLQ DED A+RKIRLRAEDVQGRNVLTNFWGM FTTDKLRSLVK
Sbjct  63   IASEGLKHRVFEVCLADLQGDEDQAYRKIRLRAEDVQGRNVLTNFWGMSFTTDKLRSLVK  122

Query  501  KWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREIMVNQ  322
            KWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R N              QIRRKM +IMVNQ
Sbjct  123  KWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRPN--------------QIRRKMVDIMVNQ  168

Query  321  AQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEVHGDY  142
            A SCDLK+LV KFIPE IG+EIEKATSSI+PLQNVFIRKVKILKAPKFDLGKLMEVHGDY
Sbjct  169  ASSCDLKELVSKFIPEVIGKEIEKATSSIFPLQNVFIRKVKILKAPKFDLGKLMEVHGDY  228

Query  141  TEDVGTKLDRPAADEPIAEATEPVGA  64
             EDVG KL+RP   +   EA + V A
Sbjct  229  KEDVGVKLERPVEGD---EAGQEVAA  251



>gb|KHG19561.1| 40S ribosomal S3a [Gossypium arboreum]
Length=245

 Score =   317 bits (811),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 164/213 (77%), Positives = 178/213 (84%), Gaps = 20/213 (9%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQN-DEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDK  520
            TQGTKIASEGLKHRVFEVSLADLQ  DED+A+RKI                 GM+FTTDK
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQGGDEDHAYRKI-----------------GMNFTTDK  93

Query  519  LRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMR  340
            LRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQSSQIRQI RKMR
Sbjct  94   LRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRPNQVKRTCYAQSSQIRQICRKMR  153

Query  339  EIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLM  160
            EIM  QA SCDLK+LV KFIPE IG+EIEKATSSIYPLQNVFIR+VKILKAPKFDLGKLM
Sbjct  154  EIMTAQATSCDLKELVQKFIPEMIGKEIEKATSSIYPLQNVFIREVKILKAPKFDLGKLM  213

Query  159  EVHGDYTEDVGTKLDRPAADEPIAEAT-EPVGA  64
             VHGDY+EDV  K++RP ADE +AE T E +GA
Sbjct  214  AVHGDYSEDVRVKIERP-ADETMAEPTPELIGA  245



>gb|AAP80855.1| cyc07 [Triticum aestivum]
Length=242

 Score =   313 bits (802),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 152/186 (82%), Positives = 163/186 (88%), Gaps = 1/186 (1%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSLADLQNDED A+RKIRLRAEDVQG NVLTNFWGMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQNDEDQAYRKIRLRAEDVQGMNVLTNFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTDNY LRMF IGFTK+R NQ KRTCYAQ+SQIRQIRRKM E
Sbjct  111  RSLVRKWQTLIEAHVDVKTTDNYMLRMFAIGFTKRRPNQVKRTCYAQASQIRQIRRKMVE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFD-LGKLM  160
            IMVNQA SCDL +LV KFIPE IG+EIE ATS I PLQNV++RKVKI + P+    G   
Sbjct  171  IMVNQAASCDLXELVNKFIPEVIGKEIEXATSGIXPLQNVYVRKVKIPEGPQVSTWGSFX  230

Query  159  EVHGDY  142
            EVHGDY
Sbjct  231  EVHGDY  236



>emb|CBX25071.1| 40S ribosomal protein S3a [Polytomella sp. Pringsheim 198.80]
Length=262

 Score =   312 bits (800),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 146/200 (73%), Positives = 171/200 (86%), Gaps = 0/200 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLK RVFEVSLADLQ +E++AF+KIRLR EDVQGRN LTNF+GMDFTTDKL
Sbjct  51   TQGTKIASEGLKGRVFEVSLADLQKNEEDAFKKIRLRVEDVQGRNCLTNFYGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            R L++KWQSLIEAHVDVKTTD Y+LRMFCI FTKKR  Q KRTCYAQ+ QIR IR+KM E
Sbjct  111  RFLIRKWQSLIEAHVDVKTTDGYSLRMFCIAFTKKRQGQIKRTCYAQTGQIRSIRKKMVE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM  +A SC++K+LV K IPE+IG++IEKA   I+P+ NVF+RKVK+LK PKFD  KLME
Sbjct  171  IMAREASSCEVKELVAKLIPEAIGKDIEKACQGIFPITNVFVRKVKVLKTPKFDHAKLME  230

Query  156  VHGDYTEDVGTKLDRPAADE  97
            VHGDYT +VGTK++R   +E
Sbjct  231  VHGDYTAEVGTKVERVLIEE  250



>emb|CEG00819.1| Ribosomal protein S3Ae [Ostreococcus tauri]
Length=258

 Score =   309 bits (791),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 145/197 (74%), Positives = 173/197 (88%), Gaps = 1/197 (1%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIAS+GLK R+FE+SLADL NDED +FRK++L+ EDVQG+NVLTNF GMDFTTDK+
Sbjct  51   TQGTKIASDGLKGRIFEISLADLNNDEDQSFRKMKLKCEDVQGKNVLTNFAGMDFTTDKI  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KW SLIE  VDVKTTD Y+LR+FCIGFTK+R++Q KRTCYAQS+QIR+IR KM E
Sbjct  111  RSLVRKWFSLIECFVDVKTTDGYSLRVFCIGFTKRRIDQAKRTCYAQSAQIRRIRAKMVE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            I+  +  +CDLK+LVLKFIPE IG+EIEK+ S IYPLQNV+IRKVK+LKAPKFDL KLME
Sbjct  171  IITRECTTCDLKELVLKFIPEVIGKEIEKSCSGIYPLQNVYIRKVKVLKAPKFDLTKLME  230

Query  156  VHGDYT-EDVGTKLDRP  109
            VHGDY+ E VG  ++RP
Sbjct  231  VHGDYSNEAVGQPVERP  247



>ref|XP_001422366.1| Ribosomal protein S3a, component of cytosolic 80S ribosome and 
40S small subunit [Ostreococcus lucimarinus CCE9901]
 sp|A4SAD2.1|RS3A_OSTLU RecName: Full=40S ribosomal protein S3a [Ostreococcus lucimarinus 
CCE9901]
 gb|ABP00683.1| Ribosomal protein S3a, component of cytosolic 80S ribosome and 
40S small subunit [Ostreococcus lucimarinus CCE9901]
Length=260

 Score =   308 bits (790),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 146/197 (74%), Positives = 172/197 (87%), Gaps = 1/197 (1%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIAS+GLK R+FE+SLADL NDED +FRK++L+ EDVQG+NVLTNF GMDFTTDK+
Sbjct  51   TQGTKIASDGLKGRIFEISLADLNNDEDQSFRKMKLKCEDVQGKNVLTNFAGMDFTTDKI  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KW SLIE  VDVKTTD YTLR+FCIGFTK+R++Q KRTCYAQS+QIR+IR KM E
Sbjct  111  RSLVRKWFSLIECFVDVKTTDGYTLRVFCIGFTKRRMDQAKRTCYAQSAQIRKIRAKMVE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            I+  +  +CDLK+LVLKFIPE IG+EIEK+ + IYPLQNV+IRKVKILKAPKFDL KLME
Sbjct  171  IITRECTTCDLKELVLKFIPEVIGKEIEKSCAGIYPLQNVYIRKVKILKAPKFDLTKLME  230

Query  156  VHGDYT-EDVGTKLDRP  109
            VHGDY+ E VG  + RP
Sbjct  231  VHGDYSGEAVGEAVARP  247



>sp|Q9XEG7.3|RS3A_TORRU RecName: Full=40S ribosomal protein S3a [Syntrichia ruralis]
 gb|AAD23952.1|AF093109_1 ribosomal protein S3 [Syntrichia ruralis]
Length=248

 Score =   306 bits (785),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 153/194 (79%), Positives = 169/194 (87%), Gaps = 3/194 (2%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            T GTKIAS+GL  RVFEVSLADLQNDED AFRKI+LRAEDVQG+NVLTNFWGMDFTTDKL
Sbjct  50   TAGTKIASDGLNFRVFEVSLADLQNDEDQAFRKIKLRAEDVQGKNVLTNFWGMDFTTDKL  109

