BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF026F22

Length=769
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009765667.1|  PREDICTED: pentatricopeptide repeat-containi...    142   2e-35   Nicotiana sylvestris
ref|XP_009608994.1|  PREDICTED: pentatricopeptide repeat-containi...    135   7e-33   Nicotiana tomentosiformis
gb|EYU42022.1|  hypothetical protein MIMGU_mgv1a018881mg                128   2e-30   Erythranthe guttata [common monkey flower]
ref|XP_011095140.1|  PREDICTED: pentatricopeptide repeat-containi...    126   8e-30   
ref|XP_004246986.1|  PREDICTED: pentatricopeptide repeat-containi...    125   2e-29   
ref|XP_007140083.1|  hypothetical protein PHAVU_008G082800g             119   3e-27   Phaseolus vulgaris [French bean]
ref|XP_002323670.2|  hypothetical protein POPTR_0016s14370g             118   3e-27   
gb|KDP21868.1|  hypothetical protein JCGZ_00655                         117   7e-27   Jatropha curcas
gb|KHN29504.1|  Pentatricopeptide repeat-containing protein, mito...    115   2e-26   Glycine soja [wild soybean]
ref|XP_010653334.1|  PREDICTED: pentatricopeptide repeat-containi...    116   5e-26   
ref|XP_006587922.1|  PREDICTED: pentatricopeptide repeat-containi...    115   9e-26   Glycine max [soybeans]
ref|XP_007033528.1|  Pentatricopeptide repeat superfamily protein...    114   2e-25   
ref|XP_008345572.1|  PREDICTED: pentatricopeptide repeat-containi...    114   2e-25   
ref|XP_011002598.1|  PREDICTED: putative pentatricopeptide repeat...    113   4e-25   Populus euphratica
gb|KJB27678.1|  hypothetical protein B456_005G004200                    107   3e-23   Gossypium raimondii
ref|XP_010109661.1|  hypothetical protein L484_006096                   108   4e-23   Morus notabilis
ref|XP_004305082.1|  PREDICTED: pentatricopeptide repeat-containi...    107   7e-23   Fragaria vesca subsp. vesca
ref|XP_008245346.1|  PREDICTED: pentatricopeptide repeat-containi...    105   3e-22   Prunus mume [ume]
ref|XP_008782664.1|  PREDICTED: pentatricopeptide repeat-containi...    102   4e-21   Phoenix dactylifera
ref|XP_007206949.1|  hypothetical protein PRUPE_ppb018157mg           99.4    1e-20   
ref|XP_009406874.1|  PREDICTED: pentatricopeptide repeat-containi...  99.8    4e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010921153.1|  PREDICTED: pentatricopeptide repeat-containi...  99.4    7e-20   Elaeis guineensis
ref|XP_006842489.1|  hypothetical protein AMTR_s00077p00087500        96.3    8e-20   
ref|XP_006481194.1|  PREDICTED: pentatricopeptide repeat-containi...  96.7    9e-20   
ref|XP_010683486.1|  PREDICTED: pentatricopeptide repeat-containi...  97.8    2e-19   
ref|XP_010253075.1|  PREDICTED: pentatricopeptide repeat-containi...  97.8    2e-19   
ref|XP_006429582.1|  hypothetical protein CICLE_v10013314mg           96.3    2e-19   
gb|KDO64095.1|  hypothetical protein CISIN_1g011714mg                 96.7    3e-19   Citrus sinensis [apfelsine]
gb|KCW88349.1|  hypothetical protein EUGRSUZ_A00738                   94.7    5e-19   Eucalyptus grandis [rose gum]
ref|XP_003623623.1|  Pentatricopeptide repeat-containing protein      95.1    1e-18   
ref|XP_010043220.1|  PREDICTED: pentatricopeptide repeat-containi...  94.7    2e-18   
ref|XP_004492557.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...  86.7    7e-16   
gb|ABR16388.1|  unknown                                               86.3    2e-15   Picea sitchensis
gb|EMT30207.1|  hypothetical protein F775_08031                       82.4    2e-14   
ref|XP_003557966.1|  PREDICTED: pentatricopeptide repeat-containi...  78.6    3e-13   Brachypodium distachyon [annual false brome]
ref|NP_001130560.1|  uncharacterized protein LOC100191659             78.2    6e-13   
gb|ACG44675.1|  hypothetical protein                                  77.8    6e-13   Zea mays [maize]
ref|XP_004984461.1|  PREDICTED: protein Rf1, mitochondrial-like       77.4    9e-13   Setaria italica
ref|NP_001050037.1|  Os03g0336000                                     77.0    1e-12   
gb|EAZ26836.1|  hypothetical protein OsJ_10752                        75.1    4e-12   Oryza sativa Japonica Group [Japonica rice]
gb|KFK35778.1|  hypothetical protein AALP_AA4G035000                  71.2    8e-11   Arabis alpina [alpine rockcress]
ref|NP_001060800.1|  Os08g0107700                                     70.9    1e-10   
dbj|BAD09393.1|  putative PPR protein                                 70.9    2e-10   Oryza sativa Japonica Group [Japonica rice]
dbj|BAD13709.1|  PPR protein                                          69.3    2e-10   Oryza sativa Indica Group [Indian rice]
ref|XP_010248027.1|  PREDICTED: pentatricopeptide repeat-containi...  70.1    2e-10   Nelumbo nucifera [Indian lotus]
ref|XP_010530346.1|  PREDICTED: pentatricopeptide repeat-containi...  69.7    3e-10   Tarenaya hassleriana [spider flower]
gb|ABG66168.1|  Rf1 protein, mitochondrial precursor, putative, e...  68.9    5e-10   Oryza sativa Japonica Group [Japonica rice]
dbj|BAD08212.1|  hypothetical protein                                 68.9    6e-10   Oryza sativa Indica Group [Indian rice]
dbj|BAD08216.1|  hypothetical protein                                 68.2    9e-10   Oryza sativa Japonica Group [Japonica rice]
gb|ABC42331.1|  PPR protein                                           68.2    9e-10   Oryza sativa Indica Group [Indian rice]
dbj|BAD08213.1|  hypothetical protein                                 68.2    1e-09   Oryza sativa Indica Group [Indian rice]
gb|AAL58260.1|AC068923_2  putative membrane-associated protein        68.2    1e-09   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ16561.1|  hypothetical protein OsJ_32034                        67.8    1e-09   Oryza sativa Japonica Group [Japonica rice]
gb|AAL58263.1|AC068923_5  putative membrane-associated protein        68.2    1e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003623872.1|  Pentatricopeptide repeat-containing protein      67.8    1e-09   
ref|XP_010530432.1|  PREDICTED: pentatricopeptide repeat-containi...  67.8    1e-09   Tarenaya hassleriana [spider flower]
dbj|BAD13711.1|  PPR protein                                          67.8    1e-09   Oryza sativa Indica Group [Indian rice]
ref|NP_001064975.1|  Os10g0499500                                     67.4    1e-09   
ref|NP_001064958.1|  Os10g0497300                                     67.8    2e-09   
dbj|BAD08211.1|  hypothetical protein                                 67.8    2e-09   Oryza sativa Indica Group [Indian rice]
ref|XP_009604022.1|  PREDICTED: pentatricopeptide repeat-containi...  67.4    2e-09   
gb|EEE51212.1|  hypothetical protein OsJ_32033                        67.8    2e-09   Oryza sativa Japonica Group [Japonica rice]
gb|AIC74549.1|  truncated PPR protein PPR9-409-Z                      67.0    2e-09   Oryza sativa Indica Group [Indian rice]
dbj|BAD20284.1|  hypothetical protein                                 67.0    3e-09   Oryza sativa Indica Group [Indian rice]
ref|XP_006346446.1|  PREDICTED: pentatricopeptide repeat-containi...  65.9    7e-09   Solanum tuberosum [potatoes]
ref|XP_003623229.1|  Pentatricopeptide repeat-containing protein      65.5    8e-09   
gb|EEE68328.1|  hypothetical protein OsJ_26607                        65.1    9e-09   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001061364.1|  Os08g0248400                                     65.1    9e-09   
ref|XP_002512435.1|  pentatricopeptide repeat-containing protein,...  65.1    9e-09   
gb|AIC74550.1|  PPR protein PPR9-782-I                                65.5    1e-08   Oryza sativa Indica Group [Indian rice]
gb|AIC74551.1|  PPR protein PPR9-782-M                                65.5    1e-08   Oryza sativa Indica Group [Indian rice]
gb|ABC42330.1|  PPR protein                                           65.1    1e-08   Oryza sativa Indica Group [Indian rice]
sp|Q76C99.1|RF1_ORYSI  RecName: Full=Protein Rf1, mitochondrial; ...  65.1    1e-08   Oryza sativa Indica Group [Indian rice]
gb|KGN60996.1|  hypothetical protein Csa_2G034490                     62.0    1e-08   Cucumis sativus [cucumbers]
ref|XP_010458712.1|  PREDICTED: pentatricopeptide repeat-containi...  64.7    1e-08   Camelina sativa [gold-of-pleasure]
ref|XP_010458689.1|  PREDICTED: pentatricopeptide repeat-containi...  64.7    1e-08   Camelina sativa [gold-of-pleasure]
gb|KHN04861.1|  Pentatricopeptide repeat-containing protein, mito...  64.7    1e-08   Glycine soja [wild soybean]
gb|AES60450.2|  pentatricopeptide (PPR) repeat protein                64.7    1e-08   Medicago truncatula
ref|XP_006572968.1|  PREDICTED: pentatricopeptide repeat-containi...  64.7    1e-08   
ref|XP_007139919.1|  hypothetical protein PHAVU_008G069700g           64.7    1e-08   Phaseolus vulgaris [French bean]
ref|XP_006651349.1|  PREDICTED: pentatricopeptide repeat-containi...  64.3    2e-08   Oryza brachyantha
ref|XP_011468486.1|  PREDICTED: pentatricopeptide repeat-containi...  64.3    2e-08   Fragaria vesca subsp. vesca
ref|XP_011009113.1|  PREDICTED: pentatricopeptide repeat-containi...  64.7    2e-08   Populus euphratica
gb|AIC74547.1|  PPR protein PPR7-458-ZH                               64.3    2e-08   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001176222.1|  Os10g0495400                                     64.3    2e-08   
gb|AAM92824.1|  putative chloroplast RNA processing protein           64.7    2e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010530459.1|  PREDICTED: pentatricopeptide repeat-containi...  63.9    2e-08   
ref|NP_001064949.1|  Os10g0495200                                     64.3    2e-08   
ref|XP_010315244.1|  PREDICTED: pentatricopeptide repeat-containi...  64.3    2e-08   
gb|KJB45449.1|  hypothetical protein B456_007G306300                  63.9    2e-08   Gossypium raimondii
gb|AES79447.2|  TCP-1/cpn60 chaperonin family protein                 63.9    3e-08   Medicago truncatula
emb|CDP12725.1|  unnamed protein product                              63.9    3e-08   Coffea canephora [robusta coffee]
ref|XP_009802358.1|  PREDICTED: pentatricopeptide repeat-containi...  63.9    3e-08   Nicotiana sylvestris
ref|XP_010476252.1|  PREDICTED: pentatricopeptide repeat-containi...  63.9    3e-08   Camelina sativa [gold-of-pleasure]
gb|EMT29222.1|  hypothetical protein F775_16585                       63.9    3e-08   
ref|XP_003620179.1|  Pentatricopeptide repeat-containing protein      63.5    3e-08   
gb|AAM92820.1|  hypothetical protein                                  63.5    3e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003590199.1|  Pentatricopeptide repeat-containing protein      63.5    4e-08   
ref|XP_008809556.1|  PREDICTED: pentatricopeptide repeat-containi...  63.5    4e-08   Phoenix dactylifera
gb|ACL53100.1|  unknown                                               63.2    4e-08   Zea mays [maize]
ref|XP_010530347.1|  PREDICTED: pentatricopeptide repeat-containi...  63.2    5e-08   
emb|CDY66121.1|  BnaC01g42390D                                        62.8    6e-08   Brassica napus [oilseed rape]
ref|XP_004492691.1|  PREDICTED: pentatricopeptide repeat-containi...  62.8    6e-08   Cicer arietinum [garbanzo]
ref|XP_001777347.1|  predicted protein                                62.8    6e-08   
gb|AIC74546.1|  PPR protein PPR7-458-Z                                62.8    6e-08   Oryza sativa Indica Group [Indian rice]
ref|XP_009117967.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...  62.8    7e-08   
ref|XP_003630734.1|  Pentatricopeptide repeat-containing protein      62.8    7e-08   Medicago truncatula
dbj|BAQ15370.1|  pentatricopeptide repeat-containing protein          62.8    7e-08   Oryza sativa Indica Group [Indian rice]
gb|KDP31244.1|  hypothetical protein JCGZ_11620                       62.8    8e-08   Jatropha curcas
ref|XP_010475835.1|  PREDICTED: pentatricopeptide repeat-containi...  62.4    8e-08   Camelina sativa [gold-of-pleasure]
ref|XP_011014424.1|  PREDICTED: pentatricopeptide repeat-containi...  62.4    8e-08   Populus euphratica
gb|ACL53015.1|  unknown                                               62.4    8e-08   Zea mays [maize]
gb|EPS61251.1|  hypothetical protein M569_13548                       62.4    9e-08   Genlisea aurea
gb|KDP45287.1|  hypothetical protein JCGZ_15152                       62.4    9e-08   Jatropha curcas
ref|XP_002967156.1|  hypothetical protein SELMODRAFT_144844           62.4    9e-08   
gb|EYU42661.1|  hypothetical protein MIMGU_mgv1a020055mg              62.4    9e-08   Erythranthe guttata [common monkey flower]
ref|XP_002467904.1|  hypothetical protein SORBIDRAFT_01g036150        62.4    9e-08   Sorghum bicolor [broomcorn]
ref|XP_006662452.1|  PREDICTED: pentatricopeptide repeat-containi...  62.4    9e-08   
ref|XP_002871729.1|  pentatricopeptide repeat-containing protein      62.0    9e-08   
ref|XP_009801387.1|  PREDICTED: pentatricopeptide repeat-containi...  62.0    1e-07   Nicotiana sylvestris
ref|XP_008806452.1|  PREDICTED: pentatricopeptide repeat-containi...  61.6    1e-07   
ref|XP_002960858.1|  hypothetical protein SELMODRAFT_75631            62.0    1e-07   
ref|XP_004515689.1|  PREDICTED: pentatricopeptide repeat-containi...  62.0    1e-07   Cicer arietinum [garbanzo]
gb|AIC74545.1|  PPR protein PPR7-458-I                                61.6    1e-07   Oryza sativa Indica Group [Indian rice]
gb|AIC74544.1|  PPR protein PPR7-454-M                                61.6    1e-07   Oryza sativa Indica Group [Indian rice]
ref|XP_011003803.1|  PREDICTED: putative pentatricopeptide repeat...  62.0    1e-07   Populus euphratica
gb|AIC74548.1|  PPR protein PPR8-780-M                                62.0    1e-07   Oryza sativa Indica Group [Indian rice]
ref|XP_010524658.1|  PREDICTED: pentatricopeptide repeat-containi...  62.0    1e-07   Tarenaya hassleriana [spider flower]
gb|EYU21622.1|  hypothetical protein MIMGU_mgv1a019624mg              61.6    1e-07   Erythranthe guttata [common monkey flower]
ref|XP_010530356.1|  PREDICTED: pentatricopeptide repeat-containi...  61.6    1e-07   
gb|KFK30719.1|  hypothetical protein AALP_AA6G018600                  61.6    2e-07   Arabis alpina [alpine rockcress]
gb|KHN09027.1|  Pentatricopeptide repeat-containing protein           61.6    2e-07   Glycine soja [wild soybean]
ref|XP_010472747.1|  PREDICTED: pentatricopeptide repeat-containi...  61.6    2e-07   Camelina sativa [gold-of-pleasure]
ref|XP_010417523.1|  PREDICTED: pentatricopeptide repeat-containi...  61.6    2e-07   Camelina sativa [gold-of-pleasure]
ref|XP_006472193.1|  PREDICTED: pentatricopeptide repeat-containi...  61.6    2e-07   Citrus sinensis [apfelsine]
ref|XP_010429780.1|  PREDICTED: pentatricopeptide repeat-containi...  61.2    2e-07   Camelina sativa [gold-of-pleasure]
ref|XP_003527866.1|  PREDICTED: pentatricopeptide repeat-containi...  61.6    2e-07   Glycine max [soybeans]
ref|XP_009362528.1|  PREDICTED: pentatricopeptide repeat-containi...  61.2    2e-07   
ref|XP_008243715.1|  PREDICTED: pentatricopeptide repeat-containi...  61.2    2e-07   Prunus mume [ume]
ref|XP_004296143.1|  PREDICTED: putative pentatricopeptide repeat...  60.5    2e-07   Fragaria vesca subsp. vesca
ref|XP_010424275.1|  PREDICTED: pentatricopeptide repeat-containi...  60.8    2e-07   
ref|XP_006423060.1|  hypothetical protein CICLE_v10028118mg           61.2    2e-07   
ref|XP_006433532.1|  hypothetical protein CICLE_v10003346mg           61.2    2e-07   
ref|XP_010540327.1|  PREDICTED: pentatricopeptide repeat-containi...  61.2    2e-07   Tarenaya hassleriana [spider flower]
ref|XP_009151645.1|  PREDICTED: pentatricopeptide repeat-containi...  61.2    2e-07   Brassica rapa
ref|XP_008243718.1|  PREDICTED: pentatricopeptide repeat-containi...  61.2    2e-07   Prunus mume [ume]
ref|XP_006465352.1|  PREDICTED: pentatricopeptide repeat-containi...  61.2    2e-07   Citrus sinensis [apfelsine]
ref|XP_006480134.1|  PREDICTED: pentatricopeptide repeat-containi...  61.2    2e-07   Citrus sinensis [apfelsine]
gb|KCW90149.1|  hypothetical protein EUGRSUZ_A02340                   61.2    2e-07   Eucalyptus grandis [rose gum]
gb|KCW88273.1|  hypothetical protein EUGRSUZ_A00652                   61.2    2e-07   Eucalyptus grandis [rose gum]
gb|KDO49128.1|  hypothetical protein CISIN_1g004231mg                 61.2    2e-07   Citrus sinensis [apfelsine]
ref|XP_010530350.1|  PREDICTED: pentatricopeptide repeat-containi...  61.2    2e-07   
ref|XP_010921699.1|  PREDICTED: pentatricopeptide repeat-containi...  61.2    2e-07   Elaeis guineensis
gb|KEH26904.1|  pentatricopeptide (PPR) repeat protein                60.8    3e-07   Medicago truncatula
ref|XP_003619805.1|  Pentatricopeptide repeat-containing protein      60.8    3e-07   Medicago truncatula
gb|EEC67240.1|  hypothetical protein OsI_34171                        60.8    3e-07   Oryza sativa Indica Group [Indian rice]
ref|XP_004144813.1|  PREDICTED: pentatricopeptide repeat-containi...  60.8    3e-07   Cucumis sativus [cucumbers]
emb|CBI36294.3|  unnamed protein product                              60.8    3e-07   Vitis vinifera
ref|XP_010530355.1|  PREDICTED: pentatricopeptide repeat-containi...  60.8    3e-07   Tarenaya hassleriana [spider flower]
ref|XP_003551657.1|  PREDICTED: pentatricopeptide repeat-containi...  60.8    3e-07   Glycine max [soybeans]
ref|XP_010040584.1|  PREDICTED: pentatricopeptide repeat-containi...  60.8    3e-07   Eucalyptus grandis [rose gum]
ref|XP_010431726.1|  PREDICTED: pentatricopeptide repeat-containi...  60.8    3e-07   Camelina sativa [gold-of-pleasure]
ref|XP_006857320.1|  hypothetical protein AMTR_s00067p00076830        60.8    3e-07   
ref|XP_002313262.2|  hypothetical protein POPTR_0009s07380g           60.8    3e-07   
ref|XP_010654769.1|  PREDICTED: pentatricopeptide repeat-containi...  60.8    3e-07   Vitis vinifera
ref|XP_010936288.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...  60.5    3e-07   
ref|XP_002889775.1|  pentatricopeptide repeat-containing protein      60.5    3e-07   Arabidopsis lyrata subsp. lyrata
ref|XP_004492420.1|  PREDICTED: pentatricopeptide repeat-containi...  60.8    3e-07   
ref|XP_008378619.1|  PREDICTED: pentatricopeptide repeat-containi...  60.5    3e-07   
ref|XP_009596549.1|  PREDICTED: pentatricopeptide repeat-containi...  60.8    3e-07   Nicotiana tomentosiformis
ref|XP_010530351.1|  PREDICTED: pentatricopeptide repeat-containi...  60.5    3e-07   Tarenaya hassleriana [spider flower]
gb|KDO66019.1|  hypothetical protein CISIN_1g048778mg                 60.8    3e-07   Citrus sinensis [apfelsine]
ref|XP_006443536.1|  hypothetical protein CICLE_v10018778mg           60.8    3e-07   Citrus clementina [clementine]
ref|XP_007141297.1|  hypothetical protein PHAVU_008G184000g           60.5    3e-07   Phaseolus vulgaris [French bean]
ref|XP_010908081.1|  PREDICTED: pentatricopeptide repeat-containi...  60.5    3e-07   
ref|XP_008360647.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...  60.5    4e-07   
ref|XP_007137661.1|  hypothetical protein PHAVU_009G145100g           60.5    4e-07   Phaseolus vulgaris [French bean]
gb|KDO45230.1|  hypothetical protein CISIN_1g018782mg                 60.1    4e-07   Citrus sinensis [apfelsine]
ref|XP_010428258.1|  PREDICTED: pentatricopeptide repeat-containi...  60.1    4e-07   Camelina sativa [gold-of-pleasure]
ref|NP_001136745.1|  hypothetical protein                             60.1    4e-07   
ref|XP_002515077.1|  pentatricopeptide repeat-containing protein,...  59.3    5e-07   
gb|KHN08231.1|  Pentatricopeptide repeat-containing protein           60.1    5e-07   Glycine soja [wild soybean]
ref|XP_011038920.1|  PREDICTED: pentatricopeptide repeat-containi...  60.5    5e-07   Populus euphratica
ref|XP_007157301.1|  hypothetical protein PHAVU_002G058500g           60.1    5e-07   Phaseolus vulgaris [French bean]
gb|AJG06104.1|  restorer-of-fertility                                 60.1    5e-07   Raphanus sativus
ref|XP_010530461.1|  PREDICTED: putative pentatricopeptide repeat...  60.1    5e-07   Tarenaya hassleriana [spider flower]
ref|XP_007215907.1|  hypothetical protein PRUPE_ppa004160mg           60.1    5e-07   Prunus persica
ref|XP_006427239.1|  hypothetical protein CICLE_v100269871mg          60.1    5e-07   
gb|AES89466.2|  PPR containing plant-like protein                     60.1    5e-07   Medicago truncatula
ref|XP_010494656.1|  PREDICTED: pentatricopeptide repeat-containi...  60.1    5e-07   Camelina sativa [gold-of-pleasure]
gb|KFK25884.1|  hypothetical protein AALP_AA8G174800                  60.1    5e-07   Arabis alpina [alpine rockcress]
ref|XP_010492576.1|  PREDICTED: pentatricopeptide repeat-containi...  60.1    6e-07   Camelina sativa [gold-of-pleasure]
ref|XP_010492577.1|  PREDICTED: pentatricopeptide repeat-containi...  59.7    6e-07   Camelina sativa [gold-of-pleasure]
ref|XP_011036957.1|  PREDICTED: pentatricopeptide repeat-containi...  60.1    6e-07   Populus euphratica
ref|XP_006378827.1|  hypothetical protein POPTR_0010s24920g           59.7    6e-07   
ref|XP_003607269.1|  UDP-glucoronosyl/UDP-glucosyl transferase fa...  60.1    6e-07   
ref|XP_011078791.1|  PREDICTED: pentatricopeptide repeat-containi...  59.7    6e-07   
gb|KJB50891.1|  hypothetical protein B456_008G192600                  60.1    6e-07   Gossypium raimondii
ref|XP_002967974.1|  hypothetical protein SELMODRAFT_88078            59.7    7e-07   
ref|XP_003523769.1|  PREDICTED: pentatricopeptide repeat-containi...  59.7    7e-07   Glycine max [soybeans]
gb|EPS74565.1|  hypothetical protein M569_00187                       59.7    7e-07   Genlisea aurea
gb|KEH26900.1|  pentatricopeptide (PPR) repeat protein                59.3    7e-07   Medicago truncatula
ref|XP_010530458.1|  PREDICTED: pentatricopeptide repeat-containi...  59.7    7e-07   
ref|XP_010092441.1|  hypothetical protein L484_019198                 59.7    7e-07   
ref|XP_008367381.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...  59.7    7e-07   
ref|XP_007037323.1|  Pentatricopeptide repeat (PPR) superfamily p...  59.7    7e-07   
gb|KEH26866.1|  pentatricopeptide (PPR) repeat protein                59.3    7e-07   Medicago truncatula
gb|KFK25885.1|  hypothetical protein AALP_AA8G174800                  59.7    7e-07   Arabis alpina [alpine rockcress]
ref|XP_008805876.1|  PREDICTED: pentatricopeptide repeat-containi...  59.3    7e-07   
ref|XP_011004426.1|  PREDICTED: pentatricopeptide repeat-containi...  59.7    7e-07   Populus euphratica
ref|NP_172461.1|  pentatricopeptide repeat-containing protein         59.7    7e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003558747.1|  PREDICTED: pentatricopeptide repeat-containi...  59.7    8e-07   Brachypodium distachyon [annual false brome]
ref|XP_010520854.1|  PREDICTED: pentatricopeptide repeat-containi...  59.7    8e-07   Tarenaya hassleriana [spider flower]
ref|XP_009366374.1|  PREDICTED: pentatricopeptide repeat-containi...  59.7    8e-07   
ref|XP_002298371.2|  hypothetical protein POPTR_0001s24340g           59.7    8e-07   
ref|XP_006826435.1|  hypothetical protein AMTR_s00004p00168920        59.7    8e-07   
ref|XP_011099967.1|  PREDICTED: pentatricopeptide repeat-containi...  59.7    8e-07   Sesamum indicum [beniseed]
ref|XP_004512803.1|  PREDICTED: pentatricopeptide repeat-containi...  59.3    8e-07   Cicer arietinum [garbanzo]
ref|XP_002531694.1|  pentatricopeptide repeat-containing protein,...  59.7    8e-07   
ref|XP_004512700.1|  PREDICTED: pentatricopeptide repeat-containi...  59.3    8e-07   Cicer arietinum [garbanzo]
ref|XP_011090619.1|  PREDICTED: putative pentatricopeptide repeat...  59.7    8e-07   Sesamum indicum [beniseed]
ref|XP_007131603.1|  hypothetical protein PHAVU_011G027200g           59.7    8e-07   Phaseolus vulgaris [French bean]
ref|XP_008338987.1|  PREDICTED: pentatricopeptide repeat-containi...  59.3    8e-07   
ref|XP_010453827.1|  PREDICTED: pentatricopeptide repeat-containi...  59.3    8e-07   Camelina sativa [gold-of-pleasure]
ref|XP_002963945.1|  hypothetical protein SELMODRAFT_82351            59.3    9e-07   
ref|XP_009419261.1|  PREDICTED: pentatricopeptide repeat-containi...  59.7    9e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006417237.1|  hypothetical protein EUTSA_v10007258mg           59.3    9e-07   
ref|XP_007031149.1|  Pentatricopeptide repeat (PPR-like) superfam...  59.3    9e-07   
ref|XP_010024947.1|  PREDICTED: pentatricopeptide repeat-containi...  59.3    9e-07   Eucalyptus grandis [rose gum]
ref|XP_007023868.1|  Pentatricopeptide repeat (PPR) superfamily p...  59.3    9e-07   
ref|XP_008792873.1|  PREDICTED: uncharacterized protein LOC103709351  59.7    9e-07   
ref|XP_004292451.1|  PREDICTED: pentatricopeptide repeat-containi...  59.3    9e-07   Fragaria vesca subsp. vesca
ref|XP_003620148.1|  Pentatricopeptide repeat-containing protein      59.3    1e-06   Medicago truncatula
tpg|DAA53112.1|  TPA: hypothetical protein ZEAMMB73_920038            59.3    1e-06   
ref|NP_177597.1|  pentatricopeptide repeat-containing protein         59.3    1e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007031148.1|  Pentatricopeptide repeat (PPR-like) superfam...  59.3    1e-06   
ref|XP_009118082.1|  PREDICTED: pentatricopeptide repeat-containi...  58.9    1e-06   
ref|XP_009118081.1|  PREDICTED: pentatricopeptide repeat-containi...  58.9    1e-06   Brassica rapa
ref|XP_002962532.1|  hypothetical protein SELMODRAFT_404389           59.3    1e-06   
ref|XP_006592041.1|  PREDICTED: putative pentatricopeptide repeat...  59.3    1e-06   Glycine max [soybeans]
ref|XP_010107145.1|  hypothetical protein L484_019627                 58.9    1e-06   Morus notabilis
ref|XP_004505699.1|  PREDICTED: putative pentatricopeptide repeat...  59.3    1e-06   Cicer arietinum [garbanzo]
ref|XP_010462107.1|  PREDICTED: pentatricopeptide repeat-containi...  58.9    1e-06   Camelina sativa [gold-of-pleasure]
ref|XP_010424684.1|  PREDICTED: pentatricopeptide repeat-containi...  58.9    1e-06   Camelina sativa [gold-of-pleasure]
ref|XP_006382397.1|  hypothetical protein POPTR_0005s01750g           58.9    1e-06   
gb|KHN05463.1|  Putative pentatricopeptide repeat-containing protein  58.9    1e-06   Glycine soja [wild soybean]
ref|NP_175673.1|  pentatricopeptide repeat-containing protein         58.9    1e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008445101.1|  PREDICTED: pentatricopeptide repeat-containi...  58.9    1e-06   
ref|XP_010500873.1|  PREDICTED: pentatricopeptide repeat-containi...  58.9    1e-06   Camelina sativa [gold-of-pleasure]
ref|XP_010934489.1|  PREDICTED: pentatricopeptide repeat-containi...  58.9    1e-06   Elaeis guineensis
gb|EYU40636.1|  hypothetical protein MIMGU_mgv1a021322mg              58.9    1e-06   Erythranthe guttata [common monkey flower]
ref|XP_010422726.1|  PREDICTED: pentatricopeptide repeat-containi...  58.9    1e-06   Camelina sativa [gold-of-pleasure]
ref|XP_010464347.1|  PREDICTED: pentatricopeptide repeat-containi...  58.9    1e-06   Camelina sativa [gold-of-pleasure]
ref|XP_010479776.1|  PREDICTED: pentatricopeptide repeat-containi...  58.5    1e-06   Camelina sativa [gold-of-pleasure]
ref|XP_002985064.1|  hypothetical protein SELMODRAFT_424099           58.9    1e-06   
ref|XP_009618149.1|  PREDICTED: pentatricopeptide repeat-containi...  58.9    1e-06   Nicotiana tomentosiformis
ref|XP_008351720.1|  PREDICTED: pentatricopeptide repeat-containi...  58.9    1e-06   
ref|XP_002305285.2|  pentatricopeptide repeat-containing family p...  58.5    2e-06   Populus trichocarpa [western balsam poplar]
ref|XP_006389305.1|  hypothetical protein POPTR_0030s00250g           58.5    2e-06   Populus trichocarpa [western balsam poplar]
gb|EYU28385.1|  hypothetical protein MIMGU_mgv1a003336mg              58.5    2e-06   Erythranthe guttata [common monkey flower]
ref|XP_006384843.1|  hypothetical protein POPTR_0004s21560g           58.9    2e-06   Populus trichocarpa [western balsam poplar]
ref|XP_008235421.1|  PREDICTED: pentatricopeptide repeat-containi...  58.9    2e-06   Prunus mume [ume]
gb|ADE76539.1|  unknown                                               58.5    2e-06   Picea sitchensis
ref|XP_008445100.1|  PREDICTED: pentatricopeptide repeat-containi...  58.5    2e-06   Cucumis melo [Oriental melon]
ref|XP_009618145.1|  PREDICTED: pentatricopeptide repeat-containi...  58.5    2e-06   Nicotiana tomentosiformis
gb|KJB49640.1|  hypothetical protein B456_008G131000                  58.5    2e-06   Gossypium raimondii
ref|XP_006389923.1|  hypothetical protein EUTSA_v10018334mg           58.5    2e-06   Eutrema salsugineum [saltwater cress]
ref|XP_010490447.1|  PREDICTED: pentatricopeptide repeat-containi...  58.5    2e-06   Camelina sativa [gold-of-pleasure]
ref|XP_010486276.1|  PREDICTED: pentatricopeptide repeat-containi...  58.5    2e-06   Camelina sativa [gold-of-pleasure]
ref|XP_007139019.1|  hypothetical protein PHAVU_009G258200g           58.2    2e-06   Phaseolus vulgaris [French bean]
ref|XP_002986246.1|  hypothetical protein SELMODRAFT_123660           58.5    2e-06   
ref|XP_010689086.1|  PREDICTED: pentatricopeptide repeat-containi...  58.5    2e-06   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004514199.1|  PREDICTED: pentatricopeptide repeat-containi...  57.4    2e-06   
ref|XP_002872129.1|  predicted protein                                58.5    2e-06   Arabidopsis lyrata subsp. lyrata
ref|XP_002962761.1|  hypothetical protein SELMODRAFT_165305           58.5    2e-06   
ref|NP_197167.1|  pentatricopeptide repeat-containing protein         58.5    2e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010458709.1|  PREDICTED: pentatricopeptide repeat-containi...  58.5    2e-06   
ref|XP_006420675.1|  hypothetical protein CICLE_v10004591mg           58.5    2e-06   
gb|KEH26908.1|  pentatricopeptide (PPR) repeat protein                58.2    2e-06   Medicago truncatula
ref|XP_010270410.1|  PREDICTED: pentatricopeptide repeat-containi...  58.2    2e-06   
ref|XP_006845595.1|  hypothetical protein AMTR_s00019p00203030        58.5    2e-06   
ref|XP_010464348.1|  PREDICTED: pentatricopeptide repeat-containi...  58.5    2e-06   
ref|XP_002887547.1|  pentatricopeptide repeat-containing protein      58.5    2e-06   
ref|XP_010458708.1|  PREDICTED: pentatricopeptide repeat-containi...  58.5    2e-06   
gb|KDP44205.1|  hypothetical protein JCGZ_05672                       58.5    2e-06   
ref|XP_003626608.1|  Pentatricopeptide repeat-containing protein      58.2    2e-06   
gb|EPS71710.1|  hypothetical protein M569_03047                       58.2    2e-06   
ref|XP_008453581.1|  PREDICTED: pentatricopeptide repeat-containi...  58.2    2e-06   
gb|KDO81684.1|  hypothetical protein CISIN_1g047648mg                 58.2    2e-06   
gb|KFK43289.1|  hypothetical protein AALP_AA1G104700                  58.2    2e-06   
emb|CDY65904.1|  BnaA06g01860D                                        58.2    2e-06   
ref|XP_010650040.1|  PREDICTED: pentatricopeptide repeat-containi...  58.2    2e-06   
ref|XP_009381144.1|  PREDICTED: pentatricopeptide repeat-containi...  58.5    2e-06   
ref|XP_010673763.1|  PREDICTED: pentatricopeptide repeat-containi...  58.2    2e-06   
gb|AAL59047.1|AC087182_30  putative membrane-associated salt-indu...  58.2    2e-06   
emb|CDX87409.1|  BnaA07g34640D                                        58.2    2e-06   
gb|EAY82302.1|  hypothetical protein OsI_37513                        58.2    2e-06   
ref|XP_009147672.1|  PREDICTED: pentatricopeptide repeat-containi...  58.2    2e-06   
ref|XP_010674115.1|  PREDICTED: putative pentatricopeptide repeat...  58.2    2e-06   
ref|NP_001064888.1|  Os10g0484300                                     58.2    2e-06   
gb|KDP23717.1|  hypothetical protein JCGZ_23550                       58.2    2e-06   
ref|XP_010674113.1|  PREDICTED: putative pentatricopeptide repeat...  58.2    2e-06   
ref|XP_003619751.1|  Pentatricopeptide repeat-containing protein      58.2    2e-06   
ref|XP_009767090.1|  PREDICTED: pentatricopeptide repeat-containi...  58.2    2e-06   
ref|XP_006287556.1|  hypothetical protein CARUB_v10000768mg           58.2    2e-06   
ref|XP_004490467.1|  PREDICTED: pentatricopeptide repeat-containi...  58.2    3e-06   
ref|XP_004138384.1|  PREDICTED: pentatricopeptide repeat-containi...  57.8    3e-06   
emb|CDP10983.1|  unnamed protein product                              58.2    3e-06   
ref|XP_011091469.1|  PREDICTED: pentatricopeptide repeat-containi...  57.8    3e-06   
ref|XP_010494565.1|  PREDICTED: pentatricopeptide repeat-containi...  58.2    3e-06   
ref|XP_010530349.1|  PREDICTED: pentatricopeptide repeat-containi...  57.8    3e-06   
emb|CBI26377.3|  unnamed protein product                              57.8    3e-06   
gb|EMT20833.1|  Putative pentatricopeptide repeat-containing protein  57.8    3e-06   
gb|EMS58658.1|  Protein Rf1, mitochondrial                            57.8    3e-06   
ref|XP_009348775.1|  PREDICTED: pentatricopeptide repeat-containi...  57.8    3e-06   
ref|NP_187385.1|  pentatricopeptide repeat-containing protein         58.2    3e-06   
ref|XP_010544054.1|  PREDICTED: pentatricopeptide repeat-containi...  57.8    3e-06   
gb|KEH26918.1|  pentatricopeptide (PPR) repeat protein                57.8    3e-06   
ref|XP_009767096.1|  PREDICTED: pentatricopeptide repeat-containi...  57.8    3e-06   
ref|XP_004983977.1|  PREDICTED: pentatricopeptide repeat-containi...  58.2    3e-06   
ref|XP_009106628.1|  PREDICTED: pentatricopeptide repeat-containi...  57.8    3e-06   
gb|EMT09091.1|  hypothetical protein F775_12904                       57.8    3e-06   
ref|XP_004288876.1|  PREDICTED: pentatricopeptide repeat-containi...  57.8    3e-06   
gb|KHN39972.1|  Pentatricopeptide repeat-containing protein           57.8    3e-06   
ref|XP_010674110.1|  PREDICTED: putative pentatricopeptide repeat...  57.8    3e-06   
ref|XP_009802081.1|  PREDICTED: pentatricopeptide repeat-containi...  57.8    3e-06   
ref|XP_009372209.1|  PREDICTED: pentatricopeptide repeat-containi...  57.8    3e-06   
ref|XP_004156879.1|  PREDICTED: pentatricopeptide repeat-containi...  57.8    3e-06   
ref|XP_010691160.1|  PREDICTED: pentatricopeptide repeat-containi...  57.8    3e-06   
ref|XP_009767095.1|  PREDICTED: pentatricopeptide repeat-containi...  57.8    3e-06   
ref|XP_002969716.1|  hypothetical protein SELMODRAFT_92207            57.8    3e-06   
ref|XP_006847909.1|  hypothetical protein AMTR_s00029p00111980        57.8    3e-06   
ref|XP_003600422.1|  Pentatricopeptide repeat-containing protein      57.8    3e-06   
ref|XP_004152353.1|  PREDICTED: pentatricopeptide repeat-containi...  57.8    3e-06   
ref|XP_007199147.1|  hypothetical protein PRUPE_ppa019612mg           57.8    3e-06   
ref|XP_002981321.1|  hypothetical protein SELMODRAFT_114398           57.4    3e-06   
ref|XP_009400405.1|  PREDICTED: putative pentatricopeptide repeat...  57.8    3e-06   
ref|XP_006828862.1|  hypothetical protein AMTR_s00001p00165480        57.8    3e-06   
ref|XP_010530460.1|  PREDICTED: pentatricopeptide repeat-containi...  57.8    3e-06   
gb|KHN32303.1|  Putative pentatricopeptide repeat-containing protein  57.8    3e-06   
ref|XP_006590792.1|  PREDICTED: putative pentatricopeptide repeat...  57.8    3e-06   
ref|XP_010430495.1|  PREDICTED: pentatricopeptide repeat-containi...  57.8    3e-06   
ref|XP_010420363.1|  PREDICTED: pentatricopeptide repeat-containi...  57.4    3e-06   
gb|EMT10155.1|  hypothetical protein F775_20486                       57.8    3e-06   
emb|CAZ44328.1|  restoring pentatricopeptide repeat protein homol...  57.8    4e-06   
ref|XP_006486600.1|  PREDICTED: pentatricopeptide repeat-containi...  57.8    4e-06   
ref|XP_004138876.1|  PREDICTED: pentatricopeptide repeat-containi...  57.8    4e-06   
gb|KDP23384.1|  hypothetical protein JCGZ_23217                       57.4    4e-06   
ref|XP_002971208.1|  hypothetical protein SELMODRAFT_94745            57.4    4e-06   
ref|XP_003620127.1|  Pentatricopeptide repeat-containing protein      57.4    4e-06   
gb|KGN62884.1|  hypothetical protein Csa_2G379150                     57.4    4e-06   
gb|ABN08713.1|  Pentatricopeptide repeat                              57.4    4e-06   
ref|XP_008363957.1|  PREDICTED: pentatricopeptide repeat-containi...  57.4    4e-06   
ref|XP_007049660.1|  Pentatricopeptide repeat (PPR) superfamily p...  57.8    4e-06   
ref|XP_010493846.1|  PREDICTED: pentatricopeptide repeat-containi...  57.4    4e-06   
gb|KJB09314.1|  hypothetical protein B456_001G134400                  57.4    4e-06   
ref|XP_002518803.1|  pentatricopeptide repeat-containing protein,...  57.4    4e-06   
ref|XP_011000283.1|  PREDICTED: putative pentatricopeptide repeat...  57.4    4e-06   
ref|XP_009339046.1|  PREDICTED: pentatricopeptide repeat-containi...  57.4    4e-06   
ref|XP_004489202.1|  PREDICTED: pentatricopeptide repeat-containi...  57.4    4e-06   
ref|XP_002462039.1|  hypothetical protein SORBIDRAFT_02g013138        57.4    4e-06   
ref|XP_009368883.1|  PREDICTED: pentatricopeptide repeat-containi...  57.4    4e-06   
ref|XP_011000284.1|  PREDICTED: putative pentatricopeptide repeat...  57.4    4e-06   
ref|XP_006850819.1|  hypothetical protein AMTR_s00025p00124790        57.4    4e-06   
emb|CDY40142.1|  BnaC06g05470D                                        57.4    4e-06   
ref|XP_007051427.1|  Pentatricopeptide repeat-containing protein,...  57.4    4e-06   
ref|NP_001183938.1|  PPR-814a                                         57.4    4e-06   
ref|NP_188886.1|  pentatricopeptide repeat-containing protein         57.4    5e-06   
gb|KEH15755.1|  pentatricopeptide (PPR) repeat protein                56.6    5e-06   
ref|XP_003620129.1|  Pentatricopeptide repeat-containing protein      57.4    5e-06   
ref|NP_001064948.1|  Os10g0495100                                     57.0    5e-06   
ref|XP_011092729.1|  PREDICTED: pentatricopeptide repeat-containi...  57.4    5e-06   
gb|AIC74553.1|  PPR protein PPR10-454-M                               57.0    5e-06   
ref|XP_009112927.1|  PREDICTED: pentatricopeptide repeat-containi...  57.4    5e-06   
ref|XP_004496165.1|  PREDICTED: pentatricopeptide repeat-containi...  57.0    5e-06   
gb|AES76347.2|  pentatricopeptide (PPR) repeat protein                57.0    5e-06   
ref|XP_004235996.1|  PREDICTED: pentatricopeptide repeat-containi...  57.0    5e-06   
dbj|BAB01462.1|  unnamed protein product                              57.0    5e-06   
ref|XP_002464340.1|  hypothetical protein SORBIDRAFT_01g016560        57.4    5e-06   
ref|XP_006830249.1|  hypothetical protein AMTR_s00130p00090930        57.0    5e-06   
ref|XP_006656649.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...  57.0    5e-06   
gb|KDP29910.1|  hypothetical protein JCGZ_18479                       57.4    5e-06   
ref|XP_006596392.1|  PREDICTED: pentatricopeptide repeat-containi...  57.0    5e-06   
ref|XP_009365209.1|  PREDICTED: pentatricopeptide repeat-containi...  57.4    5e-06   
emb|CDP18119.1|  unnamed protein product                              57.0    5e-06   
gb|KEH26914.1|  pentatricopeptide (PPR) repeat protein                57.0    5e-06   
ref|XP_003637828.1|  Pentatricopeptide repeat-containing protein      57.0    5e-06   
gb|KHG04533.1|  hypothetical protein F383_29163                       57.0    5e-06   
emb|CDP12316.1|  unnamed protein product                              57.0    5e-06   
ref|XP_006658491.1|  PREDICTED: pentatricopeptide repeat-containi...  57.4    5e-06   
emb|CED92695.1|  PPR protein                                          57.0    5e-06   
ref|XP_010462662.1|  PREDICTED: pentatricopeptide repeat-containi...  57.0    6e-06   
ref|XP_008806365.1|  PREDICTED: pentatricopeptide repeat-containi...  57.0    6e-06   
gb|KFK42287.1|  hypothetical protein AALP_AA2G236000                  57.0    6e-06   
ref|XP_008659282.1|  PREDICTED: pentatricopeptide repeat-containi...  57.0    6e-06   
gb|EYU19834.1|  hypothetical protein MIMGU_mgv1a024759mg              57.0    6e-06   
ref|XP_006470947.1|  PREDICTED: putative pentatricopeptide repeat...  57.0    6e-06   
gb|KEH26907.1|  pentatricopeptide (PPR) repeat protein                57.0    6e-06   
ref|XP_006491485.1|  PREDICTED: conserved oligomeric Golgi comple...  57.0    6e-06   
ref|XP_004144640.1|  PREDICTED: pentatricopeptide repeat-containi...  57.0    6e-06   
ref|XP_006405387.1|  hypothetical protein EUTSA_v10028208mg           57.0    6e-06   
emb|CDX73099.1|  BnaC06g35470D                                        57.0    6e-06   
ref|XP_010462657.1|  PREDICTED: pentatricopeptide repeat-containi...  57.0    6e-06   
emb|CBI35192.3|  unnamed protein product                              57.0    6e-06   
ref|XP_002519191.1|  pentatricopeptide repeat-containing protein,...  57.0    6e-06   
ref|XP_008444287.1|  PREDICTED: pentatricopeptide repeat-containi...  57.0    6e-06   
ref|XP_008357006.1|  PREDICTED: pentatricopeptide repeat-containi...  57.0    6e-06   
ref|XP_007041611.1|  Pentatricopeptide repeat (PPR) superfamily p...  57.0    6e-06   
ref|XP_004162287.1|  PREDICTED: pentatricopeptide repeat-containi...  57.0    6e-06   
ref|XP_010470870.1|  PREDICTED: pentatricopeptide repeat-containi...  57.0    6e-06   
gb|AFW85812.1|  hypothetical protein ZEAMMB73_202457                  57.0    6e-06   
ref|XP_003578861.2|  PREDICTED: pentatricopeptide repeat-containi...  56.6    6e-06   
ref|XP_010548990.1|  PREDICTED: pentatricopeptide repeat-containi...  57.0    6e-06   
gb|AAF75803.1|AC011000_6  Contains weak similarity to leaf protei...  57.0    6e-06   
ref|XP_004514088.1|  PREDICTED: putative pentatricopeptide repeat...  57.0    6e-06   
gb|AES76395.2|  pentatricopeptide (PPR) repeat protein                56.6    6e-06   
ref|XP_008218639.1|  PREDICTED: putative pentatricopeptide repeat...  57.0    6e-06   
ref|XP_004170776.1|  PREDICTED: pentatricopeptide repeat-containi...  57.0    6e-06   
ref|NP_176496.1|  transacting siRNA generating locus                  57.0    6e-06   
ref|XP_010430496.1|  PREDICTED: pentatricopeptide repeat-containi...  56.6    7e-06   
ref|XP_006846078.1|  hypothetical protein AMTR_s00012p00087690        57.0    7e-06   
ref|NP_176481.2|  pentatricopeptide repeat protein RPF3               56.6    7e-06   
gb|KJB61396.1|  hypothetical protein B456_009G354800                  56.6    7e-06   
ref|XP_011000001.1|  PREDICTED: pentatricopeptide repeat-containi...  56.6    7e-06   
ref|XP_006287361.1|  hypothetical protein CARUB_v10000559mg           56.6    7e-06   
gb|KJB50395.1|  hypothetical protein B456_008G168700                  57.0    7e-06   
ref|XP_003620177.1|  Pentatricopeptide repeat-containing protein      56.6    7e-06   
ref|XP_009589444.1|  PREDICTED: pentatricopeptide repeat-containi...  56.6    7e-06   
ref|XP_004246460.1|  PREDICTED: pentatricopeptide repeat-containi...  56.6    7e-06   
ref|XP_010917143.1|  PREDICTED: pentatricopeptide repeat-containi...  56.6    7e-06   
gb|KJB72046.1|  hypothetical protein B456_011G155600                  55.5    7e-06   
ref|XP_008233059.1|  PREDICTED: pentatricopeptide repeat-containi...  56.6    7e-06   
ref|XP_002961595.1|  hypothetical protein SELMODRAFT_76510            56.6    7e-06   
ref|XP_008444958.1|  PREDICTED: pentatricopeptide repeat-containi...  56.6    7e-06   
ref|XP_006842237.1|  hypothetical protein AMTR_s00078p00187540        56.6    7e-06   
ref|XP_007219416.1|  hypothetical protein PRUPE_ppa021922mg           56.6    7e-06   
ref|XP_011018741.1|  PREDICTED: pentatricopeptide repeat-containi...  57.0    7e-06   
ref|XP_010106002.1|  hypothetical protein L484_001609                 56.6    7e-06   
ref|XP_008233368.1|  PREDICTED: pentatricopeptide repeat-containi...  56.6    7e-06   
ref|XP_010436574.1|  PREDICTED: pentatricopeptide repeat-containi...  56.6    7e-06   
ref|XP_010271680.1|  PREDICTED: pentatricopeptide repeat-containi...  57.0    7e-06   
ref|XP_009781730.1|  PREDICTED: pentatricopeptide repeat-containi...  56.6    8e-06   
ref|XP_010914611.1|  PREDICTED: pentatricopeptide repeat-containi...  56.6    8e-06   
ref|XP_002530894.1|  pentatricopeptide repeat-containing protein,...  56.6    8e-06   
ref|XP_011036313.1|  PREDICTED: pentatricopeptide repeat-containi...  56.6    8e-06   
gb|EYU41700.1|  hypothetical protein MIMGU_mgv1a001713mg              56.6    8e-06   
ref|XP_010108224.1|  hypothetical protein L484_005698                 56.6    8e-06   
ref|XP_008219211.1|  PREDICTED: pentatricopeptide repeat-containi...  56.6    8e-06   
ref|XP_006848380.1|  hypothetical protein AMTR_s00013p00202120        56.6    8e-06   
ref|XP_010678111.1|  PREDICTED: pentatricopeptide repeat-containi...  56.6    8e-06   
ref|XP_007035007.1|  Pentatricopeptide repeat superfamily protein...  56.6    8e-06   
gb|EYU41981.1|  hypothetical protein MIMGU_mgv1a024442mg              55.8    8e-06   
gb|KEH16141.1|  pentatricopeptide (PPR) repeat protein                56.6    8e-06   
gb|KHN16401.1|  Pentatricopeptide repeat-containing protein, mito...  56.2    8e-06   
gb|KEH17452.1|  pentatricopeptide (PPR) repeat protein                56.6    8e-06   
emb|CDP06762.1|  unnamed protein product                              56.6    8e-06   
ref|XP_010661498.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...  56.6    9e-06   
ref|XP_010476184.1|  PREDICTED: pentatricopeptide repeat-containi...  56.6    9e-06   
ref|XP_010253257.1|  PREDICTED: putative pentatricopeptide repeat...  56.6    9e-06   
ref|XP_011040795.1|  PREDICTED: pentatricopeptide repeat-containi...  56.6    9e-06   
ref|XP_006380898.1|  hypothetical protein POPTR_0006s01700g           56.2    9e-06   
ref|XP_006418847.1|  hypothetical protein EUTSA_v10002441mg           56.6    9e-06   
ref|XP_003620319.1|  Pentatricopeptide repeat-containing protein      56.2    9e-06   
ref|XP_002325338.2|  pentatricopeptide repeat-containing family p...  56.2    9e-06   
gb|ABF99334.1|  expressed protein                                     56.6    9e-06   
ref|NP_001051548.2|  Os03g0795400                                     56.6    9e-06   
ref|XP_011081874.1|  PREDICTED: pentatricopeptide repeat-containi...  56.6    9e-06   
ref|XP_002535907.1|  pentatricopeptide repeat-containing protein,...  53.9    9e-06   
ref|XP_002277942.2|  PREDICTED: pentatricopeptide repeat-containi...  56.2    9e-06   
gb|AAT76414.1|  putative PPR repeat containing protein                56.6    9e-06   
ref|XP_010454809.1|  PREDICTED: pentatricopeptide repeat-containi...  56.2    9e-06   
ref|XP_011094832.1|  PREDICTED: pentatricopeptide repeat-containi...  56.2    9e-06   
ref|XP_004504486.1|  PREDICTED: pentatricopeptide repeat-containi...  56.2    9e-06   
ref|XP_010659874.1|  PREDICTED: putative pentatricopeptide repeat...  56.2    1e-05   
gb|EYU19809.1|  hypothetical protein MIMGU_mgv1a005320mg              56.2    1e-05   
ref|XP_011004498.1|  PREDICTED: pentatricopeptide repeat-containi...  56.2    1e-05   
ref|XP_011076945.1|  PREDICTED: pentatricopeptide repeat-containi...  56.2    1e-05   
ref|XP_010450862.1|  PREDICTED: pentatricopeptide repeat-containi...  56.2    1e-05   
ref|XP_006850911.1|  hypothetical protein AMTR_s00025p00172020        56.6    1e-05   
ref|XP_003576808.1|  PREDICTED: pentatricopeptide repeat-containi...  56.2    1e-05   
ref|XP_008454493.1|  PREDICTED: pentatricopeptide repeat-containi...  56.6    1e-05   
ref|XP_004486761.1|  PREDICTED: pentatricopeptide repeat-containi...  56.2    1e-05   
emb|CDO98642.1|  unnamed protein product                              55.8    1e-05   
ref|XP_002521858.1|  pentatricopeptide repeat-containing protein,...  56.2    1e-05   
emb|CBI35592.3|  unnamed protein product                              56.2    1e-05   
ref|XP_009118036.1|  PREDICTED: pentatricopeptide repeat-containi...  56.2    1e-05   
ref|XP_004516346.1|  PREDICTED: pentatricopeptide repeat-containi...  56.2    1e-05   
ref|XP_011071983.1|  PREDICTED: pentatricopeptide repeat-containi...  56.2    1e-05   
gb|KDO86622.1|  hypothetical protein CISIN_1g012126mg                 56.2    1e-05   
gb|KJB22791.1|  hypothetical protein B456_004G065800                  56.2    1e-05   
ref|XP_006444724.1|  hypothetical protein CICLE_v10023955mg           55.8    1e-05   
ref|XP_010450791.1|  PREDICTED: pentatricopeptide repeat-containi...  56.2    1e-05   
ref|XP_010645291.1|  PREDICTED: pentatricopeptide repeat-containi...  56.2    1e-05   
ref|XP_009378124.1|  PREDICTED: pentatricopeptide repeat-containi...  56.2    1e-05   
ref|XP_010450727.1|  PREDICTED: pentatricopeptide repeat-containi...  56.2    1e-05   
ref|XP_008382589.1|  PREDICTED: pentatricopeptide repeat-containi...  56.2    1e-05   
ref|XP_008374170.1|  PREDICTED: pentatricopeptide repeat-containi...  56.2    1e-05   
gb|ABQ50546.1|  hypothetical protein                                  56.2    1e-05   
ref|XP_010942600.1|  PREDICTED: pentatricopeptide repeat-containi...  56.2    1e-05   
ref|XP_006836883.1|  hypothetical protein AMTR_s00099p00108770        56.2    1e-05   



