BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF026F20

Length=759
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009786961.1|  PREDICTED: conserved oligomeric Golgi comple...    314   3e-97   Nicotiana sylvestris
ref|XP_006357255.1|  PREDICTED: conserved oligomeric Golgi comple...    312   2e-96   Solanum tuberosum [potatoes]
gb|AIU51140.1|  embryo yellow protein                                   312   2e-96   Ricinus communis
ref|XP_002510953.1|  conserved hypothetical protein                     312   2e-96   Ricinus communis
ref|XP_004238762.1|  PREDICTED: conserved oligomeric Golgi comple...    311   3e-96   Solanum lycopersicum
gb|KDP22425.1|  hypothetical protein JCGZ_26256                         311   3e-96   Jatropha curcas
ref|XP_009625424.1|  PREDICTED: conserved oligomeric Golgi comple...    311   4e-96   Nicotiana tomentosiformis
gb|AIU51136.1|  embryo yellow protein                                   310   2e-95   Prunus persica
ref|XP_007218916.1|  hypothetical protein PRUPE_ppa001391mg             310   2e-95   Prunus persica
ref|XP_008234406.1|  PREDICTED: conserved oligomeric Golgi comple...    309   2e-95   Prunus mume [ume]
ref|XP_010089680.1|  hypothetical protein L484_001268                   309   3e-95   Morus notabilis
ref|XP_011033997.1|  PREDICTED: conserved oligomeric Golgi comple...    307   1e-94   Populus euphratica
gb|AIU51131.1|  embryo yellow protein                                   307   1e-94   Manihot esculenta [manioc]
ref|XP_002304412.2|  conserved oligomeric Golgi complex component...    305   5e-94   
ref|XP_002267657.1|  PREDICTED: conserved oligomeric Golgi comple...    305   7e-94   Vitis vinifera
ref|XP_011076371.1|  PREDICTED: conserved oligomeric Golgi comple...    304   2e-93   Sesamum indicum [beniseed]
ref|XP_004307803.1|  PREDICTED: conserved oligomeric Golgi comple...    303   4e-93   Fragaria vesca subsp. vesca
ref|XP_007038383.1|  Oligomeric Golgi complex component-related /...    303   5e-93   
gb|AIU51110.1|  embryo yellow protein                                   303   5e-93   Theobroma cacao [chocolate]
ref|XP_003534367.1|  PREDICTED: conserved oligomeric Golgi comple...    303   6e-93   Glycine max [soybeans]
gb|AIU51125.1|  embryo yellow protein                                   302   7e-93   Chimonanthus praecox [wintersweet]
gb|AIU51119.1|  embryo yellow protein                                   302   7e-93   Glycine max [soybeans]
ref|XP_009372929.1|  PREDICTED: conserved oligomeric Golgi comple...    298   7e-93   
gb|KHN11738.1|  Conserved oligomeric Golgi complex subunit 7            302   8e-93   Glycine soja [wild soybean]
gb|KHG21476.1|  Conserved oligomeric Golgi complex subunit 7            291   8e-93   Gossypium arboreum [tree cotton]
ref|XP_007131467.1|  hypothetical protein PHAVU_011G016000g             302   1e-92   Phaseolus vulgaris [French bean]
gb|AIU51138.1|  embryo yellow protein                                   302   1e-92   Phaseolus vulgaris [French bean]
gb|AIU51115.1|  embryo yellow protein                                   301   2e-92   Carica papaya [mamon]
ref|XP_008376080.1|  PREDICTED: conserved oligomeric Golgi comple...    301   2e-92   
ref|XP_009340575.1|  PREDICTED: conserved oligomeric Golgi comple...    301   2e-92   Pyrus x bretschneideri [bai li]
gb|KHN46499.1|  Conserved oligomeric Golgi complex subunit 7            300   6e-92   Glycine soja [wild soybean]
emb|CDP05334.1|  unnamed protein product                                300   6e-92   Coffea canephora [robusta coffee]
ref|XP_009374477.1|  PREDICTED: conserved oligomeric Golgi comple...    300   1e-91   Pyrus x bretschneideri [bai li]
gb|AIU51152.1|  embryo yellow protein                                   298   4e-91   Platanus x hispanica [London plane tree]
gb|AIU51106.1|  embryo yellow protein                                   296   2e-90   Magnolia denudata [haku-mokuren]
gb|AIU51151.1|  embryo yellow protein                                   295   4e-90   Cinnamomum camphora
ref|XP_006490119.1|  PREDICTED: conserved oligomeric Golgi comple...    295   4e-90   Citrus sinensis [apfelsine]
gb|KDO65493.1|  hypothetical protein CISIN_1g003266mg                   295   4e-90   Citrus sinensis [apfelsine]
gb|AIU51123.1|  embryo yellow protein                                   288   8e-90   Chloranthus japonicus
gb|EYU24953.1|  hypothetical protein MIMGU_mgv1a001327mg                294   1e-89   Erythranthe guttata [common monkey flower]
gb|AIU51111.1|  embryo yellow protein                                   294   1e-89   Acorus calamus [flagroot]