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQSLI+AHVDVKTTDNY +R+FCI FTKKR N   R  YAQSSQI  IRRKMRE
Sbjct  110  RSLVRKWQSLIQAHVDVKTTDNYQIRIFCIAFTKKRPNHT-RNFYAQSSQI-AIRRKMRE  167

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATS-SIYPLQNVFIRKVKILKAPKFDLGKLM  160
            IMV +AQ+CDLK+LV KFIPE IG+EI++  S  IYPLQ+ FIRKVKILKAPKFDL KLM
Sbjct  168  IMVKEAQTCDLKELVAKFIPEVIGKEIDEWRSQGIYPLQSTFIRKVKILKAPKFDLMKLM  227

Query  159  EVHGDYTEDVGTKL  118
            EVHGDY E+VG K+
Sbjct  228  EVHGDYNEEVGAKI  241



>ref|XP_002505259.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO66517.1| predicted protein [Micromonas sp. RCC299]
Length=263

 Score =   303 bits (775),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 151/213 (71%), Positives = 172/213 (81%), Gaps = 2/213 (1%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            + GTKIAS+GLK R+FE SLADLQ DED AFRK+ L+ EDVQG NVLT F GMDFTTDKL
Sbjct  51   SAGTKIASDGLKGRIFECSLADLQQDEDQAFRKMLLKCEDVQGTNVLTQFAGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KW SLIE  VDVKTTD YTLR+FCIGFTK+R++Q KRTCYAQS QIRQIR+KM E
Sbjct  111  RSLVRKWFSLIETFVDVKTTDQYTLRVFCIGFTKRRMDQTKRTCYAQSGQIRQIRKKMNE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            I+  +  SCDLK+ VLKFIPE IG+EIEK  + IYPLQNV+IRKVKILK PKFD+ KLME
Sbjct  171  IINREISSCDLKESVLKFIPEVIGKEIEKVCAGIYPLQNVYIRKVKILKRPKFDVTKLME  230

Query  156  VHGDYT-EDVGTKLDRPA-ADEPIAEATEPVGA  64
            VHGDY  ED G K+DRP    E + +  E VGA
Sbjct  231  VHGDYAGEDAGAKVDRPKDLIEKVEKRDEVVGA  263



>ref|XP_007508881.1| predicted protein [Bathycoccus prasinos]
 emb|CCO19967.1| predicted protein [Bathycoccus prasinos]
Length=267

 Score =   301 bits (772),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 143/196 (73%), Positives = 171/196 (87%), Gaps = 1/196 (1%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIAS+GLK R+FE SLADL  DED AFRK+ L+ EDVQG+NVLTNF+GMDFTTDK+
Sbjct  59   TQGTKIASDGLKGRIFECSLADLNQDEDQAFRKMFLKCEDVQGKNVLTNFYGMDFTTDKI  118

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KW SLIE  VDVKTTD YT+R+FCIGFTK+RV+Q KRTCYAQS+QIR+IR KM E
Sbjct  119  RSLVRKWFSLIECFVDVKTTDGYTMRVFCIGFTKRRVDQTKRTCYAQSAQIRKIRAKMVE  178

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            I+  + +SCDLK+LVLKFIPE IG+EIEK+ S IYPLQNV++RKVK+LK PKFD+ KLME
Sbjct  179  IIKRECESCDLKELVLKFIPEVIGKEIEKSCSGIYPLQNVYLRKVKMLKTPKFDVTKLME  238

Query  156  VHGDYT-EDVGTKLDR  112
            VHGDY+ E+VG ++ R
Sbjct  239  VHGDYSGEEVGQQIPR  254



>gb|AFW89333.1| hypothetical protein ZEAMMB73_166147 [Zea mays]
Length=313

 Score =   303 bits (776),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 145/183 (79%), Positives = 162/183 (89%), Gaps = 3/183 (2%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGT+IASEGLKHRVFEV LADLQ DED A+RKIRLRAEDVQGRNVLTNFWGM+FTTDKL
Sbjct  121  TQGTRIASEGLKHRVFEVCLADLQGDEDQAYRKIRLRAEDVQGRNVLTNFWGMNFTTDKL  180

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLVKKWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R NQ KRTCYAQ+SQIRQIRRKM E
Sbjct  181  RSLVKKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRPNQVKRTCYAQASQIRQIRRKMVE  240

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM+NQA +CDLK+LV KFIPE IG+EIEK+TSSI+PLQNVFIRK +  + P+    +  E
Sbjct  241  IMINQASTCDLKELVSKFIPEVIGKEIEKSTSSIFPLQNVFIRKGEDTQGPQV---RSWE  297

Query  156  VHG  148
             HG
Sbjct  298  THG  300



>ref|XP_003060358.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH55127.1| predicted protein [Micromonas pusilla CCMP1545]
Length=257

 Score =   294 bits (752),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 141/196 (72%), Positives = 165/196 (84%), Gaps = 1/196 (1%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            + GTKIAS+GLK R+FEVSLADL  DED AFRK+ L+ EDVQG NVLT F GMDFTTDK+
Sbjct  51   SAGTKIASDGLKGRIFEVSLADLNQDEDQAFRKMLLKCEDVQGTNVLTQFHGMDFTTDKI  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KW SLIE + DVKTTD Y LR+FCIGFTK+R++Q KRTCYAQS QIRQIR+KM E
Sbjct  111  RSLVRKWFSLIECYADVKTTDGYRLRVFCIGFTKRRMDQTKRTCYAQSGQIRQIRKKMVE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            I+  +  +CDLK+ VLKFIPE IG+EIEK  + IYPLQNV+IRKVKIL APKFD+ KLME
Sbjct  171  IISRETTTCDLKECVLKFIPEVIGKEIEKVCAGIYPLQNVYIRKVKILGAPKFDVTKLME  230

Query  156  VHGDYT-EDVGTKLDR  112
            VHGDYT E+VG K++R
Sbjct  231  VHGDYTSEEVGAKVER  246



>ref|XP_011395666.1| 40S ribosomal protein S3a [Auxenochlorella protothecoides]
 gb|KFM22801.1| 40S ribosomal protein S3a [Auxenochlorella protothecoides]
Length=260

 Score =   294 bits (752),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 139/197 (71%), Positives = 163/197 (83%), Gaps = 0/197 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            T GTKIAS+GLK RV  V+LADLQ ++ +A+R I+LR EDVQGR+ LTNF GMD TTDKL
Sbjct  51   TAGTKIASDGLKGRVITVNLADLQKNDADAYRNIKLRVEDVQGRHCLTNFHGMDLTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTD YTLR+F I FTKKR  Q K+T YAQSSQIR IRR+M +
Sbjct  111  RSLVRKWQTLIEAHVDVKTTDGYTLRLFAIAFTKKRAGQVKKTAYAQSSQIRAIRRRMVD  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM  +A S DLKDLV KFIPE+IG+EIEKA   IYPLQN F+RKVK+L++PKFD+GKLME
Sbjct  171  IMTREATSVDLKDLVAKFIPEAIGKEIEKACQGIYPLQNTFVRKVKVLRSPKFDVGKLME  230

Query  156  VHGDYTEDVGTKLDRPA  106
            VHGD   +V T +DRPA
Sbjct  231  VHGDLPTEVSTAVDRPA  247



>emb|CBI34197.3| unnamed protein product [Vitis vinifera]
Length=215

 Score =   290 bits (743),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 145/181 (80%), Positives = 153/181 (85%), Gaps = 19/181 (10%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFE+SLADLQNDED+A+RKIRLRAEDVQG+NVLTNFWGMDFTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEISLADLQNDEDHAYRKIRLRAEDVQGKNVLTNFWGMDFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVD                   R NQ K+T YAQSSQIRQIRRKMRE
Sbjct  111  RSLVRKWQTLIEAHVD-------------------RQNQNKKTSYAQSSQIRQIRRKMRE  151

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM  QA SCDLK+LV KFIPE IGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  152  IMTTQAASCDLKELVRKFIPEMIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  211

Query  156  V  154
             
Sbjct  212  A  212



>gb|ERZ98268.1| hypothetical protein GLOINDRAFT_339726, partial [Rhizophagus 
irregularis DAOM 181602]
Length=253