>ref|XP_009765667.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63150-like 
[Nicotiana sylvestris]
Length=512

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 95/130 (73%), Gaps = 2/130 (2%)
 Frame = -2

Query  744  VLRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFC  565
            +L+DAY+ F+RM+ R++VV+   YELVIEA C+GKE+DKAL SL E+VRIGYSP  FTF 
Sbjct  359  LLKDAYQVFERMQSRRLVVDPVGYELVIEAFCSGKELDKALESLHEVVRIGYSPKAFTFS  418

Query  564  NVIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALK  385
            NVIR LC +GKVD AL V  LM +  +    V P+++LI ELN+QG+ L A  +Y  ALK
Sbjct  419  NVIRVLCLEGKVDKALLVFILMLKVGKSTSSV-PFSLLINELNQQGKPLTACYLYGVALK  477

Query  384  RGLLVPRKKP  355
             G +VPR KP
Sbjct  478  SG-VVPRNKP  486



>ref|XP_009608994.1| PREDICTED: pentatricopeptide repeat-containing protein At5g41170, 
mitochondrial-like [Nicotiana tomentosiformis]
Length=500

 Score =   135 bits (339),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 71/130 (55%), Positives = 89/130 (68%), Gaps = 17/130 (13%)
 Frame = -2

Query  744  VLRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFC  565
            +L+DAY+ F+RMR R++VV+   YELVIEALC+GKE+DKAL SL E+VRIGYSP  FTF 
Sbjct  363  LLKDAYQVFERMRSRRLVVDPIGYELVIEALCSGKELDKALESLYEVVRIGYSPKAFTFS  422

Query  564  NVIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALK  385
            NVIR LC +GKVD A                  P+++LI ELN+QG+ L A  +Y  ALK
Sbjct  423  NVIRVLCLEGKVDKAFV----------------PFSLLINELNQQGKPLTACYLYGVALK  466

Query  384  RGLLVPRKKP  355
             G +VPR KP
Sbjct  467  SG-VVPRNKP  475



>gb|EYU42022.1| hypothetical protein MIMGU_mgv1a018881mg, partial [Erythranthe 
guttata]
Length=441

 Score =   128 bits (321),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 95/133 (71%), Gaps = 3/133 (2%)
 Frame = -2

Query  744  VLRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFC  565
            +L+D +  F+ MR+R   V   AY+LV+EALC+G+E++K    L EM+ IGYSP  FTF 
Sbjct  306  LLKDVHNVFEEMRQRNYTVCPDAYDLVVEALCSGREMEKGFEILNEMITIGYSPKTFTFN  365

Query  564  NVIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALK  385
             VI++LC  G+VD AL++  LMH ++R   G+ P+N LI +LNR+GR L+AR VYA ALK
Sbjct  366  IVIKSLCGIGEVDRALAIFKLMH-KNRDPRGI-PFNALINQLNRRGRLLEARFVYAVALK  423

Query  384  RGLLVPRKKPIQF  346
            RG +VP+ KP ++
Sbjct  424  RG-VVPKSKPSKY  435



>ref|XP_011095140.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62680, 
mitochondrial-like [Sesamum indicum]
Length=488

 Score =   126 bits (316),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 69/141 (49%), Positives = 91/141 (65%), Gaps = 4/141 (3%)
 Frame = -2

Query  744  VLRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFC  565
            +L+D    F+ MR     +    ++LV+EA CNGKE ++A     EMV+IGYSP  FTF 
Sbjct  346  LLKDVSNVFEEMRNGNYTIYPGVFDLVVEAFCNGKETNRAFQIFNEMVKIGYSPKTFTFN  405

Query  564  NVIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALK  385
             VI +LC  G+VD AL+VL LMH + R   G+ P+NILI ELN+QGR+L+A  VY  ALK
Sbjct  406  IVIHSLCCVGEVDKALAVLMLMH-KDRKPSGI-PFNILIDELNQQGRSLEACRVYGVALK  463

Query  384  RGLLVPRKKPIQFSAKAQAPH  322
            RG +VP +KP  +    Q PH
Sbjct  464  RG-VVPTRKP-TYCLAEQRPH  482



>ref|XP_004246986.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62670, 
mitochondrial-like [Solanum lycopersicum]
Length=461

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/131 (50%), Positives = 91/131 (69%), Gaps = 2/131 (2%)
 Frame = -2

Query  744  VLRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFC  565
            +L+DAY+ F +MR RK+VV+   YELVIEA C+G ++DKAL +L EM+RIGYSP  FTF 
Sbjct  323  LLQDAYQVFVKMRSRKLVVDPVGYELVIEAFCSGNKLDKALENLYEMIRIGYSPKAFTFS  382

Query  564  NVIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALK  385
            N+IR LC +G+V+ AL V   M +  +    V P+N+LI ELN++   L+A  +Y  ALK
Sbjct  383  NLIRVLCLEGEVEKALLVFVPMMKNGKSPSKV-PFNLLINELNQKEMILNACYLYGVALK  441

Query  384  RGLLVPRKKPI  352
             G +V R KP+
Sbjct  442  CG-VVTRNKPV  451



>ref|XP_007140083.1| hypothetical protein PHAVU_008G082800g [Phaseolus vulgaris]
 gb|ESW12077.1| hypothetical protein PHAVU_008G082800g [Phaseolus vulgaris]
Length=514

 Score =   119 bits (298),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 62/133 (47%), Positives = 92/133 (69%), Gaps = 8/133 (6%)
 Frame = -2

Query  744  VLRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFC  565
            +L+DAY+ F++M+ER  VV+ R +E++++ALC G   D+A A+L EMV +GYSP   TF 
Sbjct  371  LLQDAYDVFEKMKERGSVVDQRTFEVMVQALCVGMRFDQAFAALNEMVGLGYSPEVVTFD  430

Query  564  NVIRALCADGKVDGALSVLSLMHRRSRFWVGVP---PYNILIKELNRQGRALDARNVYAA  394
             VI  LCA+G+VD A+S L L+H       G+P    Y++LIKELN++G+   A N++ A
Sbjct  431  KVILGLCAEGRVDDAVSTLVLLHASG----GIPSRFSYDVLIKELNKEGKLFCACNLFGA  486

Query  393  ALKRGLLVPRKKP  355
            ALK G +VP ++P
Sbjct  487  ALKLG-VVPNREP  498



>ref|XP_002323670.2| hypothetical protein POPTR_0016s14370g [Populus trichocarpa]
 gb|EEF05431.2| hypothetical protein POPTR_0016s14370g [Populus trichocarpa]
Length=424

 Score =   118 bits (296),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 68/129 (53%), Positives = 84/129 (65%), Gaps = 8/129 (6%)
 Frame = -2

Query  732  AYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  553
            AYE F++M++R  V+E   Y LVI+AL   K+VD A  +L +MVR+GY P   T  NVIR
Sbjct  299  AYEVFEKMKKRGFVIEQSTYALVIQALWVAKKVDDAFINLHQMVRLGYIPRLITINNVIR  358

Query  552  ALCADGKVDGALSVLSLMHRRSRFWVGVP---PYNILIKELNRQGRALDARNVYAAALKR  382
            ALC  GKVD A  VL LM+  S+    +P    Y++LI ELNRQ R L A NVY AAL R
Sbjct  359  ALCVGGKVDKAFYVLVLMYENSK----IPSRMSYDLLIHELNRQERTLGACNVYGAALVR  414

Query  381  GLLVPRKKP  355
            G +VP KKP
Sbjct  415  G-VVPHKKP  422



>gb|KDP21868.1| hypothetical protein JCGZ_00655 [Jatropha curcas]
Length=442

 Score =   117 bits (293),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 60/132 (45%), Positives = 85/132 (64%), Gaps = 2/132 (2%)
 Frame = -2

Query  744  VLRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFC  565
            +L DAY+ FD+M +R  V++H  Y LVI+A   GK+VD AL SL +M++ GY P   T  
Sbjct  306  LLEDAYQVFDKMTKRAFVMDHSTYNLVIQAFSMGKKVDDALVSLQKMIKFGYIPSLTTIN  365

Query  564  NVIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALK  385
            +VIRA C  G+V+ A+ VL LM+   +       Y+++I+ELNRQ R L A NVY +AL 
Sbjct  366  SVIRAFCTKGRVEKAILVLVLMYETHKI-PNTTSYDLMIQELNRQRRFLGASNVYGSALV  424

Query  384  RGLLVPRKKPIQ  349
            RG +VP + P+ 
Sbjct  425  RG-VVPNQMPLH  435



>gb|KHN29504.1| Pentatricopeptide repeat-containing protein, mitochondrial [Glycine 
soja]
Length=310

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 61/133 (46%), Positives = 90/133 (68%), Gaps = 8/133 (6%)
 Frame = -2

Query  744  VLRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFC  565
            +L+ A E F++M+ER +VV+   +E++++ALC GK  D+ALA+L EMVR+GYSP    F 
Sbjct  173  LLQGAGEVFEKMKERGLVVDQGTFEVIVQALCEGKRFDQALANLYEMVRLGYSPEVIAFD  232

Query  564  NVIRALCADGKVDGALSVLSLMHRRSRFWVGVP---PYNILIKELNRQGRALDARNVYAA  394
             VI+ LC +G+VD A+S L L+H       GVP    Y++LIKEL  +GR   A N++ A
Sbjct  233  KVIQGLCDEGRVDDAVSALVLLHANG----GVPNRVSYDVLIKELIEEGRLFCASNLFCA  288

Query  393  ALKRGLLVPRKKP  355
            A+K G +VP ++P
Sbjct  289  AVKLG-VVPNREP  300



>ref|XP_010653334.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like 
[Vitis vinifera]
Length=545

 Score =   116 bits (290),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 69/142 (49%), Positives = 91/142 (64%), Gaps = 3/142 (2%)
 Frame = -2

Query  750  EWVLRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRF-  574
            E +L++A+E F++M      +    Y LVI+ LC  KEVDKAL  L EMV  GY P R  
Sbjct  403  EGLLKNAHEVFEKMINAGCAIYPNTYGLVIQTLCVAKEVDKALMYLNEMVGFGYFPPRMI  462

Query  573  TFCNVIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAA  394
            TF +VIRALC++G+VD ALS+L LM    R    +  YN+LI E N+QGR L A  VY A
Sbjct  463  TFNSVIRALCSEGRVDEALSILVLMCEGRRIPSRI-CYNLLIDEFNQQGRWLSACTVYGA  521

Query  393  ALKRGLLVPRKKPIQFSAKAQA  328
            ALKRG ++P K+P + S++  A
Sbjct  522  ALKRG-VIPHKRPGKSSSRKNA  542



>ref|XP_006587922.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16640, 
mitochondrial-like [Glycine max]
Length=507

 Score =   115 bits (287),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 61/133 (46%), Positives = 90/133 (68%), Gaps = 8/133 (6%)
 Frame = -2

Query  744  VLRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFC  565
            +L+ A E F++M+ER +VV+   +E++++ALC GK  D+ALA+L EMVR+GYSP    F 
Sbjct  370  LLQGAGEVFEKMKERGLVVDQGTFEVIVQALCEGKRFDQALANLYEMVRLGYSPEVIAFD  429

Query  564  NVIRALCADGKVDGALSVLSLMHRRSRFWVGVP---PYNILIKELNRQGRALDARNVYAA  394
             VI+ LC +G+VD A+S L L+H       GVP    Y++LIKEL  +GR   A N++ A
Sbjct  430  KVIQGLCDEGRVDDAVSALVLLHANG----GVPNRVSYDVLIKELIEEGRLFCASNLFCA  485

Query  393  ALKRGLLVPRKKP  355
            A+K G +VP ++P
Sbjct  486  AVKLG-VVPNREP  497



>ref|XP_007033528.1| Pentatricopeptide repeat superfamily protein, putative [Theobroma 
cacao]
 gb|EOY04454.1| Pentatricopeptide repeat superfamily protein, putative [Theobroma 
cacao]
Length=523

 Score =   114 bits (285),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 64/146 (44%), Positives = 91/146 (62%), Gaps = 13/146 (9%)
 Frame = -2

Query  765  GXGMNEW----VLRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVR  598
            G  M  W    + +DAY+ F++M    IV +H  Y  VI  LC GK++++AL  L +M+R
Sbjct  368  GLCMKSWTEKDLAQDAYQVFEKMSSVSIV-DHTTYGFVIRTLCVGKKMEEALDHLQQMIR  426

Query  597  IGYSPGRFTFCNVIRALCADGKVDGALSVLSLMHRRSRFWVGVP---PYNILIKELNRQG  427
            +GY P   TF NVI+ALC +GK+  AL VL +M+   +    +P    Y+IL+KE N QG
Sbjct  427  MGYIPRTITFNNVIQALCTEGKIREALVVLVIMYESGK----IPSRTSYDILVKEFNHQG  482

Query  426  RALDARNVYAAALKRGLLVPRKKPIQ  349
            R L A NVY AALK+G +VP + P++
Sbjct  483  RLLGASNVYGAALKQG-VVPHRIPLR  507



>ref|XP_008345572.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62680, 
mitochondrial-like [Malus domestica]
 ref|XP_008355736.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62680, 
mitochondrial-like [Malus domestica]
Length=506

 Score =   114 bits (284),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 88/132 (67%), Gaps = 2/132 (2%)
 Frame = -2

Query  744  VLRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFC  565
            +L DA++ F++M+     ++   Y L+I++LC GK++D++L SL  MVR G+SP   TF 
Sbjct  377  LLEDAHQVFEKMQSGHSGIDASTYGLMIQSLCMGKKMDESLVSLQXMVRTGHSPWIVTFN  436

Query  564  NVIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALK  385
            NVI+ LC +GKV  AL VLS+M    R   G   YN +I+ELNRQG  L A +VY AALK
Sbjct  437  NVIQGLCVEGKVFEALLVLSIMFEGGR-ATGRVSYNPVIQELNRQGSFLGACSVYGAALK  495

Query  384  RGLLVPRKKPIQ  349
            RG ++P KKP Q
Sbjct  496  RG-VIPNKKPQQ  506



>ref|XP_011002598.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At3g16710, mitochondrial [Populus euphratica]
Length=536

 Score =   113 bits (283),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 66/126 (52%), Positives = 82/126 (65%), Gaps = 2/126 (2%)
 Frame = -2

Query  732  AYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  553
            AYE F++M++R  V+E   Y LVI+AL   K+VD A  +L  MVR+GY P   T  NVIR
Sbjct  411  AYEVFEKMKKRGFVIEQSTYALVIQALWVAKKVDDAFINLHLMVRLGYFPRLITINNVIR  470

Query  552  ALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGLL  373
            ALC  GKVD A  VL LM+  S+    +  Y++LI ELN+Q R L A NVY AAL RG +
Sbjct  471  ALCVAGKVDEAFYVLVLMYENSKIPSRM-SYDLLIHELNQQERTLCACNVYGAALVRG-V  528

Query  372  VPRKKP  355
            VP KKP
Sbjct  529  VPHKKP  534



>gb|KJB27678.1| hypothetical protein B456_005G004200 [Gossypium raimondii]
Length=480

 Score =   107 bits (267),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 58/147 (39%), Positives = 91/147 (62%), Gaps = 12/147 (8%)
 Frame = -2

Query  765  GXGMNEW----VLRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVR  598
            G  M  W    +++DAY+ FD+MR++  +++H +Y  +I  LC  +++++A+  L EM+ 
Sbjct  338  GLCMKSWEEKDLVQDAYQVFDKMRKKDSIIDHSSYGFMIRTLCMVRKMEEAVYHLKEMIG  397

Query  597  IGYSPGRFTFCNVIRALCADGKVDGALSVLSLMHRRSRFWVGVP---PYNILIKELNRQG  427
            +GY P   TF NVI+ LC +GK+  AL VL  M+   +    +P    Y++L+KE NRQG
Sbjct  398  MGYIPRTITFNNVIQGLCIEGKIHEALVVLVTMYENGK----IPSRTSYDMLVKEFNRQG  453

Query  426  RALDARNVYAAALKRGLLVPRKKPIQF  346
              L A NVY AALK+G +V  + PI+ 
Sbjct  454  LLLGACNVYGAALKQG-VVQHRIPIRL  479



>ref|XP_010109661.1| hypothetical protein L484_006096 [Morus notabilis]
 gb|EXC23833.1| hypothetical protein L484_006096 [Morus notabilis]
Length=618

 Score =   108 bits (270),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 60/134 (45%), Positives = 85/134 (63%), Gaps = 8/134 (6%)
 Frame = -2

Query  741  LRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  562
            L +A++ F++M+    V++   Y+++I ALC GK+ D A   L +M+R+GYSP   TF  
Sbjct  490  LENAHQVFEKMKHEDSVIDPSTYDVMIGALCMGKKTDDASVYLQKMIRMGYSPRMVTFNG  549

Query  561  VIRALCADGKVDGALSVLSLMHRRSRFWVGVPP---YNILIKELNRQGRALDARNVYAAA  391
            VIRALC + KV  ALS+L L++   R    +P    YN+LI ELN+ G  L A NVY AA
Sbjct  550  VIRALCLEEKVIEALSILVLLNEEGR----IPSRTCYNLLIDELNQHGSLLGASNVYGAA  605

Query  390  LKRGLLVPRKKPIQ  349
            LKRG ++P   P+Q
Sbjct  606  LKRG-VIPTMMPLQ  618



>ref|XP_004305082.1| PREDICTED: pentatricopeptide repeat-containing protein At5g41170, 
mitochondrial-like [Fragaria vesca subsp. vesca]
Length=509

 Score =   107 bits (266),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 58/132 (44%), Positives = 87/132 (66%), Gaps = 2/132 (2%)
 Frame = -2

Query  744  VLRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFC  565
            +L DA E F++++     ++   Y L+I++LC GK++D A+ +L +M+ +GYSP   TF 
Sbjct  380  LLEDACELFEKLQNGVSDIDASTYGLMIQSLCMGKKIDDAMINLKQMLTVGYSPRMITFN  439

Query  564  NVIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALK  385
            NVI++LCA+ K+  AL VL   ++  R    V  YN+LI++LN+ G  L+A  VY AALK
Sbjct  440  NVIQSLCAEEKMIDALLVLGTAYKFDRVASRV-SYNLLIQKLNQHGSMLEACTVYGAALK  498

Query  384  RGLLVPRKKPIQ  349
            RG L+P KKP Q
Sbjct  499  RG-LIPNKKPQQ  509



>ref|XP_008245346.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16640, 
mitochondrial-like [Prunus mume]
Length=523

 Score =   105 bits (261),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 59/132 (45%), Positives = 84/132 (64%), Gaps = 2/132 (2%)
 Frame = -2

Query  744  VLRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFC  565
            +L DA+E F++M+   + ++   + L+I+  C  K++D A+  L EM+ +GYSP   TF 
Sbjct  394  LLEDAHEVFEKMQNGVLGIDASTFGLMIQTHCMEKKMDAAVVCLQEMIGMGYSPWIITFN  453

Query  564  NVIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALK  385
            NVI+ LC +GKV  AL VLS+M+   R   G+  YN LI  LNR+G  L A +VY AALK
Sbjct  454  NVIKTLCVEGKVTEALLVLSIMYEGGRGTNGI-SYNPLIHGLNRRGSFLGACSVYGAALK  512

Query  384  RGLLVPRKKPIQ  349
            RG ++P  KP Q
Sbjct  513  RG-VIPNTKPQQ  523



>ref|XP_008782664.1| PREDICTED: pentatricopeptide repeat-containing protein At5g41170, 
mitochondrial-like [Phoenix dactylifera]
Length=587

 Score =   102 bits (254),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 61/153 (40%), Positives = 90/153 (59%), Gaps = 9/153 (6%)
 Frame = -2

Query  756  MNEWVLRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGR  577
            +N  +L+DA E F+++ E         Y L+++AL  G E+D+ALA L EMVR GYSP  
Sbjct  419  INGELLKDAKELFEKVMEMDFGPSPYTYCLMVQALAVGGEIDEALAHLHEMVRAGYSPRM  478

Query  576  FTFCNVIRALCADGKVDGALSVLSLMHRR----SRFWVGVPPYNILIKELNRQGRALDAR  409
             T+  ++R LC +G+V+ AL +L LM +R    SRF      + +L+ EL+RQGR LDA 
Sbjct  479  MTYNVILRTLCEEGRVNDALGILVLMIKRGKIPSRF-----SFRVLLNELSRQGRLLDAF  533

Query  408  NVYAAALKRGLLVPRKKPIQFSAKAQAPHIANG  310
             VYAAA+KR ++        +  + +  HI  G
Sbjct  534  GVYAAAIKRNVISNWTPQKDWQNEEELKHIQGG  566


 Score = 53.9 bits (128),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 32/107 (30%), Positives = 55/107 (51%), Gaps = 9/107 (8%)
 Frame = -2

Query  720  FDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRALCA  541
            F  +  R +  +  ++ ++I++LC   E D+A   L +MV+ G+ P   TF +++ +LC 
Sbjct  181  FSELPSRGLSPDSLSFSIMIQSLCKKNEPDEAKQVLDDMVQSGFRPNIITFTDLVNSLCK  240

Query  540  DGKVDGALSVLSLMHRRSRFWVGVPP----YNILIKELNRQGRALDA  412
             G++  A  V  +M++     VG  P    YN LI  L   GR  +A
Sbjct  241  RGRLKKAFEVFEIMNQ-----VGCEPTIRTYNCLIGGLCYVGRLEEA  282



>ref|XP_007206949.1| hypothetical protein PRUPE_ppb018157mg [Prunus persica]
 gb|EMJ08148.1| hypothetical protein PRUPE_ppb018157mg [Prunus persica]
Length=412

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 57/132 (43%), Positives = 81/132 (61%), Gaps = 2/132 (2%)
 Frame = -2

Query  744  VLRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFC  565
            +  DA+E F++M+   + +    Y L+I+ LC  K++  A+  L +M+ +GYSP   TF 
Sbjct  283  LFEDAHEVFEKMQNGILGINASTYGLMIQTLCMEKKMYAAVFCLQQMIGMGYSPWIITFN  342

Query  564  NVIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALK  385
            NVI+ LC +GKV  AL VLS+M+   R   G+  Y  LI  LNR+G  L A +VY AALK
Sbjct  343  NVIKTLCVEGKVTEALLVLSIMYEGGRGTNGI-SYKPLIHGLNRRGSFLGACSVYGAALK  401

Query  384  RGLLVPRKKPIQ  349
            RG ++P  KP Q
Sbjct  402  RG-VIPNTKPQQ  412



>ref|XP_009406874.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62680, 
mitochondrial-like [Musa acuminata subsp. malaccensis]
Length=613

 Score = 99.8 bits (247),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 63/145 (43%), Positives = 82/145 (57%), Gaps = 1/145 (1%)
 Frame = -2

Query  756  MNEWVLRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGR  577
            ++E VL DA E  D + E         Y L+++AL  G E+DKAL  L EMVRIGY P  
Sbjct  465  IDEKVLNDAMELLDAITEIGHNPSVYTYCLMVKALAIGGEIDKALFHLQEMVRIGYCPRM  524

Query  576  FTFCNVIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYA  397
             T+  V+R LC  G+ D AL VL LM  R     G   + IL+ EL +QGR LDA  VYA
Sbjct  525  MTYNVVLRVLCGGGRGDDALDVLVLMIERGTIPSG-SSFGILLGELCQQGRVLDAFGVYA  583

Query  396  AALKRGLLVPRKKPIQFSAKAQAPH  322
            AA+KRG+++  K    F+ +    H
Sbjct  584  AAIKRGVVLHWKPNKGFNVQTVIQH  608



>ref|XP_010921153.1| PREDICTED: pentatricopeptide repeat-containing protein At5g41170, 
mitochondrial-like [Elaeis guineensis]
Length=703

 Score = 99.4 bits (246),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 57/132 (43%), Positives = 84/132 (64%), Gaps = 9/132 (7%)
 Frame = -2

Query  756  MNEWVLRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGR  577
            +N  +++DA E F+++ E         Y L+++AL  G E+D+ALA L EMVR GYSP  
Sbjct  536  INSELIKDAKELFEKVMEMDFGPSPYTYCLMVQALAIGGEIDEALALLHEMVRAGYSPRM  595

Query  576  FTFCNVIRALCADGKVDGALSVLSLMHRR----SRFWVGVPPYNILIKELNRQGRALDAR  409
             T+  ++R LC +G+V+ AL +L LM +R    SRF      + +L+ EL+RQGR LDA 
Sbjct  596  MTYNVILRTLCEEGRVNDALGILVLMIKREKIPSRF-----SFRVLLNELSRQGRLLDAF  650

Query  408  NVYAAALKRGLL  373
             VYAAA+KR ++
Sbjct  651  GVYAAAIKRNVI  662


 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 33/107 (31%), Positives = 53/107 (50%), Gaps = 9/107 (8%)
 Frame = -2

Query  720  FDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRALCA  541
            F  +R   +  +  ++ ++I+ LC   + D+A   L EMV+ G+ P   TF  V+ +LC 
Sbjct  298  FSELRSHGLSPDSLSFSIMIQCLCKKNDPDEAKQVLDEMVQSGFRPNIITFTAVVNSLCK  357

Query  540  DGKVDGALSVLSLMHRRSRFWVGVPP----YNILIKELNRQGRALDA  412
             G++  A  V  +M++     VG  P    YN LI  L   GR  +A
Sbjct  358  RGRLKKAFEVFEIMNQ-----VGCEPTIRTYNCLISGLCYVGRLEEA  399



>ref|XP_006842489.1| hypothetical protein AMTR_s00077p00087500 [Amborella trichopoda]
 gb|ERN04164.1| hypothetical protein AMTR_s00077p00087500 [Amborella trichopoda]
Length=334

 Score = 96.3 bits (238),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 56/138 (41%), Positives = 77/138 (56%), Gaps = 2/138 (1%)
 Frame = -2

Query  750  EWVLRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFT  571
            E  L D    F  +RE   V     Y L+I +L    E++KAL+ L EM+  G+ P R T
Sbjct  189  EISLGDVERVFRSIRELGYVPSPHTYCLMIHSLSTRGEMEKALSILTEMIENGHPPKRMT  248

Query  570  FCNVIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAA  391
            +  +I+ LC+ G+VD A+ VL LM  R         YNILI+E N+ GR  DA  +YA A
Sbjct  249  YNTLIKGLCSKGRVDDAMDVLKLMFERET-SPSKAAYNILIREFNQSGRVFDASRLYAKA  307

Query  390  LKRGLLVPRKKPIQFSAK  337
            LKRG +VP ++P +   K
Sbjct  308  LKRG-VVPHQQPAEILVK  324



>ref|XP_006481194.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like 
[Citrus sinensis]
Length=387

 Score = 96.7 bits (239),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 54/144 (38%), Positives = 88/144 (61%), Gaps = 12/144 (8%)
 Frame = -2

Query  765  GXGMNEW----VLRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVR  598
            G  M  W    +L DAY+ F++M ++  V +   Y +VI  L  GK+ D+AL  L   + 
Sbjct  247  GLCMKSWEEKDLLEDAYQVFEKMTKKVSVTDPGTYGIVIRTLGKGKKTDEALIHLHHAIE  306

Query  597  IGYSPGRFTFCNVIRALCADGKVDGALSVLSLMHRRSRFWVGVP---PYNILIKELNRQG  427
            +G+ P   TF NVI+ALC +GK+D AL +L LM+  ++    +P    Y++LI +L++  
Sbjct  307  MGHIPRTITFNNVIQALCGEGKIDKALLLLFLMYEHAK----IPSRTSYDMLITKLDQLE  362

Query  426  RALDARNVYAAALKRGLLVPRKKP  355
            ++ DA  +Y AALK+G ++P++KP
Sbjct  363  KSYDACALYGAALKQG-VIPQRKP  385



>ref|XP_010683486.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53700, 
chloroplastic-like [Beta vulgaris subsp. vulgaris]
Length=547