gb|AIU51147.1|  embryo yellow protein                                   293   4e-89   Schrenkiella parvula
ref|XP_006421663.1|  hypothetical protein CICLE_v10004313mg             292   4e-89   Citrus clementina [clementine]
gb|AIU51114.1|  embryo yellow protein                                   292   6e-89   Gossypium raimondii
gb|AIU51126.1|  embryo yellow protein                                   283   6e-89   Pandanus utilis
ref|XP_003618197.1|  Conserved oligomeric Golgi complex subunit         290   7e-89   
ref|XP_010062289.1|  PREDICTED: conserved oligomeric Golgi comple...    289   9e-89   Eucalyptus grandis [rose gum]
gb|KEH17632.1|  oligomeric component-related/COG complex component      291   1e-88   Medicago truncatula
emb|CDY00472.1|  BnaA10g08010D                                          274   1e-88   
gb|AIU51121.1|  embryo yellow protein                                   291   1e-88   Buxus sinica
gb|AIU51103.1|  embryo yellow protein                                   291   1e-88   Arabidopsis lyrata [lyrate rockcress]
ref|XP_010692941.1|  PREDICTED: conserved oligomeric Golgi comple...    291   2e-88   Beta vulgaris subsp. vulgaris [field beet]
gb|AIU51104.1|  embryo yellow protein                                   290   3e-88   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004506344.1|  PREDICTED: conserved oligomeric Golgi comple...    290   4e-88   Cicer arietinum [garbanzo]
ref|XP_010062284.1|  PREDICTED: conserved oligomeric Golgi comple...    290   5e-88   Eucalyptus grandis [rose gum]
gb|AIU51116.1|  embryo yellow protein                                   290   5e-88   Capsella rubella
gb|AIU51108.1|  embryo yellow protein                                   289   9e-88   Pinellia ternata
ref|XP_006401980.1|  hypothetical protein EUTSA_v10012691mg             288   2e-87   Eutrema salsugineum [saltwater cress]
gb|AIU51112.1|  embryo yellow protein                                   288   3e-87   Sarcandra glabra
ref|XP_002865861.1|  hypothetical protein ARALYDRAFT_495214             287   3e-87   
gb|AIU51128.1|  embryo yellow protein                                   287   5e-87   Aristolochia tagala
ref|XP_008439087.1|  PREDICTED: conserved oligomeric Golgi comple...    287   5e-87   Cucumis melo [Oriental melon]
gb|AIU51129.1|  embryo yellow protein                                   286   6e-87   Medicago truncatula
ref|XP_003618191.1|  Conserved oligomeric Golgi complex subunit         286   6e-87   Medicago truncatula
ref|XP_004148143.1|  PREDICTED: conserved oligomeric Golgi comple...    286   7e-87   Cucumis sativus [cucumbers]
ref|XP_004165037.1|  PREDICTED: conserved oligomeric Golgi comple...    286   8e-87   
ref|NP_199956.1|  COG7-like protein EYE                                 286   8e-87   Arabidopsis thaliana [mouse-ear cress]
dbj|BAF00649.1|  hypothetical protein                                   286   9e-87   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006280007.1|  hypothetical protein CARUB_v10025880mg             286   1e-86   Capsella rubella
ref|XP_006838140.1|  hypothetical protein AMTR_s00106p00086320          286   1e-86   Amborella trichopoda
ref|XP_010934963.1|  PREDICTED: conserved oligomeric Golgi comple...    285   1e-86   Elaeis guineensis
ref|XP_010443240.1|  PREDICTED: conserved oligomeric Golgi comple...    285   2e-86   Camelina sativa [gold-of-pleasure]
ref|XP_010482477.1|  PREDICTED: conserved oligomeric Golgi comple...    285   2e-86   Camelina sativa [gold-of-pleasure]
ref|XP_008796946.1|  PREDICTED: conserved oligomeric Golgi comple...    285   4e-86   Phoenix dactylifera
dbj|BAG15881.1|  conserved oligomeric Golgi complex component 7-r...    285   5e-86   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001132532.1|  uncharacterized protein LOC100193995               271   7e-86   
gb|AIU51154.1|  embryo yellow protein                                   284   8e-86   Houttuynia cordata [chameleon-plant]
ref|XP_010264264.1|  PREDICTED: conserved oligomeric Golgi comple...    283   1e-85   Nelumbo nucifera [Indian lotus]
gb|AIU51143.1|  embryo yellow protein                                   283   2e-85   Yucca filamentosa [Adam's-needle]
gb|AIU51105.1|  embryo yellow protein                                   273   2e-85   Lilium brownii [Hong Kong lily]
ref|XP_006657236.1|  PREDICTED: conserved oligomeric Golgi comple...    283   2e-85   Oryza brachyantha
gb|KFK26748.1|  hypothetical protein AALP_AA8G288200                    282   3e-85   Arabis alpina [alpine rockcress]
ref|XP_009127310.1|  PREDICTED: conserved oligomeric Golgi comple...    282   3e-85   Brassica rapa