 Score =   287 bits (734),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 140/193 (73%), Positives = 164/193 (85%), Gaps = 1/193 (1%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQG K A++ LK RVFEVSLADL  DE+ AFRKI+LR ++VQG+N+LTNF GMDFT+DKL
Sbjct  47   TQGLKNANDALKGRVFEVSLADLNKDEEQAFRKIKLRVDEVQGKNLLTNFHGMDFTSDKL  106

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLVKKWQSLIEAHVDVKTTD Y LR+F I FTK+R NQ ++T YAQSSQIRQIR+KM +
Sbjct  107  RSLVKKWQSLIEAHVDVKTTDGYLLRLFAIAFTKRRPNQVRKTTYAQSSQIRQIRKKMFD  166

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM  QA +CDLK+LVLKF+PESIGREIEKA   IYPLQ V+IRKVKILK+PKFD+ KLME
Sbjct  167  IMTQQAATCDLKELVLKFVPESIGREIEKACQGIYPLQFVYIRKVKILKSPKFDVQKLME  226

Query  156  VHGDYTEDVGTKL  118
            +HGD   D G+K+
Sbjct  227  LHGDNI-DTGSKM  238



>ref|XP_003038024.1| 40S ribosomal protein S1 [Schizophyllum commune H4-8]
 gb|EFJ03122.1| hypothetical protein SCHCODRAFT_72059 [Schizophyllum commune 
H4-8]
Length=256

 Score =   286 bits (733),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 134/205 (65%), Positives = 170/205 (83%), Gaps = 0/205 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            +QG K A++ LK R+ EVSLADL  DE+ +FRKI+LR ++VQG+N LTNF GMDFT+DKL
Sbjct  51   SQGLKNANDSLKGRIVEVSLADLNKDEEQSFRKIKLRVDEVQGKNCLTNFHGMDFTSDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTD Y LR+F IGFTK+R  Q ++T YAQSSQ+R+IR+KM E
Sbjct  111  RSLVRKWQTLIEAHVDVKTTDGYLLRLFAIGFTKRRPTQVRKTTYAQSSQVREIRKKMFE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM  +A SCDLK+LV KF+PE+IGREIEKA+ SIYPLQNV++RK KILKAPKFD+ KLME
Sbjct  171  IMTREATSCDLKELVQKFVPEAIGREIEKASRSIYPLQNVYVRKAKILKAPKFDVSKLME  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEA  82
            +HG+ T++ GTK+ +   +  I E+
Sbjct  231  LHGESTDETGTKIAKDFKEPEILES  255



>ref|XP_007862325.1| 40S ribosomal protein S1 [Gloeophyllum trabeum ATCC 11539]
 gb|EPQ59292.1| 40S ribosomal protein S1 [Gloeophyllum trabeum ATCC 11539]
Length=256

 Score =   286 bits (731),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 136/205 (66%), Positives = 170/205 (83%), Gaps = 0/205 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            + G K A++ LK R+ EVSLADL  DE+ AFRKI+LR ++VQG+N LTNF GMDFT+DKL
Sbjct  51   SSGLKNANDSLKGRIIEVSLADLNKDEEQAFRKIKLRIDEVQGKNCLTNFHGMDFTSDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTD Y LR+F IGFTK+R +Q K+T YAQSSQIR+IR+KM E
Sbjct  111  RSLVRKWQTLIEAHVDVKTTDGYLLRLFAIGFTKRRQSQVKKTTYAQSSQIREIRKKMFE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM  +A SCDLK+LV KFIPE+IGREIEKAT SIYPLQNV++RK KILKAPKFD+ KL+E
Sbjct  171  IMTREATSCDLKELVQKFIPEAIGREIEKATRSIYPLQNVYVRKAKILKAPKFDVSKLLE  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEA  82
            +HG+ T++ GT++ +   +  I E+
Sbjct  231  LHGESTDETGTRVVKDFKEPEILES  255



>gb|KIY51600.1| ribosomal protein S3Ae [Fistulina hepatica ATCC 64428]
Length=256

 Score =   285 bits (730),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 136/205 (66%), Positives = 168/205 (82%), Gaps = 0/205 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            + G K A++ LK RV EVSLADL  DE+ AFRKI+LR ++VQG+N LTNF GMDFT+DKL
Sbjct  51   STGLKNANDSLKGRVVEVSLADLNKDEEQAFRKIKLRVDEVQGKNCLTNFHGMDFTSDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTD Y LR+F IGFTK+R +Q ++T YAQSSQIR+IRRKM E
Sbjct  111  RSLVRKWQTLIEAHVDVKTTDGYLLRLFAIGFTKRRPSQVRKTTYAQSSQIREIRRKMFE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM  +A SCDLK+LV KF+PE+IGREIEKA   IYPLQNV++RK KILKAPKFD+ KLME
Sbjct  171  IMTREATSCDLKELVQKFVPEAIGREIEKAARGIYPLQNVYVRKAKILKAPKFDMSKLME  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEA  82
            +HG+ T++ GTK+ +   +  I +A
Sbjct  231  LHGESTDETGTKVAKDFQEPEILDA  255



>ref|XP_003638197.1| 40S ribosomal protein S3a [Medicago truncatula]
Length=159

 Score =   281 bits (720),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 135/159 (85%), Positives = 144/159 (91%), Gaps = 0/159 (0%)
 Frame = -3

Query  540  MDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIR  361
            M+FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQSSQIR
Sbjct  1    MNFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRANQVKRTCYAQSSQIR  60

Query  360  QIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPK  181
            QIRRKM EIM+NQA SCDLK LV KFIPE IG+EIEKATSSIYPLQNVFIRKVKILKAPK
Sbjct  61   QIRRKMVEIMINQASSCDLKGLVHKFIPEMIGKEIEKATSSIYPLQNVFIRKVKILKAPK  120

Query  180  FDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  64
            FDLGKLMEVHGDY EDVGTK++RPA +    E TE VGA
Sbjct  121  FDLGKLMEVHGDYNEDVGTKVERPADEMVTEEPTEIVGA  159



>gb|KIK48635.1| hypothetical protein CY34DRAFT_797777 [Suillus luteus UH-Slu-Lm8-n1]
Length=256

 Score =   285 bits (728),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 133/205 (65%), Positives = 170/205 (83%), Gaps = 0/205 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            +QG K AS+ LK R+ EVSLADL  DE+ +FRKI+LR ++VQG+N LTNF GMDFT+DKL
Sbjct  51   SQGLKNASDSLKGRIIEVSLADLNKDEEQSFRKIKLRIDEVQGKNCLTNFHGMDFTSDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQSLIEAHVDVKTTD Y +R+F IGFTK+R NQ ++T YAQ+SQIR+IR+KM E
Sbjct  111  RSLVRKWQSLIEAHVDVKTTDGYLIRLFAIGFTKRRPNQVRKTTYAQTSQIREIRKKMFE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM  +A SCDLK+LV KF+PE+IGREIEK T +IYPLQNV++RK KILKAPKFD+ KL+E
Sbjct  171  IMTREASSCDLKELVQKFVPEAIGREIEKHTRNIYPLQNVYVRKAKILKAPKFDVSKLLE  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEA  82
            +HG+ T++ GT++ +   +  I E+
Sbjct  231  LHGESTDETGTRVAKDFKEPEILES  255



>gb|ABI52667.1| 40S ribosomal protein S3a [Argas monolakensis]
Length=255

 Score =   285 bits (728),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 144/213 (68%), Positives = 166/213 (78%), Gaps = 13/213 (6%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLK RVFEVS ADLQN ED AFRK RL AE+VQGRNVLTNF GMD TTDKL
Sbjct  38   TQGTKIASEGLKGRVFEVSQADLQNGED-AFRKFRLIAEEVQGRNVLTNFHGMDLTTDKL  96

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RS+VKKWQ+LIEA VDV+TTD Y LRMFCIGFTKK  NQ K+TCYAQ +Q+RQIR+KM E
Sbjct  97   RSMVKKWQTLIEATVDVRTTDGYLLRMFCIGFTKKCSNQVKKTCYAQHTQVRQIRKKMTE  156