 Score = 97.8 bits (242),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/142 (39%), Positives = 80/142 (56%), Gaps = 6/142 (4%)
 Frame = -2

Query  765  GXGMNEW----VLRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVR  598
            G   N W    +L++ +E F++++     +    Y L+I   C GKEVD AL +L EMV 
Sbjct  401  GLCRNSWEENELLKNVHEIFEKIKSWDYSIFPETYGLLIHTFCIGKEVDMALITLHEMVE  460

Query  597  IGYSPGRFTFCNVIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRAL  418
             GY P   T   ++R LC +GK+  AL VL L+    +F   +  +N LI+E NRQG  L
Sbjct  461  AGYFPRMVTINRIVRRLCDEGKISQALLVLVLVFEAGKFPSKI-SFNFLIEEFNRQGNVL  519

Query  417  DARNVYAAALKRGLLVPRKKPI  352
             A NVY AALK G ++P + P+
Sbjct  520  GACNVYGAALKVG-VIPHQMPL  540



>ref|XP_010253075.1| PREDICTED: pentatricopeptide repeat-containing protein At5g41170, 
mitochondrial-like [Nelumbo nucifera]
Length=623

 Score = 97.8 bits (242),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 59/135 (44%), Positives = 81/135 (60%), Gaps = 2/135 (1%)
 Frame = -2

Query  753  NEWVLRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRF  574
            +E +L DA E F+R+++         Y ++I AL    E++KALA+L EM+ +GY P   
Sbjct  471  DEELLIDALEVFERIKKFSYTPHSYTYGMMIHALSIRGEIEKALANLHEMLSLGYHPRMI  530

Query  573  TFCNVIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAA  394
            TF  VI+ALC  G++D AL +L  M  R R        N+LI  LN+QGR LDA  +Y A
Sbjct  531  TFNTVIQALCRAGRIDEALLLLVHMF-RGRTTPSRISCNLLIDNLNKQGRLLDACKIYGA  589

Query  393  ALKRGLLVPRKKPIQ  349
            ALKRG + P +KP Q
Sbjct  590  ALKRG-VTPHQKPKQ  603



>ref|XP_006429582.1| hypothetical protein CICLE_v10013314mg, partial [Citrus clementina]
 gb|ESR42822.1| hypothetical protein CICLE_v10013314mg, partial [Citrus clementina]
Length=438

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 54/144 (38%), Positives = 88/144 (61%), Gaps = 12/144 (8%)
 Frame = -2

Query  765  GXGMNEW----VLRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVR  598
            G  M  W    +L DAY+ F++M ++  V +   Y +VI  L  GK+ D+AL  L   + 
Sbjct  298  GLCMKSWEEKDLLEDAYQVFEKMTKKVSVTDPGTYGIVIRTLGKGKKTDEALIHLHHAIE  357

Query  597  IGYSPGRFTFCNVIRALCADGKVDGALSVLSLMHRRSRFWVGVP---PYNILIKELNRQG  427
            +G+ P   TF NVI+ALC +GK+D AL +L LM+  ++    +P    Y++LI +L++  
Sbjct  358  MGHIPRTITFNNVIQALCGEGKIDKALLLLFLMYEHAK----IPSRTSYDMLITKLDQLE  413

Query  426  RALDARNVYAAALKRGLLVPRKKP  355
            ++ DA  +Y AALK+G ++P++KP
Sbjct  414  KSYDACALYGAALKQG-VIPQRKP  436



>gb|KDO64095.1| hypothetical protein CISIN_1g011714mg [Citrus sinensis]
Length=479

 Score = 96.7 bits (239),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 54/144 (38%), Positives = 88/144 (61%), Gaps = 12/144 (8%)
 Frame = -2

Query  765  GXGMNEW----VLRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVR  598
            G  M  W    +L DAY+ F++M ++  V +   Y +VI  L  GK+ D+AL  L   + 
Sbjct  339  GLCMKSWEEKDLLEDAYQVFEKMTKKVSVTDPGTYGIVIRTLGKGKKTDEALIHLHHAIE  398

Query  597  IGYSPGRFTFCNVIRALCADGKVDGALSVLSLMHRRSRFWVGVP---PYNILIKELNRQG  427
            +G+ P   TF NVI+ALC +GK+D AL +L LM+  ++    +P    Y++LI +L++  
Sbjct  399  MGHIPRTITFNNVIQALCGEGKIDKALLLLFLMYEHAK----IPSRTSYDMLITKLDQLE  454

Query  426  RALDARNVYAAALKRGLLVPRKKP  355
            ++ DA  +Y AALK+G ++P++KP
Sbjct  455  KSYDACALYGAALKQG-VIPQRKP  477



>gb|KCW88349.1| hypothetical protein EUGRSUZ_A00738 [Eucalyptus grandis]
Length=409

 Score = 94.7 bits (234),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 80/133 (60%), Gaps = 10/133 (8%)
 Frame = -2

Query  744  VLRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFC  565
            +L DAY+ F +MR     ++  +Y  +I+ L  G   ++AL ++  M+ +G+SP   +  
Sbjct  271  LLDDAYQMFKKMRSTGCAIDESSYGFIIQTLSVGNRNEEALFNMEHMMTMGHSPKMISLA  330

Query  564  NVIRALCADGKVDGALSVLSLMHRRSRFWVGVPP---YNILIKELNRQGRALDARNVYAA  394
             V+RALC +GK+  ALSV  LM  R    +G P    YN++I E NRQGR L A NVY  
Sbjct  331  RVLRALCREGKLGKALSV--LMDER----LGHPSKEVYNVIINEFNRQGRWLCACNVYGM  384

Query  393  ALKRGLLVPRKKP  355
            ALK+G +VP KKP
Sbjct  385  ALKQG-VVPEKKP  396



>ref|XP_003623623.1| Pentatricopeptide repeat-containing protein [Medicago truncatula]
 gb|AES79841.1| PPR containing plant-like protein [Medicago truncatula]
Length=583

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 55/139 (40%), Positives = 81/139 (58%), Gaps = 1/139 (1%)
 Frame = -2

Query  744  VLRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFC  565
            +L DA E F++M+ER +VV+ R  E+++EAL  G++ D+AL +L +MVR GYS     F 
Sbjct  376  LLEDACEVFEKMKERGLVVDKRTVEVMVEALFRGEKFDEALVNLNDMVRWGYSLEGIAFE  435

Query  564  NVIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALK  385
             VI  LC  G+VD A+S L L+     F   V  + +L+ ELN  GR   A  ++  ALK
Sbjct  436  EVIEGLCGQGRVDEAVSTLLLLQANGGFLDRV-SFGVLVNELNAHGRVFCASFLFGVALK  494

Query  384  RGLLVPRKKPIQFSAKAQA  328
             G+++   K +Q   K  A
Sbjct  495  HGVVLVLNKELQADRKELA  513



>ref|XP_010043220.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, 
chloroplastic-like [Eucalyptus grandis]
Length=540

 Score = 94.7 bits (234),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 80/133 (60%), Gaps = 10/133 (8%)
 Frame = -2

Query  744  VLRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFC  565
            +L DAY+ F +MR     ++  +Y  +I+ L  G   ++AL ++  M+ +G+SP   +  
Sbjct  402  LLDDAYQMFKKMRSTGCAIDESSYGFIIQTLSVGNRNEEALFNMEHMMTMGHSPKMISLA  461

Query  564  NVIRALCADGKVDGALSVLSLMHRRSRFWVGVPP---YNILIKELNRQGRALDARNVYAA  394
             V+RALC +GK+  ALSV  LM  R    +G P    YN++I E NRQGR L A NVY  
Sbjct  462  RVLRALCREGKLGKALSV--LMDER----LGHPSKEVYNVIINEFNRQGRWLCACNVYGM  515

Query  393  ALKRGLLVPRKKP  355
            ALK+G +VP KKP
Sbjct  516  ALKQG-VVPEKKP  527



>ref|XP_004492557.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At5g41170, mitochondrial-like [Cicer arietinum]
Length=560

 Score = 86.7 bits (213),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 54/132 (41%), Positives = 81/132 (61%), Gaps = 2/132 (2%)
 Frame = -2

Query  744  VLRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFC  565
            ++ DA E F++M++R +VV+ R  E++++A C   + D+ALA+L +MVR GYS     F 
Sbjct  373  LIHDADEVFEKMKDRGLVVDKRTVEVMVQAYCWRDKFDEALANLNDMVRWGYSLEAIEFE  432

Query  564  NVIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALK  385
             VI   C  G+VD ALS L L+H      V    Y +L+ ELN +GR   A  ++  ALK
Sbjct  433  KVIEGFCGQGRVDDALSSLLLLHANGGI-VDRVCYEVLVNELNARGRVFCASFLFGVALK  491

Query  384  RG-LLVPRKKPI  352
            +G +LVP K+P+
Sbjct  492  QGVVLVPNKEPM  503


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/113 (31%), Positives = 55/113 (49%), Gaps = 1/113 (1%)
 Frame = -2

Query  720  FDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRALCA  541
            F ++   ++V +   Y ++I   C   +V++A   L  ++  G  P   T   +I +LC 
Sbjct  128  FTKLSSFQLVPDCCTYSIIIRCHCEKNDVEEAKGVLFTVLENGLQPDSATITVLINSLCK  187

Query  540  DGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKR  382
             GKV  A+ V   M RR    +GV PYN L+K L+  GR  +A  +     KR
Sbjct  188  RGKVKKAMEVFEFM-RRKGLKLGVQPYNCLLKGLSYIGRVDEAIEILMGMKKR  239



>gb|ABR16388.1| unknown [Picea sitchensis]
Length=700

 Score = 86.3 bits (212),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 73/134 (54%), Gaps = 9/134 (7%)
 Frame = -2

Query  738  RDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNV  559
            +DA   + RM++R        Y L I  L    E+++A A L EM+  GYSP   T+  +
Sbjct  550  KDASIFYRRMKDRGFAYSASDYYLAIHCLSTAGEMEEAQALLYEMINKGYSPNLTTYNTM  609

Query  558  IRALCADGKVDGALSVLSLMHRRSRFWVGVPP----YNILIKELNRQGRALDARNVYAAA  391
            I+  C  G++D A ++L+ M        G+ P    YNILIKE + QGR  DA  +YA A
Sbjct  610  IKGFCRQGRLDDADAMLNFMIEN-----GIGPDTGSYNILIKEFHNQGRTQDADQLYATA  664

Query  390  LKRGLLVPRKKPIQ  349
            L+RG+++  K  IQ
Sbjct  665  LERGVVLNPKPVIQ  678


 Score = 56.6 bits (135),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 63/126 (50%), Gaps = 9/126 (7%)
 Frame = -2

Query  741  LRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  562
            + DA +  D M +     +   Y +VI ALC  K +++A   L +M   G  P  +T+  
Sbjct  339  MEDAMKLLDDMIQNNYAPDVVTYTIVISALCKRKMIEQAYGVLQKMRENGCEPNIYTYNA  398

Query  561  VIRALCADGKVDGALSVLSLMHRRSRFWVGVPP----YNILIKELNRQGRALDARNVYAA  394
            +I+ LCA  + + AL +++LM +      GVPP    Y IL   L +  R   A+ ++  
Sbjct  399  LIQGLCAVRRPEEALELVTLMEQG-----GVPPNIYTYTILTHGLCKLRRLDRAKEMFNE  453

Query  393  ALKRGL  376
            AL RGL
Sbjct  454  ALARGL  459



>gb|EMT30207.1| hypothetical protein F775_08031 [Aegilops tauschii]
Length=539

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 54/140 (39%), Positives = 83/140 (59%), Gaps = 1/140 (1%)
 Frame = -2

Query  744  VLRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFC  565
            VLRDA E F ++           Y L+ +AL  G EVD A+A L +MVR GY+  +  + 
Sbjct  395  VLRDAKEVFGKVVAAGHEPVSYTYCLMAQALARGGEVDAAVAILDDMVRKGYALRKRAYT  454

Query  564  NVIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALK  385
            +V+RALC   +   AL VL+ +  +  F  G   ++ L++EL+RQGR  DA  VYAAA+K
Sbjct  455  DVVRALCDRSRTHAALRVLAAVITKD-FVPGRNAFDALLEELSRQGRWPDAMAVYAAAVK  513

Query  384  RGLLVPRKKPIQFSAKAQAP  325
            RG++V  K+ ++ +   ++P
Sbjct  514  RGVVVSLKRHVKEALARESP  533



>ref|XP_003557966.1| PREDICTED: pentatricopeptide repeat-containing protein At2g06000-like 
[Brachypodium distachyon]
Length=538

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 52/132 (39%), Positives = 77/132 (58%), Gaps = 1/132 (1%)
 Frame = -2

Query  744  VLRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFC  565
             LRDA E F ++           Y L+ +AL  G EVD A+A L +M R GY+  +  + 
Sbjct  390  ALRDAKEVFGKLVSSGHEPVSYTYCLMAQALARGGEVDAAVAILDDMARKGYALRKRAYT  449

Query  564  NVIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALK  385
            +V+RALC   +   A+ VL+++  R  F  G   ++ L+ EL+RQGR  DA  VYAAA+K
Sbjct  450  DVVRALCDRSRTSEAVRVLAVVIARD-FVPGRNAFDALLGELSRQGRWPDAMAVYAAAVK  508

Query  384  RGLLVPRKKPIQ  349
            RG++V  K+ I+
Sbjct  509  RGVVVSLKRHIK  520



>ref|NP_001130560.1| uncharacterized protein LOC100191659 [Zea mays]
 gb|ACF78824.1| unknown [Zea mays]
Length=558

 Score = 78.2 bits (191),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 52/130 (40%), Positives = 72/130 (55%), Gaps = 0/130 (0%)
 Frame = -2

Query  759  GMNEWVLRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPG  580
              +   L DA E F ++           Y L+ +AL  G EVD A+A L +MVR GY+  
Sbjct  405  ATDASALGDAEEVFGKVVASGHEPVSYTYCLMAQALARGGEVDAAVALLEDMVRKGYALR  464

Query  579  RFTFCNVIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVY  400
            +  + +V+RALC  G+   AL VL L+     F  G   +  L+ EL+RQGR  DA  VY
Sbjct  465  KRAYTDVVRALCDRGRARDALQVLVLVMIVRDFVPGRNAFEALLGELSRQGRWADAMTVY  524

Query  399  AAALKRGLLV  370
            AAA+KRG++V
Sbjct  525  AAAVKRGVVV  534



>gb|ACG44675.1| hypothetical protein [Zea mays]
Length=558

 Score = 77.8 bits (190),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 52/130 (40%), Positives = 72/130 (55%), Gaps = 0/130 (0%)
 Frame = -2

Query  759  GMNEWVLRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPG  580
              +   L DA E F ++           Y L+ +AL  G EVD A+A L +MVR GY+  
Sbjct  405  ATDASALGDAEEVFGKVVASGHEPVSYTYCLMAQALARGGEVDAAVALLEDMVRKGYALR  464

Query  579  RFTFCNVIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVY  400
            +  + +V+RALC  G+   AL VL L+     F  G   +  L+ EL+RQGR  DA  VY
Sbjct  465  KRAYTDVVRALCDRGRARDALQVLVLVMIVRDFVPGRNAFEALLGELSRQGRWADAMTVY  524

Query  399  AAALKRGLLV  370
            AAA+KRG++V
Sbjct  525  AAAVKRGVVV  534



>ref|XP_004984461.1| PREDICTED: protein Rf1, mitochondrial-like [Setaria italica]
Length=552

 Score = 77.4 bits (189),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 53/128 (41%), Positives = 72/128 (56%), Gaps = 0/128 (0%)
 Frame = -2

Query  753  NEWVLRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRF  574
            +   L DA E F ++           Y L+ +AL  G EVD A+A L EMVR GY+  + 
Sbjct  405  DASALGDAREVFAKLVASGHEPVSYTYCLMAQALARGGEVDAAVALLEEMVRRGYALRKR  464

Query  573  TFCNVIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAA  394
             + +V+RALC  G+   AL VL L+     F  G   ++ L+ EL+RQGR  DA  VYAA
Sbjct  465  AYTDVVRALCDRGRARDALRVLVLVMIVRDFVPGRNAFDALLGELSRQGRWPDAMAVYAA  524

Query  393  ALKRGLLV  370
            A+KRG+ V
Sbjct  525  AVKRGVAV  532



>ref|NP_001050037.1| Os03g0336000 [Oryza sativa Japonica Group]
 gb|ABF95816.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF11951.1| Os03g0336000 [Oryza sativa Japonica Group]
 gb|EAY89912.1| hypothetical protein OsI_11461 [Oryza sativa Indica Group]
 dbj|BAG94427.1| unnamed protein product [Oryza sativa Japonica Group]
Length=545

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 67/106 (63%), Gaps = 1/106 (1%)
 Frame = -2

Query  675  YELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRALCADGKVDGALSVLSLMH  496
            Y L+ +AL  G EVD A++ L EM R GY+  +  + +V+RALC  G+   AL VL+L+ 
Sbjct  418  YCLMAQALARGGEVDAAVSLLGEMARRGYALRKRAYTDVVRALCERGRARDALRVLALVI  477

Query  495  RRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGLLVPRKK  358
             R  F  G   ++ L+ EL RQGR  DA  VYAAA+KRG+LV  K+
Sbjct  478  ARD-FVPGRNAFDALLGELARQGRWPDAMAVYAAAVKRGVLVSLKR  522



>gb|EAZ26836.1| hypothetical protein OsJ_10752 [Oryza sativa Japonica Group]
Length=523

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 64/101 (63%), Gaps = 1/101 (1%)
 Frame = -2

Query  660  EALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRALCADGKVDGALSVLSLMHRRSRF  481
            EAL  G EVD A++ L EM R GY+  +  + +V+RALC  G+   AL VL+L+  R  F
Sbjct  401  EALARGGEVDAAVSLLGEMARRGYALRKRAYTDVVRALCERGRARDALRVLALVIARD-F  459

Query  480  WVGVPPYNILIKELNRQGRALDARNVYAAALKRGLLVPRKK  358
              G   ++ L+ EL RQGR  DA  VYAAA+KRG+LV  K+
Sbjct  460  VPGRNAFDALLGELARQGRWPDAMAVYAAAVKRGVLVSLKR  500



>gb|KFK35778.1| hypothetical protein AALP_AA4G035000 [Arabis alpina]
Length=397

 Score = 71.2 bits (173),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 41/114 (36%), Positives = 60/114 (53%), Gaps = 1/114 (1%)
 Frame = -2

Query  720  FDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRALCA  541
            FD M ERK VV+  AY  +++ALC   +VD+A     EM ++G+ P  +++   I A C 
Sbjct  106  FDEMLERKCVVDLLAYNALLDALCKSGDVDEAYKMFEEMGKVGFKPDAYSYAIFIHAYCD  165

Query  540  DGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRG  379
             G V  A  VL  M RR      V  YN +IK L ++ +  DA  +    ++RG
Sbjct  166  SGDVHSAYKVLDRM-RRYDLVTNVYTYNHIIKTLCKKDKVDDAYLMLDEMIERG  218


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 59/122 (48%), Gaps = 1/122 (1%)
 Frame = -2

Query  741  LRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  562
            +  AY+  DRMR   +V     Y  +I+ LC   +VD A   L EM+  G SP  +T+ +
Sbjct  169  VHSAYKVLDRMRRYDLVTNVYTYNHIIKTLCKKDKVDDAYLMLDEMIERGASPDTWTYNS  228

Query  561  VIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKR  382
            ++   C   +V+ A  + S M  R++       YN+++K L R GR   A  V+    +R
Sbjct  229  IMAYHCDHCEVNRATKLFSRMD-RTKCLPDRHTYNMVLKLLIRIGRFDRATEVWEGMSER  287

Query  381  GL  376
              
Sbjct  288  KF  289



>ref|NP_001060800.1| Os08g0107700 [Oryza sativa Japonica Group]
 dbj|BAF22714.1| Os08g0107700, partial [Oryza sativa Japonica Group]
Length=374

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/125 (34%), Positives = 66/125 (53%), Gaps = 9/125 (7%)
 Frame = -2

Query  741  LRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  562
            L  AY  FD+M ++ +  +   Y  +I AL   + +DKA   LV MV+ G  P R T  +
Sbjct  219  LDTAYHLFDQMLDQGLSPDVVTYNSIISALSKARAMDKAAVVLVRMVKNGAMPNRITHNS  278

Query  561  VIRALCADGKVDGALSVLSLMHRRSRFWVGVPP----YNILIKELNRQGRALDARNVYAA  394
            ++   C+ GK + A+ V   M R      GV P    YN L+  L + GR+++AR ++ +
Sbjct  279  LLHGYCSSGKPNDAIGVFKRMCRD-----GVEPDVFTYNTLMGYLCKNGRSMEARKIFDS  333

Query  393  ALKRG  379
             +KRG
Sbjct  334  MVKRG  338



>dbj|BAD09393.1| putative PPR protein [Oryza sativa Japonica Group]
 gb|EAZ41257.1| hypothetical protein OsJ_25765 [Oryza sativa Japonica Group]
Length=798

 Score = 70.9 bits (172),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 42/125 (34%), Positives = 66/125 (53%), Gaps = 9/125 (7%)
 Frame = -2

Query  741  LRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  562
            L  AY  FD+M ++ +  +   Y  +I AL   + +DKA   LV MV+ G  P R T  +
Sbjct  219  LDTAYHLFDQMLDQGLSPDVVTYNSIISALSKARAMDKAAVVLVRMVKNGAMPNRITHNS  278

Query  561  VIRALCADGKVDGALSVLSLMHRRSRFWVGVPP----YNILIKELNRQGRALDARNVYAA  394
            ++   C+ GK + A+ V   M R      GV P    YN L+  L + GR+++AR ++ +
Sbjct  279  LLHGYCSSGKPNDAIGVFKRMCRD-----GVEPDVFTYNTLMGYLCKNGRSMEARKIFDS  333

Query  393  ALKRG  379
             +KRG
Sbjct  334  MVKRG  338


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 35/116 (30%), Positives = 57/116 (49%), Gaps = 9/116 (8%)
 Frame = -2

Query  735  DAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVI  556
            DA   F +MR + +  +   Y +V++ALC   +VD A+A    ++  G +P    F N+I
Sbjct  396  DAMLLFSKMRRQGLNPDTVTYGIVMDALCMVGKVDDAMAQFGRLISEGLTPDAVVFRNLI  455

Query  555  RALCADGKVDGALSVLSLMHRRSRFWVGVPP----YNILIKELNRQGRALDARNVY  400
              LCA  K D A  +   M  R     G+ P    +N L+  L ++G    A+N++
Sbjct  456  HGLCARDKWDKAEELAVEMIGR-----GICPNNIFFNTLLNHLCKEGMVARAKNIF  506



>dbj|BAD13709.1| PPR protein [Oryza sativa Indica Group]
Length=332

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 61/125 (49%), Gaps = 1/125 (1%)
 Frame = -2

Query  750  EWVLRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFT  571
            E  L   Y  ++ M +++I      Y  +I ALC  + VDKA+  L  MV+ G  P   T
Sbjct  25   EGDLDKTYSTYNEMLDKRISPNVVTYNSIIAALCKAQTVDKAMEVLTTMVKSGVMPDCMT  84

Query  570  FCNVIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAA  391
            + +++   C+ G+   A+  L  M R       V  YN L+  L + GR  +AR ++ + 
Sbjct  85   YNSIVHGFCSSGQPKEAIVFLKKM-RSDGVEPDVVTYNSLMDYLCKNGRCTEARKIFDSM  143

Query  390  LKRGL  376
             KRGL
Sbjct  144  TKRGL  148



>ref|XP_010248027.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09820 
[Nelumbo nucifera]
Length=616

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/119 (32%), Positives = 67/119 (56%), Gaps = 1/119 (1%)
 Frame = -2

Query  720  FDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRALCA  541
             D MR++ + V+   Y ++I ALC   E  KA+  L EMV +G SP   T+  ++   C+
Sbjct  469  LDEMRDKGVRVDLVTYNILISALCKDGESKKAVKLLNEMVEMGLSPSHVTYNTLMDGFCS  528

Query  540  DGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGLLVPR  364
            +G +  AL++ S M +  +    V  YN+LI+ L ++G+  +A ++    L++GL+  R
Sbjct  529  EGNLRAALNMRSRMEKEGK-RANVVTYNVLIRGLCQKGKLEEANDLLNEMLEKGLIPNR  586



>ref|XP_010530346.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like 
[Tarenaya hassleriana]
Length=636

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/116 (33%), Positives = 67/116 (58%), Gaps = 2/116 (2%)
 Frame = -2

Query  714  RMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRALCADG  535
            +M ER I V+ + Y ++I+ LC G  +D AL+   +M   G +P   T+  +I  LC   
Sbjct  251  KMEERNIEVDVKIYSMIIDGLCKGGHIDDALSLFEKMDSKGIAPNVVTYSCLINGLCVFD  310

Query  534  KVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGLLVP  367
            + + A+ +L+ M +R + +  V  +NILI    ++G+ L+A+ +Y   ++RG LVP
Sbjct  311  RWNDAVRLLNDMAKR-KIFPNVVTFNILIDAFVKEGKFLEAKELYEEMIRRG-LVP  364



>gb|ABG66168.1| Rf1 protein, mitochondrial precursor, putative, expressed [Oryza 
sativa Japonica Group]
Length=484

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 42/129 (33%), Positives = 63/129 (49%), Gaps = 9/129 (7%)
 Frame = -2

Query  750  EWVLRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFT  571
            E  L  AY  +  M +R I+     Y  +I ALC  + +DKA+  L  MV+ G  P   T
Sbjct  212  EGDLDKAYGTYHEMLDRGILPNVVTYSSIIAALCKAQAMDKAMEVLTSMVKNGVMPNCRT  271

Query  570  FCNVIRALCADGKVDGALSVLSLMHRRSRFWVGVPP----YNILIKELNRQGRALDARNV  403
            + +++   C+ G+   A+  L  MH       GV P    YN L+  L + GR  +AR +
Sbjct  272  YNSIVHGYCSSGQPKEAIGFLKKMHSD-----GVEPDVVTYNSLMDYLCKNGRCTEARKM  326

Query  402  YAAALKRGL  376
            + +  KRGL
Sbjct  327  FDSMTKRGL  335



>dbj|BAD08212.1| hypothetical protein [Oryza sativa Indica Group]
 dbj|BAD13710.1| PPR protein [Oryza sativa Indica Group]
 dbj|BAE00068.1| PPR protein [Oryza sativa Indica Group]
 gb|ABI74690.1| fertility restorer [Oryza sativa Indica Group]
Length=683

 Score = 68.9 bits (167),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 61/125 (49%), Gaps = 1/125 (1%)
 Frame = -2

Query  750  EWVLRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFT  571
            E  L   Y  ++ M +++I      Y  +I ALC  + VDKA+  L  MV+ G  P   T
Sbjct  101  EGDLDKTYSTYNEMLDQRISPNVVTYNSIIAALCKAQTVDKAMEVLTTMVKSGVMPDCMT  160

Query  570  FCNVIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAA  391
            + +++   C+ G+   A+  L  M R       V  YN L+  L + GR  +AR ++ + 
Sbjct  161  YNSIVHGFCSSGQPKEAIVFLKKM-RSDGVEPDVVTYNSLMDYLCKNGRCTEARKIFDSM  219

Query  390  LKRGL  376
             KRGL
Sbjct  220  TKRGL  224



>dbj|BAD08216.1| hypothetical protein [Oryza sativa Japonica Group]
Length=401

 Score = 68.2 bits (165),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 59/116 (51%), Gaps = 1/116 (1%)
 Frame = -2

Query  723  EFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRALC  544
            + D+M +++I      Y  +I ALC  + VDKA+  L  MV+ G  P   T+ +++   C
Sbjct  103  DLDKMLDQRISPNVVTYNSIIAALCKAQTVDKAMEVLTTMVKSGVMPDCMTYNSIVHGFC  162

Query  543  ADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGL  376
            + G+   A+  L  M R       V  YN L+  L + GR  +AR ++ +  KRGL
Sbjct  163  SSGQPKEAIVFLKKM-RSDGVEPDVVTYNSLMDYLCKNGRCTEARKIFDSMTKRGL  217



>gb|ABC42331.1| PPR protein [Oryza sativa Indica Group]
Length=506

 Score = 68.2 bits (165),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 38/123 (31%), Positives = 64/123 (52%), Gaps = 9/123 (7%)
 Frame = -2

Query  732  AYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  553
            AY  +  M +R+I+     Y  +I ALC G+ +DKA+     MV+ G +P  FT+ +++ 
Sbjct  217  AYATYREMLDRRILPNVVTYSSIIAALCKGQAMDKAMEVHDRMVKNGVTPNCFTYTSLVH  276

Query  552  ALCADGKVDGALSVLSLMHRRSRFWVGVPP----YNILIKELNRQGRALDARNVYAAALK  385
              C+ G++  A+  L  M        GV P    Y+  +  L + GR  +AR ++ + +K
Sbjct  277  GFCSSGQLTEAIKFLEKMCSN-----GVEPNVVTYSSFMDYLCKNGRCTEARKIFYSMVK  331

Query  384  RGL  376
            RGL
Sbjct  332  RGL  334



>dbj|BAD08213.1| hypothetical protein [Oryza sativa Indica Group]
Length=762

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/119 (32%), Positives = 61/119 (51%), Gaps = 1/119 (1%)
 Frame = -2

Query  732  AYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  553
            AY  +  M +R+I  +   Y  +I ALC G+ +DKA+  L  MV+ G  P   T+ +++ 
Sbjct  215  AYSTYHEMLDRRISPDVVTYSSIIAALCKGQAMDKAMEVLTTMVKNGVMPNCMTYNSILH  274

Query  552  ALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGL  376
              C+  +   A+  L  M R       V  YN L+  L + GR+ +AR ++ +  KRGL
Sbjct  275  GYCSSEQPKEAIGFLKKM-RSDGVEPDVVTYNSLMDYLCKNGRSTEARKIFDSMTKRGL  332



>gb|AAL58260.1|AC068923_2 putative membrane-associated protein [Oryza sativa Japonica Group]
Length=627

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 59/116 (51%), Gaps = 1/116 (1%)
 Frame = -2

Query  723  EFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRALC  544
            + D+M +++I      Y  +I ALC  + VDKA+  L  MV+ G  P   T+ +++   C
Sbjct  103  DLDKMLDQRISPNVVTYNSIIAALCKAQTVDKAMEVLTTMVKSGVMPDCMTYNSIVHGFC  162

Query  543  ADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGL  376
            + G+   A+  L  M R       V  YN L+  L + GR  +AR ++ +  KRGL
Sbjct  163  SSGQPKEAIVFLKKM-RSDGVEPDVVTYNSLMDYLCKNGRCTEARKIFDSMTKRGL  217



>gb|EAZ16561.1| hypothetical protein OsJ_32034 [Oryza sativa Japonica Group]
Length=526

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 59/116 (51%), Gaps = 1/116 (1%)
 Frame = -2

Query  723  EFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRALC  544
            + D+M +++I      Y  +I ALC  + VDKA+  L  MV+ G  P   T+ +++   C
Sbjct  103  DLDKMLDQRISPNVVTYNSIIAALCKAQTVDKAMEVLTTMVKSGVMPDCMTYNSIVHGFC  162

Query  543  ADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGL  376
            + G+   A+  L  M R       V  YN L+  L + GR  +AR ++ +  KRGL
Sbjct  163  SSGQPKEAIVFLKKM-RSDGVEPDVVTYNSLMDYLCKNGRCTEARKIFDSMTKRGL  217



>gb|AAL58263.1|AC068923_5 putative membrane-associated protein [Oryza sativa Japonica Group]
Length=1219

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 41/126 (33%), Positives = 62/126 (49%), Gaps = 9/126 (7%)
 Frame = -2

Query  741  LRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  562
            L  AY  +  M +R I+     Y  +I ALC  + +DKA+  L  MV+ G  P   T+ +
Sbjct  215  LDKAYGTYHEMLDRGILPNVVTYSSIIAALCKAQAMDKAMEVLTSMVKNGVMPNCRTYNS  274

Query  561  VIRALCADGKVDGALSVLSLMHRRSRFWVGVPP----YNILIKELNRQGRALDARNVYAA  394
            ++   C+ G+   A+  L  MH       GV P    YN L+  L + GR  +AR ++ +
Sbjct  275  IVHGYCSSGQPKEAIGFLKKMHSD-----GVEPDVVTYNSLMDYLCKNGRCTEARKMFDS  329

Query  393  ALKRGL  376
              KRGL
Sbjct  330  MTKRGL  335



>ref|XP_003623872.1| Pentatricopeptide repeat-containing protein [Medicago truncatula]
 gb|AES80090.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula]
Length=539

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 62/120 (52%), Gaps = 0/120 (0%)
 Frame = -2

Query  738  RDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNV  559
            RDA + F +M++ ++      Y  VI+ LC    VD+A     EMV  G     +++ ++
Sbjct  192  RDAIQMFPKMKKIRVYPNLIMYNTVIDGLCKQGLVDEACGLCTEMVENGIELDVYSYNSM  251

Query  558  IRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRG  379
            I   C+ G+   A+ +L  M  R + +  V  +NILI  L + GR  +A NV A  +KRG
Sbjct  252  IHGFCSVGRFQAAVKLLDEMVVRGKVYPDVYTFNILIDGLCKLGRVSEAYNVVAVMIKRG  311



>ref|XP_010530432.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like 
[Tarenaya hassleriana]
Length=511

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/138 (29%), Positives = 75/138 (54%), Gaps = 12/138 (9%)
 Frame = -2

Query  744  VLRDAYEEFDRMRERKIVVEHR----------AYELVIEALCNGKEVDKALASLVEMVRI  595
            ++ DA++ FD+  +R +  + +           + L+I A C G+  D+A+  L   + +
Sbjct  375  LVEDAHQLFDKTTKRALTAKRKLMAIDVDVLGMHSLMIRAFCVGRRFDEAVECLERAIEL  434

Query  594  GYSPGRFTFCNVIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALD  415
            G  P    F N+++ L  +G+++ A+++L +M+ + +       Y+ LIKELNR+G    
Sbjct  435  GIVPRTIAFNNLVQGLSGEGRIEEAINILLVMYGQGKI-PSTTSYDTLIKELNRRGMWAV  493

Query  414  ARNVYAAALKRGLLVPRK  361
            A  +Y AALKR +  PR+
Sbjct  494  ASALYGAALKRRVF-PRR  510


 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 31/111 (28%), Positives = 53/111 (48%), Gaps = 1/111 (1%)
 Frame = -2

Query  699  KIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRALCADGKVDGA  520
            ++V + R + L++   C   + DKA  ++ +M+ +GY P   TF  +I   C DGK+  A
Sbjct  139  ELVPDLRTFSLMVRCHCRRNKFDKAKQTMDDMLEMGYRPDIATFTVLIDCFCKDGKLQKA  198

Query  519  LSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGLLVP  367
              +   M R+ +    +  YN L+K L   GR  +A  +  A      + P
Sbjct  199  FEIFDSM-RKIQCEPTIRVYNCLLKGLCYVGRVEEAYEMIIAIKNNKSVTP  248



>dbj|BAD13711.1| PPR protein [Oryza sativa Indica Group]
Length=794

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 41/126 (33%), Positives = 62/126 (49%), Gaps = 9/126 (7%)
 Frame = -2

Query  741  LRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  562
            L  AY  +  M +R I+     Y  +I ALC  + +DKA+  L  MV+ G  P   T+ +
Sbjct  215  LDKAYGTYHEMLDRGILPNVVTYSSIIAALCKAQAMDKAMEVLTSMVKNGVMPNCRTYNS  274

Query  561  VIRALCADGKVDGALSVLSLMHRRSRFWVGVPP----YNILIKELNRQGRALDARNVYAA  394
            ++   C+ G+   A+  L  MH       GV P    YN L+  L + GR  +AR ++ +
Sbjct  275  IVHGYCSSGQPKEAIGFLKKMHSD-----GVEPDVVTYNSLMDYLCKNGRCTEARKMFDS  329

Query  393  ALKRGL  376
              KRGL
Sbjct  330  MTKRGL  335



>ref|NP_001064975.1| Os10g0499500 [Oryza sativa Japonica Group]
 gb|AAM93691.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|AAP54465.1| Rf1 protein, mitochondrial precursor, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF26889.1| Os10g0499500 [Oryza sativa Japonica Group]
 gb|EAZ16577.1| hypothetical protein OsJ_32049 [Oryza sativa Japonica Group]
 dbj|BAG89496.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG91413.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAJ07249.1| pentatricopeptide repeat-containing protein [Oryza sativa Japonica 
Group]
 dbj|BAJ07251.1| pentatricopeptide repeat-containing protein [Oryza sativa Japonica 
Group]
Length=506

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/123 (31%), Positives = 64/123 (52%), Gaps = 9/123 (7%)
 Frame = -2

Query  732  AYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  553
            AY  +  M +R+I+     Y  +I ALC G+ +DKA+     MV+ G +P  FT+ +++ 
Sbjct  217  AYATYREMLDRRILPNVVIYSSIIAALCKGQAMDKAMEVHDRMVKNGVTPNCFTYTSLVH  276

Query  552  ALCADGKVDGALSVLSLMHRRSRFWVGVPP----YNILIKELNRQGRALDARNVYAAALK  385
              C+ G++  A+  L  M        GV P    Y+  +  L + GR  +AR ++ + +K
Sbjct  277  GFCSSGQLTEAIKFLEKMCSN-----GVEPNVVTYSSFMDYLCKNGRCTEARKIFDSMVK  331

Query  384  RGL  376
            RGL
Sbjct  332  RGL  334



>ref|NP_001064958.1| Os10g0497300 [Oryza sativa Japonica Group]
 dbj|BAD08215.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAF26872.1| Os10g0497300 [Oryza sativa Japonica Group]
 dbj|BAG89195.1| unnamed protein product [Oryza sativa Japonica Group]
Length=794

 Score = 67.8 bits (164),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 41/126 (33%), Positives = 62/126 (49%), Gaps = 9/126 (7%)
 Frame = -2

Query  741  LRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  562
            L  AY  +  M +R I+     Y  +I ALC  + +DKA+  L  MV+ G  P   T+ +
Sbjct  215  LDKAYGTYHEMLDRGILPNVVTYSSIIAALCKAQAMDKAMEVLTSMVKNGVMPNCRTYNS  274

Query  561  VIRALCADGKVDGALSVLSLMHRRSRFWVGVPP----YNILIKELNRQGRALDARNVYAA  394
            ++   C+ G+   A+  L  MH       GV P    YN L+  L + GR  +AR ++ +
Sbjct  275  IVHGYCSSGQPKEAIGFLKKMHSD-----GVEPDVVTYNSLMDYLCKNGRCTEARKMFDS  329

Query  393  ALKRGL  376
              KRGL
Sbjct  330  MTKRGL  335



>dbj|BAD08211.1| hypothetical protein [Oryza sativa Indica Group]
 dbj|BAE00069.1| PPR protein [Oryza sativa Indica Group]
Length=794

 Score = 67.8 bits (164),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 41/126 (33%), Positives = 62/126 (49%), Gaps = 9/126 (7%)
 Frame = -2

Query  741  LRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  562
            L  AY  +  M +R I+     Y  +I ALC  + +DKA+  L  MV+ G  P   T+ +
Sbjct  215  LDKAYGTYHEMLDRGILPNVVTYNSIIAALCKAQAMDKAMEVLTSMVKNGVMPNCRTYNS  274

Query  561  VIRALCADGKVDGALSVLSLMHRRSRFWVGVPP----YNILIKELNRQGRALDARNVYAA  394
            ++   C+ G+   A+  L  MH       GV P    YN L+  L + GR  +AR ++ +
Sbjct  275  IVHGYCSSGQPKEAIGFLKKMHSD-----GVEPDVVTYNSLMDYLCKNGRCTEARKMFDS  329

Query  393  ALKRGL  376
              KRGL
Sbjct  330  MTKRGL  335



>ref|XP_009604022.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52640, 
mitochondrial [Nicotiana tomentosiformis]
Length=547

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 62/120 (52%), Gaps = 1/120 (1%)
 Frame = -2

Query  735  DAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVI  556
            +A + FD M ER   V+  AY  ++E+ C  +++D A    V+M  +G  P  FT+   I
Sbjct  258  EAQKLFDEMLERGFAVDLLAYNSILESQCKAEKMDDAYNLFVKMRSMGLKPDAFTYAVFI  317

Query  555  RALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGL  376
            RA C    +  A  VL  M +R +    V  YN++IK+L +  +  DA  +    ++RG+
Sbjct  318  RAYCVKDDIHSAFRVLDRM-KRYKLVPNVFTYNVIIKKLCKSDKVEDAYQLIDEMIERGV  376



>gb|EEE51212.1| hypothetical protein OsJ_32033 [Oryza sativa Japonica Group]
Length=1144

 Score = 67.8 bits (164),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 41/126 (33%), Positives = 62/126 (49%), Gaps = 9/126 (7%)
 Frame = -2

Query  741  LRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  562
            L  AY  +  M +R I+     Y  +I ALC  + +DKA+  L  MV+ G  P   T+ +
Sbjct  215  LDKAYGTYHEMLDRGILPNVVTYSSIIAALCKAQAMDKAMEVLTSMVKNGVMPNCRTYNS  274

Query  561  VIRALCADGKVDGALSVLSLMHRRSRFWVGVPP----YNILIKELNRQGRALDARNVYAA  394
            ++   C+ G+   A+  L  MH       GV P    YN L+  L + GR  +AR ++ +
Sbjct  275  IVHGYCSSGQPKEAIGFLKKMHSD-----GVEPDVVTYNSLMDYLCKNGRCTEARKMFDS  329

Query  393  ALKRGL  376
              KRGL
Sbjct  330  MTKRGL  335



>gb|AIC74549.1| truncated PPR protein PPR9-409-Z [Oryza sativa Indica Group]
Length=409

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/119 (32%), Positives = 60/119 (50%), Gaps = 1/119 (1%)
 Frame = -2

Query  732  AYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  553
            AY  +  M +R I+     Y  +I ALC  + +DKA+  L  MV+ G  P   T+ +++ 
Sbjct  220  AYSTYHEMLDRGILPNVVTYSSIIAALCKAQAMDKAMEVLTTMVKNGVMPDCRTYTSIMH  279