ref|XP_010442640.1|  PREDICTED: conserved oligomeric Golgi comple...    278   6e-85   Camelina sativa [gold-of-pleasure]
gb|EMS57916.1|  hypothetical protein TRIUR3_24838                       278   9e-85   Triticum urartu
ref|XP_003563389.1|  PREDICTED: conserved oligomeric Golgi comple...    281   1e-84   
gb|AIU51127.1|  embryo yellow protein                                   281   1e-84   Asparagus officinalis
ref|XP_010536539.1|  PREDICTED: conserved oligomeric Golgi comple...    280   2e-84   Tarenaya hassleriana [spider flower]
gb|EMT03910.1|  hypothetical protein F775_26031                         277   2e-84   
gb|AIU51102.1|  embryo yellow protein                                   280   2e-84   Aquilegia coerulea [Rocky Mountain columbine]
gb|AIU51109.1|  embryo yellow protein                                   279   3e-84   Brachypodium distachyon [annual false brome]
gb|EEE66191.1|  hypothetical protein OsJ_22310                          279   3e-84   Oryza sativa Japonica Group [Japonica rice]
gb|AIU51153.1|  embryo yellow protein                                   279   3e-84   Ginkgo biloba [ginkgo]
gb|AIU51142.1|  embryo yellow protein                                   279   3e-84   Dioscorea oppositifolia
gb|AIU51130.1|  embryo yellow protein                                   278   5e-84   Canna indica [canna]
gb|EEC81147.1|  hypothetical protein OsI_24056                          278   7e-84   Oryza sativa Indica Group [Indian rice]
gb|AIU51157.1|  embryo yellow protein                                   278   1e-83   Trachycarpus fortunei
dbj|BAD45448.1|  oligomeric golgi complex 7-like                        278   2e-83   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009399332.1|  PREDICTED: conserved oligomeric Golgi comple...    277   2e-83   Musa acuminata subsp. malaccensis [pisang utan]
gb|AIU51107.1|  embryo yellow protein                                   276   4e-83   Musa acuminata [banana]
ref|XP_002438832.1|  hypothetical protein SORBIDRAFT_10g026850          276   5e-83   Sorghum bicolor [broomcorn]
ref|XP_004966309.1|  PREDICTED: conserved oligomeric Golgi comple...    276   7e-83   Setaria italica
gb|AIU51137.1|  embryo yellow protein                                   275   1e-82   Panicum virgatum
ref|XP_009107451.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...    275   1e-82   
emb|CDX99921.1|  BnaC09g27840D                                          271   1e-82   
gb|AIU51149.1|  embryo yellow protein                                   275   2e-82   Lactuca sativa [cultivated lettuce]
dbj|BAJ94393.1|  predicted protein                                      275   2e-82   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ95800.1|  predicted protein                                      275   2e-82   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AIU51146.1|  embryo yellow protein                                   274   3e-82   Sorghum bicolor [broomcorn]
gb|AIU51144.1|  embryo yellow protein                                   273   5e-82   Setaria italica
ref|XP_008658135.1|  PREDICTED: uncharacterized protein LOC100193...    272   2e-81   
gb|AIU51124.1|  embryo yellow protein                                   271   3e-81   Ceratophyllum demersum [hornwort]
gb|AIU51155.1|  embryo yellow protein                                   270   1e-80   Zea mays [maize]
gb|AIU51150.1|  embryo yellow protein                                   267   1e-79   Ceratophyllum platyacanthum subsp. oryzetorum
gb|AIU51156.1|  embryo yellow protein                                   265   6e-79   Alisma plantago-aquatica
gb|AIU51158.1|  embryo yellow protein                                   259   8e-77   Cabomba caroliniana
gb|EPS73811.1|  hypothetical protein M569_00940                         241   3e-70   Genlisea aurea
emb|CDY56655.1|  BnaA02g11250D                                          209   1e-58   Brassica napus [oilseed rape]
emb|CDY00475.1|  BnaA10g07980D                                          207   4e-58   
emb|CDX91578.1|  BnaC02g15820D                                          207   4e-58   
ref|XP_002992562.1|  hypothetical protein SELMODRAFT_135591             197   2e-54   
ref|XP_002972505.1|  hypothetical protein SELMODRAFT_148467             197   3e-54   
gb|AIU51139.1|  embryo yellow protein                                   177   2e-52   Artemisia annua [sweet Annie]
ref|XP_001770876.1|  predicted protein                                  179   9e-48   
ref|XP_008376425.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...    138   1e-37   
ref|XP_006491716.1|  PREDICTED: uncharacterized protein LOC102619662    128   3e-32   