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            +MV +  + DLKD+V K IPESIG++IEKA   IYPL +V IRKVK+LK PKF+LGKL+E
Sbjct  157  MMVREVSTSDLKDVVNKLIPESIGKDIEKACQRIYPLHDVLIRKVKVLKKPKFELGKLLE  216

Query  156  VHGDYTE------------DVGTKLDRPAADEP  94
            +HG+ T             + G K+DRP   EP
Sbjct  217  LHGEGTSKGGAAPATTPTGEEGIKVDRPEGYEP  249



>gb|EMD41078.1| hypothetical protein CERSUDRAFT_80722 [Ceriporiopsis subvermispora 
B]
Length=256

 Score =   284 bits (727),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 133/205 (65%), Positives = 169/205 (82%), Gaps = 0/205 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            +QG K A++ LK R+ E+SLADL NDE+ AFRKI+LR +++QG+N LTNF GM FT+DKL
Sbjct  51   SQGLKNANDSLKGRIVEISLADLNNDEEQAFRKIKLRVDEIQGKNCLTNFHGMAFTSDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTD Y +R+F IGFTK+R  Q ++T YAQSSQIR+IR+KM E
Sbjct  111  RSLVRKWQTLIEAHVDVKTTDGYLIRLFAIGFTKRRPQQVRKTTYAQSSQIREIRKKMFE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM  +A SCDLK+LV KF+PE+IGREIEKAT SIYPLQNV+I K KILKAPKFDL KL+E
Sbjct  171  IMTREASSCDLKELVQKFVPEAIGREIEKATRSIYPLQNVYIHKAKILKAPKFDLSKLLE  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEA  82
            +HG+ T++ GT++ +   +  I E+
Sbjct  231  LHGESTDETGTRVAKEFKEPEILES  255



>ref|XP_008671813.1| PREDICTED: 40S ribosomal protein S3a-like [Zea mays]
Length=238

 Score =   283 bits (725),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 137/181 (76%), Positives = 153/181 (85%), Gaps = 1/181 (1%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLKHRVFEVSL DL +DED  + KIRL AEDVQG NV+TNFWGM FTTDKL
Sbjct  51   TQGTKIASEGLKHRVFEVSLVDLHSDEDKTYMKIRLCAEDVQGGNVITNFWGMSFTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
             SLVKKWQ LIEAHV++KTTDNY LR+FCIGFTK+R N+ KRT YAQ+SQIR I  KM E
Sbjct  111  HSLVKKWQRLIEAHVNIKTTDNYMLRLFCIGFTKRRPNRVKRTSYAQASQIRHILWKMTE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM NQ  +CDLK+LV  FIPE IG+EIE ATS+I+PLQNVFIRKV  L +PKFD+GKLME
Sbjct  171  IMSNQTSTCDLKELVSNFIPEVIGKEIENATSTIFPLQNVFIRKVNTL-SPKFDIGKLME  229

Query  156  V  154
            V
Sbjct  230  V  230



>ref|XP_007268611.1| 40S ribosomal protein S1 [Fomitiporia mediterranea MF3/22]
 gb|EJD01334.1| 40S ribosomal protein S1 [Fomitiporia mediterranea MF3/22]
Length=256

 Score =   283 bits (725),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 132/205 (64%), Positives = 169/205 (82%), Gaps = 0/205 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            +QG K A++ L+ R+ EVSLADL  DE+ AFRKI+LR +++QG+N LTNF GMDFT+DKL
Sbjct  51   SQGLKNANDSLRGRIVEVSLADLAKDEEQAFRKIKLRIDEIQGKNCLTNFHGMDFTSDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTD Y LR+F I FTK+R  Q K+T YAQ++QIR+IR+KM E
Sbjct  111  RSLVRKWQTLIEAHVDVKTTDGYLLRLFAIAFTKRRPTQVKKTTYAQTAQIREIRKKMFE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM  +A SCDLK+LVLKFIPE+IGREIEKAT  IYPLQNV++RK KI+KAPKFD+ KLME
Sbjct  171  IMTREASSCDLKELVLKFIPEAIGREIEKATRKIYPLQNVYVRKAKIIKAPKFDVSKLME  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEA  82
            +HG+ T++ GT++ +   +  I E+
Sbjct  231  LHGESTDETGTRVAKEFKEPEIQES  255



>ref|XP_007315533.1| hypothetical protein SERLADRAFT_382295 [Serpula lacrymans var. 
lacrymans S7.9]
 gb|EGO01811.1| hypothetical protein SERLA73DRAFT_120459 [Serpula lacrymans var. 
lacrymans S7.3]
 gb|EGO27442.1| hypothetical protein SERLADRAFT_382295 [Serpula lacrymans var. 
lacrymans S7.9]
Length=256

 Score =   283 bits (724),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 132/205 (64%), Positives = 170/205 (83%), Gaps = 0/205 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            +QG K A++ LK R+ EVSLADL  DE+ ++RKI+LR ++VQG+N LTNF GMDFT+DKL
Sbjct  51   SQGLKNANDSLKGRIVEVSLADLNKDEEQSYRKIKLRIDEVQGKNCLTNFHGMDFTSDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQSLIEAHVDVKTTD Y +R+F IGFTK+R NQ ++T YAQ+SQIR+IR+KM E
Sbjct  111  RSLVRKWQSLIEAHVDVKTTDGYLIRLFAIGFTKRRPNQVRKTTYAQTSQIREIRKKMFE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM  +A SCDLK+LV KF+PE+IGREIEKA  SIYPLQNV++RK KILKAPKFD+ KL+E
Sbjct  171  IMTREATSCDLKELVQKFVPEAIGREIEKAARSIYPLQNVYVRKAKILKAPKFDVSKLLE  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEA  82
            +HG+ T++ GT++ +   +  I E+
Sbjct  231  LHGESTDETGTRIVKDFKEPEILES  255



>ref|XP_007843081.1| 40s ribosomal protein s3ae [Moniliophthora roreri MCA 2997]
 gb|ESK97646.1| 40s ribosomal protein s3ae [Moniliophthora roreri MCA 2997]
Length=256

 Score =   283 bits (723),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 131/205 (64%), Positives = 169/205 (82%), Gaps = 0/205 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            +QG + A++ LK RV EVSL DL  DED +FRKI+LR +++QG+N LTNF GMDFT+DKL
Sbjct  51   SQGLRNANDSLKGRVIEVSLGDLNKDEDQSFRKIKLRVDEIQGKNCLTNFHGMDFTSDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTD Y LR+F IGFTK+R  Q ++T YAQSSQIR+IR+KM E
Sbjct  111  RSLVRKWQTLIEAHVDVKTTDGYLLRLFAIGFTKRRPTQVRKTTYAQSSQIREIRKKMFE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM  +A +CDLK+LV KF+PE+IGREIEKA+ SIYPLQNV++RK KILKAPKFD+ KLME
Sbjct  171  IMTREASNCDLKELVQKFVPEAIGREIEKASRSIYPLQNVYVRKAKILKAPKFDVSKLME  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEA  82
            +HG+ T++ GT++ +   +  + E+
Sbjct  231  LHGETTDETGTRVAKDFKEPEVLES  255



>ref|XP_007382215.1| S-phase-specific ribosomal protein cyc07 [Punctularia strigosozonata 
HHB-11173 SS5]
 gb|EIN10703.1| S-phase-specific ribosomal protein cyc07 [Punctularia strigosozonata 
HHB-11173 SS5]
Length=256

 Score =   283 bits (723),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 133/205 (65%), Positives = 169/205 (82%), Gaps = 0/205 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            +QG K A++ LK R+ E+SL DL  DE+ AFRKI+LR ++VQG+N LTNF GMDFT+DKL
Sbjct  51   SQGLKNANDSLKGRIIELSLGDLNKDEEQAFRKIKLRIDEVQGKNCLTNFHGMDFTSDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTD Y LR+F IGFTK+R  Q K+T YAQS+QIR+IR+KM E
Sbjct  111  RSLVRKWQTLIEAHVDVKTTDGYILRLFAIGFTKRRPTQVKKTTYAQSAQIREIRKKMFE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM  +A SCDLK+LV KF+PE+IGREIEKAT SIYPLQNV+IRK KI+KAPKFD+ KL+E
Sbjct  171  IMTREASSCDLKELVQKFVPEAIGREIEKATRSIYPLQNVYIRKAKIIKAPKFDVSKLLE  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEA  82
            +HG+ T++ GT++ +   +  I E+
Sbjct  231  LHGETTDETGTRIIKDFKEPEILES  255