Query  552  ALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGL  376
              C+ G+   A+  L  M R       V  YN L+  L + GR+ +AR ++ +  KRGL
Sbjct  280  GYCSSGQPKEAIGFLKKM-RSDGVEPDVVTYNSLMDYLCKNGRSTEARKIFDSMTKRGL  337



>dbj|BAD20284.1| hypothetical protein [Oryza sativa Indica Group]
Length=791

 Score = 67.0 bits (162),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 41/123 (33%), Positives = 64/123 (52%), Gaps = 9/123 (7%)
 Frame = -2

Query  732  AYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  553
            AY  +  M +R+I  +   Y  +I ALC G+ +DKA+  L  MV+ G  P   T+ +++ 
Sbjct  215  AYSTYHEMLDRRISPDVVTYSSIIAALCKGQAMDKAMEVLTTMVKNGVMPNCMTYNSILH  274

Query  552  ALCADGKVDGALSVLSLMHRRSRFWVGVPP----YNILIKELNRQGRALDARNVYAAALK  385
              C+  +   A+  L  M  RS    GV P    YN L+  L + GR+ +AR ++ +  K
Sbjct  275  GYCSSEQPKEAIGFLKKM--RSD---GVEPDVVTYNSLMDYLCKNGRSTEARKIFDSMTK  329

Query  384  RGL  376
            RGL
Sbjct  330  RGL  332



>ref|XP_006346446.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006346447.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710-like 
isoform X2 [Solanum tuberosum]
Length=767

 Score = 65.9 bits (159),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 33/101 (33%), Positives = 57/101 (56%), Gaps = 1/101 (1%)
 Frame = -2

Query  711  MRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRALCADGK  532
            M E+ ++ +   Y  +I+ LC  + + +A     EM+R+G  P +FT+  +I A CA+G 
Sbjct  488  MVEKGVLPDVITYSSLIQGLCEQQRLTEACELFQEMLRVGLQPDKFTYTTLIGAYCANGD  547

Query  531  VDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDAR  409
            + GA  + + M  +  F+  V  YN+LI  LN+Q R  +A+
Sbjct  548  IKGAFHLHNKMIYKG-FFPDVVTYNVLINGLNKQARTREAK  587



>ref|XP_003623229.1| Pentatricopeptide repeat-containing protein [Medicago truncatula]
Length=770

 Score = 65.5 bits (158),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 39/121 (32%), Positives = 61/121 (50%), Gaps = 1/121 (1%)
 Frame = -2

Query  735  DAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVI  556
            DA +  D M +R     +  Y  +I  LC    VD AL  L  M + G  P   T+  ++
Sbjct  322  DAIKVLDLMVKRGEEPNNVTYNAIINGLCKEGRVDDALGILETMAKKGKKPDVVTYSTLV  381

Query  555  RALCADGKVDGALSVLS-LMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRG  379
            + LC  GK+D A+ +L+ LM +       V  +N++I+EL +Q R   A+ VY   ++RG
Sbjct  382  KGLCGVGKIDEAVDLLNLLMSKEFHIKPDVFAFNLVIQELCKQRRLRHAKRVYYTMVERG  441

Query  378  L  376
             
Sbjct  442  F  442



>gb|EEE68328.1| hypothetical protein OsJ_26607 [Oryza sativa Japonica Group]
Length=461

 Score = 65.1 bits (157),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 38/123 (31%), Positives = 62/123 (50%), Gaps = 9/123 (7%)
 Frame = -2

Query  732  AYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  553
            AY  +  M ER I+ +   Y  ++ ALC  + +DKA+  L  MV+ G  P   T+ +++ 
Sbjct  225  AYSTYHEMLERGILPDVVTYNTIVAALCKAQAMDKAMDVLNRMVKNGVMPDCITYNSIVH  284

Query  552  ALCADGKVDGALSVLSLMHRRSRFWVGVPP----YNILIKELNRQGRALDARNVYAAALK  385
              C+ G+   A+ +L  M        GV P    Y  L+  L + GR ++AR +  + +K
Sbjct  285  GYCSSGQSKEAIGILEKMCSD-----GVEPDAVTYTSLMDYLCKNGRCIEARKILDSMIK  339

Query  384  RGL  376
            RGL
Sbjct  340  RGL  342



>ref|NP_001061364.1| Os08g0248400 [Oryza sativa Japonica Group]
 dbj|BAF23278.1| Os08g0248400, partial [Oryza sativa Japonica Group]
Length=440

 Score = 65.1 bits (157),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 38/123 (31%), Positives = 62/123 (50%), Gaps = 9/123 (7%)
 Frame = -2

Query  732  AYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  553
            AY  +  M ER I+ +   Y  ++ ALC  + +DKA+  L  MV+ G  P   T+ +++ 
Sbjct  225  AYSTYHEMLERGILPDVVTYNTIVAALCKAQAMDKAMDVLNRMVKNGVMPDCITYNSIVH  284

Query  552  ALCADGKVDGALSVLSLMHRRSRFWVGVPP----YNILIKELNRQGRALDARNVYAAALK  385
              C+ G+   A+ +L  M        GV P    Y  L+  L + GR ++AR +  + +K
Sbjct  285  GYCSSGQSKEAIGILEKMCSD-----GVEPDAVTYTSLMDYLCKNGRCIEARKILDSMIK  339

Query  384  RGL  376
            RGL
Sbjct  340  RGL  342



>ref|XP_002512435.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF49887.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=546

 Score = 65.1 bits (157),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 61/116 (53%), Gaps = 1/116 (1%)
 Frame = -2

Query  711  MRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRALCADGK  532
            M  + +  +   Y ++I++LCN  E+ KAL  L EM R G  P + T+  +I   C +G 
Sbjct  402  MDTKHLKADLITYNILIDSLCNKGEMKKALRLLDEMCRKGLKPSQLTYNTMIDGYCKEGN  461

Query  531  VDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGLLVPR  364
            +  AL++ S M +  R    V  YN+LIK   ++ +  DA  +    L++GL+  R
Sbjct  462  LRAALNLRSQMEKVGRL-ANVATYNVLIKGFCKKDKLEDANGLLNEMLEKGLIPNR  516



>gb|AIC74550.1| PPR protein PPR9-782-I [Oryza sativa Indica Group]
 dbj|BAQ15369.1| pentatricopeptide repeat-containing protein [Oryza sativa Indica 
Group]
Length=782

 Score = 65.5 bits (158),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 40/123 (33%), Positives = 63/123 (51%), Gaps = 9/123 (7%)
 Frame = -2

Query  732  AYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  553
            AY  +  M +R I+ +   Y  +I ALC  + +DKA+  L  MV+ G  P   T+ +++ 
Sbjct  220  AYSTYHEMLDRGILPDVVTYSSIIAALCKAQAMDKAMEVLTTMVKNGVMPDCMTYTSIMH  279

Query  552  ALCADGKVDGALSVLSLMHRRSRFWVGVPP----YNILIKELNRQGRALDARNVYAAALK  385
              C+ G+   A+  L  M  RS    GV P    Y  L+  L + GR+ +AR ++ +  K
Sbjct  280  GYCSSGQPKEAIGFLKKM--RSD---GVKPNVFTYRSLMNYLCKNGRSTEARKIFDSMTK  334

Query  384  RGL  376
            RGL
Sbjct  335  RGL  337



>gb|AIC74551.1| PPR protein PPR9-782-M [Oryza sativa Indica Group]
Length=782

 Score = 65.5 bits (158),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 40/123 (33%), Positives = 63/123 (51%), Gaps = 9/123 (7%)
 Frame = -2

Query  732  AYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  553
            AY  +  M +R I+ +   Y  +I ALC  + +DKA+  L  MV+ G  P   T+ +++ 
Sbjct  220  AYSTYHEMLDRGILPDVVTYSSIIAALCKAQAMDKAMEVLTTMVKNGVMPDCMTYTSIMH  279

Query  552  ALCADGKVDGALSVLSLMHRRSRFWVGVPP----YNILIKELNRQGRALDARNVYAAALK  385
              C+ G+   A+  L  M  RS    GV P    Y  L+  L + GR+ +AR ++ +  K
Sbjct  280  GYCSSGQPKEAIGFLKKM--RSD---GVEPNVFTYRSLMNYLCKNGRSTEARKIFDSMTK  334

Query  384  RGL  376
            RGL
Sbjct  335  RGL  337



>gb|ABC42330.1| PPR protein [Oryza sativa Indica Group]
Length=791

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 40/123 (33%), Positives = 65/123 (53%), Gaps = 9/123 (7%)
 Frame = -2

Query  732  AYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  553
            AY  +  M +R I+ +   Y  +I ALC  + +DKA+  L  MV+ G  P   T+ +++ 
Sbjct  215  AYSTYHEMLDRGILPDVVTYNSIIAALCKAQAMDKAMEVLNTMVKNGVMPDCMTYNSILH  274

Query  552  ALCADGKVDGALSVLSLMHRRSRFWVGVPP----YNILIKELNRQGRALDARNVYAAALK  385
              C+ G+   A+  L  M  RS    GV P    Y++L+  L + GR ++AR ++ +  K
Sbjct  275  GYCSSGQPKEAIGFLKKM--RSD---GVEPDVVTYSLLMDYLCKNGRCMEARKIFDSMTK  329

Query  384  RGL  376
            RGL
Sbjct  330  RGL  332



>sp|Q76C99.1|RF1_ORYSI RecName: Full=Protein Rf1, mitochondrial; AltName: Full=Fertility 
restorer; AltName: Full=Protein PPR; AltName: Full=Restorer 
for CMS; Flags: Precursor [Oryza sativa Indica Group]
 dbj|BAC77665.2| PPR protein [Oryza sativa Indica Group]
 dbj|BAC77666.2| Rf1 [Oryza sativa Indica Group]
 dbj|BAD08214.1| fertility restorer [Oryza sativa Indica Group]
 dbj|BAD13708.1| PPR protein [Oryza sativa Indica Group]
 dbj|BAD20283.1| restorer for CMS [Oryza sativa Indica Group]
Length=791

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 40/123 (33%), Positives = 65/123 (53%), Gaps = 9/123 (7%)
 Frame = -2

Query  732  AYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  553
            AY  +  M +R I+ +   Y  +I ALC  + +DKA+  L  MV+ G  P   T+ +++ 
Sbjct  215  AYSTYHEMLDRGILPDVVTYNSIIAALCKAQAMDKAMEVLNTMVKNGVMPDCMTYNSILH  274

Query  552  ALCADGKVDGALSVLSLMHRRSRFWVGVPP----YNILIKELNRQGRALDARNVYAAALK  385
              C+ G+   A+  L  M  RS    GV P    Y++L+  L + GR ++AR ++ +  K
Sbjct  275  GYCSSGQPKEAIGFLKKM--RSD---GVEPDVVTYSLLMDYLCKNGRCMEARKIFDSMTK  329

Query  384  RGL  376
            RGL
Sbjct  330  RGL  332



>gb|KGN60996.1| hypothetical protein Csa_2G034490 [Cucumis sativus]
Length=153

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 59/119 (50%), Gaps = 1/119 (1%)
 Frame = -2

Query  720  FDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRALCA  541
             + M+ R +  +   Y ++I A C  KE  KA   + EM+  G  P   T+  ++   C 
Sbjct  8    LNEMQCRGVKADTVTYNILISAWCEKKEPKKAARLIDEMLDKGLKPSHLTYNILLNGYCM  67

Query  540  DGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGLLVPR  364
            +G +  AL++   M +  R W  V  YN+LI+   R+G+  DA  +    L++GL+  R
Sbjct  68   EGNLRAALNLRKQMEKEGR-WANVVTYNVLIQGYCRKGKLEDANGLLNEMLEKGLIPNR  125



>ref|XP_010458712.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12300, 
mitochondrial-like [Camelina sativa]
Length=633

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/119 (32%), Positives = 59/119 (50%), Gaps = 1/119 (1%)
 Frame = -2

Query  732  AYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  553
            A E   +M ERKI +    Y ++I+ LC  + +D AL    EM   G+     T+  +IR
Sbjct  243  AMELLRKMEERKIKLNVVHYSIIIDGLCKDENLDDALNLFNEMEVKGFKADVITYTTLIR  302

Query  552  ALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGL  376
              C DG+ D    +L  M  R R    V  +N LI    ++G+ L+A  +Y   ++RG+
Sbjct  303  GFCNDGRWDDGAQLLRDMITR-RIAPNVVTFNSLIDSFVKEGKLLEAEELYKEMIRRGI  360



>ref|XP_010458689.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12300, 
mitochondrial-like [Camelina sativa]
Length=575

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/119 (32%), Positives = 59/119 (50%), Gaps = 1/119 (1%)
 Frame = -2

Query  732  AYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  553
            A E   +M ERKI +    Y ++I+ LC  + +D AL    EM   G+     T+  +IR
Sbjct  233  AMELLRKMEERKIKLNVVHYSIIIDGLCKDENLDDALNLFNEMEVKGFKADVITYTTLIR  292

Query  552  ALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGL  376
              C DG+ D    +L  M  R R    V  +N LI    ++G+ L+A  +Y   ++RG+
Sbjct  293  GFCNDGRWDDGAQLLRDMITR-RIAPNVVTFNSLIDSFVKEGKLLEAEELYKEMIRRGI  350


 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 29/120 (24%), Positives = 58/120 (48%), Gaps = 1/120 (1%)
 Frame = -2

Query  735  DAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVI  556
            D +E F +M  R +V     Y  +I+  C   +V+ A      MV     P   T+  ++
Sbjct  407  DGFELFRKMSLRGVVANTVTYSTLIQGFCQSGKVEVAKELFQAMVSRRVPPNIVTYSILL  466

Query  555  RALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGL  376
              LC +G+++ A+ +   M + S+  + +  YNI+I  +    +  DA +++++   RG+
Sbjct  467  DGLCDNGELEKAMEIFEKMQK-SKMELDIGIYNIIIHGMCNDSKVDDAWDLFSSLPLRGV  525



>gb|KHN04861.1| Pentatricopeptide repeat-containing protein, mitochondrial [Glycine 
soja]
Length=566

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/123 (31%), Positives = 59/123 (48%), Gaps = 1/123 (1%)
 Frame = -2

Query  741  LRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  562
            + +AY  F  M+ER + ++  +Y  +I   CN +E+ KA A   EM R G SP   T+  
Sbjct  426  MHEAYGIFKEMKERGLCLDQISYTTLIVGFCNNREMKKAWALFEEMSREGCSPNVITYTC  485

Query  561  VIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKR  382
            +I   C   ++D A  V   M+R S     V  Y +LI   ++ G    A  +Y     +
Sbjct  486  IIDGFCKSNRIDLATWVFDKMNRDSVI-PDVVTYTVLIDWYHKHGYFDQAHKLYDVMKDK  544

Query  381  GLL  373
            G+L
Sbjct  545  GVL  547



>gb|AES60450.2| pentatricopeptide (PPR) repeat protein [Medicago truncatula]
Length=497

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 64/122 (52%), Gaps = 1/122 (1%)
 Frame = -2

Query  744  VLRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFC  565
            +L +A + F+ MR   ++ +  AY  +I+ LC    ++ AL  + EM   G  P   T+ 
Sbjct  305  MLDEAMDLFEGMRNENVIPDVVAYSSLIDGLCKSGRINSALKYVDEMHDRGQPPNVITYT  364

Query  564  NVIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALK  385
            ++I ALC   +VD A+++L  +  +      +  YNIL+  L + GR  DA+ V+   L 
Sbjct  365  SLIDALCKSHQVDKAIALLKKIKDQG-IQANMYTYNILVDGLCKDGRLTDAQKVFQDLLM  423

Query  384  RG  379
            +G
Sbjct  424  KG  425



>ref|XP_006572968.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12300, 
mitochondrial-like isoform X1 [Glycine max]
 ref|XP_006572969.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12300, 
mitochondrial-like isoform X2 [Glycine max]
 ref|XP_006572970.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12300, 
mitochondrial-like isoform X3 [Glycine max]
 ref|XP_006572971.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12300, 
mitochondrial-like isoform X4 [Glycine max]
Length=734

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/123 (31%), Positives = 59/123 (48%), Gaps = 1/123 (1%)
 Frame = -2

Query  741  LRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  562
            + +AY  F  M+ER + ++  +Y  +I   CN +E+ KA A   EM R G SP   T+  
Sbjct  594  MHEAYGIFKEMKERGLCLDQISYTTLIVGFCNNREMKKAWALFEEMSREGCSPNVITYTC  653

Query  561  VIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKR  382
            +I   C   ++D A  V   M+R S     V  Y +LI   ++ G    A  +Y     +
Sbjct  654  IIDGFCKSNRIDLATWVFDKMNRDSVI-PDVVTYTVLIDWYHKHGYFDQAHKLYDVMKDK  712

Query  381  GLL  373
            G+L
Sbjct  713  GVL  715



>ref|XP_007139919.1| hypothetical protein PHAVU_008G069700g [Phaseolus vulgaris]
 gb|ESW11913.1| hypothetical protein PHAVU_008G069700g [Phaseolus vulgaris]
Length=524

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/123 (32%), Positives = 60/123 (49%), Gaps = 2/123 (2%)
 Frame = -2

Query  738  RDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNV  559
            + A E   +M    I      Y +V++ LC    V +A     EMV  G+    FT+ ++
Sbjct  176  KGAIELLRKMDSVGIRPNLIMYNMVVDGLCKEGHVTEACGLCSEMVGKGFCIDVFTYNSL  235

Query  558  IRALCADGKVDGALSVLS--LMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALK  385
            I  LC  G+  GA+ +L+  +M      W  V  +NIL+  L + G   +ARNV+   +K
Sbjct  236  IHGLCGAGQFQGAVRLLNEMVMQENKDIWPDVYTFNILVDGLCKLGMVAEARNVFGVMIK  295

Query  384  RGL  376
            RGL
Sbjct  296  RGL  298



>ref|XP_006651349.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like 
[Oryza brachyantha]
Length=507

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 51/143 (36%), Positives = 74/143 (52%), Gaps = 3/143 (2%)
 Frame = -2

Query  732  AYEEFDRMRERKIVVEHRAYELVIEALCNGKEVD-KALASLVEMVRIGYSPGRF-TFCNV  559
            A++ + RM       + RA + +   LC     D  ALA   E+     + GR   +  V
Sbjct  360  AWQTYKRMERAGFEADGRALDTLARGLCRRCAADISALADAREVFATLVASGRKRAYTGV  419

Query  558  IRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRG  379
            +RALC  G+   AL VL+L+  R  F  G   ++ L+ EL RQGR  DA  VYAAA+KRG
Sbjct  420  VRALCERGRSRDALRVLALVIARD-FVPGRNAFDALLGELARQGRWPDAMAVYAAAVKRG  478

Query  378  LLVPRKKPIQFSAKAQAPHIANG  310
            +LV  K+  + +  AQ    ++G
Sbjct  479  VLVSLKRHSKEALLAQETRESSG  501



>ref|XP_011468486.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52640, 
mitochondrial, partial [Fragaria vesca subsp. vesca]
Length=506

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 65/138 (47%), Gaps = 7/138 (5%)
 Frame = -2

Query  720  FDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRALCA  541
            FD M E+  +V+  AY   +EALC G  VD+A     EM   G  P   T+   IRA C 
Sbjct  242  FDEMTEKGCLVDVPAYNSYLEALCKGGNVDEAYKIFREMGSKGVEPDAGTYSIFIRAYCE  301

Query  540  DGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGLLVPRK  361
               +    SVL  M +R      V  YN +IK+L +  R  +A  +    ++ G+     
Sbjct  302  ANDIHSVFSVLDRM-KRYNLLANVFTYNCVIKKLCKNERVEEAYQLLDEMIEMGV-----  355

Query  360  KPIQFSAKA-QAPHIANG  310
            KP ++S  A QA H  +G
Sbjct  356  KPDEWSYNAIQAYHCEHG  373


 Score = 56.6 bits (135),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 65/126 (52%), Gaps = 9/126 (7%)
 Frame = -2

Query  741  LRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  562
            +   +   DRM+   ++     Y  VI+ LC  + V++A   L EM+ +G  P  +++ N
Sbjct  305  IHSVFSVLDRMKRYNLLANVFTYNCVIKKLCKNERVEEAYQLLDEMIEMGVKPDEWSY-N  363

Query  561  VIRAL-CADGKVDGALSVLSLMHRRSRFWVGVP---PYNILIKELNRQGRALDARNVYAA  394
             I+A  C  G+V+ AL +LS M + S     +P    YN+++K L R GR   A +V+  
Sbjct  364  AIQAYHCEHGEVNQALRLLSRMEKDS----CMPDHHTYNMVLKLLIRIGRFDRATDVWER  419

Query  393  ALKRGL  376
              KRG 
Sbjct  420  MGKRGF  425



>ref|XP_011009113.1| PREDICTED: pentatricopeptide repeat-containing protein At4g28010-like 
[Populus euphratica]
Length=720

 Score = 64.7 bits (156),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/119 (32%), Positives = 63/119 (53%), Gaps = 1/119 (1%)
 Frame = -2

Query  732  AYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  553
            A + F+RM+   I+ +  +Y  +I  LC  K ++KA+  LVEM      P  FT+C ++ 
Sbjct  155  ALDLFNRMKRINILPDTVSYNTIINGLCKEKRLEKAVDLLVEMEGSNCEPNSFTYCILMD  214

Query  552  ALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGL  376
             LC +G+V+ A+ +L  M +R    V V  Y+ LI     QG     + ++   L+RG+
Sbjct  215  GLCKEGRVEEAMRLLGEM-KRKELEVDVVVYSTLISGFCSQGCLDRGKALFDEMLERGI  272


 Score = 53.5 bits (127),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 54/122 (44%), Gaps = 6/122 (5%)
 Frame = -2

Query  720  FDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRALCA  541
            FD M ER I      Y  +I   C      +A A L  M   G  P  +T+  +I  LC 
Sbjct  264  FDEMLERGISPNVVVYSCLINGFCKKGLWREATAVLHAMTERGIQPDVYTYTCMIGGLCK  323

Query  540  DGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGLLVPRK  361
            DG+   AL +  LM  +      V  YN+LI  L ++G   DA  ++   L++     RK
Sbjct  324  DGRARKALDLFDLMTEKGEEPSTV-TYNVLINGLCKEGCIGDAFKIFETMLEK-----RK  377

Query  360  KP  355
            +P
Sbjct  378  RP  379



>gb|AIC74547.1| PPR protein PPR7-458-ZH [Oryza sativa Japonica Group]
Length=458

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 58/119 (49%), Gaps = 1/119 (1%)
 Frame = -2

Query  732  AYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  553
            AY  +  M +R+I      Y  +I ALC  + +DKA+  L  MV+ G  P   T+ +++ 
Sbjct  223  AYSTYHEMLDRRISPNVVTYSSIIAALCKAQAMDKAMEVLNTMVKNGVMPDCMTYNSILH  282

Query  552  ALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGL  376
              C+ G+   A+  L  M R       V  Y  L+  L + GR  +AR ++ +  KRGL
Sbjct  283  GYCSSGQPKEAIGTLKKM-RSDGVEPNVVTYRSLMNYLCKNGRCTEARKIFDSMTKRGL  340



>ref|NP_001176222.1| Os10g0495400 [Oryza sativa Japonica Group]
 dbj|BAH94950.1| Os10g0495400, partial [Oryza sativa Japonica Group]
Length=438

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 58/119 (49%), Gaps = 1/119 (1%)
 Frame = -2

Query  732  AYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  553
            AY  +  M +R+I      Y  +I ALC  + +DKA+  L  MV+ G  P   T+ +++ 
Sbjct  223  AYSTYHEMLDRRISPNVVTYSSIIAALCKAQAMDKAMEVLNTMVKNGVMPDCMTYNSILH  282

Query  552  ALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGL  376
              C+ G+   A+  L  M R       V  Y  L+  L + GR  +AR ++ +  KRGL
Sbjct  283  GYCSSGQPKEAIGTLKKM-RSDGVEPNVVTYRSLMNYLCKNGRCTEARKIFDSMTKRGL  340



>gb|AAM92824.1| putative chloroplast RNA processing protein [Oryza sativa Japonica 
Group]
Length=878

 Score = 64.7 bits (156),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 37/119 (31%), Positives = 61/119 (51%), Gaps = 1/119 (1%)
 Frame = -2

Query  732  AYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  553
            AY  +  M +R I+ +   Y  +I ALC  + +DKA+  L  MV+ G  P   T+ +++ 
Sbjct  220  AYSTYHEMLDRGILPDVVTYSSIIAALCKAQAMDKAMEVLNTMVKNGVMPDCMTYNSILH  279

Query  552  ALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGL  376
              C+ G+   A+  L  M R       V  Y+ L+  L + GR+ +AR ++ +  KRGL
Sbjct  280  GYCSSGQPKEAIGTLKKM-RSDGVEPNVVTYSSLMNYLCKNGRSTEARKIFDSMTKRGL  337



>ref|XP_010530459.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62590-like 
[Tarenaya hassleriana]
Length=371

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/114 (32%), Positives = 62/114 (54%), Gaps = 1/114 (1%)
 Frame = -2

Query  714  RMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRALCADG  535
            +M ER I V    Y  +I+ LC G ++D AL    +M   G +P   T+  +I  LC   
Sbjct  251  KMEERNIEVNVIMYNTIIDGLCKGGQIDDALNLFEKMDSKGIAPNVVTYSCLINGLCVFD  310

Query  534  KVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGLL  373
            + + A+ +L+ M +R + +  V  +NILI    ++G+ L+A+ +Y   ++RGL 
Sbjct  311  RWNDAVRLLNDMAKR-KIFPNVVTFNILIDVFVKEGKFLEAKELYEDMIRRGLF  363


 Score = 50.1 bits (118),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 29/101 (29%), Positives = 52/101 (51%), Gaps = 1/101 (1%)
 Frame = -2

Query  678  AYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRALCADGKVDGALSVLSLM  499
             Y  ++  LC    V +A++ + +M+++GY P   T+  V+  +C  G    AL++L  M
Sbjct  193  TYTTLVNGLCREGRVSEAVSLVDKMLKLGYQPNVVTYGAVVNGICKSGDCALALNLLMKM  252

Query  498  HRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGL  376
              R+   V V  YN +I  L + G+  DA N++     +G+
Sbjct  253  EERN-IEVNVIMYNTIIDGLCKGGQIDDALNLFEKMDSKGI  292



>ref|NP_001064949.1| Os10g0495200 [Oryza sativa Japonica Group]
 gb|ABB47822.1| Rf1 protein, mitochondrial precursor, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF26863.1| Os10g0495200 [Oryza sativa Japonica Group]
 gb|AIC74552.1| PPR protein PPR9-782-ZH [Oryza sativa Japonica Group]
Length=782

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 37/119 (31%), Positives = 61/119 (51%), Gaps = 1/119 (1%)
 Frame = -2

Query  732  AYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  553
            AY  +  M +R I+ +   Y  +I ALC  + +DKA+  L  MV+ G  P   T+ +++ 
Sbjct  220  AYSTYHEMLDRGILPDVVTYSSIIAALCKAQAMDKAMEVLNTMVKNGVMPDCMTYNSILH  279

Query  552  ALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGL  376
              C+ G+   A+  L  M R       V  Y+ L+  L + GR+ +AR ++ +  KRGL
Sbjct  280  GYCSSGQPKEAIGTLKKM-RSDGVEPNVVTYSSLMNYLCKNGRSTEARKIFDSMTKRGL  337



>ref|XP_010315244.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Solanum lycopersicum]
 ref|XP_010315245.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Solanum lycopersicum]
 ref|XP_010315246.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Solanum lycopersicum]
 ref|XP_010315247.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Solanum lycopersicum]
 ref|XP_010315248.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Solanum lycopersicum]
 ref|XP_010315249.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Solanum lycopersicum]
 ref|XP_010315250.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Solanum lycopersicum]
 ref|XP_010315251.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Solanum lycopersicum]
 ref|XP_010315252.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Solanum lycopersicum]
 ref|XP_010315253.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Solanum lycopersicum]
 ref|XP_010315254.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Solanum lycopersicum]
 ref|XP_010315255.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Solanum lycopersicum]
 ref|XP_010315256.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Solanum lycopersicum]
 ref|XP_010315257.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Solanum lycopersicum]
 ref|XP_010315258.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Solanum lycopersicum]
 ref|XP_010315259.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Solanum lycopersicum]
 ref|XP_010315260.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Solanum lycopersicum]
 ref|XP_010315261.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Solanum lycopersicum]
 ref|XP_010315262.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Solanum lycopersicum]
 ref|XP_010315263.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Solanum lycopersicum]
 ref|XP_010315264.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Solanum lycopersicum]
 ref|XP_010315265.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Solanum lycopersicum]
Length=767

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 56/103 (54%), Gaps = 1/103 (1%)
 Frame = -2

Query  717  DRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRALCAD  538
             +M E+ ++ +   Y  +I+ LC  + + +A     EM R+G  P +FT+  +I A CA+
Sbjct  486  QQMVEKGVLPDVITYSSLIQGLCEQRRLTEAFELFQEMFRVGLQPDKFTYTTLIGAYCAN  545

Query  537  GKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDAR  409
            G + GA  + + M  +  F   V  YN+LI  LN+Q R  +A+
Sbjct  546  GDIKGAFHLHNKMIYKGCFP-DVVTYNVLINGLNKQARTREAK  587


 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 55/120 (46%), Gaps = 1/120 (1%)
 Frame = -2

Query  732  AYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  553
            A + +D M +  +      Y ++I  LC   E+ K+L    EM + G      T+  +I 
Sbjct  201  AQKFYDDMVQSGVSPNVYTYNIMIRGLCAKGELQKSLVVFNEMEKNGCLRNVVTYNTIIG  260

Query  552  ALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGLL  373
              C  GKVD A+ +L LM  RS     V  YN +I  L R+GR  +   +      +GL+
Sbjct  261  GYCKIGKVDEAVKLLKLMQVRS-LEPSVVTYNAIINGLCREGRMKETSEILEEMRGKGLM  319



>gb|KJB45449.1| hypothetical protein B456_007G306300 [Gossypium raimondii]
Length=589

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 63/119 (53%), Gaps = 1/119 (1%)
 Frame = -2

Query  720  FDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRALCA  541
             + M  + + V    Y ++++ALCN  E  KA   L EMV++G  P + T+  ++   C 
Sbjct  443  INEMLNKGLKVNVVTYNILVDALCNDGESRKAARLLDEMVKMGLRPNQITYNTLMDGYCR  502

Query  540  DGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGLLVPR  364
            +G +  AL+V + M +       V  YN+LIK L ++G+  DA  +    L++GL+  R
Sbjct  503  EGNLRAALNVRTRMEKEG-MLANVVTYNVLIKGLCKKGKLEDANGLLNEMLEKGLIPNR  560



>gb|AES79447.2| TCP-1/cpn60 chaperonin family protein [Medicago truncatula]
Length=713

 Score = 63.9 bits (154),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 61/121 (50%), Gaps = 1/121 (1%)
 Frame = -2

Query  735  DAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVI  556
            DA +  D M +R     +  Y  +I  LC    VD AL  L  M + G  P   T+  ++
Sbjct  322  DAIKVLDLMVKRGEEPNNVTYNAIINGLCKEGRVDDALGILETMAKKGKKPDVVTYSTLV  381

Query  555  RALCADGKVDGALSVLS-LMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRG  379
            + LC  GK+D A+ +L+ LM +       V  +N++I+EL +Q R   A+ VY   ++RG
Sbjct  382  KGLCGVGKIDEAVDLLNLLMSKEFHIKPDVFAFNLVIQELCKQRRLRHAKRVYYTMVERG  441

Query  378  L  376
             
Sbjct  442  F  442



>emb|CDP12725.1| unnamed protein product [Coffea canephora]
Length=767

 Score = 63.9 bits (154),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 37/128 (29%), Positives = 64/128 (50%), Gaps = 1/128 (1%)
 Frame = -2

Query  756  MNEWVLRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGR  577
            + +  L +A   FD M+      +   Y +++  LC G + D A     +M+R   SP +
Sbjct  311  LQQHSLNNALRLFDIMKGNGCQPDEWTYAILVSGLCKGGKFDLASTLFEDMIRKHLSPNQ  370

Query  576  FTFCNVIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYA  397
              +  +I  LC DGKVD AL++L  M + S     +  YN ++  L++ G   +A+ ++ 
Sbjct  371  VNYTTLIDGLCKDGKVDAALALLKRM-QGSGCNPAIETYNAVLNGLSKSGMLSEAKKLHD  429

Query  396  AALKRGLL  373
              L+ GLL
Sbjct  430  KLLESGLL  437


 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 59/129 (46%), Gaps = 10/129 (8%)
 Frame = -2

Query  741  LRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  562
            L  AYE FDRM +  I      Y  +I  LC+   VD+ L  L EM+  G  P  +T+  
Sbjct  106  LDKAYEVFDRMLKDGIDPNSVTYSTLINGLCDEGRVDEVLDMLDEMIEKGVEPTVYTYTV  165

Query  561  VIRALCADGKVDGALSVLSLMHRRSRFWVGVPP----YNILIKELNRQGRALDARNVYAA  394
             +  LC  G+   A+ ++S M +R     G  P    Y  LI  L   G+   A  +Y  
Sbjct  166  PLNVLCDVGRAKDAIGLMSTMMKR-----GCKPNAQNYTALISGLAVVGQLELAIGLYHR  220

Query  393  ALKRGLLVP  367
             LK G LVP
Sbjct  221  MLKEG-LVP  228



>ref|XP_009802358.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52640, 
mitochondrial-like [Nicotiana sylvestris]
 ref|XP_009802359.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52640, 
mitochondrial-like [Nicotiana sylvestris]
 ref|XP_009802360.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52640, 
mitochondrial-like [Nicotiana sylvestris]
 ref|XP_009802361.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52640, 
mitochondrial-like [Nicotiana sylvestris]
 ref|XP_009802362.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52640, 
mitochondrial-like [Nicotiana sylvestris]
 ref|XP_009802363.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52640, 
mitochondrial-like [Nicotiana sylvestris]
 ref|XP_009802364.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52640, 
mitochondrial-like [Nicotiana sylvestris]
Length=548

 Score = 63.9 bits (154),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 62/120 (52%), Gaps = 1/120 (1%)
 Frame = -2

Query  735  DAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVI  556
            +A + FD M ER   V+  AY  ++E++C   ++D+A    ++M  +G  P  FT+   I
Sbjct  249  EAQKLFDEMLERGFSVDLLAYNSILESVCKAGKMDEAYNLFMKMRSMGLRPDAFTYAVFI  308

Query  555  RALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGL  376
             A C    +  A  VL  M +R +    V  YN++IK+L +  +  DA  +    ++RG+
Sbjct  309  HAYCVKDDIHAAFRVLDRM-KRYKLVPNVFTYNVIIKKLCKSDKVEDAYQLIDEMIERGV  367



>ref|XP_010476252.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12300, 
mitochondrial-like [Camelina sativa]
Length=621

 Score = 63.9 bits (154),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 60/119 (50%), Gaps = 1/119 (1%)
 Frame = -2

Query  732  AYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  553
            A E    M ERK+ ++   Y ++I+ LC  K +D AL    EM   G+     T+  +I+
Sbjct  248  AMELLRNMEERKMKLDAAKYNILIDGLCKDKNLDDALNLFNEMEVKGFKADVITYTTLIK  307

Query  552  ALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGL  376
              C DG+ D    +L  M  R R    V  +N+LI    ++G+ L+A  ++   ++RG+
Sbjct  308  GFCNDGRWDDGAQLLRDMITR-RITPNVVTFNVLIDSFVKEGKLLEAEALHNEMIRRGI  365


 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 29/121 (24%), Positives = 62/121 (51%), Gaps = 1/121 (1%)
 Frame = -2

Query  735  DAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVI  556
            D +E F +M  R +V     Y  +++      +++ A     EMV  G  P   T+  ++
Sbjct  422  DGFELFRKMSLRGVVANTVTYNTLVQGFRQSGKLEVAKELFQEMVFRGVHPDIVTYSILL  481

Query  555  RALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGL  376
              LC +G+++ AL +   + ++S+  + +  YNI+I  +   G+  DA +++++   RG+
Sbjct  482  DGLCDNGEIEKALEIFEKI-QKSKMELDIGIYNIIIHGMCNDGKVDDAWDLFSSLPLRGV  540

Query  375  L  373
            +
Sbjct  541  M  541



>gb|EMT29222.1| hypothetical protein F775_16585 [Aegilops tauschii]
Length=502

 Score = 63.9 bits (154),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 61/120 (51%), Gaps = 2/120 (2%)
 Frame = -2

Query  720  FDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRALCA  541
             D M+++ +  +   Y  +I ALC   EV KA+  L EM+ +G  P   T+ N+I   C 
Sbjct  304  LDEMKDKGVRADIVTYNTLIGALCCKGEVRKAVKLLDEMLMVGLEPEHRTYNNIINGYCE  363

Query  540  DGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGLLVPRK  361
             G +  A  + + M  + R    V  YN+ IK L+R G+  +A  +    L++G LVP K
Sbjct  364  KGNIKSAYEIRARME-KGRKRANVVTYNVFIKHLSRMGKMEEANELLNEMLEKG-LVPNK  421



>ref|XP_003620179.1| Pentatricopeptide repeat-containing protein [Medicago truncatula]
 gb|AES76397.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula]
Length=517

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 65/126 (52%), Gaps = 9/126 (7%)
 Frame = -2

Query  744  VLRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFC  565
            ++ +A E    M  ++I+     Y  +I+ LC   ++  AL  + EM   G  P   T+ 
Sbjct  262  MMDEAMELLKEMHHKQIIPNVVTYSSLIDGLCKSGKISYALKLVDEMHDRGQPPNIVTYS  321

Query  564  NVIRALCADGKVDGALSVLSLMHRRSRFWVGVPP----YNILIKELNRQGRALDARNVYA  397
            +++ ALC + +VD A+++L+ M  +     G+ P    Y ILIK L + G+  DAR V+ 
Sbjct  322  SILDALCKNHQVDNAIALLTQMKNQ-----GIQPNMYTYTILIKGLCQSGKLEDARKVFE  376

Query  396  AALKRG  379
              L +G
Sbjct  377  DLLVKG  382



>gb|AAM92820.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|AAP54427.1| Rf1 protein, mitochondrial precursor, putative [Oryza sativa 
Japonica Group]
Length=517

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 58/119 (49%), Gaps = 1/119 (1%)
 Frame = -2

Query  732  AYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  553
            AY  +  M +R+I      Y  +I ALC  + +DKA+  L  MV+ G  P   T+ +++ 
Sbjct  360  AYSTYHEMLDRRISPNVVTYSSIIAALCKAQAMDKAMEVLNTMVKNGVMPDCMTYNSILH  419

Query  552  ALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGL  376
              C+ G+   A+  L  M R       V  Y  L+  L + GR  +AR ++ +  KRGL
Sbjct  420  GYCSSGQPKEAIGTLKKM-RSDGVEPNVVTYRSLMNYLCKNGRCTEARKIFDSMTKRGL  477



>ref|XP_003590199.1| Pentatricopeptide repeat-containing protein [Medicago truncatula]
Length=834

 Score = 63.5 bits (153),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 37/122 (30%), Positives = 64/122 (52%), Gaps = 1/122 (1%)
 Frame = -2

Query  744  VLRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFC  565
            +L +A + F+ MR   ++ +  AY  +I+ LC    ++ AL  + EM   G  P   T+ 
Sbjct  344  MLDEAMDLFEGMRNENVIPDVVAYSSLIDGLCKSGRINSALKYVDEMHDRGQPPNVITYT  403

Query  564  NVIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALK  385
            ++I ALC   +VD A+++L  +  +      +  YNIL+  L + GR  DA+ V+   L 
Sbjct  404  SLIDALCKSHQVDKAIALLKKIKDQG-IQANMYTYNILVDGLCKDGRLTDAQKVFQDLLM  462

Query  384  RG  379
            +G
Sbjct  463  KG  464


 Score = 50.4 bits (119),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 36/127 (28%), Positives = 62/127 (49%), Gaps = 9/127 (7%)
 Frame = -2

Query  744  VLRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFC  565
            ++RDA++ +  M E+++      Y  +I   C   ++DKA   L EMV    +P   TF 
Sbjct  204  LVRDAFDLYCEMFEKRVFPNVVTYTSLIYGFCIVGQLDKAFGLLNEMVLKNVNPNVCTFN  263

Query  564  NVIRALCADGKVDGALSVLSLMHRRSRFWVGVPP----YNILIKELNRQGRALDARNVYA  397
             ++  LC +GK+  A S++++M +      GV P    YN L+        A  A+NV+ 
Sbjct  264  TLVDGLCKEGKMREAKSLVAVMMKE-----GVGPDVFTYNALMDGYFLVKEAGKAKNVFN  318

Query  396  AALKRGL  376
               + G+
Sbjct  319  IMAQMGV  325



>ref|XP_008809556.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like 
[Phoenix dactylifera]
Length=902

 Score = 63.5 bits (153),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 35/123 (28%), Positives = 63/123 (51%), Gaps = 1/123 (1%)
 Frame = -2

Query  741  LRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  562
            L +A    D M+E     +   Y  ++   C G ++D A  +  EM+  G SP   ++  
Sbjct  446  LNNAIRMLDHMKENGHEPDEWTYTELVNGFCKGGKLDMAHKTFEEMLECGLSPNEVSYTA  505

Query  561  VIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKR  382
            +I   C DGK+D AL++L+ M  +S     V  YN +I   +R+ +  +A  +++  +++
Sbjct  506  LIDGYCKDGKLDNALALLNRM-EKSSCKPNVRTYNAIINGFSRKNQLSEAEKLFSEMVEQ  564

Query  381  GLL  373
            GLL
Sbjct  565  GLL  567



>gb|ACL53100.1| unknown [Zea mays]
Length=437

 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 53/127 (42%), Positives = 72/127 (57%), Gaps = 0/127 (0%)
 Frame = -2