ref|NP_001058323.2|  Os06g0669600                                       122   2e-30   
ref|XP_001418731.1|  predicted protein                                  119   1e-26   Ostreococcus lucimarinus CCE9901
ref|XP_003080398.1|  conserved oligomeric Golgi complex component...    111   6e-25   
emb|CEF98773.1|  Conserved oligomeric Golgi complex subunit 7           111   5e-24   Ostreococcus tauri
emb|CBI21190.3|  unnamed protein product                                103   1e-23   Vitis vinifera
gb|AIU51120.1|  embryo yellow protein                                 95.5    1e-21   Illicium henryi
ref|XP_002731007.1|  PREDICTED: conserved oligomeric Golgi comple...  94.0    3e-19   Saccoglossus kowalevskii
ref|XP_007513783.1|  predicted protein                                96.7    7e-19   Bathycoccus prasinos
ref|XP_005847546.1|  hypothetical protein CHLNCDRAFT_133750           93.2    9e-18   Chlorella variabilis
ref|XP_002503576.1|  predicted protein                                90.5    6e-17   Micromonas commoda
ref|XP_003055554.1|  predicted protein                                90.1    1e-16   Micromonas pusilla CCMP1545
ref|XP_005643872.1|  hypothetical protein COCSUDRAFT_67854            88.2    4e-16   Coccomyxa subellipsoidea C-169
ref|XP_797564.3|  PREDICTED: conserved oligomeric Golgi complex s...  83.2    3e-15   
ref|XP_786237.3|  PREDICTED: conserved oligomeric Golgi complex s...  84.0    1e-14   Strongylocentrotus purpuratus [purple urchin]
ref|XP_001701937.1|  component of oligomeric golgi complex 7          81.3    6e-14   Chlamydomonas reinhardtii
ref|XP_011431811.1|  PREDICTED: conserved oligomeric Golgi comple...  80.9    8e-14   Crassostrea gigas
gb|EKC24157.1|  Conserved oligomeric Golgi complex subunit 7          80.9    8e-14   Crassostrea gigas
gb|EFA86654.1|  oligomeric Golgi complex component                    79.0    3e-13   Heterostelium album PN500
ref|XP_005105726.1|  PREDICTED: conserved oligomeric Golgi comple...  78.6    5e-13   Aplysia californica
ref|XP_001844946.1|  conserved hypothetical protein                   77.8    8e-13   Culex quinquefasciatus
emb|CDS12214.1|  hypothetical protein LRAMOSA04409                    76.3    3e-12   Lichtheimia ramosa
ref|XP_011402672.1|  PREDICTED: conserved oligomeric Golgi comple...  75.9    3e-12   
ref|XP_004535745.1|  PREDICTED: conserved oligomeric Golgi comple...  75.1    7e-12   
ref|XP_004206189.1|  PREDICTED: conserved oligomeric Golgi comple...  71.6    8e-12   
dbj|GAM17697.1|  hypothetical protein SAMD00019534_008720             74.7    9e-12   Acytostelium subglobosum LB1
ref|XP_002109935.1|  hypothetical protein TRIADDRAFT_53345            74.3    1e-11   Trichoplax adhaerens
ref|XP_009062761.1|  hypothetical protein LOTGIDRAFT_194952           73.6    2e-11   Lottia gigantea
ref|XP_003703617.1|  PREDICTED: conserved oligomeric Golgi comple...  73.2    2e-11   
gb|ELT88100.1|  hypothetical protein CAPTEDRAFT_161050                72.4    4e-11   Capitella teleta
ref|XP_011299085.1|  PREDICTED: conserved oligomeric Golgi comple...  72.4    5e-11   Fopius arisanus
ref|XP_011299070.1|  PREDICTED: conserved oligomeric Golgi comple...  72.4    5e-11   Fopius arisanus
ref|XP_011299078.1|  PREDICTED: conserved oligomeric Golgi comple...  72.4    5e-11   Fopius arisanus
gb|KDR16116.1|  Conserved oligomeric Golgi complex subunit 7          70.5    2e-10   Zootermopsis nevadensis
ref|XP_001652664.1|  AAEL007307-PA                                    70.1    2e-10   
ref|XP_006682175.1|  hypothetical protein BATDEDRAFT_27828            70.1    2e-10   Batrachochytrium dendrobatidis JAM81
ref|XP_003490215.1|  PREDICTED: conserved oligomeric Golgi comple...  70.1    3e-10   
ref|XP_003397366.1|  PREDICTED: conserved oligomeric Golgi comple...  69.3    4e-10   Bombus terrestris [large earth bumblebee]
ref|XP_005810284.1|  PREDICTED: conserved oligomeric Golgi comple...  69.3    4e-10   Xiphophorus maculatus
ref|XP_011159533.1|  PREDICTED: conserved oligomeric Golgi comple...  69.3    5e-10   Solenopsis invicta [imported red fire ant]
gb|EFZ22757.1|  hypothetical protein SINV_01051                       69.3    5e-10   
ref|XP_011340196.1|  PREDICTED: conserved oligomeric Golgi comple...  68.9    5e-10   
ref|XP_007571518.1|  PREDICTED: conserved oligomeric Golgi comple...  66.6    5e-10   Poecilia formosa
ref|XP_011340195.1|  PREDICTED: conserved oligomeric Golgi comple...  68.9    6e-10   
ref|XP_005825555.1|  oligomeric Golgi complex subunit 7               68.6    8e-10   Guillardia theta CCMP2712