>ref|XP_007767741.1| ribosomal protein S3Ae [Coniophora puteana RWD-64-598 SS2]
 gb|EIW82383.1| ribosomal protein S3Ae [Coniophora puteana RWD-64-598 SS2]
Length=256

 Score =   283 bits (723),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 133/205 (65%), Positives = 169/205 (82%), Gaps = 0/205 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            +QG K A++ LK R+ EVSLADL  DE+ +FRKI+LR ++VQG+N LTNF GMDFT+DKL
Sbjct  51   SQGLKNANDSLKGRIIEVSLADLNKDEEQSFRKIKLRVDEVQGKNCLTNFHGMDFTSDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQSLIEAHVDVKTTD Y +R+F I FTK+R NQ ++T YAQSSQIR+IR+KM E
Sbjct  111  RSLVRKWQSLIEAHVDVKTTDGYLIRLFAIAFTKRRPNQVRKTTYAQSSQIREIRKKMFE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM  +A SCDLK+LV KF+PE+IGREIEK T +IYPLQNV+IRK KILKAPKFD+ KL+E
Sbjct  171  IMTREASSCDLKELVQKFVPEAIGREIEKNTRNIYPLQNVYIRKAKILKAPKFDVSKLLE  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEA  82
            +HG+ T++ GT++ +   +  I E+
Sbjct  231  LHGESTDETGTRVVKDFKEPEILES  255



>gb|KIM46265.1| hypothetical protein M413DRAFT_441346 [Hebeloma cylindrosporum 
h7]
Length=256

 Score =   282 bits (722),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 131/204 (64%), Positives = 169/204 (83%), Gaps = 0/204 (0%)
 Frame = -3

Query  693  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  514
            QG K  ++ LK R+ E+SLADL  DE+ +FRKI+LR +++QGRN LTNF GMDFT+DKLR
Sbjct  52   QGLKNPNDSLKGRIIEISLADLNKDEEQSFRKIKLRIDEIQGRNCLTNFHGMDFTSDKLR  111

Query  513  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  334
            SLV+KWQSLIEAHVDVKTTD Y LR+F IGFTK+R +Q ++T YAQSSQIR+IR+KM EI
Sbjct  112  SLVRKWQSLIEAHVDVKTTDGYLLRLFAIGFTKRRPSQVRKTTYAQSSQIREIRKKMFEI  171

Query  333  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  154
            M  +A +CDLK+LV KF+PE+IGREIEKA+ SIYPLQNV++RK KILKAPKFD+ KL+E+
Sbjct  172  MTREATTCDLKELVQKFVPEAIGREIEKASRSIYPLQNVYVRKAKILKAPKFDVSKLLEL  231

Query  153  HGDYTEDVGTKLDRPAADEPIAEA  82
            HG+ T++ GT++ +   +  I E+
Sbjct  232  HGESTDETGTRVAKEFKEPEILES  255



>gb|ABW23199.1| ribosomal protein rps3a [Eurythoe complanata]
Length=263

 Score =   283 bits (723),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 142/207 (69%), Positives = 167/207 (81%), Gaps = 7/207 (3%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQGTKIASEGLK RVFEVSLADLQNDE  AFRK +L AE+VQGRNVLTNF GM+ TTDKL
Sbjct  52   TQGTKIASEGLKGRVFEVSLADLQNDE-VAFRKFKLVAEEVQGRNVLTNFHGMNLTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RS+VKKWQ+LIEA+VDV+TTD + LR+FCIGFTKKR NQ K+TCYAQ +Q+R I +KM E
Sbjct  111  RSMVKKWQTLIEANVDVRTTDAFLLRLFCIGFTKKRQNQIKKTCYAQHTQVRAIXKKMVE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM  +  S DLK++V K IP+SIG++IEKA   IYPL +V+IRKVKILK PKFDLGKLME
Sbjct  171  IMSREVSSNDLKEVVNKLIPDSIGKDIEKACQGIYPLHDVYIRKVKILKKPKFDLGKLME  230

Query  156  VHGD------YTEDVGTKLDRPAADEP  94
            +HG+       T + G K+DRP   EP
Sbjct  231  LHGEGGTTKTVTTEGGEKVDRPEGYEP  257



>gb|KJB28384.1| hypothetical protein B456_005G045000 [Gossypium raimondii]
Length=230

 Score =   281 bits (719),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 151/213 (71%), Positives = 165/213 (77%), Gaps = 35/213 (16%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQN-DEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDK  520
            TQGTKIASEGLKHRVFEVSLADLQ  DED+A+RKIRLRAEDVQG+NVLTNFWGM+FTTDK
Sbjct  51   TQGTKIASEGLKHRVFEVSLADLQGGDEDHAYRKIRLRAEDVQGKNVLTNFWGMNFTTDK  110

Query  519  LRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMR  340
            LR                         MFCI FTK+R NQ KRTCYAQSSQIRQIRRKMR
Sbjct  111  LR-------------------------MFCIRFTKRRPNQVKRTCYAQSSQIRQIRRKMR  145

Query  339  EIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLM  160
            EIM  QA SCDLK+LV KFIPE+IG+EIEKATSSIYPLQNVFIR+VKILKAPKFDLGKLM
Sbjct  146  EIMTAQATSCDLKELVQKFIPETIGKEIEKATSSIYPLQNVFIRQVKILKAPKFDLGKLM  205

Query  159  EVHGDYTEDVGTKLDRPAADEPIAEAT-EPVGA  64
            E+        G K++RP ADE +AE T E +GA
Sbjct  206  EMF-------GVKIERP-ADETMAEPTPELIGA  230



>gb|KIJ70171.1| hypothetical protein HYDPIDRAFT_104846 [Hydnomerulius pinastri 
MD-312]
Length=256

 Score =   282 bits (721),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 132/205 (64%), Positives = 169/205 (82%), Gaps = 0/205 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            +QG K AS+ LK R+ EVSLADL  DE+ +FRKI+LR ++VQG+N LTNF GMDFT+DKL
Sbjct  51   SQGLKNASDSLKGRIVEVSLADLNKDEEQSFRKIKLRIDEVQGKNCLTNFHGMDFTSDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTD Y LR+F I FTK+R NQ ++T YAQSSQIR+IR+KM E
Sbjct  111  RSLVRKWQTLIEAHVDVKTTDGYLLRLFAIAFTKRRPNQVRKTTYAQSSQIREIRKKMFE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM  +A SCDLK+LV KF+PE+IGREIEK + +IYPLQNV++RK KILKAPKFD+ KL+E
Sbjct  171  IMTREASSCDLKELVQKFVPEAIGREIEKHSRNIYPLQNVYVRKAKILKAPKFDVSKLLE  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEA  82
            +HG+ T++ GT++ +   +  I E+
Sbjct  231  LHGESTDETGTRVAKDFKEPEILES  255



>sp|B0CY45.2|RS3A_LACBS RecName: Full=40S ribosomal protein S1 [Laccaria bicolor S238N-H82]
Length=256

 Score =   282 bits (721),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 129/205 (63%), Positives = 170/205 (83%), Gaps = 0/205 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            +QG K A++ LK R+ EVSLADL  DE+ +FRKI+LR +++QG+N LTNF GMDFT+DKL
Sbjct  51   SQGLKNANDSLKGRIIEVSLADLNKDEEQSFRKIKLRIDEIQGKNCLTNFHGMDFTSDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+L+EAHVDVKTTD Y LR+F IGFTK+R +Q ++T YAQSSQ+R+IR+KM E
Sbjct  111  RSLVRKWQTLVEAHVDVKTTDGYLLRLFAIGFTKRRPSQVRKTTYAQSSQVREIRKKMFE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM  +A +CDLK+LV KF+PE+IGREIEKA  SIYPLQNV++RK KILK+PKFD+ KL+E
Sbjct  171  IMTREATNCDLKELVQKFVPEAIGREIEKAARSIYPLQNVYVRKAKILKSPKFDMSKLLE  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEA  82
            +HGD T++ GT++ +   +  I E+
Sbjct  231  LHGDSTDETGTRIAKDFKEPEILES  255