Query  741  LRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  562
            L DA E F ++           Y L+ +AL  G EVD A+A L +MVR GY+  +  + +
Sbjct  290  LGDAEEVFAKVVASGHEPVSYTYCLMAQALARGGEVDAAVALLEDMVRKGYALRKRAYTD  349

Query  561  VIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKR  382
            V+RALC  G+   AL VL L+     F  G   +  L+ EL+RQGR  DA  VYAAA+KR
Sbjct  350  VVRALCDRGRARDALQVLVLVMIVRDFVPGRNAFEALLGELSRQGRWADAMAVYAAAVKR  409

Query  381  GLLVPRK  361
            G++V  K
Sbjct  410  GVVVSWK  416



>ref|XP_010530347.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like 
[Tarenaya hassleriana]
Length=637

 Score = 63.2 bits (152),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 65/116 (56%), Gaps = 2/116 (2%)
 Frame = -2

Query  714  RMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRALCADG  535
            +M E+ I V+ + Y ++I+ LC G  +D AL+   +M   G +P   T+  +I  LC   
Sbjct  252  KMEEKNIEVDVKIYSMIIDGLCKGGHIDDALSLFDKMDSKGIAPNVVTYSCLINGLCVFD  311

Query  534  KVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGLLVP  367
            + +  + +L+ M +R + +  V  +NILI    ++G+ L+A+ +    ++RG LVP
Sbjct  312  RWNDVVRLLNDMAKR-KIFPNVVTFNILIDAFVKEGKFLEAKELCEEMIRRG-LVP  365



>emb|CDY66121.1| BnaC01g42390D [Brassica napus]
Length=471

 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 65/126 (52%), Gaps = 13/126 (10%)
 Frame = -2

Query  756  MNEWVLRD----AYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGY  589
            M  + L D    AY+ F +M ER +V +  +Y ++I+  C   +V+ A+  L +M+  G+
Sbjct  202  MRAFCLNDDLSIAYKLFGKMLERDVVPDVESYRILIQGFCRKGQVNGAMELLEDMLNKGF  261

Query  588  SPGRFTFCNVIRALCADGKVDGALSVLSLMHRRSRFWVGVPP----YNILIKELNRQGRA  421
             P R ++  ++ +LC   ++  A  +L  M  +     G  P    YN +I    RQGRA
Sbjct  262  VPDRLSYTTLLNSLCRKTQLREAYKLLCRMKLK-----GCNPDIVHYNTMILGFCRQGRA  316

Query  420  LDARNV  403
            +DAR V
Sbjct  317  MDARKV  322



>ref|XP_004492691.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22470, 
mitochondrial-like isoform X1 [Cicer arietinum]
 ref|XP_004492692.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22470, 
mitochondrial-like isoform X2 [Cicer arietinum]
Length=538

 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 58/121 (48%), Gaps = 0/121 (0%)
 Frame = -2

Query  738  RDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNV  559
            R A E F +M+   +      Y  VI+ LC   +VD+A     EMV  G     +++ ++
Sbjct  190  RVAIELFPKMKTLSVYPNLIMYNTVIDGLCKQGDVDEACGLCSEMVANGIGLDVYSYNSL  249

Query  558  IRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRG  379
            I   C+ G+   A  +L  M  R   +  V  +NILI  L + G   +A NV A  +KRG
Sbjct  250  IHGFCSVGRFGSAAKLLDEMAVRGNVYPDVYTFNILIDGLCKLGMVTEAHNVVAVMIKRG  309

Query  378  L  376
            L
Sbjct  310  L  310



>ref|XP_001777347.1| predicted protein [Physcomitrella patens]
 gb|EDQ57877.1| predicted protein [Physcomitrella patens]
Length=621

 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 41/124 (33%), Positives = 58/124 (47%), Gaps = 1/124 (1%)
 Frame = -2

Query  744  VLRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFC  565
            +L DA   FDRM+ +    +   Y  +I AL     V+ A     EM  +G  P  FT+C
Sbjct  339  LLNDAGRLFDRMKSKGCNPDVVTYSTLITALGKAARVESACVLFEEMESVGIQPDLFTYC  398

Query  564  NVIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALK  385
            ++I  L   G+VD A  + S M R       V  YN  +  L R GR  +AR ++    +
Sbjct  399  SIITVLGKAGQVDDADRLFSEM-RGKGLSPDVITYNAFLNSLGRGGRFKEARKIFEDMKE  457

Query  384  RGLL  373
             GLL
Sbjct  458  SGLL  461


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 53/113 (47%), Gaps = 1/113 (1%)
 Frame = -2

Query  741  LRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  562
             ++A + F+ M+E  ++ +   Y+ ++  L   KEVD A   L E++  G +     F  
Sbjct  445  FKEARKIFEDMKESGLLPDVATYDALLLGLSKTKEVDDACGLLKELIEQGCAFDSLKFDE  504

Query  561  VIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNV  403
             +  L + G VD A  +L   + +   W G   YN LI  L + GR  +A N 
Sbjct  505  CLEILTSWGNVDEAHELLQFANSKG-LWPGASSYNALIDALAKAGRVSEAFNT  556



>gb|AIC74546.1| PPR protein PPR7-458-Z [Oryza sativa Indica Group]
Length=458

 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 56/119 (47%), Gaps = 1/119 (1%)
 Frame = -2

Query  732  AYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  553
            AY  +  M  R+I      Y  +I ALC  + +DKA+  L  MV+ G  P   T+ +++ 
Sbjct  223  AYSTYHEMLGRRISPNVVTYSSIIAALCKAQAMDKAMEVLNTMVKNGVMPDCMTYSSILH  282

Query  552  ALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGL  376
              C+ G+   A+  L  M R       V  Y  L+  L + GR   AR ++ +  KRGL
Sbjct  283  GYCSSGQPKEAIGTLKKM-RSDGVEPNVVTYRSLMNYLCKNGRCTKARKIFDSMTKRGL  340



>ref|XP_009117967.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At3g22470, mitochondrial-like [Brassica rapa]
Length=638

 Score = 62.8 bits (151),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 34/119 (29%), Positives = 60/119 (50%), Gaps = 1/119 (1%)
 Frame = -2

Query  732  AYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  553
            A++   +M +RKI  +   Y ++I++LC  + +D AL+   EM   G  P  FT+ ++I 
Sbjct  236  AFDLLTKMEDRKIKPQVVIYNMIIDSLCKDESLDDALSLFSEMETKGIKPNVFTYTSLIG  295

Query  552  ALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGL  376
              C  G+ D    +L  M  R      V  +N LI    ++G+  +A+ +Y   + RG+
Sbjct  296  GFCNAGRWDDGAQLLRDMITRD-ITPDVVTFNALIDSFVKEGKLTEAQELYNEMITRGI  353



>ref|XP_003630734.1| Pentatricopeptide repeat-containing protein [Medicago truncatula]
 gb|AET05210.1| PPR containing plant-like protein [Medicago truncatula]
Length=520

 Score = 62.8 bits (151),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 48/138 (35%), Positives = 65/138 (47%), Gaps = 7/138 (5%)
 Frame = -2

Query  732  AYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  553
            A E FD M E+   V+  AY  ++EALC G  VD+A+  L +M+     P  FT+   IR
Sbjct  232  ARELFDAMLEQGCHVDLLAYNNLLEALCKGGHVDEAMDFLNDMLSKKVEPDAFTYSIFIR  291

Query  552  ALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGLL  373
            + C    V  A  VL  M RR      V  YN +IK L +  +  +A  +    +  GL 
Sbjct  292  SYCDANNVHSAFGVLDKM-RRCNLLPNVFTYNCIIKRLCKIKKVEEAYQLLDEMISSGL-  349

Query  372  VPRKKPIQFSAKA-QAPH  322
                KP  +S  A QA H
Sbjct  350  ----KPDTWSYNAIQAYH  363



>dbj|BAQ15370.1| pentatricopeptide repeat-containing protein [Oryza sativa Indica 
Group]
Length=782

 Score = 62.8 bits (151),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 41/126 (33%), Positives = 62/126 (49%), Gaps = 9/126 (7%)
 Frame = -2

Query  741  LRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  562
            L  AY  +  M +R I      Y  +I ALC  + +DKA+  L  MV+ G  P   T+ +
Sbjct  217  LDKAYSTYHEMLDRGISPNVVTYSSIIAALCKAQAMDKAMEVLNTMVKNGVMPDCMTYNS  276

Query  561  VIRALCADGKVDGALSVLSLMHRRSRFWVGVPP----YNILIKELNRQGRALDARNVYAA  394
            ++   C+ G+   A+  L  M  RS    GV P    Y  L+  L + GR+ +AR ++ +
Sbjct  277  ILHGYCSSGQPKEAIGTLKKM--RSD---GVEPNVFTYRSLMNYLCKNGRSTEARKIFDS  331

Query  393  ALKRGL  376
              KRGL
Sbjct  332  MTKRGL  337



>gb|KDP31244.1| hypothetical protein JCGZ_11620 [Jatropha curcas]
Length=763

 Score = 62.8 bits (151),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 53/103 (51%), Gaps = 0/103 (0%)
 Frame = -2

Query  738  RDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNV  559
             D  E F  M E++ V     Y ++IE+LC  ++V+ AL  + E+   G +P   +F  V
Sbjct  513  EDVMETFKLMMEKRCVPNLITYNILIESLCKARKVNDALDLVEEIRNKGLTPDTVSFGTV  572

Query  558  IRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQ  430
            +  LC +G ++GA  V   M ++ +    V  YNI+I   + Q
Sbjct  573  MSGLCNNGDLEGAYRVFRRMEQQYKVCYSVATYNIMINAFSEQ  615



>ref|XP_010475835.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09820-like 
[Camelina sativa]
Length=608

 Score = 62.4 bits (150),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 64/119 (54%), Gaps = 1/119 (1%)
 Frame = -2

Query  720  FDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRALCA  541
            FD++  + +  +   Y +++E  C+  E  KA   L EM ++G  P   T+  +++  C 
Sbjct  461  FDQLTSKGLP-DLVTYHILMEGYCSKGETRKAAMLLKEMSKMGLKPRHLTYNILMKGYCR  519

Query  540  DGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGLLVPR  364
            +G +  A ++ + M +  R W+ V  YN+L++  +++G+  DA  +    L++GL+  R
Sbjct  520  EGNLKAATNLRTQMEKERRLWINVASYNVLLQGYSQKGKLEDANILLNEMLEKGLVPNR  578



>ref|XP_011014424.1| PREDICTED: pentatricopeptide repeat-containing protein At4g28010-like 
[Populus euphratica]
Length=720

 Score = 62.4 bits (150),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 63/119 (53%), Gaps = 1/119 (1%)
 Frame = -2

Query  732  AYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  553
            A + F+RM+   I+ +  +Y  +I  LC  K ++KA+  LVEM      P  FT+C ++ 
Sbjct  155  ALDLFNRMKRINILPDIVSYNTIINGLCKEKRLEKAVDLLVEMEGSNCEPNSFTYCILMD  214

Query  552  ALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGL  376
             LC +G+V+ A+ +L  M +R    V V  Y+ LI     QG     + ++   L++G+
Sbjct  215  GLCKEGRVEEAMRLLGEM-KRKELEVDVVVYSTLISGFCSQGCLDRGKALFDEMLEKGI  272


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 54/122 (44%), Gaps = 6/122 (5%)
 Frame = -2

Query  720  FDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRALCA  541
            FD M E+ I      Y  +I   C      +A A L  M   G  P  +T+  +I  LC 
Sbjct  264  FDEMLEKGISPNVVVYSCLINGFCKKGLWREATAVLHAMTERGIQPDVYTYTCMIGGLCK  323

Query  540  DGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGLLVPRK  361
            DG+   AL +  LM  +      V  YN+LI  L ++G   DA  ++   L++     RK
Sbjct  324  DGRARKALDLFDLMTEKGEEPSTV-TYNVLINGLCKEGCIGDAFKIFETMLEK-----RK  377

Query  360  KP  355
            +P
Sbjct  378  RP  379



>gb|ACL53015.1| unknown [Zea mays]
 tpg|DAA45234.1| TPA: hypothetical protein ZEAMMB73_414823 [Zea mays]
Length=559

 Score = 62.4 bits (150),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 52/130 (40%), Positives = 72/130 (55%), Gaps = 0/130 (0%)
 Frame = -2

Query  759  GMNEWVLRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPG  580
              +   L DA E F ++           Y L+ +AL  G EVD A+A L +MVR GY+  
Sbjct  406  ATDASALGDAEEVFAKVVASGHEPVSYTYCLMAQALARGGEVDAAVALLEDMVRKGYALR  465

Query  579  RFTFCNVIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVY  400
            +  + +V+RALC  G+   AL VL L+     F  G   +  L+ EL+RQGR  DA  VY
Sbjct  466  KRAYTDVVRALCDRGRARDALQVLVLVMIVRDFVPGRNAFEALLGELSRQGRWADAMAVY  525

Query  399  AAALKRGLLV  370
            AAA+KRG++V
Sbjct  526  AAAVKRGVVV  535



>gb|EPS61251.1| hypothetical protein M569_13548, partial [Genlisea aurea]
Length=488

 Score = 62.4 bits (150),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 59/119 (50%), Gaps = 0/119 (0%)
 Frame = -2

Query  732  AYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  553
            A +  +RM E        +Y  ++   C  K++D AL  L  MV  G  P   T+  ++ 
Sbjct  266  AVDVLERMPENGCTPNSLSYNSLLHTFCKEKKMDSALEYLELMVSRGCYPDIVTYNTMLT  325

Query  552  ALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGL  376
            ALC DGKVD A+++L+ +  + R    +  YN +I  L++ GR  +A  +      RGL
Sbjct  326  ALCRDGKVDAAVAILNRLRSKGRCSPVLITYNTVIDGLSKMGRTDEAMELLVEMRGRGL  384


 Score = 53.9 bits (128),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 36/121 (30%), Positives = 60/121 (50%), Gaps = 1/121 (1%)
 Frame = -2

Query  741  LRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  562
            L +A E  DRM  ++   +   Y ++IEA      VD+A+  L +M R G  P   T+  
Sbjct  123  LSEAMEVIDRMLLKECHPDVITYTILIEATLKENGVDQAMELLDDMKRRGCKPDIVTYNV  182

Query  561  VIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKR  382
            +I  +C +GK+D A+  L  M         V  +NI+++ +   GR +DA  + +  L +
Sbjct  183  LIDGICKEGKLDEAIKFLDTMSSYG-CRPNVITHNIILRSMCSTGRWMDAEKLLSEMLVK  241

Query  381  G  379
            G
Sbjct  242  G  242



>gb|KDP45287.1| hypothetical protein JCGZ_15152 [Jatropha curcas]
Length=897

 Score = 62.4 bits (150),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 39/125 (31%), Positives = 63/125 (50%), Gaps = 9/125 (7%)
 Frame = -2

Query  741  LRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  562
            L++ Y  F ++ +  +V     Y ++++  C   E++ +L  L  M R+G +P  +T+  
Sbjct  564  LKEEYTMFGKILKYGLVPSVVTYTILVDGQCRAGEINSSLNMLELMKRVGCAPNVYTYTI  623

Query  561  VIRALCADGKVDGALSVLSLMHRRSRFWVGVPP----YNILIKELNRQGRALDARNVYAA  394
            VI  LC +G++  A S+LS M     F VGVPP    Y  L+K     GR   A N+   
Sbjct  624  VINGLCQNGRIQEAESLLSSM-----FDVGVPPNVITYTTLVKAHANAGRLDCALNIVNT  678

Query  393  ALKRG  379
             +K G
Sbjct  679  MVKNG  683


 Score = 57.8 bits (138),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 34/120 (28%), Positives = 62/120 (52%), Gaps = 1/120 (1%)
 Frame = -2

Query  741  LRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  562
            L +A+   + M  +  +   R Y ++++A+C+   +DKA++ L EMVR G  P  +T+  
Sbjct  284  LEEAFGLKEEMSRKGCLPTTRTYSVLLKAVCDIGLIDKAISLLDEMVRNGCKPNVYTYTA  343

Query  561  VIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKR  382
            +I  LC +GK++ A  +   M +      G+  YN LI    ++GR + A  +     +R
Sbjct  344  LIDGLCREGKIEEANGIFRRMLQDG-LSPGIITYNALINGYCKEGRIVSAFEIIGLMERR  402



>ref|XP_002967156.1| hypothetical protein SELMODRAFT_144844 [Selaginella moellendorffii]
 gb|EFJ31755.1| hypothetical protein SELMODRAFT_144844 [Selaginella moellendorffii]
Length=651

 Score = 62.4 bits (150),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 41/118 (35%), Positives = 57/118 (48%), Gaps = 9/118 (8%)
 Frame = -2

Query  741  LRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  562
            L  AY+  + M E+  V     + ++I  LC    V +A   L +MV  G SP   T+  
Sbjct  200  LDSAYKLLEVMIEKGCVPNVFTFTILITGLCKANRVGEAQQLLEKMVTGGCSPNVVTYST  259

Query  561  VIRALCADGKVDGALSVLSLMHRRSRFWVGVPP----YNILIKELNRQGRALDARNVY  400
            VI  LC  G+VD A  +  LM RR+      PP    +NILI  L +  R  +AR +Y
Sbjct  260  VINGLCKQGQVDDAYELFQLMERRN-----CPPNVVTHNILIDGLCKAKRIEEARQLY  312



>gb|EYU42661.1| hypothetical protein MIMGU_mgv1a020055mg [Erythranthe guttata]
Length=730

 Score = 62.4 bits (150),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 60/115 (52%), Gaps = 1/115 (1%)
 Frame = -2

Query  720  FDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRALCA  541
            +D M +  +      Y ++I  LC+ KE+D+ L    +M + G  P   T+  +I A C 
Sbjct  219  YDEMMDNDVSPNVFTYNILIRGLCSNKEMDRGLVLFEKMEKKGCLPNVVTYNTLIDAYCK  278

Query  540  DGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGL  376
             GK+D A ++L LM  ++     V  YN++I  L R+GR  + + V+    ++GL
Sbjct  279  MGKIDEAYALLKLMWEKN-MEPNVITYNVIINGLCREGRMEETKKVFEEMKEQGL  332



>ref|XP_002467904.1| hypothetical protein SORBIDRAFT_01g036150 [Sorghum bicolor]
 gb|EER94902.1| hypothetical protein SORBIDRAFT_01g036150 [Sorghum bicolor]
Length=558

 Score = 62.4 bits (150),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 52/124 (42%), Positives = 71/124 (57%), Gaps = 0/124 (0%)
 Frame = -2

Query  741  LRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  562
            L DA E F ++           Y L+ +AL  G EVD A+A L +MVR GY+  +  + +
Sbjct  411  LGDAKEVFAKVVASGHEPVSYTYCLMAQALARGGEVDAAVALLEDMVRKGYALRKRAYTD  470

Query  561  VIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKR  382
            V+RALC  G+   AL VL L+     F  G   +  L+ EL+RQGR  DA  VYAAA+KR
Sbjct  471  VVRALCDRGRALDALQVLVLVMIVRDFVPGRNAFEALLGELSRQGRWADAMAVYAAAVKR  530

Query  381  GLLV  370
            G++V
Sbjct  531  GVVV  534



>ref|XP_006662452.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09820-like, 
partial [Oryza brachyantha]
Length=526

 Score = 62.4 bits (150),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 58/115 (50%), Gaps = 1/115 (1%)
 Frame = -2

Query  717  DRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRALCAD  538
            D M+E+ I  +   Y ++I ALC   EV KA+  L EM+++G  P   T+  +I+  C  
Sbjct  377  DEMKEKGIEADVVTYNVLIGALCGKGEVPKAVKLLDEMLKVGLEPNHLTYNTIIQGFCDK  436

Query  537  GKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGLL  373
            G +  A  + + M  + R    V  YN+LIK     G+   A ++    L +GL+
Sbjct  437  GNIKAAYEIRTRME-KFRKRANVVTYNVLIKYFCSLGKMEQADDLINEMLDKGLV  490


 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 52/115 (45%), Gaps = 1/115 (1%)
 Frame = -2

Query  720  FDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRALCA  541
            F+ M+++ I      Y ++I  LC    V++ L  + EM  +G  P   TF  V+   C 
Sbjct  236  FEEMKQQGIAASAAIYNVLISGLCGEGRVEEGLKMMKEMEDLGLPPNEITFGRVLNGFCK  295

Query  540  DGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGL  376
             G V  A   +  M  R+     V  YN+LI    R G+  DA  V  A  K+G+
Sbjct  296  KGMVANAKDWIDGMVERN-VQPSVVTYNMLIGGYRRLGKMEDAMAVKEAMAKKGI  349



>ref|XP_002871729.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH47988.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
Length=504

 Score = 62.0 bits (149),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 40/122 (33%), Positives = 59/122 (48%), Gaps = 1/122 (1%)
 Frame = -2

Query  741  LRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  562
            + DA   FDRM E         Y  +I+ LC  K+VD AL  L  M   G  P   T+ +
Sbjct  167  IYDALYMFDRMVEMGYEPNVVIYNTIIDGLCKSKQVDNALDLLNRMEVDGIRPDAVTYNS  226

Query  561  VIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKR  382
            +I  LC  G+ D A  ++S M +R   +  V  +N LI    ++GR  +A  +Y   ++R
Sbjct  227  LISGLCNSGRWDDATRMVSCMTKR-EIYPDVFTFNALIDACVKEGRISEAEELYEEMIRR  285

Query  381  GL  376
             L
Sbjct  286  SL  287


 Score = 53.5 bits (127),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 32/115 (28%), Positives = 59/115 (51%), Gaps = 1/115 (1%)
 Frame = -2

Query  720  FDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRALCA  541
            F  M +R +V     Y ++I+  C   +++ A      MV  G  P   T+  ++  LC 
Sbjct  349  FCEMSQRGVVRNTVTYTVLIQGYCRAGKLNVAEEIFKWMVFCGVPPNIITYNVLLHGLCD  408

Query  540  DGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGL  376
            +GK++ AL +L+ M ++S     +  YNI+I+ + + G   DA ++Y +   +GL
Sbjct  409  NGKIEKALVILADM-QKSGMDADIVTYNIIIRGMCKAGEVADAWDLYCSLNLKGL  462



>ref|XP_009801387.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Nicotiana sylvestris]
 ref|XP_009801388.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Nicotiana sylvestris]
 ref|XP_009801389.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Nicotiana sylvestris]
Length=767

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/111 (31%), Positives = 60/111 (54%), Gaps = 1/111 (1%)
 Frame = -2

Query  741  LRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  562
            L  A+    +M E+ +  +   Y  +I+ LC  + + +A     EM+R+G  P +FT+  
Sbjct  479  LERAFCAKQQMVEKGVSPDVITYSSLIQGLCEQQSLTEARELFQEMLRVGIQPDKFTYTT  538

Query  561  VIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDAR  409
            +I A C  G + GAL++ + M  +  F+  V  Y++LI  LN+Q R  +A+
Sbjct  539  LIGAYCLKGDIKGALNLHNEMINKG-FFPDVVTYSVLINGLNKQARTREAK  588


 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 40/122 (33%), Positives = 58/122 (48%), Gaps = 2/122 (2%)
 Frame = -2

Query  732  AYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  553
            A + +D M    +      Y ++I  LC   +++K LA   EM + G  P   T+  +I 
Sbjct  202  AQKFYDDMVNSGVSPNVYTYNIMIRGLCVKGDLNKGLAFFKEMEKCGCLPSVVTYNTIIG  261

Query  552  ALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGLL  373
            A C  GKVD A+ +L LM  R+     V  YN +I  L R+GR  +   V      +G L
Sbjct  262  AYCKIGKVDEAVELLKLMQVRN-LEPSVVTYNAIINGLCREGRMKETSEVLKDMRGKG-L  319

Query  372  VP  367
            VP
Sbjct  320  VP  321


 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 44/84 (52%), Gaps = 0/84 (0%)
 Frame = -2

Query  741  LRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  562
            L  A E FD++R R +    R Y  +I        +++A   L EM+  G+SP   T+  
Sbjct  374  LHRAMEFFDQLRARGLYPNERTYTTLIVGFSQQGFMNEAYKLLNEMISSGFSPSIVTYNA  433

Query  561  VIRALCADGKVDGALSVLSLMHRR  490
            ++   CA G+++ ALSV+  M RR
Sbjct  434  LVNGHCALGRMEDALSVIQEMERR  457



>ref|XP_008806452.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09820 
[Phoenix dactylifera]
Length=447

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 63/126 (50%), Gaps = 1/126 (1%)
 Frame = -2

Query  741  LRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  562
            +  A +  D M E  +  +   Y ++I ALC   ++ KA+  L EM  IG  P   T+  
Sbjct  295  MSSATKLLDEMEENDVKADLITYNVLISALCREGKMAKAVKLLDEMQDIGLQPSHVTYNT  354

Query  561  VIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKR  382
            +I  LC  G +  AL++ + M +  +    V  YNILIK  + +G+  +A  +    L++
Sbjct  355  LIDGLCKKGNLRAALNIRARMEKGGK-HANVVTYNILIKYFSGRGKMHEANELLNEMLEK  413

Query  381  GLLVPR  364
            GL+  R
Sbjct  414  GLVPNR  419



>ref|XP_002960858.1| hypothetical protein SELMODRAFT_75631 [Selaginella moellendorffii]
 gb|EFJ38397.1| hypothetical protein SELMODRAFT_75631 [Selaginella moellendorffii]
Length=699

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 41/118 (35%), Positives = 57/118 (48%), Gaps = 9/118 (8%)
 Frame = -2

Query  741  LRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  562
            L  AY+  + M E+  V     + ++I  LC    V +A   L +MV  G SP   T+  
Sbjct  248  LDSAYKLLEVMIEKGCVPNVFTFTILITGLCKANRVGEAQQLLEKMVMGGCSPNVVTYST  307

Query  561  VIRALCADGKVDGALSVLSLMHRRSRFWVGVPP----YNILIKELNRQGRALDARNVY  400
            VI  LC  G+VD A  +  LM RR+      PP    +NILI  L +  R  +AR +Y
Sbjct  308  VINGLCKQGQVDDAYELFQLMERRN-----CPPNVVTHNILIDGLCKAKRIEEARQLY  360


 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 56/121 (46%), Gaps = 4/121 (3%)
 Frame = -2

Query  732  AYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRI---GYSPGRFTFCN  562
            A + FD M  R    +   Y LV+E +    + DKALA L +++      ++P       
Sbjct  497  AIQLFDSMAARGCTDDALIYNLVVEGMARASKHDKALAVLEQVIDKRDRKFNPSSSAVDA  556

Query  561  VIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKR  382
            ++ +LC  GK D A  +L  M  R  F   V  YN L+  L+R  R  +A  V+ A +  
Sbjct  557  LVESLCQVGKTDDAKQLLHKMSERG-FAAAVSSYNRLLSGLSRLQRWDEATQVFEAMVSA  615

Query  381  G  379
            G
Sbjct  616  G  616



>ref|XP_004515689.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12300, 
mitochondrial-like [Cicer arietinum]
Length=550

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 63/123 (51%), Gaps = 9/123 (7%)
 Frame = -2

Query  735  DAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVI  556
            +A   F  M+ RKIV +   Y  +I++LC    +  AL  + EM   G  P  +T+ +++
Sbjct  361  EAMNLFKEMQSRKIVPDVVTYSSLIDSLCKSGRITYALELVCEMHDRGQPPNIYTYSSIL  420

Query  555  RALCADGKVDGALSVLSLMHRRSRFWVGVPP----YNILIKELNRQGRALDARNVYAAAL  388
             ALC    VD A+++L   +      +G+ P    YNIL+  L + GR  D++ ++   L
Sbjct  421  DALCKSHDVDKAIALLKKFND-----LGIQPDMCTYNILLNGLCKSGRIKDSQKIFEYLL  475

Query  387  KRG  379
             +G
Sbjct  476  VKG  478



>gb|AIC74545.1| PPR protein PPR7-458-I [Oryza sativa Indica Group]
Length=458

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 56/119 (47%), Gaps = 1/119 (1%)
 Frame = -2

Query  732  AYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  553
            AY  +  M  R+I      Y  +I ALC  + +DKA+  L  MV+ G  P   T+ +++ 
Sbjct  223  AYSTYHEMLGRRISPNVVTYSSIIAALCKAQAMDKAMEVLNTMVKNGVMPDCMTYNSILH  282

Query  552  ALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGL  376
              C+ G+   A+  L  M R       V  Y  L+  L + GR   AR ++ +  KRGL
Sbjct  283  GYCSSGQPKEAIGTLKKM-RSDGVEPNVVTYRSLMNYLCKNGRCTKARKIFDSMTKRGL  340



>gb|AIC74544.1| PPR protein PPR7-454-M [Oryza sativa Indica Group]
Length=454

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 56/119 (47%), Gaps = 1/119 (1%)
 Frame = -2

Query  732  AYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  553
            AY  +  M  R+I      Y  +I ALC  + +DKA+  L  MV+ G  P   T+ +++ 
Sbjct  219  AYSTYHEMLGRRISPNVVTYSSIIAALCKAQAMDKAMEVLNTMVKNGVMPDCMTYNSILH  278

Query  552  ALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGL  376
              C+ G+   A+  L  M R       V  Y  L+  L + GR   AR ++ +  KRGL
Sbjct  279  GYCSSGQPKEAIGTLKKM-RSDGVEPNVVTYRSLMNYLCKNGRCTKARKIFDSMTKRGL  336



>ref|XP_011003803.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g12700, mitochondrial [Populus euphratica]
Length=611

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 61/113 (54%), Gaps = 1/113 (1%)
 Frame = -2

Query  714  RMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRALCADG  535
            +M ER  +     Y  +I++LC  K + +A+  L EMV  G SP   T+ +++   C  G
Sbjct  221  KMEERGCMPNVVVYSTIIDSLCKDKLITEAMEFLSEMVNRGISPNVVTYSSILHGFCNLG  280

Query  534  KVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGL  376
            + + A S+   M  R+     V  +NIL+  L+++G  L+AR V+   +++G+
Sbjct  281  RSNEATSLFKQMVERNVMPDTV-TFNILVDGLSKEGMILEARCVFETMIEKGV  332



>gb|AIC74548.1| PPR protein PPR8-780-M [Oryza sativa Indica Group]
Length=780

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 37/119 (31%), Positives = 58/119 (49%), Gaps = 1/119 (1%)
 Frame = -2

Query  732  AYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  553
            AY  +  M +R+I      Y  +I ALC  + +DKA+  L  MV+ G  P   T+ +++ 
Sbjct  218  AYITYHEMLDRRISPNVATYNSIIAALCKAQAMDKAMEVLNTMVKNGVMPDCMTYNSILH  277

Query  552  ALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGL  376
              C+ G+   A+  L  M R       V  Y  L+  L + GR  +AR ++ +  KRGL
Sbjct  278  GYCSSGQPKEAIGTLKKM-RSDGVEPNVVTYRSLMNYLCKNGRCTEARKIFDSMTKRGL  335



>ref|XP_010524658.1| PREDICTED: pentatricopeptide repeat-containing protein At3g07290, 
mitochondrial isoform X1 [Tarenaya hassleriana]
 ref|XP_010524659.1| PREDICTED: pentatricopeptide repeat-containing protein At3g07290, 
mitochondrial isoform X2 [Tarenaya hassleriana]
Length=882

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 41/120 (34%), Positives = 61/120 (51%), Gaps = 1/120 (1%)
 Frame = -2

Query  741  LRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  562
            L +A+   D+MRE+      R Y ++I+ALC+   ++KAL  L EMV  G  P   T+ +
Sbjct  285  LEEAFRLKDQMREKGCQPSTRTYTVLIKALCDKGLIEKALNLLDEMVAGGCKPNAHTYTD  344

Query  561  VIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKR  382
            +I  LC  GK++ A  + S M +   F   V  YN LI    + GR + A  +     KR
Sbjct  345  LIDGLCKLGKIEEANGLYSKMVKEGIF-PSVVTYNALINGYCKDGRIIPAIELLGMMEKR  403



>gb|EYU21622.1| hypothetical protein MIMGU_mgv1a019624mg, partial [Erythranthe 
guttata]
Length=510

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 61/120 (51%), Gaps = 1/120 (1%)
 Frame = -2

Query  735  DAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVI  556
            +A + FD M ER+  V+  A+  V++ALC G +VD+A      M   G  P  +++   I
Sbjct  223  EAQKLFDEMLEREYTVDLLAWNSVLDALCKGGKVDEAYELFQGMRTKGLEPDAYSYSIFI  282

Query  555  RALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGL  376
            RA C++  +  A  VL  M +R      V  YN +IK L +  +  +A  +    L+RG+
Sbjct  283  RASCSENDIHSAFRVLDSM-KRCNLAPNVFTYNCIIKSLCKNNKIDEAYELLDEMLERGV  341



>ref|XP_010530356.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like 
[Tarenaya hassleriana]
 ref|XP_010530357.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like 
[Tarenaya hassleriana]
 ref|XP_010530358.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like 
[Tarenaya hassleriana]
 ref|XP_010530360.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like 
[Tarenaya hassleriana]
Length=640

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 64/116 (55%), Gaps = 2/116 (2%)
 Frame = -2

Query  714  RMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRALCADG  535
            RM E+ I V+   Y  +I+ LC G  +D AL+   +M   G +P   T+  +I  LC   
Sbjct  255  RMEEKNIEVDVIMYNTIIDGLCKGGHIDVALSLFEKMDSKGIAPNVVTYNCLINGLCVFN  314

Query  534  KVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGLLVP  367
            + + A+ +L+ M +R + +  V  +NILI    ++G+ L+A+ +    ++RG LVP
Sbjct  315  RWNDAVLLLNDMAKR-KIFSNVVTFNILIDAFVKEGKFLEAKELCEEIIRRG-LVP  368



>gb|KFK30719.1| hypothetical protein AALP_AA6G018600 [Arabis alpina]
Length=472

 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 64/126 (51%), Gaps = 13/126 (10%)
 Frame = -2

Query  756  MNEWVLRD----AYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGY  589
            M  +VL D    AY+ F +M ER +V +  +Y ++I+  C   +V+ A+  L +M+  G+
Sbjct  202  MQAFVLNDDLSIAYQLFGKMLERDVVPDIESYRILIQGFCRKGQVNGAMELLDDMLNKGF  261

Query  588  SPGRFTFCNVIRALCADGKVDGALSVLSLMHRRSRFWVGVPP----YNILIKELNRQGRA  421
             P R ++  ++ +LC   ++  A  VL  M  +     G  P    YN +I    R+G  
Sbjct  262  VPDRLSYTTLLNSLCRKTQLREAYKVLCRMKLK-----GCNPDLVHYNTIILGFVREGHG  316

Query  420  LDARNV  403
            +DAR V
Sbjct  317  MDARKV  322



>gb|KHN09027.1| Pentatricopeptide repeat-containing protein [Glycine soja]
Length=513

 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 65/125 (52%), Gaps = 9/125 (7%)
 Frame = -2

Query  741  LRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  562
            L++A E  DR  +R+   +   Y ++IEA CN   V +A+  L EM + G  P   T+  
Sbjct  135  LKEAMEVLDRQMQRECYPDVITYTILIEATCNDSGVGQAMKLLDEMRKKGCKPDVVTYNV  194

Query  561  VIRALCADGKVDGALSVLSLMHRRSRFWVGVPP----YNILIKELNRQGRALDARNVYAA  394
            +I  +C +G++D A+  L+ M        G  P    +NI+++ +   GR +DA  + A 
Sbjct  195  LINGICKEGRLDEAIKFLNNMP-----LYGCQPNVITHNIILRSMCSTGRWMDAERLLAD  249

Query  393  ALKRG  379
             L++G
Sbjct  250  MLRKG  254


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/119 (27%), Positives = 58/119 (49%), Gaps = 1/119 (1%)
 Frame = -2

Query  732  AYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  553
            A +  ++M +   V    +Y  ++   C  K++D+A+  L  MV  G  P   T+  ++ 
Sbjct  278  AIDVLEKMPKHGCVPNSLSYNPLLHGFCQEKKMDRAIEYLEIMVSRGCYPDIVTYNTLLT  337

Query  552  ALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGL  376
            ALC DGK D A+ +L+ +  +    V +  YN +I  L + G+   A  +     ++GL
Sbjct  338  ALCKDGKADAAVEILNQLSSKGCSPVLI-TYNTVIDGLTKVGKTEYAAELLEEMRRKGL  395



>ref|XP_010472747.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79080, 
chloroplastic isoform X1 [Camelina sativa]
 ref|XP_010472748.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79080, 
chloroplastic isoform X2 [Camelina sativa]
Length=580

 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/120 (28%), Positives = 58/120 (48%), Gaps = 0/120 (0%)
 Frame = -2

Query  741  LRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  562
            +++A+     +  ++    H  Y+ VI +LC       A   L EM R G+ P   T+ +
Sbjct  408  VQEAFYIIQSLSNKQKCCTHDFYKSVITSLCRKGNTFAAFQLLYEMTRCGFDPDSHTYSS  467

Query  561  VIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKR  382
            +IR LC +G   GA+ VLS+M    ++   V  +N +I  L +  R   A  V+   +++
Sbjct  468  LIRGLCLEGMYTGAMEVLSIMEESEKYKPSVDNFNAMILGLCKTRRTDLAMEVFEMMVEK  527



>ref|XP_010417523.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79080, 
chloroplastic-like [Camelina sativa]
Length=580

 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/120 (28%), Positives = 58/120 (48%), Gaps = 0/120 (0%)
 Frame = -2

Query  741  LRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  562
            +++A+     +  ++    H  Y+ VI +LC       A   L EM R G+ P   T+ +
Sbjct  408  VQEAFYIIQSLSNKQKCCTHDFYKSVITSLCRKGNTFAAFQLLYEMTRCGFDPDSHTYSS  467

Query  561  VIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKR  382
            +IR LC +G   GA+ VLS+M    ++   V  +N +I  L +  R   A  V+   +++
Sbjct  468  LIRGLCLEGMYTGAMEVLSIMEESEKYKPSVDNFNAMILGLCKTRRTDLAMEVFEMMVEK  527



>ref|XP_006472193.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09820-like 
isoform X1 [Citrus sinensis]
 ref|XP_006472194.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09820-like 
isoform X2 [Citrus sinensis]
Length=595

 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 59/110 (54%), Gaps = 2/110 (2%)
 Frame = -2

Query  678  AYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRALCADGKVDGALSVLSLM  499
             Y +++ ALC   +  KA++ L EM ++G SP   T+  ++   C +G +  A+++   M
Sbjct  462  TYNILVGALCKDGKSKKAVSLLDEMFKVGVSPSHVTYNTLMDGYCREGNLVAAMNLRKQM  521

Query  498  HRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGLLVPRKKPIQ  349
             +  + W  +  YN+LIK   ++G+  DA  +    L++G L+P +   Q
Sbjct  522  EKEKK-WPNIVTYNVLIKGFCQKGKLEDANGLLNELLEKG-LIPNQTTYQ  569



>ref|XP_010429780.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79080, 
chloroplastic [Camelina sativa]
Length=580

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/120 (28%), Positives = 58/120 (48%), Gaps = 0/120 (0%)
 Frame = -2

Query  741  LRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  562
            +++A+     +  ++    H  Y+ VI +LC       A   L EM R G+ P   T+ +
Sbjct  408  VQEAFYIIQSLSNKQKCCTHDFYKSVITSLCRKGNTFAAFQLLYEMTRCGFDPDSHTYSS  467

Query  561  VIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKR  382
            +IR LC +G   GA+ VLS+M    ++   V  +N +I  L +  R   A  V+   +++
Sbjct  468  LIRGLCLEGMYTGAMEVLSIMEESEKYKPSVDNFNAMILGLCKTRRTDLAMEVFEMMVEK  527



>ref|XP_003527866.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like 
[Glycine max]
Length=603

 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 65/125 (52%), Gaps = 9/125 (7%)
 Frame = -2

Query  741  LRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  562
            L++A E  DR  +R+   +   Y ++IEA CN   V +A+  L EM + G  P   T+  
Sbjct  225  LKEAMEVLDRQMQRECYPDVITYTILIEATCNDSGVGQAMKLLDEMRKKGCKPDVVTYNV  284

Query  561  VIRALCADGKVDGALSVLSLMHRRSRFWVGVPP----YNILIKELNRQGRALDARNVYAA  394
            +I  +C +G++D A+  L+ M        G  P    +NI+++ +   GR +DA  + A 
Sbjct  285  LINGICKEGRLDEAIKFLNNMP-----LYGCQPNVITHNIILRSMCSTGRWMDAERLLAD  339

Query  393  ALKRG  379
             L++G
Sbjct  340  MLRKG  344



>ref|XP_009362528.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52640, 
mitochondrial-like [Pyrus x bretschneideri]
 ref|XP_009362529.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52640, 
mitochondrial-like [Pyrus x bretschneideri]
 ref|XP_009362534.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52640, 
mitochondrial-like [Pyrus x bretschneideri]
 ref|XP_009362535.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52640, 
mitochondrial-like [Pyrus x bretschneideri]
Length=525

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 50/155 (32%), Positives = 69/155 (45%), Gaps = 16/155 (10%)
 Frame = -2

Query  720  FDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRALCA  541
            FD M ER  +V+  AY   +EALC G +VD+A     EM   G  P   T+   IRA C 
Sbjct  242  FDEMTERGCLVDVPAYNSYLEALCKGGKVDEAYKIFREMGSNGVEPDACTYSIFIRAYCE  301

Query  540  DGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGLLVPRK  361
               +     VL  M RR      V  YN +IK+L +  +  +A  +     +RG++    
Sbjct  302  VDDIHSVFRVLDRM-RRYNLLPNVYTYNCVIKKLCKNEKVEEAYQLLDEMTERGVM----  356

Query  360  KPIQFSAKA-QAPHIANG*ILLLCEICHGSDLLRL  259
             P  +S  A QA H         C+ C  +  LRL
Sbjct  357  -PDTWSYNAIQAYH---------CDHCEVNGSLRL  381



>ref|XP_008243715.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52640, 
mitochondrial-like [Prunus mume]
Length=525

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 50/161 (31%), Positives = 74/161 (46%), Gaps = 17/161 (11%)
 Frame = -2