ref|XP_002407978.1|  conserved oligomeric golgi complex subunit, ...  67.8    1e-09   Ixodes scapularis [blacklegged tick]
ref|XP_008559723.1|  PREDICTED: conserved oligomeric Golgi comple...  67.8    2e-09   
ref|XP_007233023.1|  PREDICTED: conserved oligomeric Golgi comple...  67.4    2e-09   
ref|XP_002293816.1|  predicted protein                                63.9    2e-09   Thalassiosira pseudonana CCMP1335
ref|XP_003961343.1|  PREDICTED: conserved oligomeric Golgi comple...  67.0    2e-09   Takifugu rubripes [tiger puffer]
ref|XP_006623838.1|  PREDICTED: conserved oligomeric Golgi comple...  67.0    2e-09   Apis dorsata [rock honeybee]
ref|XP_006623839.1|  PREDICTED: conserved oligomeric Golgi comple...  67.0    3e-09   Apis dorsata [rock honeybee]
ref|XP_008434639.1|  PREDICTED: conserved oligomeric Golgi comple...  67.0    3e-09   Poecilia reticulata
ref|XP_003691700.1|  PREDICTED: conserved oligomeric Golgi comple...  67.0    3e-09   
ref|XP_011068677.1|  PREDICTED: conserved oligomeric Golgi comple...  66.6    3e-09   Acromyrmex echinatior
gb|EGI69206.1|  Conserved oligomeric Golgi complex subunit 7          66.6    3e-09   Acromyrmex echinatior
ref|XP_394713.2|  PREDICTED: conserved oligomeric Golgi complex s...  66.6    3e-09   
ref|XP_006637161.1|  PREDICTED: conserved oligomeric Golgi comple...  66.6    3e-09   Lepisosteus oculatus
ref|XP_004080382.1|  PREDICTED: conserved oligomeric Golgi comple...  66.6    4e-09   Oryzias latipes [Japanese rice fish]
ref|XP_006872058.1|  PREDICTED: conserved oligomeric Golgi comple...  66.2    4e-09   Chrysochloris asiatica
gb|ABC86343.1|  IP14069p                                              65.1    5e-09   Drosophila melanogaster
ref|XP_007571519.1|  PREDICTED: conserved oligomeric Golgi comple...  66.2    5e-09   Poecilia formosa
ref|XP_007571524.1|  PREDICTED: conserved oligomeric Golgi comple...  65.9    5e-09   Poecilia formosa
ref|XP_010903275.1|  PREDICTED: conserved oligomeric Golgi comple...  65.9    6e-09   Esox lucius
ref|XP_011264700.1|  PREDICTED: conserved oligomeric Golgi comple...  65.5    7e-09   
ref|XP_011186252.1|  PREDICTED: conserved oligomeric Golgi comple...  65.5    8e-09   Zeugodacus cucurbitae [melon fruit fly]
ref|XP_004706118.1|  PREDICTED: conserved oligomeric Golgi comple...  65.5    8e-09   Echinops telfairi [lesser hedgehog tenrec]
ref|XP_002431030.1|  conserved hypothetical protein                   65.5    8e-09   Pediculus humanus corporis [human body lice]
ref|XP_011264701.1|  PREDICTED: conserved oligomeric Golgi comple...  65.5    8e-09   
ref|XP_006892752.1|  PREDICTED: conserved oligomeric Golgi comple...  65.5    8e-09   Elephantulus edwardii [Cape long-eared elephant shrew]
emb|CDQ68336.1|  unnamed protein product                              64.3    1e-08   Oncorhynchus mykiss
ref|XP_008202374.1|  PREDICTED: conserved oligomeric Golgi comple...  64.7    2e-08   Nasonia vitripennis
ref|XP_008202373.1|  PREDICTED: conserved oligomeric Golgi comple...  64.7    2e-08   Nasonia vitripennis
gb|ENN72949.1|  hypothetical protein YQE_10420                        63.2    2e-08   Dendroctonus ponderosae
ref|XP_008202375.1|  PREDICTED: conserved oligomeric Golgi comple...  64.3    2e-08   Nasonia vitripennis
ref|XP_008202376.1|  PREDICTED: conserved oligomeric Golgi comple...  64.3    2e-08   
emb|CDQ66102.1|  unnamed protein product                              64.3    2e-08   Oncorhynchus mykiss
ref|XP_007951381.1|  PREDICTED: conserved oligomeric Golgi comple...  63.9    2e-08   Orycteropus afer afer
ref|XP_010959320.1|  PREDICTED: conserved oligomeric Golgi comple...  63.9    2e-08   Camelus bactrianus [camel]
ref|XP_011154014.1|  PREDICTED: conserved oligomeric Golgi comple...  63.9    2e-08   Harpegnathos saltator
gb|EPY74529.1|  conserved oligomeric Golgi complex subunit 7-like...  63.9    3e-08   Camelus ferus
ref|XP_006193181.1|  PREDICTED: conserved oligomeric Golgi comple...  63.9    3e-08   Camelus ferus
ref|XP_010985221.1|  PREDICTED: conserved oligomeric Golgi comple...  63.9    3e-08   Camelus dromedarius [camel]
ref|XP_006125865.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...  63.9    3e-08   
ref|XP_007058642.1|  PREDICTED: conserved oligomeric Golgi comple...  63.9    3e-08   Chelonia mydas [green seaturtle]
gb|ERL93874.1|  hypothetical protein D910_11160                       63.5    3e-08   Dendroctonus ponderosae
ref|XP_004373515.1|  PREDICTED: conserved oligomeric Golgi comple...  63.5    3e-08   Trichechus manatus latirostris
ref|XP_003418948.1|  PREDICTED: conserved oligomeric Golgi comple...  63.5    3e-08   Loxodonta africana [African bush elephant]