>gb|KIK30608.1| hypothetical protein PISMIDRAFT_670675 [Pisolithus microcarpus 
441]
Length=256

 Score =   281 bits (720),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 130/193 (67%), Positives = 165/193 (85%), Gaps = 0/193 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            +QG K A++ LK R+ EVSLADLQ DE+ +FRKI+LR ++VQG+N LTNF GMDFT+DKL
Sbjct  51   SQGLKNANDSLKGRIIEVSLADLQKDEEQSFRKIKLRVDEVQGKNCLTNFHGMDFTSDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTD Y LR+F I FTK+R NQ ++T YAQ+SQIR+IR+KM E
Sbjct  111  RSLVRKWQTLIEAHVDVKTTDGYLLRLFAIAFTKRRPNQVRKTTYAQTSQIREIRKKMFE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM  +A SCDLK+LV KF+PE+IGREIEK T +IYPLQNV++RK KILKAPKFD+ KL+E
Sbjct  171  IMTREASSCDLKELVQKFVPEAIGREIEKHTRNIYPLQNVYVRKAKILKAPKFDVSKLLE  230

Query  156  VHGDYTEDVGTKL  118
            +HG+ T++ GT++
Sbjct  231  LHGETTDETGTRV  243



>gb|KIM33406.1| hypothetical protein M408DRAFT_153936 [Serendipita vermifera 
MAFF 305830]
Length=256

 Score =   281 bits (719),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 132/204 (65%), Positives = 166/204 (81%), Gaps = 0/204 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            +QG K AS+ LK R+ EVSLADL  DED  FRKI+LR ++VQG+N LTNF GMDFT+DKL
Sbjct  51   SQGLKNASDSLKGRIVEVSLADLVKDEDQTFRKIKLRVDEVQGKNCLTNFHGMDFTSDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQSLIEAHVDVKTTD Y +R+F I FTK+R NQ ++T YAQS+QIR+IR+KM E
Sbjct  111  RSLVRKWQSLIEAHVDVKTTDGYIIRLFAIAFTKRRANQVRKTTYAQSAQIREIRKKMFE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM  +A SCDLK+LV KF+PE+IGREIEKA   I+P+Q+VFIRK KI+KAPKFD+ KLME
Sbjct  171  IMTREATSCDLKELVQKFVPEAIGREIEKAARGIFPIQSVFIRKAKIVKAPKFDINKLME  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAE  85
            +HG+ T++ GTK+ +   +  + E
Sbjct  231  MHGEITDETGTKVAKDFKEPEVME  254



>gb|KDD76342.1| ribosomal protein S3Ae [Helicosporidium sp. ATCC 50920]
Length=259

 Score =   281 bits (720),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 133/195 (68%), Positives = 159/195 (82%), Gaps = 0/195 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            T GTKIAS+GLK R+  VSLADLQ++E +A+R I+LR EDVQGRN LT+F GMD TTDKL
Sbjct  51   TAGTKIASDGLKGRIINVSLADLQSNEADAYRNIKLRIEDVQGRNCLTHFHGMDLTTDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDV+T D YTLRMFCI FTKK   Q K+TCYAQS+QIR IRRKM +
Sbjct  111  RSLVRKWQTLIEAHVDVRTADGYTLRMFCISFTKKGAGQIKKTCYAQSAQIRAIRRKMVD  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            +M  +A SCDLKDLV KFIPE+IG++IEKA   I+PLQN FIRKVK+L+ PKFD  KL+E
Sbjct  171  VMTREATSCDLKDLVGKFIPEAIGKDIEKACLGIFPLQNTFIRKVKVLRTPKFDASKLLE  230

Query  156  VHGDYTEDVGTKLDR  112
            VH +Y  D G  ++R
Sbjct  231  VHENYDVDAGEVVER  245



>ref|XP_002428136.1| 40S ribosomal protein S3A, putative [Pediculus humanus corporis]
 gb|EEB15398.1| 40S ribosomal protein S3A, putative [Pediculus humanus corporis]
Length=263

 Score =   281 bits (720),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 138/206 (67%), Positives = 163/206 (79%), Gaps = 5/206 (2%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDED--NAFRKIRLRAEDVQGRNVLTNFWGMDFTTD  523
            TQGTKIASEGLK+RVFEVSLADLQND D   +FRK RL AEDVQGRNVLTNF GMD TTD
Sbjct  52   TQGTKIASEGLKNRVFEVSLADLQNDTDAERSFRKFRLIAEDVQGRNVLTNFHGMDLTTD  111

Query  522  KLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKM  343
            KLRS+VKKWQ+LIEAHVDVKTTD Y LR+FCIGFT K    QK+TCYAQ +Q+R IR+KM
Sbjct  112  KLRSMVKKWQTLIEAHVDVKTTDGYLLRVFCIGFTNKDQMSQKKTCYAQHTQVRAIRKKM  171

Query  342  REIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKL  163
             EI+  +    DLKD+V K +P+SI +EIEK    IYPL +V+IRKVK+LK P+FDL KL
Sbjct  172  TEIITKEVTDSDLKDVVQKLLPDSIAKEIEKYCQKIYPLHDVYIRKVKVLKKPRFDLSKL  231

Query  162  MEVHGD---YTEDVGTKLDRPAADEP  94
            +E+HGD    +++ G K+DRP   EP
Sbjct  232  LELHGDSKAASDEPGAKVDRPKGYEP  257



>sp|Q764D2.1|RS3A_LENED RecName: Full=40S ribosomal protein S1; AltName: Full=Protein 
cyc07 [Lentinula edodes]
 dbj|BAD11816.1| putative S-phase specific ribosomal protein cyc07 [Lentinula 
edodes]
Length=256

 Score =   281 bits (719),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 130/205 (63%), Positives = 169/205 (82%), Gaps = 0/205 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            +QG K A++ LK R+ EVSL DL  +E+ +FRKI+LR ++VQG+N LTNF GMDFT+DKL
Sbjct  51   SQGLKNANDSLKGRIIEVSLGDLNKEEEQSFRKIKLRVDEVQGKNCLTNFHGMDFTSDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTD Y LR+F IGFTK+R  Q ++T YAQSSQ+R+IR+KM E
Sbjct  111  RSLVRKWQTLIEAHVDVKTTDGYLLRLFAIGFTKRRPTQVRKTTYAQSSQVREIRKKMFE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM  +A +CDLK+LV KF+PE+IGREIEKA+ SIYPLQNV++RK KILKAPKFD+ KLME
Sbjct  171  IMTREATNCDLKELVQKFVPEAIGREIEKASRSIYPLQNVYVRKAKILKAPKFDVSKLME  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEA  82
            +HG+ T++ GTK+ +   +  + E+
Sbjct  231  LHGESTDETGTKIAKDFKEPEVLES  255



>gb|EXX58553.1| ribosomal 40S subunit protein S1A [Rhizophagus irregularis DAOM 
197198w]
Length=258

 Score =   281 bits (719),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 140/197 (71%), Positives = 164/197 (83%), Gaps = 5/197 (3%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            TQG K A++ LK RVFEVSLADL  DE+ AFRKI+LR ++VQG+N+LTNF GMDFT+DKL
Sbjct  48   TQGLKNANDALKGRVFEVSLADLNKDEEQAFRKIKLRVDEVQGKNLLTNFHGMDFTSDKL  107

Query  516  RSLVKKWQ----SLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRR  349
            RSLVKKWQ    SLIEAHVDVKTTD Y LR+F I FTK+R NQ ++T YAQSSQIRQIR+
Sbjct  108  RSLVKKWQGRLGSLIEAHVDVKTTDGYLLRLFAIAFTKRRPNQVRKTTYAQSSQIRQIRK  167

Query  348  KMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLG  169
            KM +IM  QA +CDLK+LVLKF+PESIGREIEKA   IYPLQ V+IRKVKILK+PKFD+ 
Sbjct  168  KMFDIMTQQAATCDLKELVLKFVPESIGREIEKACQGIYPLQFVYIRKVKILKSPKFDVQ  227