Query  720  FDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRALCA  541
            FD M ER  +V+  AY   +EALC G +VD+A     EM   G  P   T+   IRA C 
Sbjct  242  FDEMTERGCLVDVPAYNSYLEALCKGGKVDEAYKIFREMGSNGTDPDACTYSIFIRAYCE  301

Query  540  DGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGLLVPRK  361
               +     VL  M +R      V  YN +IK+L +  +  +A  +    ++ G++    
Sbjct  302  ANDIHSVFRVLDRM-KRYNLLPNVYSYNCIIKKLCKNDKVEEAYQLLDEMIESGVM----  356

Query  360  KPIQFSAKA-QAPHIANG*ILLLCEICHGSDLLRLCIHRVK  241
             P  +S  A QA H         C+ C  +  LRL ++R+K
Sbjct  357  -PDAWSYNAIQAYH---------CDHCEVNRALRL-LYRMK  386



>ref|XP_004296143.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g12700, mitochondrial [Fragaria vesca subsp. vesca]
Length=262

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 62/117 (53%), Gaps = 1/117 (1%)
 Frame = -2

Query  732  AYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  553
            A +    M ER    +  +Y  +I++L  G  +D+AL    EM+R G +P   T+ ++I+
Sbjct  75   AIQLLTNMEERGFNPDTVSYSTIIDSLAKGTLIDEALKLFAEMIRRGIAPDVVTYTSLIQ  134

Query  552  ALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKR  382
             LC  G+   A  +L+ M  +S F   +  +N+L+  L + G+ ++A++V     +R
Sbjct  135  GLCDIGRCKQATRLLNYMVSQSVFP-DLVTFNVLVDTLCKDGKVVEAQSVIEIMFQR  190



>ref|XP_010424275.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12775, 
mitochondrial-like [Camelina sativa]
Length=300

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/125 (30%), Positives = 59/125 (47%), Gaps = 1/125 (1%)
 Frame = -2

Query  750  EWVLRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFT  571
             W    A E   +M ER I +    Y ++I++LC  + +D AL+   EM   G      T
Sbjct  163  SWKTALAMELLKKMEERNIKLNVVHYSIIIDSLCKDENLDDALSLFNEMEVKGIKSNIVT  222

Query  570  FCNVIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAA  391
            +  +IR  C DG+ D    +L  M  R R    V  +N LI    ++G+ +DA  ++   
Sbjct  223  YNTLIRGFCNDGRWDDGAQLLRDMITR-RITPDVVTFNALIDSFAKEGKLVDAEALHEEM  281

Query  390  LKRGL  376
            + RG+
Sbjct  282  IIRGI  286



>ref|XP_006423060.1| hypothetical protein CICLE_v10028118mg [Citrus clementina]
 gb|ESR36300.1| hypothetical protein CICLE_v10028118mg [Citrus clementina]
Length=557

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/111 (30%), Positives = 57/111 (51%), Gaps = 1/111 (1%)
 Frame = -2

Query  741  LRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  562
            L  A++    M E+ ++ +   Y  +I  LC  + + +A     EM+  G SP  FT+  
Sbjct  271  LDKAFDTKREMVEKGVLPDTITYSSLIHGLCEQRRITEACELFQEMLSRGMSPDEFTYTT  330

Query  561  VIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDAR  409
            +I A C +G +  AL +   M ++  F   V  Y++LI  LN+Q R ++A+
Sbjct  331  LINAYCTEGDIPQALRLHDEMIQKG-FLPDVVTYSVLINGLNKQARTMEAK  380



>ref|XP_006433532.1| hypothetical protein CICLE_v10003346mg [Citrus clementina]
 gb|ESR46772.1| hypothetical protein CICLE_v10003346mg [Citrus clementina]
Length=596

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 59/110 (54%), Gaps = 2/110 (2%)
 Frame = -2

Query  678  AYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRALCADGKVDGALSVLSLM  499
             Y +++ ALC   +  KA++ L EM ++G SP   T+  ++   C +G +  A+++   M
Sbjct  463  TYNILVGALCKDGKSKKAVSLLDEMFKVGVSPSHVTYNTLMDGYCREGNLVAAMNLRKQM  522

Query  498  HRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGLLVPRKKPIQ  349
             +  + W  +  YN+LIK   ++G+  DA  +    L++G L+P +   Q
Sbjct  523  EKEKK-WPNIVTYNVLIKGFCQKGKLEDANGLLNELLEKG-LIPNQTTYQ  570



>ref|XP_010540327.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like 
[Tarenaya hassleriana]
 ref|XP_010540328.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like 
[Tarenaya hassleriana]
Length=636

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/116 (33%), Positives = 61/116 (53%), Gaps = 2/116 (2%)
 Frame = -2

Query  714  RMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRALCADG  535
            +M E  I V    Y  +I+ LC G  +D AL     M   G+ P   T+  +I  LC  G
Sbjct  251  KMEEMNIEVNVIMYNTIIDGLCKGGHIDDALNLFEMMDNKGFVPNVVTYNCLINGLCVFG  310

Query  534  KVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGLLVP  367
            +  GA+ +L+ M +R +    V  +N LI  L+++G+ L+ + +Y   ++RG LVP
Sbjct  311  RWKGAVLLLNEMVKR-KISPDVVTFNGLIDALSKEGKFLETKELYEEMIRRG-LVP  364



>ref|XP_009151645.1| PREDICTED: pentatricopeptide repeat-containing protein At4g01400, 
mitochondrial-like [Brassica rapa]
Length=468

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 64/126 (51%), Gaps = 13/126 (10%)
 Frame = -2

Query  756  MNEWVLRD----AYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGY  589
            M  + L D    AY+ F +M ER +V    +Y ++I+  C   +V+ A+  L +M+  G+
Sbjct  199  MRAFCLNDDLSIAYKLFGKMLERDVVPGVESYRILIQGFCRKGQVNGAMELLEDMLNKGF  258

Query  588  SPGRFTFCNVIRALCADGKVDGALSVLSLMHRRSRFWVGVPP----YNILIKELNRQGRA  421
             P R ++  ++ +LC   ++  A  +L  M  +     G  P    YN +I    RQGRA
Sbjct  259  VPDRLSYTTLLNSLCRKTQLREAYKLLCRMKLK-----GCNPDIVHYNTMILGFCRQGRA  313

Query  420  LDARNV  403
            +DAR V
Sbjct  314  MDARKV  319



>ref|XP_008243718.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52640, 
mitochondrial-like [Prunus mume]
Length=525

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 50/161 (31%), Positives = 74/161 (46%), Gaps = 17/161 (11%)
 Frame = -2

Query  720  FDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRALCA  541
            FD M ER  +V+  AY   +EALC G +VD+A     EM   G  P   T+   IRA C 
Sbjct  242  FDEMTERGCLVDVPAYNSYLEALCKGGKVDEAYKIFREMGSNGTDPDACTYSIFIRAYCE  301

Query  540  DGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGLLVPRK  361
               +     VL  M +R      V  YN +IK+L +  +  +A  +    ++ G++    
Sbjct  302  ANDIHSVFRVLDRM-KRYNLLPNVYSYNCIIKKLCKNDKVEEAYQLLDEMIESGVM----  356

Query  360  KPIQFSAKA-QAPHIANG*ILLLCEICHGSDLLRLCIHRVK  241
             P  +S  A QA H         C+ C  +  LRL ++R+K
Sbjct  357  -PDAWSYNAIQAYH---------CDHCEVNRALRL-LYRMK  386



>ref|XP_006465352.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52640, 
mitochondrial-like [Citrus sinensis]
Length=531

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 59/121 (49%), Gaps = 1/121 (1%)
 Frame = -2

Query  741  LRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  562
            L +A + FD M ERK  V+  A+  ++EA+C    +D+A   L EM  IG  P  F++  
Sbjct  241  LSEARKLFDEMLERKCPVDILAHNSLLEAMCKAGNIDEAHGMLREMRSIGAEPDAFSYSI  300

Query  561  VIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKR  382
             I A C    +     VL  M +R      V  YN +IK+L +  +  +A  +    ++R
Sbjct  301  FIHAFCEANDIHSVFRVLDSM-KRYNLVPNVFTYNCIIKKLCKNEKVEEAYQLLDEMIER  359

Query  381  G  379
            G
Sbjct  360  G  360



>ref|XP_006480134.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710-like 
[Citrus sinensis]
Length=766

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/111 (30%), Positives = 57/111 (51%), Gaps = 1/111 (1%)
 Frame = -2

Query  741  LRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  562
            L  A++    M E+ ++ +   Y  +I  LC  + + +A     EM+  G SP  FT+  
Sbjct  480  LDKAFDTKREMVEKGVLPDTITYSSLIHGLCEQRRITEACELFQEMLSRGMSPDEFTYTT  539

Query  561  VIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDAR  409
            +I A C +G +  AL +   M ++  F   V  Y++LI  LN+Q R ++A+
Sbjct  540  LINAYCTEGDIPQALRLHDEMIQKG-FLPDVVTYSVLINGLNKQARTMEAK  589



>gb|KCW90149.1| hypothetical protein EUGRSUZ_A02340 [Eucalyptus grandis]
Length=703

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 42/138 (30%), Positives = 59/138 (43%), Gaps = 16/138 (12%)
 Frame = -2

Query  741  LRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  562
            ++DA + FD M  R I    R Y +VI  LC  K  D A      M   G SP   T+  
Sbjct  200  IKDALKMFDEMTLRGISPNERTYTIVIAGLCQAKSTDYAYKLFESMRESGCSPDTVTYNV  259

Query  561  VIRALCADGKVDGALSVLSLMHRRS------RFWV----------GVPPYNILIKELNRQ  430
            ++   C  GK+D AL VL    + +        W            V  Y I+I+ L++ 
Sbjct  260  LLDGFCKAGKIDEALLVLPTFEKEAGRYDEVDVWYRRIVKEEVTPDVTLYAIMIRGLSKA  319

Query  429  GRALDARNVYAAALKRGL  376
            GR  DA ++     +RGL
Sbjct  320  GRMEDAMSMLEEMTQRGL  337



>gb|KCW88273.1| hypothetical protein EUGRSUZ_A00652 [Eucalyptus grandis]
Length=447

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/129 (28%), Positives = 64/129 (50%), Gaps = 1/129 (1%)
 Frame = -2

Query  750  EWVLRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFT  571
            E  +  A + F  M++  +      Y ++I +LC  +E  KA   L  MV+IG SP   T
Sbjct  292  EGKMDKAEKLFGEMKDNSLKPNVVTYNILIGSLCKKRESRKAHRLLDRMVKIGLSPNHVT  351

Query  570  FCNVIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAA  391
            +  ++   C +G +  A+ V  LM +       +  +N+LIK   +QG+  +A ++    
Sbjct  352  YDTLMDGYCTEGNLRAAVKVRELMQKEG-LRANIATFNVLIKGFCKQGKLENANSLLNEM  410

Query  390  LKRGLLVPR  364
            L+RG++  R
Sbjct  411  LERGMVPNR  419



>gb|KDO49128.1| hypothetical protein CISIN_1g004231mg [Citrus sinensis]
 gb|KDO49129.1| hypothetical protein CISIN_1g004231mg [Citrus sinensis]
Length=766

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/111 (30%), Positives = 57/111 (51%), Gaps = 1/111 (1%)
 Frame = -2

Query  741  LRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  562
            L  A++    M E+ ++ +   Y  +I  LC  + + +A     EM+  G SP  FT+  
Sbjct  480  LDKAFDTKREMVEKGVLPDTITYSSLIHGLCEQRRITEACELFQEMLSRGMSPDEFTYTT  539

Query  561  VIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDAR  409
            +I A C +G +  AL +   M ++  F   V  Y++LI  LN+Q R ++A+
Sbjct  540  LINAYCTEGDIPQALRLHDEMIQKG-FLPDVVTYSVLINGLNKQARTMEAK  589



>ref|XP_010530350.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like 
[Tarenaya hassleriana]
Length=636

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 63/116 (54%), Gaps = 2/116 (2%)
 Frame = -2

Query  714  RMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRALCADG  535
            +M ER I V  R Y ++I+ LC G  +D AL+   +M   G +P   T+  +I  LC   
Sbjct  251  KMEERNIEVNVRIYSMIIDGLCKGGHIDDALSLFDKMDSKGIAPNVVTYSCLINGLCVFD  310

Query  534  KVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGLLVP  367
            + + A+ +L+ M +R +    V  +N LI    ++G+ L+A+ +    ++RG LVP
Sbjct  311  RWNDAVRLLNDMAKR-KITPDVVTFNGLIDAFVKEGKFLEAKELCEEMIRRG-LVP  364



>ref|XP_010921699.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52640, 
mitochondrial [Elaeis guineensis]
Length=531

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 59/121 (49%), Gaps = 2/121 (2%)
 Frame = -2

Query  738  RDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVR-IGYSPGRFTFCN  562
            + A + FD M +R  VV+  AY  +I A C G E+D+A   L EM R  G  P   T+  
Sbjct  249  KKALDLFDEMLQRGCVVDAVAYNTLIMAFCRGGEIDEAHRRLQEMQRDHGLKPDAATYSA  308

Query  561  VIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKR  382
             IRA C    V  A+ VL  M RR      V  YN +IK L  + + ++A  +    L R
Sbjct  309  FIRASCEAKDVHSAMRVLDTMKRRD-LSPNVFTYNAIIKLLCEEEKIVEAYELLDEMLYR  367

Query  381  G  379
            G
Sbjct  368  G  368



>gb|KEH26904.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula]
Length=389

 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 38/123 (31%), Positives = 64/123 (52%), Gaps = 9/123 (7%)
 Frame = -2

Query  735  DAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVI  556
            +A   F+ M  RKI+ +   Y  +I+ LC   ++  AL  + EM   G  P   T+ +++
Sbjct  200  EAMNLFEEMHCRKIIPDVVTYNSLIDGLCKSGKISYALKLVDEMHDRGVPPDIITYSSIL  259

Query  555  RALCADGKVDGALSVLSLMHRRSRFWVGVPP----YNILIKELNRQGRALDARNVYAAAL  388
             ALC + +VD A+++L+ +  +     G+ P    Y ILI  L + GR  DA N++   L
Sbjct  260  DALCKNHQVDKAIALLTNLKDQ-----GIRPNMYTYTILIDGLCKGGRLEDAHNIFEDLL  314

Query  387  KRG  379
             +G
Sbjct  315  VKG  317


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 51/100 (51%), Gaps = 1/100 (1%)
 Frame = -2

Query  675  YELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRALCADGKVDGALSVLSLMH  496
            Y  +I+ +C  K V+ A     EMV    SP  FT+  +I   C  GK+  A+ + + M 
Sbjct  45   YNTIIDGMCKDKHVNDAFDLYSEMVSKRISPDVFTYNALISGFCIVGKLKDAIGLFNKMT  104

Query  495  RRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGL  376
              +     +  +NIL+    ++G+  +A+NV A  +K+G+
Sbjct  105  LEN-INPDMYTFNILVDAFCKEGKMKEAKNVLAMMMKQGM  143



>ref|XP_003619805.1| Pentatricopeptide repeat-containing protein [Medicago truncatula]
 gb|AES76023.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula]
Length=548

 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 66/126 (52%), Gaps = 9/126 (7%)
 Frame = -2

Query  744  VLRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFC  565
            ++ +A   F+ MR RKI+     Y  +I+ LC    +  AL  + EM   G  P   T+ 
Sbjct  356  MVDEAINLFEEMRCRKIIPNVVTYSSLIDGLCKLGRIFYALKLVDEMHDRGQPPNIVTYS  415

Query  564  NVIRALCADGKVDGALSVLSLMHRRSRFWVGVPP----YNILIKELNRQGRALDARNVYA  397
            +++ ALC +  VD A+++L+ +  +     G+ P    Y ILIK L + GR  DA+NV+ 
Sbjct  416  SILDALCKNHHVDKAIALLTNLKDQ-----GIRPDMYTYTILIKGLCQSGRLEDAQNVFE  470

Query  396  AALKRG  379
              L +G
Sbjct  471  DLLVKG  476



>gb|EEC67240.1| hypothetical protein OsI_34171 [Oryza sativa Indica Group]
Length=458

 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 56/119 (47%), Gaps = 1/119 (1%)
 Frame = -2

Query  732  AYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  553
            AY  +  M  R+I      Y  +I ALC  + +DKA+  L  MV+ G  P   T+ +++ 
Sbjct  223  AYSTYHEMLGRRISPNVVTYSSIIAALCKAQAMDKAMEVLNTMVKNGVMPDCMTYSSILH  282

Query  552  ALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGL  376
              C+ G+    +  L+ M R       V  Y  L+  L + GR   AR ++ +  KRGL
Sbjct  283  GYCSSGQPKEDIGTLNKM-RSDGVEPNVVTYRSLMNYLCKNGRCTKARKIFDSMTKRGL  340



>ref|XP_004144813.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09820-like 
[Cucumis sativus]
 ref|XP_004169491.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09820-like 
[Cucumis sativus]
Length=611

 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 59/119 (50%), Gaps = 1/119 (1%)
 Frame = -2

Query  720  FDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRALCA  541
             + M+ R +  +   Y ++I A C  KE  KA   + EM+  G  P   T+  ++   C 
Sbjct  466  LNEMQCRGVKADTVTYNILISAWCEKKEPKKAARLIDEMLDKGLKPSHLTYNILLNGYCM  525

Query  540  DGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGLLVPR  364
            +G +  AL++   M +  R W  V  YN+LI+   R+G+  DA  +    L++GL+  R
Sbjct  526  EGNLRAALNLRKQMEKEGR-WANVVTYNVLIQGYCRKGKLEDANGLLNEMLEKGLIPNR  583



>emb|CBI36294.3| unnamed protein product [Vitis vinifera]
Length=517

 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 49/155 (32%), Positives = 71/155 (46%), Gaps = 16/155 (10%)
 Frame = -2

Query  720  FDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRALCA  541
            F+ MRER   V+  AY  ++EALC G  VD+A     EM   G +P   ++   IRA C 
Sbjct  215  FEEMRERGCAVDVVAYNSLLEALCKGGNVDEAYKLFREMGSNGLAPDACSYSIFIRAYCE  274

Query  540  DGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGLLVPRK  361
               +  A  VL  M RR      V  YN ++K+L +  +  +A  +    ++RG+     
Sbjct  275  VNDIHSAFQVLDRM-RRYNLVPNVFTYNCIVKKLCKSEKVDEAYQLLDEMIERGV-----  328

Query  360  KPIQFSAKA-QAPHIANG*ILLLCEICHGSDLLRL  259
             P  +S  A QA H         C+ C  +  LRL
Sbjct  329  SPDLWSYNAIQAFH---------CDHCEVNKALRL  354


 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 66/126 (52%), Gaps = 9/126 (7%)
 Frame = -2

Query  741  LRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  562
            +  A++  DRMR   +V     Y  +++ LC  ++VD+A   L EM+  G SP  +++ N
Sbjct  278  IHSAFQVLDRMRRYNLVPNVFTYNCIVKKLCKSEKVDEAYQLLDEMIERGVSPDLWSY-N  336

Query  561  VIRAL-CADGKVDGALSVLSLMHRRSRFWVGVP---PYNILIKELNRQGRALDARNVYAA  394
             I+A  C   +V+ AL ++S M + +     +P    YN+++K L R GR     +V+  
Sbjct  337  AIQAFHCDHCEVNKALRLISRMEKEN----CMPDRHTYNMVLKMLLRVGRFDRVTDVWGG  392

Query  393  ALKRGL  376
              +RG 
Sbjct  393  MEERGF  398



>ref|XP_010530355.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like 
[Tarenaya hassleriana]
Length=636

 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 64/116 (55%), Gaps = 2/116 (2%)
 Frame = -2

Query  714  RMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRALCADG  535
            +M E+ I V+ + Y ++I+ LC    +D AL     M   G +P   T+  +I+ LC   
Sbjct  251  KMEEKNIEVDVKIYSMIIDGLCKDGHIDDALNLFEMMDSKGIAPDVVTYSCLIKGLCVFD  310

Query  534  KVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGLLVP  367
            + + A+ +L+ M +R + +  V  +NILI    ++G+ L+A+ +    ++RG LVP
Sbjct  311  RWNDAVRLLNDMAKR-KIFPNVVTFNILIDAFVKEGKFLEAKELCEEMIRRG-LVP  364



>ref|XP_003551657.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62910-like 
isoform X1 [Glycine max]
 ref|XP_006602774.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62910-like 
isoform X2 [Glycine max]
 ref|XP_006602775.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62910-like 
isoform X3 [Glycine max]
Length=525

 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 59/121 (49%), Gaps = 0/121 (0%)
 Frame = -2

Query  738  RDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNV  559
            RDA E   +M +  +      Y +V++ LC    V +A     EMV  G     FT+ ++
Sbjct  178  RDAIELLRKMEKGGVRPNLIMYNMVVDGLCKEGLVTEACGLCSEMVGKGICIDVFTYNSL  237

Query  558  IRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRG  379
            I   C  G+  GA+ +L+ M  +      V  +NIL+  L + G   +ARNV+   +KRG
Sbjct  238  IHGFCGAGQFQGAVRLLNEMVMKEDVRPDVYTFNILVDALCKLGMVAEARNVFGLMIKRG  297

Query  378  L  376
            L
Sbjct  298  L  298



>ref|XP_010040584.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09820 
[Eucalyptus grandis]
 ref|XP_010040641.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09820 
[Eucalyptus grandis]
 ref|XP_010040692.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09820 
[Eucalyptus grandis]
 ref|XP_010040755.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09820 
[Eucalyptus grandis]
Length=626

 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/129 (28%), Positives = 64/129 (50%), Gaps = 1/129 (1%)
 Frame = -2

Query  750  EWVLRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFT  571
            E  +  A + F  M++  +      Y ++I +LC  +E  KA   L  MV+IG SP   T
Sbjct  471  EGKMDKAEKLFGEMKDNSLKPNVVTYNILIGSLCKKRESRKAHRLLDRMVKIGLSPNHVT  530

Query  570  FCNVIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAA  391
            +  ++   C +G +  A+ V  LM +       +  +N+LIK   +QG+  +A ++    
Sbjct  531  YDTLMDGYCTEGNLRAAVKVRELMQKEG-LRANIATFNVLIKGFCKQGKLENANSLLNEM  589

Query  390  LKRGLLVPR  364
            L+RG++  R
Sbjct  590  LERGMVPNR  598



>ref|XP_010431726.1| PREDICTED: pentatricopeptide repeat-containing protein At1g64100-like 
[Camelina sativa]
Length=630

 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/126 (28%), Positives = 63/126 (50%), Gaps = 7/126 (6%)
 Frame = -2

Query  741  LRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  562
            + +A   FD M E ++      +  ++  LC+   V +A+A L  M+ IG+ P   T+  
Sbjct  167  VSEAVALFDHMVETRLTPNVVTFTTLMNGLCHDGRVLEAVALLGRMLAIGHEPNAVTYRT  226

Query  561  VIRALCADGKVDGALSVLSLM---HRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAA  391
            ++  +C  G  D AL++L  M   H ++ F +    YN +I  L + G   DA+N++   
Sbjct  227  IVNGMCKMGDTDSALNLLRKMDDSHIKANFLL----YNPIIDRLCKDGHHSDAQNLFTEM  282

Query  390  LKRGLL  373
            L++G  
Sbjct  283  LEKGFF  288



>ref|XP_006857320.1| hypothetical protein AMTR_s00067p00076830 [Amborella trichopoda]
 gb|ERN18787.1| hypothetical protein AMTR_s00067p00076830 [Amborella trichopoda]
Length=602

 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 40/122 (33%), Positives = 59/122 (48%), Gaps = 11/122 (9%)
 Frame = -2

Query  732  AYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  553
            A +  DR+ E         Y ++IEA CN   +D+A+  L EM+     P  FT+  +IR
Sbjct  188  AMKFLDRLLENNCSPTVVTYTILIEATCNIGGIDEAMKLLDEMLARNLHPDMFTYNVIIR  247

Query  552  ALCADGKVDGALSVLSLMHRRSRFWVGVPP----YNILIKELNRQGRALDARNVYAAALK  385
             +C +GK+D AL +        R  V   P    YNIL++ L  Q R  DA N+ +  + 
Sbjct  248  GMCKEGKLDVALELF-------RTKVNCEPDTISYNILLRALLSQQRWGDAENILSEMIS  300

Query  384  RG  379
             G
Sbjct  301  NG  302



>ref|XP_002313262.2| hypothetical protein POPTR_0009s07380g [Populus trichocarpa]
 gb|EEE87217.2| hypothetical protein POPTR_0009s07380g [Populus trichocarpa]
Length=648

 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 63/119 (53%), Gaps = 1/119 (1%)
 Frame = -2

Query  732  AYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  553
            A + F+RM+   I+ +  +Y  +I  LC  K ++KA+  LVEM      P  FT+C ++ 
Sbjct  83   ALDLFNRMKRINILPDIVSYNTIINGLCKEKRLEKAVDLLVEMEGSNCEPNSFTYCILMD  142

Query  552  ALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGL  376
             LC +G+V+ A+ +L  M R+    V V  Y+ LI     +G     + ++   L++G+
Sbjct  143  GLCKEGRVEEAMRLLGEMKRKG-LEVDVVVYSTLISGFCSKGCLDRGKALFDEMLEKGI  200


 Score = 53.9 bits (128),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 35/114 (31%), Positives = 51/114 (45%), Gaps = 1/114 (1%)
 Frame = -2

Query  720  FDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRALCA  541
            FD M E+ I      Y  +I   C      +A A L  M   G  P  +T+  +I  LC 
Sbjct  192  FDEMLEKGISPNVVVYSCLINGFCKKGLWREATAVLHTMTERGIQPDVYTYTCMIGGLCK  251

Query  540  DGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRG  379
            DG+   AL +  LM  +      V  YN+LI  L ++G   DA  ++   L++G
Sbjct  252  DGRARKALDLFDLMTEKGEEPSTV-TYNVLINGLCKEGCIGDAFKIFETMLEKG  304


 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 64/130 (49%), Gaps = 4/130 (3%)
 Frame = -2

Query  750  EWVLRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIG--YSPGR  577
            E  + DA++ F+ M E+   +E  +Y  +I  LCN  ++D+A+     ++  G    P  
Sbjct  287  EGCIGDAFKIFETMLEKGKRLEVVSYNTLIMGLCNNGKLDEAMKLFSSLLEDGNYVEPDV  346

Query  576  FTFCNVIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYA  397
             TF  VI+ LC +G++D A+ +   M  R  F   +   +ILI E  + G    A  ++ 
Sbjct  347  ITFNTVIQGLCKEGRLDKAVEIYDTMIERGSFG-NLFTCHILIGEYIKSGIIDKAMELWK  405

Query  396  AALKRGLLVP  367
               K G LVP
Sbjct  406  RVHKLG-LVP  414



>ref|XP_010654769.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52640, 
mitochondrial [Vitis vinifera]
 ref|XP_010654770.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52640, 
mitochondrial [Vitis vinifera]
Length=544

 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 49/155 (32%), Positives = 71/155 (46%), Gaps = 16/155 (10%)
 Frame = -2

Query  720  FDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRALCA  541
            F+ MRER   V+  AY  ++EALC G  VD+A     EM   G +P   ++   IRA C 
Sbjct  242  FEEMRERGCAVDVVAYNSLLEALCKGGNVDEAYKLFREMGSNGLAPDACSYSIFIRAYCE  301

Query  540  DGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGLLVPRK  361
               +  A  VL  M RR      V  YN ++K+L +  +  +A  +    ++RG+     
Sbjct  302  VNDIHSAFQVLDRM-RRYNLVPNVFTYNCIVKKLCKSEKVDEAYQLLDEMIERGV-----  355

Query  360  KPIQFSAKA-QAPHIANG*ILLLCEICHGSDLLRL  259
             P  +S  A QA H         C+ C  +  LRL
Sbjct  356  SPDLWSYNAIQAFH---------CDHCEVNKALRL  381


 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 66/126 (52%), Gaps = 9/126 (7%)
 Frame = -2

Query  741  LRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  562
            +  A++  DRMR   +V     Y  +++ LC  ++VD+A   L EM+  G SP  +++ N
Sbjct  305  IHSAFQVLDRMRRYNLVPNVFTYNCIVKKLCKSEKVDEAYQLLDEMIERGVSPDLWSY-N  363

Query  561  VIRAL-CADGKVDGALSVLSLMHRRSRFWVGVP---PYNILIKELNRQGRALDARNVYAA  394
             I+A  C   +V+ AL ++S M + +     +P    YN+++K L R GR     +V+  
Sbjct  364  AIQAFHCDHCEVNKALRLISRMEKEN----CMPDRHTYNMVLKMLLRVGRFDRVTDVWGG  419

Query  393  ALKRGL  376
              +RG 
Sbjct  420  MEERGF  425



>ref|XP_010936288.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At1g74900, mitochondrial [Elaeis guineensis]
Length=517

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 56/118 (47%), Gaps = 1/118 (1%)
 Frame = -2

Query  720  FDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRALCA  541
            FD M ++  +     Y  +I+ +C    V  A+    EMVR GY+P   T+  VIR LC 
Sbjct  323  FDEMVDQGCLPSVPTYNALIQVICKKGSVKDAILVFDEMVRKGYTPNAVTYNLVIRGLCH  382

Query  540  DGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGLLVP  367
             G++D A+  L  M +R      V  YNILI+    +G       ++   L RG  +P
Sbjct  383  AGEMDQAMEFLERM-KREECEPNVQTYNILIRYWCEEGEIEKGLQLFGTMLGRGGCLP  439



>ref|XP_002889775.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH66034.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
Length=598

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 63/122 (52%), Gaps = 1/122 (1%)
 Frame = -2

Query  741  LRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  562
            L+ A E  DRM +R    +   Y ++IEA C    V +A+  L EM   G +P   T+  
Sbjct  220  LKQAMEVLDRMLQRDCYPDVITYTILIEATCRDSGVGQAMKLLDEMRDRGCTPDVVTYNV  279

Query  561  VIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKR  382
            ++  +C +G++D A+  L+ M   S     V  +NI+++ +   GR +DA  + A  L++
Sbjct  280  LVNGICKEGRLDEAIKFLNDMP-SSGCQPNVITHNIILRSMCSTGRWMDAEKLLADMLRK  338

Query  381  GL  376
            G 
Sbjct  339  GF  340



>ref|XP_004492420.1| PREDICTED: pentatricopeptide repeat-containing protein At4g28010-like 
[Cicer arietinum]
Length=721

 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 62/120 (52%), Gaps = 1/120 (1%)
 Frame = -2

Query  735  DAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVI  556
            DA +  D M ++     +  Y ++I  LC    VD A   L  M + G  P   T+  ++
Sbjct  330  DAIKVLDLMVQKGEEPNNITYNVIINGLCKEGRVDDAFKILETMAKKGKKPDVVTYNTLL  389

Query  555  RALCADGKVDGALSVLS-LMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRG  379
            + LC  GK+D A+ +L+ L+ +       V  +N++I+ L ++ R  DAR VY+  +++G
Sbjct  390  KGLCGVGKIDEAMDLLNLLLSKEFHMKPDVFAFNLVIQGLCKELRLHDARKVYSTMVEKG  449



>ref|XP_008378619.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like 
[Malus domestica]
Length=613

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 62/121 (51%), Gaps = 1/121 (1%)
 Frame = -2

Query  741  LRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  562
            L+ A E  DR  +R+   +   Y ++IEA C    V++A+  L EM   G  P   T+  
Sbjct  235  LKQAMEVLDRQMQRQCYPDVITYTILIEATCKESGVEQAMKLLDEMRSKGCKPDVVTYNV  294

Query  561  VIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKR  382
            +I  +C +G++D A+  L+ M   S     V  +NI+++ +   GR +DA  + A  + R
Sbjct  295  LINGICKEGRLDEAIKFLNDMPS-SDCQPNVITHNIILRSMCSTGRWMDAEKLLAEMVHR  353

Query  381  G  379
            G
Sbjct  354  G  354



>ref|XP_009596549.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Nicotiana tomentosiformis]
 ref|XP_009596550.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Nicotiana tomentosiformis]
 ref|XP_009596551.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Nicotiana tomentosiformis]
 ref|XP_009596552.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Nicotiana tomentosiformis]
 ref|XP_009596553.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Nicotiana tomentosiformis]
Length=777

 Score = 60.8 bits (146),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 31/104 (30%), Positives = 57/104 (55%), Gaps = 1/104 (1%)
 Frame = -2

Query  714  RMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRALCADG  535
            +M E+ +  +   Y  +I+ LC  + + +A     EM+R+G  P +FT+  +I A C +G
Sbjct  497  QMVEKGVSPDVITYSSLIQGLCEQQSLTEARELFQEMLRVGIQPDKFTYTTLIGAYCVEG  556

Query  534  KVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNV  403
             + GAL++   M  +  F+     Y++LI  LN+Q R  +A+ +
Sbjct  557  DIKGALNLHDEMINKG-FFPDAVTYSVLINGLNKQARTREAKRL  599


 Score = 58.9 bits (141),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 39/120 (33%), Positives = 57/120 (48%), Gaps = 1/120 (1%)
 Frame = -2

Query  732  AYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  553
            A E +D M +  +      Y ++I  LC   +++K LA   EM + G  P   T+  +I 
Sbjct  211  AQEFYDDMVKSGVSPNVYTYNIMIRGLCGKGDLEKGLAFFKEMEKCGCLPSVVTYNTIIG  270

Query  552  ALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGLL  373
            A C  GKVD A+ +L LM  R+     V  YN +I  L R+GR  +   V       GL+
Sbjct  271  AYCKIGKVDEAVKLLKLMQVRN-LEPSVVTYNAIINGLCREGRMKETSEVLEDMRGTGLV  329



>ref|XP_010530351.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like 
[Tarenaya hassleriana]
 ref|XP_010530352.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like 
[Tarenaya hassleriana]
 ref|XP_010530353.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like 
[Tarenaya hassleriana]
 ref|XP_010530354.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like 
[Tarenaya hassleriana]
Length=687

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 64/116 (55%), Gaps = 2/116 (2%)
 Frame = -2

Query  714  RMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRALCADG  535
            +M E+ I V+ + Y ++I+ LC    +D AL     M   G +P   T+  +I+ LC   
Sbjct  302  KMEEKNIEVDVKIYSMIIDGLCKDGHIDDALNLFEMMDSKGIAPDVVTYSCLIKGLCVFD  361

Query  534  KVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGLLVP  367
            + + A+ +L+ M +R + +  V  +NILI    ++G+ L+A+ +    ++RG LVP
Sbjct  362  RWNDAVRLLNDMAKR-KIFPNVVTFNILIDAFVKEGKFLEAKELCEEMIRRG-LVP  415



>gb|KDO66019.1| hypothetical protein CISIN_1g048778mg [Citrus sinensis]
Length=902

 Score = 60.8 bits (146),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 42/120 (35%), Positives = 60/120 (50%), Gaps = 1/120 (1%)
 Frame = -2

Query  741  LRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  562
            L +A+   D M E+      R Y ++I+ALC+    DKAL+   EMV     P   T+  
Sbjct  284  LDEAFSLKDEMCEKGWQPSTRTYTVLIKALCDISLTDKALSLFDEMVVKRCKPNAHTYTV  343

Query  561  VIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKR  382
            +I  LC +GK+D A  +   M +   F  GV  YN+LI    +QGR + A  + A   KR
Sbjct  344  LIDRLCREGKIDEANGMCGKMLQDGHF-PGVVTYNVLINGYCKQGRIIAAFELLALMEKR  402



>ref|XP_006443536.1| hypothetical protein CICLE_v10018778mg [Citrus clementina]
 ref|XP_006479201.1| PREDICTED: pentatricopeptide repeat-containing protein At3g07290, 
mitochondrial-like isoform X1 [Citrus sinensis]
 gb|ESR56776.1| hypothetical protein CICLE_v10018778mg [Citrus clementina]
Length=902

 Score = 60.8 bits (146),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 42/120 (35%), Positives = 60/120 (50%), Gaps = 1/120 (1%)
 Frame = -2

Query  741  LRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  562
            L +A+   D M E+      R Y ++I+ALC+    DKAL+   EMV     P   T+  
Sbjct  284  LDEAFSLKDEMCEKGWQPSTRTYTVLIKALCDISLTDKALSLFDEMVVKRCKPNAHTYTV  343

Query  561  VIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKR  382
            +I  LC +GK+D A  +   M +   F  GV  YN+LI    +QGR + A  + A   KR
Sbjct  344  LIDRLCREGKIDEANGMCGKMLQDGHF-PGVVTYNVLINGYCKQGRIIAAFELLALMEKR  402



>ref|XP_007141297.1| hypothetical protein PHAVU_008G184000g [Phaseolus vulgaris]
 gb|ESW13291.1| hypothetical protein PHAVU_008G184000g [Phaseolus vulgaris]
Length=622

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 39/123 (32%), Positives = 60/123 (49%), Gaps = 1/123 (1%)
 Frame = -2

Query  744  VLRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFC  565
            +L  A    + M +       R+Y  +IE  CN K VD+A+  L  MV  G  P   T+ 
Sbjct  335  LLGKALNVLEMMPKHGCTPNSRSYNPLIEGFCNEKSVDRAIEYLEIMVSRGCYPDIVTYN  394

Query  564  NVIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALK  385
             ++ ALC DGKVD A+ +L+ +     F   +  YNI+I  L   G+   A  ++    +
Sbjct  395  ILLTALCKDGKVDDAVEILNQLSFEG-FLSSLITYNIVIDRLLTVGKTEPAVELFEEMSR  453

Query  384  RGL  376
            +GL
Sbjct  454  KGL  456



>ref|XP_010908081.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09820 
[Elaeis guineensis]
 ref|XP_010908082.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09820 
[Elaeis guineensis]
Length=447

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 62/130 (48%), Gaps = 1/130 (1%)
 Frame = -2

Query  753  NEWVLRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRF  574
            N   +  A +  D M E  +  +   Y ++I ALC  ++  KA+  L EM  I   P   
Sbjct  291  NNGDMNSATKLLDEMEENGVKADLITYNVLISALCREQKTAKAVKLLDEMQEISLQPSHV  350

Query  573  TFCNVIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAA  394
            T+  +I  LC  G +  AL++ + M +  +    V  YNILIK  +  G+  +A  +   
Sbjct  351  TYNTLIDGLCKKGNLRAALNIRARMEKGGK-HANVVTYNILIKYFSGGGKMDEANELLNE  409

Query  393  ALKRGLLVPR  364
             L++GL+  R
Sbjct  410  MLEKGLVPNR  419



>ref|XP_008360647.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At1g52640, mitochondrial-like [Malus domestica]
Length=463

 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 38/116 (33%), Positives = 56/116 (48%), Gaps = 1/116 (1%)
 Frame = -2

Query  720  FDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRALCA  541
            FD M ER  +V+  AY+  +EALC G +VD+A     EM   G  P   T+   IR  C 
Sbjct  180  FDEMTERGCLVDVPAYDSYLEALCKGGKVDEAYKIFQEMGSNGVEPDACTYSIFIRTYCE  239

Query  540  DGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGLL  373
               +     VL  M RR      V  YN +IK+L +  +  +A  +    ++RG++
Sbjct  240  VDDIHSVFRVLDRM-RRYNILPNVYTYNCVIKKLCKNEKVEEAYQLLDEMIERGVM  294


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/125 (30%), Positives = 62/125 (50%), Gaps = 7/125 (6%)
 Frame = -2

Query  741  LRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  562
            +   +   DRMR   I+     Y  VI+ LC  ++V++A   L EM+  G  P  +++  
Sbjct  243  IHSVFRVLDRMRRYNILPNVYTYNCVIKKLCKNEKVEEAYQLLDEMIERGVMPDTWSYNA  302

Query  561  VIRALCADGKVDGALSVLSLMHRRSRFWVGVP---PYNILIKELNRQGRALDARNVYAAA  391
            +    C   +V+G+L +LS M + +     +P    YN+++K L R GR   A  V+ + 
Sbjct  303  IXAYHCDHCEVNGSLRLLSRMEKDN----CMPDRHTYNMVLKLLIRIGRFDRATEVWDSI  358

Query  390  LKRGL  376
             KRG 
Sbjct  359  RKRGF  363



>ref|XP_007137661.1| hypothetical protein PHAVU_009G145100g [Phaseolus vulgaris]
 gb|ESW09655.1| hypothetical protein PHAVU_009G145100g [Phaseolus vulgaris]
Length=600

 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 63/121 (52%), Gaps = 1/121 (1%)
 Frame = -2

Query  741  LRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  562
            L++A E  DR  +R+   +   Y ++IEA CN   V +A+  L EM   G  P   T+  
Sbjct  222  LKEAMEVLDRQLQRECYPDVITYTILIEATCNESGVGQAMKLLDEMRNKGCKPDVVTYNV  281

Query  561  VIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKR  382
            +I  +C +G++D A+  L+ M         V  +NI+++ +   GR +DA  + A  L++
Sbjct  282  LINGICKEGRLDEAIKFLNSMPSYG-CQPNVITHNIILRSMCSTGRWMDAERLLADMLRK  340

Query  381  G  379
            G
Sbjct  341  G  341


 Score = 53.5 bits (127),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 34/119 (29%), Positives = 59/119 (50%), Gaps = 1/119 (1%)
 Frame = -2

Query  732  AYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  553
            A +  ++M +   V    +Y  ++   C  K++D+A+  L  MV  G  P   T+  ++ 
Sbjct  365  AIDVLEKMPKHGCVPNSLSYNPLLHGFCQEKKMDRAIEYLEIMVSRGCYPDIVTYNTLLT  424

Query  552  ALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGL  376
            ALC DGKVD A+ +L+ +  +    V V  YN +I  L + G+   A  +     ++GL
Sbjct  425  ALCKDGKVDAAIEILNQLSSKGCSPVLV-TYNTVIDGLAKVGKTESAVELLEEMRRKGL  482



>gb|KDO45230.1| hypothetical protein CISIN_1g018782mg [Citrus sinensis]
Length=350

 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 59/121 (49%), Gaps = 1/121 (1%)
 Frame = -2