ref|XP_002105431.1|  GD17535                                          63.5    3e-08   Drosophila simulans
ref|XP_002037280.1|  GM12202                                          63.5    3e-08   Drosophila sechellia
ref|XP_011207193.1|  PREDICTED: conserved oligomeric Golgi comple...  63.5    3e-08   Bactrocera dorsalis [papaya fruit fly]
ref|XP_008299300.1|  PREDICTED: conserved oligomeric Golgi comple...  63.5    4e-08   Stegastes partitus
ref|XP_005288959.1|  PREDICTED: conserved oligomeric Golgi comple...  63.2    4e-08   Chrysemys picta bellii
ref|XP_006003103.1|  PREDICTED: conserved oligomeric Golgi comple...  63.2    5e-08   Latimeria chalumnae
ref|NP_651750.1|  Cog7                                                63.2    5e-08   Drosophila melanogaster
ref|XP_004604166.1|  PREDICTED: conserved oligomeric Golgi comple...  63.2    5e-08   Sorex araneus [Eurasian shrew]
ref|XP_010731364.1|  PREDICTED: conserved oligomeric Golgi comple...  62.8    6e-08   
ref|XP_001357618.1|  GA15960                                          62.8    6e-08   Drosophila pseudoobscura pseudoobscura
ref|XP_009194445.1|  PREDICTED: conserved oligomeric Golgi comple...  62.8    6e-08   
ref|XP_008474511.1|  PREDICTED: conserved oligomeric Golgi comple...  62.0    6e-08   Diaphorina citri
ref|XP_010731365.1|  PREDICTED: conserved oligomeric Golgi comple...  62.8    7e-08   
ref|XP_002098511.1|  GE10410                                          62.8    7e-08   Drosophila yakuba
ref|XP_006808092.1|  PREDICTED: conserved oligomeric Golgi comple...  62.4    8e-08   Neolamprologus brichardi [lyretail cichlid]
ref|XP_313727.3|  AGAP004439-PA                                       62.4    9e-08   Anopheles gambiae str. PEST
ref|XP_006201263.1|  PREDICTED: conserved oligomeric Golgi comple...  62.4    1e-07   Vicugna pacos
ref|XP_001993908.1|  GH22206                                          62.0    1e-07   Drosophila grimshawi
ref|XP_010791235.1|  PREDICTED: conserved oligomeric Golgi comple...  62.0    1e-07   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_003341699.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...  62.0    1e-07   Monodelphis domestica
ref|XP_004398866.1|  PREDICTED: conserved oligomeric Golgi comple...  62.0    1e-07   Odobenus rosmarus divergens
ref|XP_011502446.1|  PREDICTED: conserved oligomeric Golgi comple...  61.6    1e-07   Ceratosolen solmsi marchali
ref|XP_004360949.1|  oligomeric Golgi complex component               62.0    1e-07   Cavenderia fasciculata
ref|XP_005935571.1|  PREDICTED: conserved oligomeric Golgi comple...  61.6    1e-07   Haplochromis burtoni
ref|XP_004571418.1|  PREDICTED: conserved oligomeric Golgi comple...  61.6    1e-07   Maylandia zebra
ref|XP_005748533.1|  PREDICTED: conserved oligomeric Golgi comple...  61.6    2e-07   Pundamilia nyererei
ref|XP_003438511.1|  PREDICTED: conserved oligomeric Golgi comple...  61.6    2e-07   Oreochromis niloticus
gb|KFM79726.1|  Conserved oligomeric Golgi complex subunit 7          58.5    2e-07   Stegodyphus mimosarum
ref|XP_008695386.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...  61.6    2e-07   Ursus maritimus [white bear]
ref|XP_004442758.1|  PREDICTED: conserved oligomeric Golgi comple...  61.6    2e-07   Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_002927171.1|  PREDICTED: conserved oligomeric Golgi comple...  61.6    2e-07   Ailuropoda melanoleuca
ref|XP_001945391.2|  PREDICTED: conserved oligomeric Golgi comple...  61.2    2e-07   Acyrthosiphon pisum
ref|XP_004268622.1|  PREDICTED: conserved oligomeric Golgi comple...  61.2    2e-07   Orcinus orca [Orca]
ref|XP_002058398.1|  GJ14333                                          61.2    2e-07   Drosophila virilis
gb|ETN63528.1|  hypothetical protein AND_004755                       61.2    2e-07   Anopheles darlingi [American malaria mosquito]
ref|XP_001981279.1|  GG11984                                          61.2    2e-07   Drosophila erecta
ref|XP_002001440.1|  GI21972                                          61.2    2e-07   Drosophila mojavensis
ref|XP_009248828.1|  PREDICTED: conserved oligomeric Golgi comple...  58.5    2e-07   
ref|XP_007615834.1|  PREDICTED: conserved oligomeric Golgi comple...  61.2    2e-07   
gb|ELK37852.1|  Conserved oligomeric Golgi complex subunit 7          61.2    2e-07   Myotis davidii
ref|XP_006753680.1|  PREDICTED: conserved oligomeric Golgi comple...  60.8    3e-07   
ref|XP_004670260.1|  PREDICTED: conserved oligomeric Golgi comple...  60.8    3e-07   Jaculus jaculus
ref|XP_004453849.1|  PREDICTED: conserved oligomeric Golgi comple...  60.8    3e-07   Dasypus novemcinctus