Query  168  KLMEVHGDYTEDVGTKL  118
            KLME+HGD   D G+K+
Sbjct  228  KLMELHGDNI-DTGSKM  243



>ref|XP_007392195.1| hypothetical protein PHACADRAFT_250267 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EKM59637.1| hypothetical protein PHACADRAFT_250267 [Phanerochaete carnosa 
HHB-10118-sp]
Length=256

 Score =   281 bits (719),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 132/205 (64%), Positives = 168/205 (82%), Gaps = 0/205 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            +QG K A++ LK R+ EVSLADL  DE+ AFRKI+LR ++VQG+N LTNF GM FT+DKL
Sbjct  51   SQGLKNANDSLKGRIIEVSLADLNKDEEQAFRKIKLRVDEVQGKNCLTNFHGMSFTSDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTD Y +R+F IGFTK+R NQ ++T YAQSSQIR+IR+KM E
Sbjct  111  RSLVRKWQTLIEAHVDVKTTDGYLIRLFTIGFTKRRPNQVRKTTYAQSSQIREIRKKMFE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM  +A SCDLK+LV KF+PE+IGREIEKA  SIYPLQNV++ K KILKAP+FDL KL+E
Sbjct  171  IMTREATSCDLKELVQKFVPEAIGREIEKAARSIYPLQNVYVHKAKILKAPRFDLSKLLE  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEA  82
            +HG+ T++ GT++ +   +  I E+
Sbjct  231  LHGESTDETGTRVVKDFKEPEILES  255



>gb|KIJ20179.1| hypothetical protein PAXINDRAFT_166304 [Paxillus involutus ATCC 
200175]
 gb|KIK98754.1| hypothetical protein PAXRUDRAFT_823536 [Paxillus rubicundulus 
Ve08.2h10]
Length=256

 Score =   281 bits (719),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 132/205 (64%), Positives = 169/205 (82%), Gaps = 0/205 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            +QG K A++ LK RV EVSLADL  DE+ +FRKI+LR ++VQG+N LTNF GMDFT+DKL
Sbjct  51   SQGLKNANDSLKGRVVEVSLADLNGDEEQSFRKIKLRIDEVQGKNCLTNFHGMDFTSDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTD Y LR+F I FTK+R NQ ++T YAQ+SQIR+IR+KM E
Sbjct  111  RSLVRKWQTLIEAHVDVKTTDGYLLRLFAIAFTKRRPNQVRKTTYAQTSQIREIRKKMFE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM  +A SCDLK+LV KF+PE+IGREIEK T +IYPLQNV++RK KILKAPKFD+ KL+E
Sbjct  171  IMTREASSCDLKELVQKFVPEAIGREIEKHTRNIYPLQNVYVRKAKILKAPKFDVSKLLE  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEA  82
            +HG+ T++ GT++ +   +  I E+
Sbjct  231  LHGESTDETGTRVAKDFKEPEILES  255



>gb|KIK65348.1| hypothetical protein GYMLUDRAFT_38796 [Gymnopus luxurians FD-317 
M1]
Length=256

 Score =   281 bits (718),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 131/205 (64%), Positives = 169/205 (82%), Gaps = 0/205 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            +QG K A++ LK R+ EVSL DL  +E+ +FRKI+LR ++VQG+N LTNF GMDFT+DKL
Sbjct  51   SQGLKNANDSLKGRIIEVSLGDLNKEEEQSFRKIKLRVDEVQGKNCLTNFHGMDFTSDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTD Y LR+F IGFTK+R  Q ++T YAQSSQ+R+IR+KM E
Sbjct  111  RSLVRKWQTLIEAHVDVKTTDGYLLRLFAIGFTKRRPTQVRKTTYAQSSQVREIRKKMFE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM  ++ +CDLK+LV KF+PE+IGREIEKA+ SIYPLQNV+IRK KILKAPKFD+ KLME
Sbjct  171  IMTRESTNCDLKELVQKFVPEAIGREIEKASRSIYPLQNVYIRKAKILKAPKFDVSKLME  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEA  82
            +HG+ T++ GTK+ +   +  I E+
Sbjct  231  LHGESTDETGTKIAKDFKEPEILES  255



>gb|AFU72288.1| 40S ribosomal protein S1, partial [Amanita strobiliformis]
Length=219

 Score =   280 bits (715),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 131/205 (64%), Positives = 168/205 (82%), Gaps = 0/205 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            + G K A++ LK R+ E+SLADL  DE+ AFRKI+LR ++VQG+N LTNF GMDFT+DKL
Sbjct  14   STGMKNANDSLKGRIIEISLADLNKDEEQAFRKIKLRIDEVQGKNCLTNFHGMDFTSDKL  73

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTD Y LR+F IGFTK+R +Q ++T YAQSSQ+R+IR+KM E
Sbjct  74   RSLVRKWQTLIEAHVDVKTTDGYLLRLFAIGFTKRRPSQVRKTTYAQSSQVREIRKKMFE  133

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            I+  +A SCDLK+LV KF+PE+IGREIEKA   IYPLQNV+IRK KILKAPKFD+ KL+E
Sbjct  134  IITREATSCDLKELVQKFVPEAIGREIEKACRGIYPLQNVYIRKAKILKAPKFDVSKLLE  193

Query  156  VHGDYTEDVGTKLDRPAADEPIAEA  82
            +HG+ T++ GTK+ +   +  I E+
Sbjct  194  LHGESTDETGTKVAKDFQEPEILES  218



>gb|KIM68608.1| hypothetical protein SCLCIDRAFT_1208801 [Scleroderma citrinum 
Foug A]
Length=256

 Score =   281 bits (718),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 131/205 (64%), Positives = 170/205 (83%), Gaps = 0/205 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            +QG K A++ LK R+ EVSLADLQ DE+ +FRKIRLR ++VQG+N LTNF GMDFT+DKL
Sbjct  51   SQGLKNANDSLKGRIVEVSLADLQKDEEQSFRKIRLRIDEVQGKNCLTNFHGMDFTSDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTD Y LR+F I FTK+R +Q ++T YAQ+SQ+R+IR+KM E
Sbjct  111  RSLVRKWQTLIEAHVDVKTTDGYLLRLFAIAFTKRRPSQVRKTTYAQTSQVREIRKKMFE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM  +A SCDLK+LV KF+PE+IGREIEK T +IYPLQNV++RK KILKAPKFD+ KL+E
Sbjct  171  IMTREATSCDLKELVQKFVPEAIGREIEKHTRNIYPLQNVYVRKAKILKAPKFDMSKLLE  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEA  82
            +HG+ T++ GT++ +   +  I E+
Sbjct  231  LHGESTDETGTRVVKDFKEPEILES  255



>gb|KIK06774.1| hypothetical protein K443DRAFT_674057 [Laccaria amethystina LaAM-08-1]
Length=256

 Score =   281 bits (718),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 128/205 (62%), Positives = 170/205 (83%), Gaps = 0/205 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            +QG K A++ L+ R+ EVSLADL  DE+ +FRKI+LR +++QG+N LTNF GMDFT+DKL
Sbjct  51   SQGLKNANDSLRGRIIEVSLADLNKDEEQSFRKIKLRIDEIQGKNCLTNFHGMDFTSDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+L+EAHVDVKTTD Y LR+F IGFTK+R +Q ++T YAQSSQ+R+IR+KM E
Sbjct  111  RSLVRKWQTLVEAHVDVKTTDGYLLRLFAIGFTKRRPSQVRKTTYAQSSQVREIRKKMFE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM  +A +CDLK+LV KF+PE+IGREIEKA  SIYPLQNV++RK KILK+PKFD+ KL+E
Sbjct  171  IMTREATNCDLKELVQKFVPEAIGREIEKAARSIYPLQNVYVRKAKILKSPKFDMSKLLE  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEA  82
            +HGD T++ GT++ +   +  I E+
Sbjct  231  LHGDSTDETGTRIAKDFKEPEILES  255



>gb|KJA29982.1| hypothetical protein HYPSUDRAFT_81601 [Hypholoma sublateritium 
FD-334 SS-4]
Length=256