Query  741  LRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  562
            L +A + FD M ERK  V+  A+  ++EA+C    +D+A   L EM  IG  P  F++  
Sbjct  60   LSEARKLFDEMLERKCPVDILAHNSLLEAMCKAGNIDEAHGMLREMRSIGAEPDAFSYSI  119

Query  561  VIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKR  382
             I A C    +     VL  M +R      V  YN +I++L +  +  +A  +    ++R
Sbjct  120  FIHAFCEANDIHSVFRVLDSM-KRYNLVPNVFTYNCIIRKLCKNEKVEEAYQLLDEMIER  178

Query  381  G  379
            G
Sbjct  179  G  179



>ref|XP_010428258.1| PREDICTED: pentatricopeptide repeat-containing protein At4g01400, 
mitochondrial [Camelina sativa]
Length=476

 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 68/138 (49%), Gaps = 13/138 (9%)
 Frame = -2

Query  756  MNEWVLRD----AYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGY  589
            M+ + L D    AY+ F +M ER +V +  +Y+++I+      +V+ A+  L +M+  G+
Sbjct  200  MHAFCLNDDLSIAYQLFGKMLERDVVPDVESYKILIQGFSRKGQVNGAMELLEDMLNKGF  259

Query  588  SPGRFTFCNVIRALCADGKVDGALSVLSLMHRRSRFWVGVPP----YNILIKELNRQGRA  421
             P R ++  ++ +LC   ++  A  +L  M  +     G  P    YN +I    R+GRA
Sbjct  260  VPDRLSYTTLLNSLCRKTQLREAYKLLCRMKLK-----GCNPDIVHYNTMILGFCREGRA  314

Query  420  LDARNVYAAALKRGLLVP  367
            +DAR V       G   P
Sbjct  315  MDARKVLDDMSGNGCCAP  332



>ref|NP_001136745.1| hypothetical protein [Zea mays]
 gb|ACF82524.1| unknown [Zea mays]
 tpg|DAA53111.1| TPA: hypothetical protein ZEAMMB73_920038 [Zea mays]
Length=421

 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 57/119 (48%), Gaps = 1/119 (1%)
 Frame = -2

Query  720  FDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRALCA  541
             D M+E+ +  +   Y ++I ALC   EV KA+  L EMV +G  P    +  +I   C 
Sbjct  271  LDEMKEKGVKADVVTYNVLIGALCCKGEVRKAVKLLDEMVEVGLEPKHVAYNTIINGFCE  330

Query  540  DGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGLLVPR  364
             G   GA  +   M +R +    V  YN+ +K   + G+  +A  V    L++GL+  R
Sbjct  331  KGDAQGAHEIRLRMEKRKK-RANVVTYNVFLKYFCKMGKMDEANVVLNEMLEKGLVPNR  388



>ref|XP_002515077.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF47061.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=262

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 34/114 (30%), Positives = 62/114 (54%), Gaps = 9/114 (8%)
 Frame = -2

Query  732  AYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  553
            AY+ F++M +R ++ +  +Y ++++ LC   +V+ A+  L +M+  G+ P   T+  ++ 
Sbjct  13   AYKLFNQMFKRDVLPDIESYRILMQGLCRRSQVNGAVGLLEDMLNKGFVPDCLTYTTLLN  72

Query  552  ALCADGKVDGALSVLSLMHRRSRFWVGVPP----YNILIKELNRQGRALDARNV  403
            +LC   K+  A  +L  M  +     G  P    YN +I    R+GRA+DAR V
Sbjct  73   SLCRKKKLREAYKLLCRMKVK-----GCNPDIVHYNTIISGFCREGRAMDARKV  121



>gb|KHN08231.1| Pentatricopeptide repeat-containing protein [Glycine soja]
Length=471

 Score = 60.1 bits (144),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 36/121 (30%), Positives = 64/121 (53%), Gaps = 1/121 (1%)
 Frame = -2

Query  741  LRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  562
            L++A E  DR  +R+   +   Y ++IEA CN   V +A+  L EM + G  P   T+  
Sbjct  93   LKEAMEVLDRQLQRECYPDVITYTILIEATCNDSGVGQAMKLLDEMRKKGCKPDVVTYNV  152

Query  561  VIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKR  382
            +I  +C +G++D A+  L+ M         V  +NI+++ +   GR +DA  + +  L++
Sbjct  153  LINGICKEGRLDEAIKFLNNMPSYG-CKPNVITHNIILRSMCSTGRWMDAERLLSDMLRK  211

Query  381  G  379
            G
Sbjct  212  G  212


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/119 (28%), Positives = 59/119 (50%), Gaps = 1/119 (1%)
 Frame = -2

Query  732  AYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  553
            A +  ++M +   V    +Y  ++   C  K++D+A+  L  MV  G  P   T+  ++ 
Sbjct  236  AIDVLEKMPKHGCVPNSLSYNPLLHGFCQEKKMDRAIEYLEIMVSRGCYPDIVTYNTLLT  295

Query  552  ALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGL  376
            ALC DGKVD A+ +L+ +  +    V +  YN +I  L + G+   A  +     ++GL
Sbjct  296  ALCKDGKVDAAVEILNQLSSKGCSPVLI-TYNTVIDGLTKVGKTEYAVELLEEMRRKGL  353



>ref|XP_011038920.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09820-like 
[Populus euphratica]
Length=731

 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 60/118 (51%), Gaps = 1/118 (1%)
 Frame = -2

Query  717  DRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRALCAD  538
            + M  +K+  +   Y ++I++LC   E  KA+  L EM   G +P   T+  ++   C +
Sbjct  581  NEMVSKKLSADVVTYNILIDSLCKKGESRKAVKLLDEMFEKGLNPSHVTYNTLMDGYCRE  640

Query  537  GKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGLLVPR  364
            G +  AL V + M R+ +    V  YN+LIK    +GR  DA  +    L+RGL+  R
Sbjct  641  GNLRAALIVRTRMERKGK-QANVVTYNVLIKGFCLKGRLEDANGLLNEMLERGLVPNR  697



>ref|XP_007157301.1| hypothetical protein PHAVU_002G058500g [Phaseolus vulgaris]
 ref|XP_007157302.1| hypothetical protein PHAVU_002G058500g [Phaseolus vulgaris]
 ref|XP_007157303.1| hypothetical protein PHAVU_002G058500g [Phaseolus vulgaris]
 gb|ESW29295.1| hypothetical protein PHAVU_002G058500g [Phaseolus vulgaris]
 gb|ESW29296.1| hypothetical protein PHAVU_002G058500g [Phaseolus vulgaris]
 gb|ESW29297.1| hypothetical protein PHAVU_002G058500g [Phaseolus vulgaris]
Length=583

 Score = 60.1 bits (144),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 33/101 (33%), Positives = 49/101 (49%), Gaps = 1/101 (1%)
 Frame = -2

Query  678  AYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRALCADGKVDGALSVLSLM  499
             Y ++I+  C   E  KA   L EM+ +G  P   T+  ++   C +G V  AL V + M
Sbjct  450  TYNILIDGCCKDNETSKAEKLLSEMLNVGVKPNHVTYNTLMDGYCMEGNVKAALKVRTQM  509

Query  498  HRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGL  376
             +  +    V  YN+LIK   R G+  DA  +    L+RGL
Sbjct  510  EKEGK-RANVVTYNVLIKGFCRTGKLEDANRLLNEMLERGL  549



>gb|AJG06104.1| restorer-of-fertility [Raphanus sativus]
Length=687

 Score = 60.1 bits (144),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 61/133 (46%), Gaps = 10/133 (8%)
 Frame = -2

Query  741  LRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  562
            + D  E    M E  +V +   Y  +I   C   +++ AL  L EM+  G  P   T   
Sbjct  411  IDDGMELLHEMTETGLVADTTTYNTLIHGFCLVGDLNAALDLLQEMISSGLCPDIVTCDT  470

Query  561  VIRALCADGKVDGALSVLSLMHRR------SRFWVGVPP----YNILIKELNRQGRALDA  412
            ++  LC +GK+  AL +  +M +       S  + GV P    YNILI  L  +G+ L+A
Sbjct  471  LLDGLCDNGKLKDALEMFKVMQKSKKDLDASHPFNGVEPDVQTYNILISGLINEGKFLEA  530

Query  411  RNVYAAALKRGLL  373
              +Y     RG++
Sbjct  531  EELYEEMPHRGIV  543


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/127 (27%), Positives = 54/127 (43%), Gaps = 1/127 (1%)
 Frame = -2

Query  756  MNEWVLRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGR  577
            +NE    +A E ++ M  R IV +   Y  +I+ LC    +D+A      M    +SP  
Sbjct  522  INEGKFLEAEELYEEMPHRGIVPDTITYSSMIDGLCKQSRLDEATQMFDSMGSKSFSPNV  581

Query  576  FTFCNVIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYA  397
             TF  +I   C  G+VD  L +   M RR      +  Y  LI    + G    A +++ 
Sbjct  582  VTFTTLINGYCKAGRVDDGLELFCEMGRRGIVANAI-TYITLICGFRKVGNINGALDIFQ  640

Query  396  AALKRGL  376
              +  G+
Sbjct  641  EMISSGV  647



>ref|XP_010530461.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g12700, mitochondrial [Tarenaya hassleriana]
Length=584

 Score = 60.1 bits (144),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 37/113 (33%), Positives = 57/113 (50%), Gaps = 1/113 (1%)
 Frame = -2

Query  765  GXGMNEWVLRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYS  586
            G  + EW L +A E +D+M    +V +   Y  +I+ LC  K +D+A      MV +GY 
Sbjct  287  GGFVKEWKLVEAKELYDQMIHMGLVPDTFMYTSLIDGLCIQKRLDEAKEIFESMVALGYP  346

Query  585  PGRFTFCNVIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQG  427
                TF  +I+  C DG++D  + +LS M RR      +  YN L++   R G
Sbjct  347  LTTVTFNALIKGYCKDGRMDEGMKLLSEMPRRG-VVADIYTYNSLVEGFFRAG  398



>ref|XP_007215907.1| hypothetical protein PRUPE_ppa004160mg [Prunus persica]
 gb|EMJ17106.1| hypothetical protein PRUPE_ppa004160mg [Prunus persica]
Length=526

 Score = 60.1 bits (144),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 48/155 (31%), Positives = 69/155 (45%), Gaps = 16/155 (10%)
 Frame = -2

Query  720  FDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRALCA  541
            FD M ER  +V+  AY   +EALC G +VD+A      M   G  P   T+   IRA C 
Sbjct  242  FDEMTERGCLVDVPAYNSYLEALCKGGKVDEAYKIFRGMGSNGTDPDACTYSIFIRAYCE  301

Query  540  DGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGLLVPRK  361
               +     VL  M +R      V  YN +IK+L +  +  +A  +    ++RG++    
Sbjct  302  ANDIHSVFRVLDRM-KRYNLLPNVYSYNCIIKKLCKNDKVEEAYELLDEMIERGVM----  356

Query  360  KPIQFSAKA-QAPHIANG*ILLLCEICHGSDLLRL  259
             P  +S  A QA H         C+ C  +  LRL
Sbjct  357  -PDAWSYNAIQAHH---------CDHCEVNRALRL  381



>ref|XP_006427239.1| hypothetical protein CICLE_v100269871mg, partial [Citrus clementina]
 gb|ESR40479.1| hypothetical protein CICLE_v100269871mg, partial [Citrus clementina]
Length=436

 Score = 60.1 bits (144),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 59/121 (49%), Gaps = 1/121 (1%)
 Frame = -2

Query  741  LRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  562
            L +A + FD M ERK  V+  A+  ++EA+C    +D+A   L EM  IG  P  F++  
Sbjct  146  LSEARKLFDEMLERKCPVDILAHNSLLEAMCKAGNIDEAHGMLREMRSIGAEPDAFSYSI  205

Query  561  VIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKR  382
             I A C    +     VL  M +R      V  YN +I++L +  +  +A  +    ++R
Sbjct  206  FIHAFCEANDIHSVFRVLDSM-KRYNLVPNVFTYNCIIRKLCKNEKVEEAYQLLDEMIER  264

Query  381  G  379
            G
Sbjct  265  G  265



>gb|AES89466.2| PPR containing plant-like protein [Medicago truncatula]
Length=889

 Score = 60.1 bits (144),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 35/122 (29%), Positives = 61/122 (50%), Gaps = 1/122 (1%)
 Frame = -2

Query  741  LRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  562
            + +A + FD M ERKI      Y ++IE  C    +DKA   L +M+  G  P  +T+  
Sbjct  514  MAEASKLFDEMVERKIKPTEVTYNVMIEGYCKAHNMDKAFELLEDMLHNGLVPDTYTYRP  573

Query  561  VIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKR  382
            +I  LC+ G+V  A   +  +H+++   +    Y+ L+     QGR  +A +     ++R
Sbjct  574  LISGLCSTGRVSAAKDFIDDLHKKN-LKLNEMCYSALLHGYCGQGRLTEALSASCEMIQR  632

Query  381  GL  376
            G+
Sbjct  633  GI  634



>ref|XP_010494656.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12300, 
mitochondrial-like [Camelina sativa]
Length=637

 Score = 60.1 bits (144),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 58/119 (49%), Gaps = 1/119 (1%)
 Frame = -2

Query  732  AYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  553
            A E   +M ERK+ ++   Y ++I+ LC    +D AL    EM   G      T+  +IR
Sbjct  247  AMELLRKMEERKMKLDAAKYNIIIDGLCKDGSLDDALNLFNEMEVKGIKSNIITYNTLIR  306

Query  552  ALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGL  376
              C DG+ D    +L  M  R+     V  +++LI    ++G+ L+A  +Y   + RG+
Sbjct  307  GFCNDGRWDDGAQLLRDMITRN-ITPDVVTFSVLIDSFVKEGKLLEAEKLYKEMITRGI  364


 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 31/121 (26%), Positives = 58/121 (48%), Gaps = 1/121 (1%)
 Frame = -2

Query  735  DAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVI  556
            D  E F  M  R +V +   Y  +I   C   +++ A     EMV  G  P   T+  ++
Sbjct  421  DGLELFRAMSLRGVVADTVTYNTLIHGFCQSGKLNVAKELFQEMVSRGVPPNIVTYKILL  480

Query  555  RALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGL  376
              LC  G++  AL +   + ++S+  + +  YNI+I  +   G+  DA ++++    RG+
Sbjct  481  DGLCDSGELKKALEIFEKI-QKSKMELDIGIYNIIIHGMCNDGKVDDAWDLFSGLPLRGV  539

Query  375  L  373
            +
Sbjct  540  M  540



>gb|KFK25884.1| hypothetical protein AALP_AA8G174800 [Arabis alpina]
Length=503

 Score = 60.1 bits (144),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 58/122 (48%), Gaps = 1/122 (1%)
 Frame = -2

Query  741  LRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  562
            + DA   FDRM E         Y  +I+ LC   +V+ AL     M + G SP   T+ +
Sbjct  166  IYDALSMFDRMVEMGYKPNVVIYNTIIDGLCKNNQVNNALDLFNRMEKDGVSPDVVTYNS  225

Query  561  VIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKR  382
            V+  LC+ G+   A  ++S M +R   +  V  +N LI    + G  L+A  +Y   ++R
Sbjct  226  VVCGLCSSGRWSDATGMVSYMSKRG-IYPDVYTFNALIDACVKGGNILEAEGLYEEMIRR  284

Query  381  GL  376
             L
Sbjct  285  SL  286


 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 31/116 (27%), Positives = 58/116 (50%), Gaps = 1/116 (1%)
 Frame = -2

Query  720  FDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRALCA  541
            F  M +R +V     Y ++I+  C   +++ A     +MV  G  P   T+  ++  LC 
Sbjct  348  FREMSQRGVVRNTVTYTILIQGYCRAGKLNVAEEIFKQMVFCGVPPNIITYNILLHGLCG  407

Query  540  DGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGLL  373
            +GK++ AL +L+ M +       +  YNI+I  + + G   DA ++Y +   +GL+
Sbjct  408  NGKLEKALVILADMQKNG-MDADIVTYNIIIGGMCKAGEFEDAWDLYCSLDHKGLM  462



>ref|XP_010492576.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16640, 
mitochondrial isoform X1 [Camelina sativa]
Length=506

 Score = 60.1 bits (144),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 59/121 (49%), Gaps = 1/121 (1%)
 Frame = -2

Query  735  DAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVI  556
            DA   F+RM E         Y  VI+ LC  K+VD AL  L  M + G  P   T+ +++
Sbjct  171  DALYMFERMVEMGYKPNVVIYNTVIDGLCKSKQVDNALDLLNRMEKDGVRPDAVTYNSLV  230

Query  555  RALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGL  376
              LC  G+   A  ++S M +R   +  V  +N LI    ++G  L+A  +Y   ++R L
Sbjct  231  SGLCNSGRWSDATRMVSYMTKR-EIYPDVFTFNALIDACVKEGNILEAEELYEEMIRRSL  289

Query  375  L  373
            +
Sbjct  290  V  290


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/116 (28%), Positives = 59/116 (51%), Gaps = 1/116 (1%)
 Frame = -2

Query  720  FDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRALCA  541
            F  M +R +V     Y ++I+  C   +++ A      MV  G +P   T+  ++  LC 
Sbjct  351  FCEMSQRGVVKNTVTYTILIQGYCRAGKLNVAEEIFRRMVFSGVTPNIVTYNVLLHGLCD  410

Query  540  DGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGLL  373
             GK++ AL +L+ M ++S     +  YNI+I  + + G   DA ++Y +   +GL+
Sbjct  411  IGKIEKALVILADM-QKSGMDADIVTYNIIIGGMCKAGEVADAWDLYCSLNHKGLM  465



>ref|XP_010492577.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16640, 
mitochondrial isoform X2 [Camelina sativa]
Length=453

 Score = 59.7 bits (143),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 40/123 (33%), Positives = 60/123 (49%), Gaps = 2/123 (2%)
 Frame = -2

Query  735  DAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVI  556
            DA   F+RM E         Y  VI+ LC  K+VD AL  L  M + G  P   T+ +++
Sbjct  118  DALYMFERMVEMGYKPNVVIYNTVIDGLCKSKQVDNALDLLNRMEKDGVRPDAVTYNSLV  177

Query  555  RALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGL  376
              LC  G+   A  ++S M +R   +  V  +N LI    ++G  L+A  +Y   ++R  
Sbjct  178  SGLCNSGRWSDATRMVSYMTKR-EIYPDVFTFNALIDACVKEGNILEAEELYEEMIRRS-  235

Query  375  LVP  367
            LVP
Sbjct  236  LVP  238


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/116 (28%), Positives = 59/116 (51%), Gaps = 1/116 (1%)
 Frame = -2

Query  720  FDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRALCA  541
            F  M +R +V     Y ++I+  C   +++ A      MV  G +P   T+  ++  LC 
Sbjct  298  FCEMSQRGVVKNTVTYTILIQGYCRAGKLNVAEEIFRRMVFSGVTPNIVTYNVLLHGLCD  357

Query  540  DGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGLL  373
             GK++ AL +L+ M ++S     +  YNI+I  + + G   DA ++Y +   +GL+
Sbjct  358  IGKIEKALVILADM-QKSGMDADIVTYNIIIGGMCKAGEVADAWDLYCSLNHKGLM  412



>ref|XP_011036957.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09820-like 
[Populus euphratica]
Length=731

 Score = 60.1 bits (144),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 38/119 (32%), Positives = 61/119 (51%), Gaps = 2/119 (2%)
 Frame = -2

Query  717  DRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRALCAD  538
            + M  +K+  +   Y ++I++LC   E  KA+  L EM   G +P   T+  ++   C +
Sbjct  581  NEMVSKKLSADVVTYNILIDSLCKKGESRKAVKLLDEMFEKGLNPSHVTYNTLMDGYCRE  640

Query  537  GKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGLLVPRK  361
            G +  AL V + M R+ +    V  YN+LIK    +GR  DA  +    L+RG LVP +
Sbjct  641  GNLRAALIVRTRMERKGK-QANVVTYNVLIKGFCLKGRLEDANGLLNEMLERG-LVPNQ  697



>ref|XP_006378827.1| hypothetical protein POPTR_0010s24920g [Populus trichocarpa]
 gb|ERP56624.1| hypothetical protein POPTR_0010s24920g [Populus trichocarpa]
Length=476

 Score = 59.7 bits (143),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 36/117 (31%), Positives = 59/117 (50%), Gaps = 1/117 (1%)
 Frame = -2

Query  726  EEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRAL  547
             +F+R +E  I ++   Y +V+ ALC   E+D A+A L+EM      P   ++  +I   
Sbjct  217  SQFNRFKETGIKLDEACYNIVMNALCKLGEMDGAVALLIEMKGRRTIPDIVSYTTLIHGY  276

Query  546  CADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGL  376
            C +GK++ ALS+   M    R    V  YN+L+      G    A+ V+  A+ RG+
Sbjct  277  CLEGKLNDALSLFHEMKMNGR-KPDVVTYNVLVGMFCHAGEMGKAQYVFDVAITRGI  332



>ref|XP_003607269.1| UDP-glucoronosyl/UDP-glucosyl transferase family protein-like 
protein [Medicago truncatula]
Length=970

 Score = 60.1 bits (144),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 35/122 (29%), Positives = 61/122 (50%), Gaps = 1/122 (1%)
 Frame = -2

Query  741  LRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  562
            + +A + FD M ERKI      Y ++IE  C    +DKA   L +M+  G  P  +T+  
Sbjct  514  MAEASKLFDEMVERKIKPTEVTYNVMIEGYCKAHNMDKAFELLEDMLHNGLVPDTYTYRP  573

Query  561  VIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKR  382
            +I  LC+ G+V  A   +  +H+++   +    Y+ L+     QGR  +A +     ++R
Sbjct  574  LISGLCSTGRVSAAKDFIDDLHKKN-LKLNEMCYSALLHGYCGQGRLTEALSASCEMIQR  632

Query  381  GL  376
            G+
Sbjct  633  GI  634



>ref|XP_011078791.1| PREDICTED: pentatricopeptide repeat-containing protein At5g24830 
isoform X1 [Sesamum indicum]
Length=567

 Score = 59.7 bits (143),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 67/130 (52%), Gaps = 10/130 (8%)
 Frame = -2

Query  741  LRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  562
            + +A   ++ + +R I V+  AY ++I   C   +++    SL EM + G+ P  FT+  
Sbjct  272  MAEALTCWNDVFQRGIEVDVVAYNVMIHGFCLTGDINLVYKSLCEMFKSGHLPDIFTYNT  331

Query  561  VIRALCADGKVDGALSVLSLMHRRSRFWVGVPP----YNILIKELNRQGRALDARNVYAA  394
            +I  LC  G+ + A  V S+M R     +GVPP    Y ++I+ L   G AL A +  + 
Sbjct  332  LISNLCKSGRTNEACYVFSVMSR-----MGVPPDHITYKMIIQGLCINGDALRANHFLSH  386

Query  393  ALKRGLLVPR  364
             L+   L+P+
Sbjct  387  MLEDS-LIPK  395



>gb|KJB50891.1| hypothetical protein B456_008G192600 [Gossypium raimondii]
Length=759

 Score = 60.1 bits (144),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 52/103 (50%), Gaps = 0/103 (0%)
 Frame = -2

Query  738  RDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNV  559
             D  E F  M E+  +     Y +++E+LC  ++V++A+  L E+ + G SP   +F  +
Sbjct  513  EDVMETFKTMMEKGCIPNVITYNILVESLCKARKVNEAMDLLEEIEKKGLSPDIVSFGTL  572

Query  558  IRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQ  430
            I   C +G +DGA  +   M +R +       YNI+I   + +
Sbjct  573  IHGFCDNGDLDGAYKLFRRMGQRYKVCHTTATYNIMINAFSEK  615



>ref|XP_002967974.1| hypothetical protein SELMODRAFT_88078 [Selaginella moellendorffii]
 gb|EFJ31321.1| hypothetical protein SELMODRAFT_88078 [Selaginella moellendorffii]
Length=376

 Score = 59.7 bits (143),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 58/127 (46%), Gaps = 1/127 (1%)
 Frame = -2

Query  741  LRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  562
              +A    D M ER  +     Y  +I+ LC   +V++A      MV+ G SP  +T+ +
Sbjct  80   FSEALAVLDVMAERGCIPPAIVYNQLIDGLCKAGKVEEAFELSTTMVKNGCSPTLYTYNS  139

Query  561  VIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKR  382
            +I  LC  GK D A   L  M   S +   V  Y +LI  L R G    A +V+   + +
Sbjct  140  LINGLCLQGKTDEARDFLQEMA-DSGYNPDVVTYTVLINSLRRDGNFKAAVDVFDEMVSK  198

Query  381  GLLVPRK  361
            G  VP +
Sbjct  199  GGCVPDR  205



>ref|XP_003523769.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like 
[Glycine max]
Length=602

 Score = 59.7 bits (143),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 36/121 (30%), Positives = 64/121 (53%), Gaps = 1/121 (1%)
 Frame = -2

Query  741  LRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  562
            L++A E  DR  +R+   +   Y ++IEA CN   V +A+  L EM + G  P   T+  
Sbjct  224  LKEAMEVLDRQLQRECYPDVITYTILIEATCNDSGVGQAMKLLDEMRKKGCKPDVVTYNV  283

Query  561  VIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKR  382
            +I  +C +G++D A+  L+ M         V  +NI+++ +   GR +DA  + +  L++
Sbjct  284  LINGICKEGRLDEAIKFLNNMPSYG-CKPNVITHNIILRSMCSTGRWMDAERLLSDMLRK  342

Query  381  G  379
            G
Sbjct  343  G  343


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/119 (28%), Positives = 59/119 (50%), Gaps = 1/119 (1%)
 Frame = -2

Query  732  AYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  553
            A +  ++M +   V    +Y  ++   C  K++D+A+  L  MV  G  P   T+  ++ 
Sbjct  367  AIDVLEKMPKHGCVPNSLSYNPLLHGFCQEKKMDRAIEYLEIMVSRGCYPDIVTYNTLLT  426

Query  552  ALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGL  376
            ALC DGKVD A+ +L+ +  +    V +  YN +I  L + G+   A  +     ++GL
Sbjct  427  ALCKDGKVDAAVEILNQLSSKGCSPVLI-TYNTVIDGLTKVGKTEYAVELLEEMRRKGL  484



>gb|EPS74565.1| hypothetical protein M569_00187, partial [Genlisea aurea]
Length=860

 Score = 59.7 bits (143),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 37/123 (30%), Positives = 54/123 (44%), Gaps = 1/123 (1%)
 Frame = -2

Query  741  LRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  562
            L +A    D MRE     +   Y  +I   C     DKA A   EM+++G  P    F  
Sbjct  419  LDNAMRLMDMMRENGCEPDQLTYAELISGFCGSNNSDKAFALFQEMIQLGLKPNSVNFTA  478

Query  561  VIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKR  382
            +I  LC +GKV  AL ++  M +    W  +  YN ++  L    R  +A  +    L+ 
Sbjct  479  LIDGLCKEGKVRDALILMGRMQKVG-CWPYIEAYNAVLNGLCTTKRLSEAHELLNEILES  537

Query  381  GLL  373
            GLL
Sbjct  538  GLL  540


 Score = 55.5 bits (132),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 41/128 (32%), Positives = 60/128 (47%), Gaps = 2/128 (2%)
 Frame = -2

Query  750  EWVLRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFT  571
            E  +RDA     RM++        AY  V+  LC  K + +A   L E++  G  P   T
Sbjct  486  EGKVRDALILMGRMQKVGCWPYIEAYNAVLNGLCTTKRLSEAHELLNEILESGLLPNTIT  545

Query  570  FCNVIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAA  391
            +  +I  LC +G +D A  V   M +RS F   +  Y+ LI  L R GRA DA  +    
Sbjct  546  YTTLIDGLCKNGDMDLAFEVFHDMEKRSCF-PNLYTYSALIHGLCRVGRAGDAE-ILLEE  603

Query  390  LKRGLLVP  367
            + + +L P
Sbjct  604  MSKKMLCP  611



>gb|KEH26900.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula]
Length=379

 Score = 59.3 bits (142),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 38/123 (31%), Positives = 64/123 (52%), Gaps = 9/123 (7%)
 Frame = -2

Query  735  DAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVI  556
            +A   F+ M  RKI+ +   Y  +I+ LC   ++  AL  + EM   G  P   T+ +++
Sbjct  200  EAMNLFEEMHCRKIIPDVVTYNSLIDGLCKLGKISYALKLVDEMHDRGVPPDIITYSSIL  259

Query  555  RALCADGKVDGALSVLSLMHRRSRFWVGVPP----YNILIKELNRQGRALDARNVYAAAL  388
             ALC + +VD A+++L+ +  +     G+ P    Y ILI  L + GR  DA N++   L
Sbjct  260  DALCKNHQVDKAIALLTKLKDQ-----GIRPNMYTYTILIDGLCKGGRLDDAHNIFEDLL  314

Query  387  KRG  379
             +G
Sbjct  315  VKG  317


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 51/100 (51%), Gaps = 1/100 (1%)
 Frame = -2

Query  675  YELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRALCADGKVDGALSVLSLMH  496
            Y  +I+ +C  K V+ A     EMV    SP  FT+  +I   C  GK+  A+ + + M 
Sbjct  45   YNTIIDGMCKDKHVNDAFDLYSEMVSKRISPDVFTYNALISGFCIVGKLKDAIGLFNKMT  104

Query  495  RRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGL  376
              +     +  +NIL+    ++G+  +A+NV A  +K+G+
Sbjct  105  LEN-INPDMYTFNILVDAFCKEGKMKEAKNVLAMMMKQGM  143



>ref|XP_010530458.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like 
[Tarenaya hassleriana]
Length=636

 Score = 59.7 bits (143),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 62/116 (53%), Gaps = 2/116 (2%)
 Frame = -2

Query  714  RMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRALCADG  535
            +M ER I V  R Y ++I+ LC G  +D AL+   +M   G +P   T+  +I  LC   
Sbjct  251  KMEERNIEVNVRIYSMIIDGLCKGGHIDDALSLFDKMDSKGIAPNVVTYSCLINGLCVFD  310

Query  534  KVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGLLVP  367
            + +  + +L+ M +R +    V  +N LI    ++G+ L+A+ +    ++RG LVP
Sbjct  311  RWNDVVRLLNDMAKR-KITPDVVTFNGLIDAFVKEGKFLEAKELCEEMIRRG-LVP  364



>ref|XP_010092441.1| hypothetical protein L484_019198 [Morus notabilis]
 gb|EXB51207.1| hypothetical protein L484_019198 [Morus notabilis]
Length=759

 Score = 59.7 bits (143),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 34/122 (28%), Positives = 60/122 (49%), Gaps = 1/122 (1%)
 Frame = -2

Query  741  LRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  562
            ++DA + FD M ER +  + R Y ++I  LC  K VD+A   L+ M   G  P    +  
Sbjct  177  IQDAQKMFDEMAERGLAPDERTYTIIISGLCQAKRVDEARRLLITMEESGCCPDTVAYNA  236

Query  561  VIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKR  382
            ++   C  G++D A + +    +   + VG+  Y+ LI  L +  R ++A   +   +K 
Sbjct  237  LLNGYCQLGRIDEAYAFMRWSEKEG-YVVGLKGYSCLIDGLFKAKRYVEAHGWFRKMIKA  295

Query  381  GL  376
            G+
Sbjct  296  GV  297



>ref|XP_008367381.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At1g52640, mitochondrial-like [Malus domestica]
Length=464

 Score = 59.7 bits (143),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 60/118 (51%), Gaps = 5/118 (4%)
 Frame = -2

Query  720  FDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRALCA  541
            FD M ER  +V+  AY+  +EALC G +VD+A     EM   G  P   T+   IR  C 
Sbjct  181  FDEMTERGCLVDVPAYBSYLEALCKGGKVDEAYKIFXEMGSNGVEPDACTYSIFIRXYC-  239

Query  540  DGKVDGALSVLSLMHRRSRFWV--GVPPYNILIKELNRQGRALDARNVYAAALKRGLL  373
              +VD   SV  ++ R  R+     V  YN +IK+L +  +  +A  +    ++RG++
Sbjct  240  --EVDDIHSVFRVLDRMXRYNJLPNVYTYNCVIKKLCKNEKVEEAYQLLDEMIERGVM  295



>ref|XP_007037323.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma 
cacao]
 gb|EOY21824.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma 
cacao]
Length=759

 Score = 59.7 bits (143),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 31/121 (26%), Positives = 59/121 (49%), Gaps = 0/121 (0%)
 Frame = -2

Query  738  RDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNV  559
             D  E F  M E+  +     Y ++IE+LC  ++ ++AL  L E+ + G +P   +F  +
Sbjct  513  EDVIETFKAMTEKGCIPNVITYNILIESLCKARKCNEALNLLEEIDKKGLAPDIVSFGTL  572

Query  558  IRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRG  379
            I   C++G +DGA  +   M +R +       YNI+I   + + +   A  ++    + G
Sbjct  573  IHGFCSNGDLDGAYKLFRRMGQRYKVSFTAATYNIMINAYSEKLKINTAEKLFHEMGENG  632

Query  378  L  376
            +
Sbjct  633  I  633



>gb|KEH26866.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula]
Length=403

 Score = 59.3 bits (142),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 62/122 (51%), Gaps = 9/122 (7%)
 Frame = -2

Query  732  AYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  553
            A   F+ M  RKI+     Y  +I+ LC   ++  AL  + EM   G  P   T+ +++ 
Sbjct  215  AMNLFEEMHCRKIIPNVVTYNSLIDGLCKSGKISYALKLVDEMHDRGQPPDIITYSSLLD  274

Query  552  ALCADGKVDGALSVLSLMHRRSRFWVGVPP----YNILIKELNRQGRALDARNVYAAALK  385
            ALC +  VD A+++L+ +  +     G+ P    Y ILI  L + GR  DA+N++   L 
Sbjct  275  ALCKNHHVDKAIALLTKLKDQ-----GLQPNMYTYTILINGLCKGGRPEDAQNIFEDLLV  329

Query  384  RG  379
            +G
Sbjct  330  KG  331



>gb|KFK25885.1| hypothetical protein AALP_AA8G174800 [Arabis alpina]
Length=473

 Score = 59.7 bits (143),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 58/122 (48%), Gaps = 1/122 (1%)
 Frame = -2

Query  741  LRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  562
            + DA   FDRM E         Y  +I+ LC   +V+ AL     M + G SP   T+ +
Sbjct  166  IYDALSMFDRMVEMGYKPNVVIYNTIIDGLCKNNQVNNALDLFNRMEKDGVSPDVVTYNS  225

Query  561  VIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKR  382
            V+  LC+ G+   A  ++S M +R   +  V  +N LI    + G  L+A  +Y   ++R
Sbjct  226  VVCGLCSSGRWSDATGMVSYMSKRG-IYPDVYTFNALIDACVKGGNILEAEGLYEEMIRR  284

Query  381  GL  376
             L
Sbjct  285  SL  286



>ref|XP_008805876.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52640, 
mitochondrial [Phoenix dactylifera]
Length=337

 Score = 59.3 bits (142),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 58/121 (48%), Gaps = 2/121 (2%)
 Frame = -2

Query  738  RDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRI-GYSPGRFTFCN  562
            + A E FD M +R  + +  AY  +I ALC G E+D+A   L EM R  G  P   T+  
Sbjct  61   KKALELFDEMLQRGCLADAVAYNTLIMALCRGGEIDEAHRRLQEMQRDRGLKPDAGTYSA  120

Query  561  VIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKR  382
             IRA C    V  A+ VL  M +R      V  YN +IK L  +   ++A  +    L R
Sbjct  121  FIRASCEAKDVHSAMRVLDTM-KRHDLSPNVFTYNAIIKLLCEKENVVEAYELLDEMLHR  179

Query  381  G  379
            G
Sbjct  180  G  180


 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 35/121 (29%), Positives = 58/121 (48%), Gaps = 2/121 (2%)
 Frame = -2

Query  735  DAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVI  556
            +AYE  D M  R    +  +Y  ++   C   EV+KAL  L  MVR    P R T+  ++
Sbjct  168  EAYELLDEMLHRGAKPDAWSYNAILAVHCKLHEVNKALRLLARMVRDSCLPDRHTYNMLL  227

Query  555  RALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNR-QGRALDARNVYAAALKRG  379
            + L   G++D A+ V   M +R  F+     + ++I  L R +GR  +A   +   +  G
Sbjct  228  KMLIGVGRIDRAMEVWDGMEKRG-FYPSASTFAVMIHGLCRKKGRIEEACQYFEVMVDEG  286

Query  378  L  376
            +
Sbjct  287  I  287



>ref|XP_011004426.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52640, 
mitochondrial [Populus euphratica]
Length=523

 Score = 59.7 bits (143),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 55/115 (48%), Gaps = 1/115 (1%)
 Frame = -2

Query  720  FDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRALCA  541
            FD M  R   ++  AY  ++EALC G  VD+A     E+   G  P   ++   IRA C 
Sbjct  240  FDEMLGRGCALDVLAYNSLLEALCKGGNVDEAYKMFREIASHGVEPDACSYAIFIRAYCE  299

Query  540  DGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGL  376
               +    SVL  M +R      V  YN +IK+L + G+  DA  +    ++RG+
Sbjct  300  ANNIHSVFSVLDRM-KRYDLVPNVFTYNCIIKKLCKNGKVEDAYQLLHEMIERGV  353



>ref|NP_172461.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
 sp|Q3EDF8.1|PPR28_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g09900 
[Arabidopsis thaliana]
 gb|AEE28512.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
Length=598

 Score = 59.7 bits (143),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 62/122 (51%), Gaps = 1/122 (1%)
 Frame = -2

Query  741  LRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  562
            L+ A E  DRM +R    +   Y ++IEA C    V  A+  L EM   G +P   T+  
Sbjct  220  LKQAMEVLDRMLQRDCYPDVITYTILIEATCRDSGVGHAMKLLDEMRDRGCTPDVVTYNV  279

Query  561  VIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKR  382
            ++  +C +G++D A+  L+ M   S     V  +NI+++ +   GR +DA  + A  L++
Sbjct  280  LVNGICKEGRLDEAIKFLNDMP-SSGCQPNVITHNIILRSMCSTGRWMDAEKLLADMLRK  338

Query  381  GL  376
            G 
Sbjct  339  GF  340



>ref|XP_003558747.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 
[Brachypodium distachyon]
 ref|XP_010229153.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 
[Brachypodium distachyon]
 ref|XP_010229154.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 
[Brachypodium distachyon]
Length=651

 Score = 59.7 bits (143),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 36/113 (32%), Positives = 54/113 (48%), Gaps = 1/113 (1%)
 Frame = -2

Query  741  LRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  562
            L  A E +D M  R+I   H  Y ++I++ C   +VD A A L EMV  G  P   T+ +
Sbjct  455  LGKANELWDDMHSREIFPNHVTYSILIDSHCEKGQVDNAFAFLDEMVNKGIVPNIMTYNS  514

Query  561  VIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNV  403
            +I+  C  G V      L  M R  +    +  YN LI    ++G+  +A N+
Sbjct  515  IIKGYCRSGNVSKGQQFLPKM-RHDKVMPDLITYNTLIHGYVKEGKMHEAFNL  566



>ref|XP_010520854.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22470, 
mitochondrial-like isoform X1 [Tarenaya hassleriana]
Length=638

 Score = 59.7 bits (143),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 39/122 (32%), Positives = 62/122 (51%), Gaps = 2/122 (2%)
 Frame = -2

Query  732  AYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  553
            A +   +M ER  VV+   Y  +I+ LC    +D AL    +M   G      ++  +I 
Sbjct  249  ALDLVKKMEERCTVVDVVTYNTIIDCLCKSGNIDDALGVFSKMDDRGVVSDVISYNTLIN  308

Query  552  ALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGLL  373
             LC+ G+ + AL +L  M RR +    V  +N LI +  ++G  L+A+ +Y   L+RG L
Sbjct  309  GLCSLGRWNDALRLLKDMMRR-KIMPDVVTFNGLIDKFIKEGMFLEAKELYEQMLQRG-L  366

Query  372  VP  367
            VP
Sbjct  367  VP  368



>ref|XP_009366374.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 
[Pyrus x bretschneideri]
Length=613

 Score = 59.7 bits (143),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 62/121 (51%), Gaps = 1/121 (1%)
 Frame = -2

Query  741  LRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  562
            L+ A E  DR  +R+   +   Y ++IEA C    V++A+  L EM   G  P   T+  
Sbjct  235  LKQAMEVLDRQLQRECYPDVITYTILIEATCKESGVEQAMKLLDEMRSKGCKPDVVTYNV  294

Query  561  VIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKR  382
            +I  +C +G++D A+  L+ M   S     V  +NI+++ +   GR +DA  + A  + R
Sbjct  295  LINGICKEGRLDEAIKFLNDMPS-SDCQPNVITHNIVLRSMCSTGRWMDAEKLLAEMVHR  353

Query  381  G  379
            G
Sbjct  354  G  354


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/119 (28%), Positives = 59/119 (50%), Gaps = 1/119 (1%)
 Frame = -2

Query  732  AYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  553
            A +  ++M +        +Y  ++   C  K++D+A+  L  MV  G  P   T+  ++ 
Sbjct  378  AIDILEKMPKHGCTPNSLSYNPLLHGFCKEKKMDRAIEYLDIMVSRGCYPDIVTYNTLLT  437

Query  552  ALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGL  376
            ALC DGKVD A+ +L+ +  +    V +  YN +I  L++ G+   A  +     K+GL
Sbjct  438  ALCKDGKVDSAVEILNQLSSKGCSPVLI-TYNTVIDGLSKVGKTERALELLHEMRKKGL  495



>ref|XP_002298371.2| hypothetical protein POPTR_0001s24340g [Populus trichocarpa]
 gb|EEE83176.2| hypothetical protein POPTR_0001s24340g [Populus trichocarpa]
Length=742

 Score = 59.7 bits (143),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 61/122 (50%), Gaps = 1/122 (1%)
 Frame = -2

Query  741  LRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  562
            + DA+  FD M E+ ++     Y ++IE  C      KA   L +MV+ G  P  +T+  
Sbjct  349  MTDAFRLFDEMLEQNMMPNEVTYNVMIEGHCKEGNTVKAFELLNQMVQKGLVPDTYTYRP  408