gb|ERE78144.1|  conserved oligomeric Golgi complex subunit 7          60.8    3e-07   Cricetulus griseus [Chinese hamsters]
ref|XP_007450043.1|  PREDICTED: conserved oligomeric Golgi comple...  60.8    3e-07   Lipotes vexillifer [baiji]
ref|XP_007516677.1|  PREDICTED: conserved oligomeric Golgi comple...  60.8    3e-07   
ref|NP_001029061.1|  conserved oligomeric Golgi complex subunit 7     60.8    3e-07   Rattus norvegicus [brown rat]
ref|XP_006912615.1|  PREDICTED: conserved oligomeric Golgi comple...  60.8    3e-07   
ref|XP_007105719.1|  PREDICTED: conserved oligomeric Golgi comple...  60.5    3e-07   Physeter catodon
ref|XP_004691773.1|  PREDICTED: conserved oligomeric Golgi comple...  60.5    4e-07   Condylura cristata
ref|XP_006085923.1|  PREDICTED: conserved oligomeric Golgi comple...  60.5    4e-07   
ref|XP_004778381.1|  PREDICTED: conserved oligomeric Golgi comple...  60.5    4e-07   Mustela putorius furo [black ferret]
ref|XP_011372750.1|  PREDICTED: conserved oligomeric Golgi comple...  60.5    4e-07   
ref|XP_008150973.1|  PREDICTED: conserved oligomeric Golgi comple...  60.5    4e-07   Eptesicus fuscus
gb|ELK12106.1|  Conserved oligomeric Golgi complex subunit 7          60.5    4e-07   Pteropus alecto
gb|EPQ17692.1|  Conserved oligomeric Golgi complex subunit 7          60.5    4e-07   Myotis brandtii
ref|XP_004855999.1|  PREDICTED: conserved oligomeric Golgi comple...  60.5    4e-07   Heterocephalus glaber [naked mole rat]
ref|XP_001510180.1|  PREDICTED: conserved oligomeric Golgi comple...  60.5    4e-07   
ref|XP_005882395.1|  PREDICTED: conserved oligomeric Golgi comple...  60.5    4e-07   
ref|NP_001028490.2|  conserved oligomeric Golgi complex subunit 7     60.5    4e-07   Mus musculus [mouse]
sp|Q3UM29.1|COG7_MOUSE  RecName: Full=Conserved oligomeric Golgi ...  60.5    4e-07   Mus musculus [mouse]
ref|XP_004900783.1|  PREDICTED: conserved oligomeric Golgi comple...  60.5    4e-07   
ref|XP_003513853.1|  PREDICTED: conserved oligomeric Golgi comple...  60.5    4e-07   Cricetulus griseus [Chinese hamsters]
ref|XP_006085922.1|  PREDICTED: conserved oligomeric Golgi comple...  60.5    4e-07   
ref|XP_005351192.1|  PREDICTED: conserved oligomeric Golgi comple...  60.5    4e-07   Microtus ochrogaster [prairie voles]
gb|AAQ88995.1|  COG7                                                  60.1    4e-07   Homo sapiens [man]
ref|XP_005063464.1|  PREDICTED: conserved oligomeric Golgi comple...  60.5    4e-07   
ref|NP_001070861.1|  conserved oligomeric Golgi complex subunit 7     60.5    4e-07   
gb|EDL17254.1|  component of oligomeric golgi complex 7               60.5    4e-07   
ref|XP_007986068.1|  PREDICTED: conserved oligomeric Golgi comple...  60.1    4e-07   
ref|XP_006980401.1|  PREDICTED: conserved oligomeric Golgi comple...  60.1    5e-07   
ref|XP_010184345.1|  PREDICTED: conserved oligomeric Golgi comple...  60.1    5e-07   
ref|XP_005405157.1|  PREDICTED: conserved oligomeric Golgi comple...  60.1    5e-07   
gb|KDO27581.1|  hypothetical protein SPRG_06849                       60.1    5e-07   
ref|XP_006027196.1|  PREDICTED: conserved oligomeric Golgi comple...  60.1    5e-07   
ref|XP_005405156.1|  PREDICTED: conserved oligomeric Golgi comple...  60.1    5e-07   
ref|XP_005405155.1|  PREDICTED: conserved oligomeric Golgi comple...  60.1    5e-07   
ref|XP_003261698.2|  PREDICTED: conserved oligomeric Golgi comple...  60.1    6e-07   
gb|ELR49362.1|  Conserved oligomeric Golgi complex subunit 7          60.1    6e-07   
ref|XP_005405154.1|  PREDICTED: conserved oligomeric Golgi comple...  60.1    6e-07   
ref|NP_001085832.1|  component of oligomeric golgi complex 7          60.1    6e-07   
ref|XP_536935.3|  PREDICTED: conserved oligomeric Golgi complex s...  60.1    6e-07   
ref|XP_009428772.1|  PREDICTED: conserved oligomeric Golgi comple...  59.7    6e-07   
ref|XP_005255738.1|  PREDICTED: conserved oligomeric Golgi comple...  59.7    6e-07   
ref|XP_510875.2|  PREDICTED: conserved oligomeric Golgi complex s...  59.7    6e-07   
emb|CBY21571.1|  unnamed protein product                              59.7    6e-07   
ref|XP_008312851.1|  PREDICTED: conserved oligomeric Golgi comple...  59.7    7e-07   
ref|XP_006730882.1|  PREDICTED: conserved oligomeric Golgi comple...  59.7    7e-07   
dbj|BAG52793.1|  unnamed protein product                              59.7    7e-07   
ref|NP_705831.1|  conserved oligomeric Golgi complex subunit 7        59.7    7e-07   
ref|XP_010339086.1|  PREDICTED: conserved oligomeric Golgi comple...  59.7    7e-07   
ref|XP_004057400.1|  PREDICTED: conserved oligomeric Golgi comple...  59.7    7e-07   