 Score =   281 bits (718),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 129/205 (63%), Positives = 171/205 (83%), Gaps = 0/205 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            +QG K A++ LK R+ E+SLADL  DE+ +FRKI+LR +++QG+N LTNF GMDFT+DKL
Sbjct  51   SQGLKNANDSLKGRIIELSLADLNKDEEQSFRKIKLRIDEIQGKNCLTNFHGMDFTSDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTD Y LR+F IGFTK+R +Q ++T YAQ+SQIR+IR+KM E
Sbjct  111  RSLVRKWQTLIEAHVDVKTTDGYLLRLFAIGFTKRRPSQVRKTTYAQTSQIREIRKKMFE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM  +A +CDLK+LV KF+PE+IGREIEKA+ SIYPLQNV++RK KILKAPKFD+ KL+E
Sbjct  171  IMTREATTCDLKELVQKFVPEAIGREIEKASRSIYPLQNVYVRKAKILKAPKFDVSKLLE  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEA  82
            +HG+ T++ GT++ +   +  I E+
Sbjct  231  LHGESTDETGTRVAKEFKEPEILES  255



>gb|KIY73683.1| putative S-phase-specific ribosomal protein cyc07 [Cylindrobasidium 
torrendii FP15055 ss-10]
Length=256

 Score =   280 bits (717),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 130/205 (63%), Positives = 169/205 (82%), Gaps = 0/205 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            +QG K A++ LK R+ EVSL DL  DE+ +FRK+RLR ++VQG+N LTNF GMDFT+DKL
Sbjct  51   SQGLKNANDSLKGRIIEVSLGDLNKDEEQSFRKMRLRVDEVQGKNCLTNFHGMDFTSDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTD Y LR+F IGFTK+R +Q ++T YAQS+Q+R+IR+KM E
Sbjct  111  RSLVRKWQTLIEAHVDVKTTDGYLLRLFAIGFTKRRPSQVRKTTYAQSAQVREIRKKMFE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM  +A + DLKDLV KFIPE+IGREIEKA+ SIYPLQNV++RK KILKAPKFD+ KLME
Sbjct  171  IMTREATTVDLKDLVQKFIPEAIGREIEKASRSIYPLQNVYVRKAKILKAPKFDINKLME  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEA  82
            +HG+ T++ GT++ +   +  + E+
Sbjct  231  LHGESTDETGTRIAKDFKEPEVLES  255



>ref|XP_001877091.1| 40S ribosomal protein S1 [Laccaria bicolor S238N-H82]
 gb|EDR12827.1| predicted protein [Laccaria bicolor S238N-H82]
Length=273

 Score =   281 bits (719),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 129/205 (63%), Positives = 170/205 (83%), Gaps = 0/205 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            +QG K A++ LK R+ EVSLADL  DE+ +FRKI+LR +++QG+N LTNF GMDFT+DKL
Sbjct  68   SQGLKNANDSLKGRIIEVSLADLNKDEEQSFRKIKLRIDEIQGKNCLTNFHGMDFTSDKL  127

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+L+EAHVDVKTTD Y LR+F IGFTK+R +Q ++T YAQSSQ+R+IR+KM E
Sbjct  128  RSLVRKWQTLVEAHVDVKTTDGYLLRLFAIGFTKRRPSQVRKTTYAQSSQVREIRKKMFE  187

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM  +A +CDLK+LV KF+PE+IGREIEKA  SIYPLQNV++RK KILK+PKFD+ KL+E
Sbjct  188  IMTREATNCDLKELVQKFVPEAIGREIEKAARSIYPLQNVYVRKAKILKSPKFDMSKLLE  247

Query  156  VHGDYTEDVGTKLDRPAADEPIAEA  82
            +HGD T++ GT++ +   +  I E+
Sbjct  248  LHGDSTDETGTRIAKDFKEPEILES  272



>gb|KIM90711.1| hypothetical protein PILCRDRAFT_811171 [Piloderma croceum F 1598]
Length=256

 Score =   280 bits (717),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 131/205 (64%), Positives = 169/205 (82%), Gaps = 0/205 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            +QG K A++ LK R+ EVSLADL  DE+ +FRKI+LR ++VQG+N LTNF GMDFT+DKL
Sbjct  51   SQGLKNANDSLKGRIIEVSLADLNKDEEQSFRKIKLRIDEVQGKNCLTNFHGMDFTSDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTD Y LR+F IGFTK+R  Q ++T YAQS+QIR+IR+KM E
Sbjct  111  RSLVRKWQTLIEAHVDVKTTDGYLLRLFAIGFTKRRQTQVRKTTYAQSAQIREIRKKMFE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM  +A SCDLK+LV KF+PE+IGREIEKA  SIYPLQNV++RK KILKAPKFD+ KL+E
Sbjct  171  IMTREATSCDLKELVQKFVPEAIGREIEKAARSIYPLQNVYVRKAKILKAPKFDVSKLLE  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEA  82
            +HG+ T++ GT++ +   +  + E+
Sbjct  231  LHGESTDETGTRVVKDFKEPEVLES  255



>ref|XP_001837102.1| 40S ribosomal protein S1 [Coprinopsis cinerea okayama7#130]
 sp|A8NX92.1|RS3A_COPC7 RecName: Full=40S ribosomal protein S1 [Coprinopsis cinerea okayama7#130]
 gb|EAU84719.1| 40s ribosomal protein s3ae-a [Coprinopsis cinerea okayama7#130]
Length=256

 Score =   280 bits (716),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 128/205 (62%), Positives = 170/205 (83%), Gaps = 0/205 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            +QG K A++ L+ R+ EVSLADL  DE+ +FRKI+LR +++QGRN LTNF GMDFT+DKL
Sbjct  51   SQGLKNANDSLRGRIIEVSLADLNKDEEQSFRKIKLRVDEIQGRNCLTNFHGMDFTSDKL  110

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+L+EAHVDVKTTD Y LR+F IGFTK+R  Q K+T YAQ++Q+R++R+KM E
Sbjct  111  RSLVRKWQTLVEAHVDVKTTDGYLLRLFAIGFTKRRPTQVKKTTYAQTAQVRELRKKMFE  170

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            I+  +A SCDLK+LV KF+PE+IGREIEKA+ SIYPLQNV+IRK KILKAPKFD+ KL+E
Sbjct  171  IITREATSCDLKELVQKFVPEAIGREIEKASRSIYPLQNVYIRKAKILKAPKFDVSKLLE  230

Query  156  VHGDYTEDVGTKLDRPAADEPIAEA  82
            +HGD T++ GT++ +   +  + E+
Sbjct  231  LHGDSTDESGTRVTKDFKEPEVLES  255



>gb|EPS95373.1| hypothetical protein FOMPIDRAFT_157719 [Fomitopsis pinicola FP-58527 
SS1]
Length=266

 Score =   280 bits (717),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 132/205 (64%), Positives = 169/205 (82%), Gaps = 0/205 (0%)
 Frame = -3

Query  696  TQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  517
            +QG K A++ LK R+ EVSLADL NDE+ AFRKI+LR ++VQG++ LTNF GM F++DKL
Sbjct  61   SQGLKNANDSLKGRIVEVSLADLNNDEEQAFRKIKLRIDEVQGKHCLTNFHGMSFSSDKL  120

Query  516  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  337
            RSLV+KWQ+LIEAHVDVKTTD Y LR+F IGFTK+R +Q ++T YAQSSQIR+IRRKM E
Sbjct  121  RSLVRKWQTLIEAHVDVKTTDGYLLRLFAIGFTKRRPSQVRKTTYAQSSQIREIRRKMFE  180

Query  336  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  157
            IM  +A SCDLK+LV KFIPE+IGREIEKA  SIYP+QNV++ K KILKAPKFD+ KL+E
Sbjct  181  IMTREATSCDLKELVQKFIPEAIGREIEKAARSIYPVQNVYVHKAKILKAPKFDMSKLLE  240

Query  156  VHGDYTEDVGTKLDRPAADEPIAEA  82
            +HG+ T++ GT++ +   +  I E+
Sbjct  241  LHGESTDETGTRVAKDFKEPEILES  265



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1185322056160