Query  561  VIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKR  382
            +I +LC+ G+V  A   +  +HR   F +    Y+ L+    ++GR  DA  V    +KR
Sbjct  409  LISSLCSTGRVCEAKKFIDDLHRE-HFKLNEMCYSALLHGYCKEGRLRDALGVCREMVKR  467

Query  381  GL  376
            G+
Sbjct  468  GV  469



>ref|XP_006826435.1| hypothetical protein AMTR_s00004p00168920 [Amborella trichopoda]
 gb|ERM93672.1| hypothetical protein AMTR_s00004p00168920 [Amborella trichopoda]
Length=735

 Score = 59.7 bits (143),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 36/125 (29%), Positives = 57/125 (46%), Gaps = 1/125 (1%)
 Frame = -2

Query  753  NEWVLRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRF  574
            N+ +   A E F  M E++I      Y  +I  LC   +   A      M+  G  P   
Sbjct  275  NKGLFDKAIELFHEMSEKRISPNVVTYSSLIHGLCKNGQWQDATEMFNGMLESGLQPDAI  334

Query  573  TFCNVIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAA  394
            T+  ++  LC DG+V  A+ +L+ M  +      V  YN+LI  L ++G+  DA N    
Sbjct  335  TYTGLVDGLCKDGRVPQAMQLLNTMMEKGEEPDTV-TYNVLINGLCKEGQMGDAMNYMGK  393

Query  393  ALKRG  379
             ++RG
Sbjct  394  MIERG  398



>ref|XP_011099967.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560 
[Sesamum indicum]
 ref|XP_011099969.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560 
[Sesamum indicum]
Length=937

 Score = 59.7 bits (143),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 38/124 (31%), Positives = 62/124 (50%), Gaps = 7/124 (6%)
 Frame = -2

Query  732  AYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  553
            A+E FD M  +      R Y  +I   C GK+V KA+A L +M+     P   TF  ++R
Sbjct  420  AFEIFDMMESKNCSPNVRTYNELISGFCEGKKVHKAMALLSKMLEEKIPPDLVTFNILVR  479

Query  552  ALCADGKVDGALSVLSLMHRRSRFWVGVP---PYNILIKELNRQGRALDARNVYAAALKR  382
              C +G +D AL +L+LM  ++     VP    +  LI  L  +G    A +++ +  ++
Sbjct  480  GQCKEGDIDSALRLLNLMEEKNV----VPDQLTFGTLINALCEKGCVDRAYDMFDSLKEK  535

Query  381  GLLV  370
            G+ V
Sbjct  536  GIKV  539


 Score = 56.2 bits (134),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 35/105 (33%), Positives = 55/105 (52%), Gaps = 9/105 (9%)
 Frame = -2

Query  732  AYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  553
            AY+ FD ++E+ I V    Y  +I+  CN ++VD ALA    MVR G  P  +T+  +I 
Sbjct  525  AYDMFDSLKEKGIKVNEVMYTALIDGYCNVEKVDAALALFERMVREGCLPNSYTYNVLIN  584

Query  552  ALCADGKVDGALSVLSLMHRRSRFWVGVPP----YNILIKELNRQ  430
             LC   K+  AL  L  M        G+ P    Y+I+I+++ ++
Sbjct  585  GLCKVKKLREALKFLERMLED-----GMKPTIVTYSIIIEQMLKE  624



>ref|XP_004512803.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22470, 
mitochondrial-like isoform X1 [Cicer arietinum]
 ref|XP_004512804.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22470, 
mitochondrial-like isoform X2 [Cicer arietinum]
Length=567

 Score = 59.3 bits (142),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 60/123 (49%), Gaps = 9/123 (7%)
 Frame = -2

Query  735  DAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVI  556
            +A   F  M+ RKIV     Y  +I+ LC    +  AL  + EM   G  P  +T+ +++
Sbjct  378  EAMNLFKEMQSRKIVPNVVTYSSLIDGLCRSGRITYALELVCEMHDRGQPPNIYTYSSIL  437

Query  555  RALCADGKVDGALSVLSLMHRRSRFWVGVPP----YNILIKELNRQGRALDARNVYAAAL  388
             ALC    VD A+++L          +G+ P    YNIL+  L + GR  D++ ++   L
Sbjct  438  DALCKSHDVDKAIALLKKFKD-----LGIQPNMCTYNILLNGLCKSGRIKDSQKIFEYLL  492

Query  387  KRG  379
             +G
Sbjct  493  VKG  495



>ref|XP_002531694.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF30685.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=821

 Score = 59.7 bits (143),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 33/112 (29%), Positives = 55/112 (49%), Gaps = 1/112 (1%)
 Frame = -2

Query  711  MRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRALCADGK  532
            M+E     + R Y  +I   C G ++D A +   EM++ G SP ++T+  +I   C +GK
Sbjct  468  MKESNCEPDERTYCELISGFCKGGKLDSATSFFYEMLKCGISPNQWTYTAMIDGYCKEGK  527

Query  531  VDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGL  376
            +D ALS+   M         +  YN +I  L++  R  +A    A   ++GL
Sbjct  528  IDVALSLFERMEENG-CSASIETYNAIISGLSKGNRFSEAEKFCAKMTEQGL  578


 Score = 58.5 bits (140),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 40/127 (31%), Positives = 60/127 (47%), Gaps = 9/127 (7%)
 Frame = -2

Query  741  LRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  562
            L  A+E FDRM +         Y  +I  LCN   + +A+  L EM   G  P  +T+  
Sbjct  248  LDKAFEVFDRMVKDGCNPNSVTYSTLINGLCNEGRIGEAMDMLEEMTEKGIEPTVYTYTV  307

Query  561  VIRALCADGKVDGALSVLSLMHRRSRFWVGVPP----YNILIKELNRQGRALDARNVYAA  394
             I +LC  G+VD A++++  M ++     G  P    Y  +I  L R G+   A  +Y  
Sbjct  308  PISSLCDIGRVDDAINLVRSMGKK-----GCSPSVQTYTAIISGLFRAGKMELAIGMYHK  362

Query  393  ALKRGLL  373
             LK GL+
Sbjct  363  MLKEGLV  369



>ref|XP_004512700.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22470, 
mitochondrial-like [Cicer arietinum]
Length=567

 Score = 59.3 bits (142),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 60/123 (49%), Gaps = 9/123 (7%)
 Frame = -2

Query  735  DAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVI  556
            +A   F  M+ RKIV     Y  +I+ LC    +  AL  + EM   G  P  +T+ +++
Sbjct  378  EAMNLFKEMQSRKIVPNVVTYSSLIDGLCRSGRITYALELVCEMHDRGQPPNIYTYSSIL  437

Query  555  RALCADGKVDGALSVLSLMHRRSRFWVGVPP----YNILIKELNRQGRALDARNVYAAAL  388
             ALC    VD A+++L          +G+ P    YNIL+  L + GR  D++ ++   L
Sbjct  438  DALCKSHDVDKAIALLKKFKD-----LGIQPNMCTYNILLNGLCKSGRIKDSQKIFEYLL  492

Query  387  KRG  379
             +G
Sbjct  493  VKG  495



>ref|XP_011090619.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At2g02150 [Sesamum indicum]
 ref|XP_011090620.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At2g02150 [Sesamum indicum]
 ref|XP_011090621.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At2g02150 [Sesamum indicum]
 ref|XP_011090622.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At2g02150 [Sesamum indicum]
Length=754

 Score = 59.7 bits (143),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 37/125 (30%), Positives = 62/125 (50%), Gaps = 2/125 (2%)
 Frame = -2

Query  732  AYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  553
            A++    M+ER I      Y   ++A C    + +A+   V+M R+G +P  FT+ ++I 
Sbjct  340  AFQFLREMKERCIKPNDVTYSTFVDAFCKEGMLQQAIKFFVDMRRVGLTPNEFTYTSLID  399

Query  552  ALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGLL  373
            A    G +D AL  L  M   +   + +  Y  L+  L  +G+  +A  V+ A LK G +
Sbjct  400  ANFKMGNIDDALKFLKEM-LEAGLKLNIVTYTALLNGLCEEGKIKEAEEVFNAMLKDG-V  457

Query  372  VPRKK  358
            VP +K
Sbjct  458  VPNEK  462



>ref|XP_007131603.1| hypothetical protein PHAVU_011G027200g [Phaseolus vulgaris]
 gb|ESW03597.1| hypothetical protein PHAVU_011G027200g [Phaseolus vulgaris]
Length=900

 Score = 59.7 bits (143),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 33/122 (27%), Positives = 65/122 (53%), Gaps = 1/122 (1%)
 Frame = -2

Query  741  LRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  562
            + +A + FD + ERKI      Y ++IE  C    +DKA   L +M++ G  P  +T+  
Sbjct  518  MAEASKLFDDLLERKIKPTEVTYNVLIEGYCRDNNIDKAFELLEDMLQKGLVPDTYTYRP  577

Query  561  VIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKR  382
            +I  LC++G+V  A   +  +H++ +  +    Y+ L+    ++GR ++A +     ++R
Sbjct  578  LISGLCSNGRVSEAGDFIDALHKQ-KVKLNEMCYSALLHGYCQEGRLVEALSASCEMIQR  636

Query  381  GL  376
            G+
Sbjct  637  GI  638



>ref|XP_008338987.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like 
[Malus domestica]
Length=613

 Score = 59.3 bits (142),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 62/121 (51%), Gaps = 1/121 (1%)
 Frame = -2

Query  741  LRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  562
            L+ A E  DR  +R+   +   Y ++IEA C    V++A+  L EM   G  P   T+  
Sbjct  235  LKQAMEVLDRQLQRECYPDVITYTILIEATCKESGVEQAMKLLDEMRSKGCKPDVVTYNV  294

Query  561  VIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKR  382
            +I  +C +G++D A+  L+ M   S     V  +NI+++ +   GR +DA  + A  + R
Sbjct  295  LINGICKEGRLDEAIKFLNDMPS-SDCQPNVITHNIVLRSMCSTGRWMDAEKLLAEMVHR  353

Query  381  G  379
            G
Sbjct  354  G  354


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/119 (28%), Positives = 59/119 (50%), Gaps = 1/119 (1%)
 Frame = -2

Query  732  AYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  553
            A +  ++M +        +Y  ++   C  K++D+A+  L  MV  G  P   T+  ++ 
Sbjct  378  AIDILEKMPKHGCTPNSLSYNPLLHGFCKEKKMDRAIEYLDIMVSRGCYPDIVTYNTLLT  437

Query  552  ALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGL  376
            ALC DGKVD A+ +L+ +  +    V +  YN +I  L++ G+   A  +     K+GL
Sbjct  438  ALCKDGKVDSAVEILNQLSSKGCSPVLI-TYNTVIDGLSKVGKTECALELLHEMRKKGL  495



>ref|XP_010453827.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16640, 
mitochondrial-like [Camelina sativa]
Length=506

 Score = 59.3 bits (142),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 57/120 (48%), Gaps = 1/120 (1%)
 Frame = -2

Query  735  DAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVI  556
            DA   F+RM E         Y  VI+ LC  K+VD AL  L  M   G  P   T+ ++I
Sbjct  171  DALYMFERMVEMGYKPNVVIYNTVIDGLCKSKQVDNALDLLNRMENDGVRPDAVTYNSLI  230

Query  555  RALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGL  376
              LC  G+   A  ++S M +R   +  V  +N LI    ++G  L+A  +Y   ++R L
Sbjct  231  SGLCNSGRWSDATRMVSYMTKR-EIYPDVFTFNALIDACVKEGNILEAEELYEEMIRRSL  289


 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 31/116 (27%), Positives = 60/116 (52%), Gaps = 1/116 (1%)
 Frame = -2

Query  720  FDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRALCA  541
            F  M +R ++     Y ++I+  C   +++ A      MV  G +P   T+  ++  LC 
Sbjct  351  FCEMSQRGVIRNAVTYTILIQGYCRAGKLNVAEEIFRRMVFSGVTPNIVTYNVLLHGLCG  410

Query  540  DGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGLL  373
            +GK++ AL +L+ M ++S     +  YNI+I  + + G   DA ++Y +   +GL+
Sbjct  411  NGKIEKALVILADM-QKSGMDADIVTYNIIIGGMCKAGEVADAWDLYCSLNHKGLM  465



>ref|XP_002963945.1| hypothetical protein SELMODRAFT_82351 [Selaginella moellendorffii]
 gb|EFJ34278.1| hypothetical protein SELMODRAFT_82351 [Selaginella moellendorffii]
Length=376

 Score = 59.3 bits (142),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 58/127 (46%), Gaps = 1/127 (1%)
 Frame = -2

Query  741  LRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  562
              +A    D M ER  +     Y  +I+ LC   +V++A      MV+ G SP  +T+ +
Sbjct  80   FSEALAVLDVMAERGCIPPAIVYNQLIDGLCKAGKVEEAFELSTTMVKNGCSPTLYTYNS  139

Query  561  VIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKR  382
            +I  LC  GK D A   L  M   S +   V  Y +LI  L R G    A +V+   + +
Sbjct  140  LINGLCLQGKTDEARDFLQEMA-DSGYNPDVVTYTVLINSLRRDGNFRAAVDVFDEMVSK  198

Query  381  GLLVPRK  361
            G  VP +
Sbjct  199  GGCVPDR  205



>ref|XP_009419261.1| PREDICTED: pentatricopeptide repeat-containing protein At2g26790, 
mitochondrial-like [Musa acuminata subsp. malaccensis]
Length=996

 Score = 59.7 bits (143),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 64/116 (55%), Gaps = 1/116 (1%)
 Frame = -2

Query  720  FDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRALCA  541
            FD+M+   I ++  A+ ++I+ALC   ++D+ +  L  M  +G  P R T+  VI+ +C 
Sbjct  389  FDKMKMFGIGLDAYAFTILIKALCREGKLDETVGVLDVMREVGVQPDRITYHTVIQGMCT  448

Query  540  DGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGLL  373
            +GK D A  +L ++  +S   +    YN +I  L ++ R  +A NV     ++G+L
Sbjct  449  NGKPDLAYVLLKVI-TKSGILLDRVAYNKVISRLCKEKRVQEAENVLEDMNRQGIL  503


 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 63/116 (54%), Gaps = 1/116 (1%)
 Frame = -2

Query  720  FDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRALCA  541
            F++M    I ++  A+ ++I++LC   ++D+ L  L  M ++G  P R T+  VI  +C 
Sbjct  212  FEKMMMLGIDLDAYAFTILIKSLCREGKLDETLGVLDVMRKVGIQPDRITYHTVIEGMCT  271

Query  540  DGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGLL  373
            +GK D A  +L  + RR    +G   YN +I  L ++ R  +A NV     ++G++
Sbjct  272  NGKPDLAYVLLKEITRRG-ILLGRIAYNKVISRLCKEKRVREAENVLEDMTRQGVV  326



>ref|XP_006417237.1| hypothetical protein EUTSA_v10007258mg [Eutrema salsugineum]
 gb|ESQ35590.1| hypothetical protein EUTSA_v10007258mg [Eutrema salsugineum]
Length=559

 Score = 59.3 bits (142),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 31/120 (26%), Positives = 63/120 (53%), Gaps = 1/120 (1%)
 Frame = -2

Query  735  DAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVI  556
            D  + F +M  R +V +   Y  +I+  C   +++ A     EMV +G  P   T+  ++
Sbjct  343  DGLKLFRKMSLRGVVADTVTYSTLIQGFCQSGKINAAKEIFQEMVSLGVPPSVVTYGILL  402

Query  555  RALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGL  376
              LC +G+V+ AL +L  M ++S+  +G+  YNI++  +    +  DA +++ +   +G+
Sbjct  403  DGLCDNGEVEKALEILGKM-QKSKMDLGIAIYNIILHGMCNASKVDDAWDLFCSLPLKGV  461



>ref|XP_007031149.1| Pentatricopeptide repeat (PPR-like) superfamily protein isoform 
2 [Theobroma cacao]
 ref|XP_007031150.1| Pentatricopeptide repeat (PPR-like) superfamily protein isoform 
2 [Theobroma cacao]
 gb|EOY11651.1| Pentatricopeptide repeat (PPR-like) superfamily protein isoform 
2 [Theobroma cacao]
 gb|EOY11652.1| Pentatricopeptide repeat (PPR-like) superfamily protein isoform 
2 [Theobroma cacao]
Length=448

 Score = 59.3 bits (142),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 55/105 (52%), Gaps = 1/105 (1%)
 Frame = -2

Query  678  AYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRALCADGKVDGALSVLSLM  499
             Y ++I+A C   E  KA   L EMV+IG  P   T+  ++   C +G +  AL+V + M
Sbjct  316  TYNILIDAFCKEGESRKAARVLDEMVKIGLRPNHVTYNTLMLGHCREGNLRAALNVRTQM  375

Query  498  HRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGLLVPR  364
             +  R    V  YN+LIK   ++G+  DA  +    L++GL+  R
Sbjct  376  EKDGR-RANVVTYNVLIKGFCKKGKLEDANGLLNEMLEKGLIPNR  419



>ref|XP_010024947.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, 
chloroplastic-like [Eucalyptus grandis]
 gb|KCW61500.1| hypothetical protein EUGRSUZ_H04228 [Eucalyptus grandis]
Length=584

 Score = 59.3 bits (142),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 61/119 (51%), Gaps = 1/119 (1%)
 Frame = -2

Query  732  AYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  553
            A E F ++ E        +Y  +  AL +  +  +AL  + EMV  G  P   T+ ++I 
Sbjct  404  ALEIFAKLDEVGCSPNVSSYNTMFSALWSSGDRYRALEMISEMVSKGIDPDNITYNSLIS  463

Query  552  ALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGL  376
             LC DG VD ALS+L  M  RS F   V  YNI+I  L++  R  DA  V A  +++G+
Sbjct  464  CLCRDGMVDEALSLLVDME-RSGFSSTVISYNIVILGLSKVSRIDDAIEVLAVMVEKGI  521



>ref|XP_007023868.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma 
cacao]
 gb|EOY26490.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma 
cacao]
Length=520

 Score = 59.3 bits (142),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 59/119 (50%), Gaps = 1/119 (1%)
 Frame = -2

Query  732  AYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  553
            A+   DRMR   +V     Y  +I  LCN  +VD+A   L EM+  G SP  +++  ++ 
Sbjct  303  AFRVLDRMRRYNLVPNLFTYNCIIRKLCNNDKVDEAYQLLTEMIERGISPDEWSYNAILA  362

Query  552  ALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGL  376
              C   +V+ AL+++S M +   F      YN+ +K L R GR   A  ++ +   RG 
Sbjct  363  YHCEHSEVNRALNLISRMEKNECF-PDRHTYNMALKLLIRIGRFDRATELWESMANRGF  420



>ref|XP_008792873.1| PREDICTED: uncharacterized protein LOC103709351 [Phoenix dactylifera]
Length=1724

 Score = 59.7 bits (143),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 39/127 (31%), Positives = 61/127 (48%), Gaps = 10/127 (8%)
 Frame = -2

Query  741  LRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKE-VDKALASLVEMVRIGYSPGRFTFC  565
            L   +E +  MR   +      + ++I ALC G+E   KA   L EM   G+ P   T+ 
Sbjct  245  LGHCWEVYGEMRRIGVSPNSYTFNILIHALCRGEEDAGKAKEFLEEMELEGFDPDVVTYN  304

Query  564  NVIRALCADGKVDGALSVLSLMHRRSRFWVGVPP----YNILIKELNRQGRALDARNVYA  397
             +I   C  G++D A  +  +MHRR+     V P    Y +L+  L R  R ++A  ++ 
Sbjct  305  TLIDGYCRRGRLDEAFYLFRIMHRRA-----VEPDLVSYTVLMNGLCRDRRVVEAHQLFN  359

Query  396  AALKRGL  376
              L+RGL
Sbjct  360  RMLQRGL  366



>ref|XP_004292451.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Fragaria vesca subsp. vesca]
Length=751

 Score = 59.3 bits (142),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 58/113 (51%), Gaps = 1/113 (1%)
 Frame = -2

Query  741  LRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  562
            L  A++    M E+ I  +   Y  +I+ +C  + +D A     +M+ +G  P  FT+  
Sbjct  464  LDSAFQMKAEMVEKGISPDAVTYSSLIQGVCQQRRLDDACNLFQKMISMGLRPDEFTYTT  523

Query  561  VIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNV  403
            +I A C +G ++ AL +   M R+  F   V  Y++LI  LN+Q R  +A+ +
Sbjct  524  LINAYCKEGDLNMALHLNDEMIRKG-FLPDVVTYSVLINGLNKQARTREAKKL  575



>ref|XP_003620148.1| Pentatricopeptide repeat-containing protein [Medicago truncatula]
 gb|ACJ85849.1| unknown [Medicago truncatula]
 gb|AES76366.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula]
Length=465

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 64/125 (51%), Gaps = 9/125 (7%)
 Frame = -2

Query  741  LRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  562
            L+DA + F++M    I  +   + ++++  C   ++  AL  + EM   G  P   T+ +
Sbjct  278  LKDAVDLFNKMISENIKPDVYTFNILVDVFCKSGKISYALKLVDEMHDRGQPPNIVTYSS  337

Query  561  VIRALCADGKVDGALSVLSLMHRRSRFWVGVPP----YNILIKELNRQGRALDARNVYAA  394
            ++ ALC   +VD A+++L+ +  +     G+ P    Y ILI  L   G+  DARN++  
Sbjct  338  ILDALCKTHRVDKAVALLTKLKDQ-----GIRPNMHTYTILIDGLCTSGKLEDARNIFED  392

Query  393  ALKRG  379
             L +G
Sbjct  393  LLVKG  397



>tpg|DAA53112.1| TPA: hypothetical protein ZEAMMB73_920038 [Zea mays]
Length=574

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 57/119 (48%), Gaps = 1/119 (1%)
 Frame = -2

Query  720  FDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRALCA  541
             D M+E+ +  +   Y ++I ALC   EV KA+  L EMV +G  P    +  +I   C 
Sbjct  424  LDEMKEKGVKADVVTYNVLIGALCCKGEVRKAVKLLDEMVEVGLEPKHVAYNTIINGFCE  483

Query  540  DGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGLLVPR  364
             G   GA  +   M +R +    V  YN+ +K   + G+  +A  V    L++GL+  R
Sbjct  484  KGDAQGAHEIRLRMEKRKK-RANVVTYNVFLKYFCKMGKMDEANVVLNEMLEKGLVPNR  541



>ref|NP_177597.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
 sp|Q9CA58.1|PP120_ARATH RecName: Full=Putative pentatricopeptide repeat-containing protein 
At1g74580 [Arabidopsis thaliana]
 gb|AAG52381.1|AC011765_33 hypothetical protein; 77097-79388 [Arabidopsis thaliana]
 gb|AEE35612.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
Length=763

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 54/122 (44%), Gaps = 0/122 (0%)
 Frame = -2

Query  741  LRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  562
              D  E +  M E+        + +++E+LC  +++D+AL  L EM     +P   TF  
Sbjct  512  FEDVMETYKTMVEKGCAPNLFTFNILLESLCRYRKLDEALGLLEEMKNKSVNPDAVTFGT  571

Query  561  VIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKR  382
            +I   C +G +DGA ++   M    +     P YNI+I     +     A  ++   + R
Sbjct  572  LIDGFCKNGDLDGAYTLFRKMEEAYKVSSSTPTYNIIIHAFTEKLNVTMAEKLFQEMVDR  631

Query  381  GL  376
             L
Sbjct  632  CL  633



>ref|XP_007031148.1| Pentatricopeptide repeat (PPR-like) superfamily protein, putative 
isoform 1 [Theobroma cacao]
 gb|EOY11650.1| Pentatricopeptide repeat (PPR-like) superfamily protein, putative 
isoform 1 [Theobroma cacao]
Length=587

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 55/105 (52%), Gaps = 1/105 (1%)
 Frame = -2

Query  678  AYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRALCADGKVDGALSVLSLM  499
             Y ++I+A C   E  KA   L EMV+IG  P   T+  ++   C +G +  AL+V + M
Sbjct  455  TYNILIDAFCKEGESRKAARVLDEMVKIGLRPNHVTYNTLMLGHCREGNLRAALNVRTQM  514

Query  498  HRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGLLVPR  364
             +  R    V  YN+LIK   ++G+  DA  +    L++GL+  R
Sbjct  515  EKDGR-RANVVTYNVLIKGFCKKGKLEDANGLLNEMLEKGLIPNR  558



>ref|XP_009118082.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12300, 
mitochondrial-like isoform X2 [Brassica rapa]
Length=524

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/122 (29%), Positives = 60/122 (49%), Gaps = 9/122 (7%)
 Frame = -2

Query  732  AYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  553
            A +   +M  RKI ++   Y  +I++LC    ++ AL+   EM   G  P  FT+ ++IR
Sbjct  239  ALDLLRKMEHRKIKLDAVTYNFIIDSLCKDGSLEDALSLFNEMETKGIKPNVFTYNSLIR  298

Query  552  ALCADGKVDGALSVLSLMHRRSRFWVGVPP----YNILIKELNRQGRALDARNVYAAALK  385
              C+ G+ D    +L  M  R     G+ P    +N LI    + G+  +A+++Y   + 
Sbjct  299  GFCSAGRWDDGAPLLRDMITR-----GITPTVITFNSLIDSFVKVGKLTEAQDLYNEMIT  353

Query  384  RG  379
            RG
Sbjct  354  RG  355



>ref|XP_009118081.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12620-like 
isoform X1 [Brassica rapa]
Length=629

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/122 (29%), Positives = 60/122 (49%), Gaps = 9/122 (7%)
 Frame = -2

Query  732  AYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  553
            A +   +M  RKI ++   Y  +I++LC    ++ AL+   EM   G  P  FT+ ++IR
Sbjct  239  ALDLLRKMEHRKIKLDAVTYNFIIDSLCKDGSLEDALSLFNEMETKGIKPNVFTYNSLIR  298

Query  552  ALCADGKVDGALSVLSLMHRRSRFWVGVPP----YNILIKELNRQGRALDARNVYAAALK  385
              C+ G+ D    +L  M  R     G+ P    +N LI    + G+  +A+++Y   + 
Sbjct  299  GFCSAGRWDDGAPLLRDMITR-----GITPTVITFNSLIDSFVKVGKLTEAQDLYNEMIT  353

Query  384  RG  379
            RG
Sbjct  354  RG  355


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/116 (27%), Positives = 57/116 (49%), Gaps = 1/116 (1%)
 Frame = -2

Query  723  EFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRALC  544
             F +M  R +V     Y  +I+  C   +++ A     EMV  G  P   T+  ++  LC
Sbjct  417  HFRKMCMRGVVANTVTYNTLIQGFCQSGKLNVAKELFQEMVSQGVHPDIVTYKILLDGLC  476

Query  543  ADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGL  376
             +G+V+ AL +L  MH +S+  +    YNI+I  +    +  DA +++ +   +G+
Sbjct  477  DNGEVEEALGILDQMH-KSKMELDFGIYNIIIHGMCNANKVDDAWSLFCSLRSKGV  531



>ref|XP_002962532.1| hypothetical protein SELMODRAFT_404389 [Selaginella moellendorffii]
 gb|EFJ35995.1| hypothetical protein SELMODRAFT_404389 [Selaginella moellendorffii]
Length=1031

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 38/120 (32%), Positives = 59/120 (49%), Gaps = 1/120 (1%)
 Frame = -2

Query  732  AYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  553
            A E    M ERK+  +   Y ++I+ LC   + DKA   L EMV  G +P   TF +++ 
Sbjct  245  ALEFLKEMNERKVAPDVFTYNILIDGLCKASKTDKASEMLHEMVDRGVTPDTVTFNSIMD  304

Query  552  ALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGLL  373
             LC  GK + A S+L++M  R+        YN LI  L +Q     A+++    +  G +
Sbjct  305  GLCKAGKFERAHSLLAVMAERN-CRPSCCTYNTLISGLCKQQNVDRAKDLVDEFVSSGFV  363


 Score = 51.2 bits (121),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 31/122 (25%), Positives = 57/122 (47%), Gaps = 9/122 (7%)
 Frame = -2

Query  735  DAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVI  556
            +A+E    M  +        Y  +I+ LC   + +KA   L  +V  G+ P   T+  ++
Sbjct  384  EAFELVKEMSGKGCTPNLVTYNTLIDGLCKASKTEKAYELLESLVSSGFVPDVVTYTIIV  443

Query  555  RALCADGKVDGALSVLSLMHRRSRFWVGVPP----YNILIKELNRQGRALDARNVYAAAL  388
              LC +G++D AL ++  M +R     G  P    Y  L++ L R GR  +A +++   +
Sbjct  444  DGLCKEGRLDKALKMVEGMLKR-----GCTPSVITYTALMEGLCRTGRVDEAHHIFKEMV  498

Query  387  KR  382
             +
Sbjct  499  SK  500



>ref|XP_006592041.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At5g59900-like isoform X1 [Glycine max]
 ref|XP_006592042.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At5g59900-like isoform X2 [Glycine max]
Length=903

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 34/122 (28%), Positives = 64/122 (52%), Gaps = 1/122 (1%)
 Frame = -2

Query  741  LRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  562
            + +A E FD + ERKI      Y ++IE  C   ++DKA   L +M + G  P  +T+  
Sbjct  521  MAEASELFDELVERKIKPTEVTYNVLIEGYCRDGKIDKAFELLEDMHQKGLVPDTYTYRP  580

Query  561  VIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKR  382
            +I  LC+ G+V  A   +  +H+++   +    Y+ L+    ++GR ++A +     ++R
Sbjct  581  LISGLCSTGRVSKAKDFIDDLHKQN-VKLNEMCYSALLHGYCQEGRLMEALSASCEMIQR  639

Query  381  GL  376
            G+
Sbjct  640  GI  641



>ref|XP_010107145.1| hypothetical protein L484_019627 [Morus notabilis]
 gb|EXC13666.1| hypothetical protein L484_019627 [Morus notabilis]
Length=458

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 64/124 (52%), Gaps = 9/124 (7%)
 Frame = -2

Query  732  AYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  553
            AY+ F++M ER +V    +Y ++++ LC   +V+ A+  L +M+  G++P   ++  ++ 
Sbjct  206  AYQLFNKMFERDLVPNDESYRILMQGLCRKGQVNTAVDFLEDMLNKGFTPDTLSYTTLLN  265

Query  552  ALCADGKVDGALSVLSLMHRRSRFWVGVPP----YNILIKELNRQGRALDARNVYAAALK  385
            +LC   ++  A  +L  M  +     G  P    YN +I    R+GRA+DA  V     +
Sbjct  266  SLCRKKQLREAYKLLCRMKVK-----GCNPDIVHYNTVIVGFCREGRAMDACKVLEDMAE  320

Query  384  RGLL  373
             G L
Sbjct  321  NGCL  324



>ref|XP_004505699.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At5g59900-like [Cicer arietinum]
Length=886

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 37/131 (28%), Positives = 67/131 (51%), Gaps = 3/131 (2%)
 Frame = -2

Query  768  GGXGMNEWVLRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGY  589
            G  G NE  + +A + FD M ERK+      Y ++IE  C  + +DKA   L +M++ G 
Sbjct  503  GLCGTNE--MAEASKLFDEMVERKVNPTEVTYNVMIEGYCRARNIDKAFELLEDMLQKGL  560

Query  588  SPGRFTFCNVIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDAR  409
             P  +T+  +I  LC+ G+V  A   +  +H+++   +    Y+ L+     +GR  +A 
Sbjct  561  VPDTYTYRPLIGGLCSTGRVSEAKDFIDDLHKQN-LKLNEMCYSALLHGYCGEGRLTEAL  619

Query  408  NVYAAALKRGL  376
            +     ++RG+
Sbjct  620  SASYEMIQRGI  630



>ref|XP_010462107.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52640, 
mitochondrial-like [Camelina sativa]
Length=527

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/103 (36%), Positives = 50/103 (49%), Gaps = 1/103 (1%)
 Frame = -2

Query  720  FDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRALCA  541
            FD M E   VV+  AY  +++ALC   +VD A   L EM  +G  P  +++   I A C 
Sbjct  228  FDEMLENNCVVDLLAYNALLDALCKSGDVDGAYKMLQEMGSLGLKPDAYSYAIFIHAYCD  287

Query  540  DGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDA  412
             G V  A  VL  M +R      V  YN +IK L +  +  DA
Sbjct  288  AGDVHNAYKVLDRM-KRYELVPNVYTYNHIIKTLCKNEKVDDA  329


 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 35/122 (29%), Positives = 64/122 (52%), Gaps = 1/122 (1%)
 Frame = -2

Query  741  LRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  562
            + +AY+  DRM+  ++V     Y  +I+ LC  ++VD A   L EM++ G +P  +T+ +
Sbjct  291  VHNAYKVLDRMKRYELVPNVYTYNHIIKTLCKNEKVDDAYLLLDEMIQNGANPDTWTYNS  350

Query  561  VIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKR  382
            ++   C   +V+ A  +LS M  R++       YN+++K L R GR   A  ++    +R
Sbjct  351  MMAYHCDHCEVNRATKLLSRMD-RTKCLPDRHTYNMVLKLLIRIGRFDRATEIWEGMSER  409

Query  381  GL  376
              
Sbjct  410  KF  411



>ref|XP_010424684.1| PREDICTED: pentatricopeptide repeat-containing protein At4g01400, 
mitochondrial-like [Camelina sativa]
Length=449

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/126 (29%), Positives = 66/126 (52%), Gaps = 13/126 (10%)
 Frame = -2

Query  756  MNEWVLRD----AYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGY  589
            M+ + L D    AY+ F +M ER +V +  +Y+++I+      +V+ A+  L +M+  G+
Sbjct  199  MHAFCLNDDLSIAYQLFGKMLERDVVPDVESYKILIQGFSRKGQVNGAMELLEDMLNKGF  258

Query  588  SPGRFTFCNVIRALCADGKVDGALSVLSLMHRRSRFWVGVPP----YNILIKELNRQGRA  421
             P R ++  ++ +LC   ++  A  +L  M  +     G  P    YN +I    R+GRA
Sbjct  259  VPDRLSYTTLLNSLCRKTQLREAYKLLCRMKLK-----GCNPDIVHYNTMILGFCREGRA  313

Query  420  LDARNV  403
            +D+R V
Sbjct  314  MDSRKV  319



>ref|XP_006382397.1| hypothetical protein POPTR_0005s01750g [Populus trichocarpa]
 gb|ERP60194.1| hypothetical protein POPTR_0005s01750g [Populus trichocarpa]
Length=453

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 60/119 (50%), Gaps = 1/119 (1%)
 Frame = -2

Query  720  FDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRALCA  541
             + M  +K+  +   Y ++I++LC   E  KA+  L EM   G +P   T+  ++   C 
Sbjct  302  MNEMVSKKLSADVVTYNILIDSLCKKGESRKAVKLLDEMFEKGLNPSHVTYNTLMDGYCR  361

Query  540  DGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGLLVPR  364
            +G +  AL V + M R+ +    V  +N+LIK    +GR  DA  +    L+RGL+  R
Sbjct  362  EGNLRAALIVRTRMERKGK-QANVVTHNVLIKGFCLKGRLEDANGLLNEMLERGLVPNR  419


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/101 (29%), Positives = 51/101 (50%), Gaps = 1/101 (1%)
 Frame = -2

Query  678  AYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRALCADGKVDGALSVLSLM  499
             + ++I   C  K V++A+    +M + G  P   T+  +I A C DG+++ A ++ ++M
Sbjct  211  THNVLINGFCKNKTVNEAINLFNDMEKQGVDPNAMTYTTLIDAYCKDGRMEDAFALYNMM  270

Query  498  HRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRGL  376
              R  F   V  YN LI  L R+G    AR++    + + L
Sbjct  271  IDRGIFP-EVSTYNCLIAGLCRKGDVKAARSLMNEMVSKKL  310



>gb|KHN05463.1| Putative pentatricopeptide repeat-containing protein [Glycine 
soja]
Length=923

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 34/122 (28%), Positives = 64/122 (52%), Gaps = 1/122 (1%)
 Frame = -2

Query  741  LRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  562
            + +A E FD + ERKI      Y ++IE  C   ++DKA   L +M + G  P  +T+  
Sbjct  533  MAEASELFDELVERKIKPTEVTYNVLIEGYCRDGKIDKAFELLEDMHQKGLVPDTYTYRP  592

Query  561  VIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKR  382
            +I  LC+ G+V  A   +  +H+++   +    Y+ L+    ++GR ++A +     ++R
Sbjct  593  LISGLCSTGRVSKAKDFIDDLHKQN-VKLNEMCYSALLHGYCQEGRLMEALSASCEMIQR  651

Query  381  GL  376
            G+
Sbjct  652  GI  653



>ref|NP_175673.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
 sp|Q9SSR6.1|PPR78_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g52640, 
mitochondrial; Flags: Precursor [Arabidopsis thaliana]
 gb|AAD55601.1|AC008016_11 Contains 2 PF|01535 DUF domains [Arabidopsis thaliana]
 gb|AAS76774.1| At1g52640 [Arabidopsis thaliana]
 dbj|BAD95108.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE32833.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
Length=523

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 54/114 (47%), Gaps = 1/114 (1%)
 Frame = -2

Query  720  FDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRALCA  541
            FD M ER  VV+  AY  +++ALC   +VD       EM  +G  P  ++F   I A C 
Sbjct  231  FDEMLERNCVVDLLAYNALLDALCKSGDVDGGYKMFQEMGNLGLKPDAYSFAIFIHAYCD  290

Query  540  DGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKRG  379
             G V  A  VL  M +R      V  +N +IK L +  +  DA  +    +++G
Sbjct  291  AGDVHSAYKVLDRM-KRYDLVPNVYTFNHIIKTLCKNEKVDDAYLLLDEMIQKG  343


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/122 (28%), Positives = 62/122 (51%), Gaps = 1/122 (1%)
 Frame = -2

Query  741  LRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  562
            +  AY+  DRM+   +V     +  +I+ LC  ++VD A   L EM++ G +P  +T+ +
Sbjct  294  VHSAYKVLDRMKRYDLVPNVYTFNHIIKTLCKNEKVDDAYLLLDEMIQKGANPDTWTYNS  353

Query  561  VIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKR  382
            ++   C   +V+ A  +LS M  R++       YN+++K L R GR   A  ++    +R
Sbjct  354  IMAYHCDHCEVNRATKLLSRMD-RTKCLPDRHTYNMVLKLLIRIGRFDRATEIWEGMSER  412

Query  381  GL  376
              
Sbjct  413  KF  414



>ref|XP_008445101.1| PREDICTED: pentatricopeptide repeat-containing protein At5g24830 
isoform X2 [Cucumis melo]
Length=523

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/140 (28%), Positives = 69/140 (49%), Gaps = 22/140 (16%)
 Frame = -2

Query  720  FDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRALCA  541
            +D+M E+K  ++  AY ++I  LC  ++   AL+ + +M++ G+ P  FT+  +I A C 
Sbjct  235  WDKMVEKKTEIDVVAYNVLIHGLCLNQDKKSALSYVADMLKRGFLPDIFTYNTLISAFCK  294

Query  540  DGKVDGALSVLSLMHRRSRFWVGVPP----YNILIKELNRQGRALDARNVYAAALKRGLL  373
            +G+   A  +  +M R     +GV P    Y ++I+ L   G A+ A     + L++  +
Sbjct  295  EGQFGDAYYIHDVMSR-----MGVSPDQILYKMIIQALCMNGDAIKADEFLHSMLEKS-M  348

Query  372  VPRKKPIQFSAKAQAPHIAN  313
            VP             PHI N
Sbjct  349  VPD------------PHIWN  356



>ref|XP_010500873.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52640, 
mitochondrial [Camelina sativa]
Length=530

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/103 (36%), Positives = 50/103 (49%), Gaps = 1/103 (1%)
 Frame = -2

Query  720  FDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRALCA  541
            FD M E   VV+  AY  +++ALC   +VD A   L EM  +G  P  +++   I A C 
Sbjct  231  FDEMLENNCVVDLLAYNALLDALCKSGDVDGAYKMLQEMGSLGLKPDAYSYAIFIHAYCD  290

Query  540  DGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDA  412
             G V  A  VL  M +R      V  YN +IK L +  +  DA
Sbjct  291  AGDVHNAYKVLDRM-KRYELVPNVYTYNHIIKTLCKNEKVDDA  332


 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 35/122 (29%), Positives = 64/122 (52%), Gaps = 1/122 (1%)
 Frame = -2

Query  741  LRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  562
            + +AY+  DRM+  ++V     Y  +I+ LC  ++VD A   L EM++ G +P  +T+ +
Sbjct  294  VHNAYKVLDRMKRYELVPNVYTYNHIIKTLCKNEKVDDAYLLLDEMIQNGANPDTWTYNS  353

Query  561  VIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYNILIKELNRQGRALDARNVYAAALKR  382
            ++   C   +V+ A  +LS M  R++       YN+++K L R GR   A  ++    +R
Sbjct  354  MMAYHCDHCEVNRATKLLSRMD-RTKCLPDRHTYNMVLKLLIRIGRFDRATEIWEGMSER  412

Query  381  GL  376
              
Sbjct  413  KF  414



>ref|XP_010934489.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16420, 
mitochondrial [Elaeis guineensis]
Length=554

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 62/127 (49%), Gaps = 10/127 (8%)
 Frame = -2

Query  741  LRDAYEEFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  562
            L DA +  D M    I      Y +VIEA C  K+  +AL  L +M+   Y P     C 
Sbjct  298  LSDAVKTMDEMEAAGIPPNDVTYSVVIEACCKEKKSGEALNLLCDMLDGKYIPDSSLCCK  357

Query  561  VIRALCADGKVDGALSVLSLMHRRSRFWVGVPPYN----ILIKELNRQGRALDARNVYAA  394
            VI ALC DGKV+ A  +   + +++     V P N     LI  L ++G+  +ARN++  
Sbjct  358  VIDALCVDGKVEDACEIWRRLLKKN-----VTPDNSISSALIYWLCKKGKVWEARNLF-D  411

Query  393  ALKRGLL  373
              +RG +
Sbjct  412  QFERGFI  418



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1467725733100