ref|XP_003813754.1|  PREDICTED: conserved oligomeric Golgi comple...  59.7    7e-07   
ref|XP_010356516.1|  PREDICTED: conserved oligomeric Golgi comple...  59.7    7e-07   
ref|XP_008631786.1|  PREDICTED: conserved oligomeric Golgi comple...  59.7    7e-07   
ref|XP_010390549.1|  PREDICTED: conserved oligomeric Golgi comple...  59.7    7e-07   
ref|XP_009007562.1|  PREDICTED: conserved oligomeric Golgi comple...  59.7    7e-07   
ref|XP_005591519.1|  PREDICTED: conserved oligomeric Golgi comple...  59.7    7e-07   
ref|XP_005141261.1|  PREDICTED: conserved oligomeric Golgi comple...  59.3    8e-07   
gb|KFO58912.1|  Conserved oligomeric Golgi complex subunit 7          59.7    8e-07   
ref|XP_004622945.1|  PREDICTED: conserved oligomeric Golgi comple...  59.7    8e-07   
ref|XP_003930238.1|  PREDICTED: conserved oligomeric Golgi comple...  59.3    8e-07   
ref|XP_005523167.1|  PREDICTED: conserved oligomeric Golgi comple...  59.3    8e-07   
ref|XP_006071244.1|  PREDICTED: conserved oligomeric Golgi comple...  59.3    8e-07   
ref|XP_010835502.1|  PREDICTED: conserved oligomeric Golgi comple...  59.3    8e-07   
ref|XP_004020887.1|  PREDICTED: conserved oligomeric Golgi comple...  59.3    9e-07   
ref|XP_005905382.1|  PREDICTED: conserved oligomeric Golgi comple...  59.3    9e-07   
ref|XP_005697660.1|  PREDICTED: conserved oligomeric Golgi comple...  59.3    9e-07   
ref|NP_001076841.1|  conserved oligomeric Golgi complex subunit 7     59.3    9e-07   
ref|XP_005975366.1|  PREDICTED: conserved oligomeric Golgi comple...  59.3    9e-07   
ref|NP_001264493.1|  conserved oligomeric Golgi complex subunit 7     59.3    9e-07   
ref|XP_003998815.1|  PREDICTED: conserved oligomeric Golgi comple...  59.3    1e-06   
ref|XP_006148372.1|  PREDICTED: conserved oligomeric Golgi comple...  59.3    1e-06   
ref|NP_001015714.1|  component of oligomeric golgi complex 7          59.3    1e-06   
ref|XP_007084222.1|  PREDICTED: conserved oligomeric Golgi comple...  59.3    1e-06   
ref|XP_003478248.1|  PREDICTED: conserved oligomeric Golgi comple...  59.3    1e-06   
ref|XP_008504971.1|  PREDICTED: conserved oligomeric Golgi comple...  58.9    1e-06   
ref|XP_005505761.1|  PREDICTED: conserved oligomeric Golgi comple...  59.3    1e-06   
gb|KFQ15936.1|  Conserved oligomeric Golgi complex subunit 7          59.3    1e-06   
ref|XP_009957143.1|  PREDICTED: conserved oligomeric Golgi comple...  58.9    1e-06   
ref|NP_001124794.1|  conserved oligomeric Golgi complex subunit 7     58.9    1e-06   
ref|XP_003795773.1|  PREDICTED: conserved oligomeric Golgi comple...  58.9    1e-06   
ref|XP_001916280.1|  PREDICTED: conserved oligomeric Golgi comple...  58.9    1e-06   
ref|XP_005598907.1|  PREDICTED: conserved oligomeric Golgi comple...  58.9    1e-06   
ref|XP_004176695.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...  58.9    1e-06   
ref|XP_003761800.1|  PREDICTED: conserved oligomeric Golgi comple...  58.9    1e-06   
ref|XP_974190.1|  PREDICTED: conserved oligomeric Golgi complex s...  58.9    1e-06   
ref|XP_009089982.1|  PREDICTED: conserved oligomeric Golgi comple...  58.9    1e-06   
ref|XP_005323804.1|  PREDICTED: conserved oligomeric Golgi comple...  58.9    1e-06   
ref|XP_003230028.2|  PREDICTED: conserved oligomeric Golgi comple...  58.2    2e-06   
ref|XP_005188405.1|  PREDICTED: conserved oligomeric Golgi comple...  58.5    2e-06   
ref|XP_008058130.1|  PREDICTED: conserved oligomeric Golgi comple...  58.5    2e-06   
ref|XP_007903979.1|  PREDICTED: conserved oligomeric Golgi comple...  58.5    2e-06   
ref|XP_008842039.1|  PREDICTED: conserved oligomeric Golgi comple...  58.5    2e-06   
ref|XP_008566482.1|  PREDICTED: conserved oligomeric Golgi comple...  58.5    2e-06   
ref|XP_001955508.1|  GF16218                                          58.5    2e-06   
ref|XP_007198346.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...  58.2    2e-06   
ref|XP_010010968.1|  PREDICTED: conserved oligomeric Golgi comple...  58.2    2e-06   
gb|KFQ47789.1|  Conserved oligomeric Golgi complex subunit 7          58.2    2e-06   
gb|KFQ77454.1|  Conserved oligomeric Golgi complex subunit 7          58.2    2e-06   
ref|XP_009665180.1|  PREDICTED: conserved oligomeric Golgi comple...  57.8    3e-06   
ref|XP_002802472.1|  PREDICTED: conserved oligomeric Golgi comple...  57.8    3e-06   
gb|KFP79541.1|  Conserved oligomeric Golgi complex subunit 7          57.8    3e-06   
ref|XP_009072086.1|  PREDICTED: conserved oligomeric Golgi comple...  57.8    3e-06   
gb|KFV72508.1|  Conserved oligomeric Golgi complex subunit 7          57.8    3e-06   
ref|XP_009665174.1|  PREDICTED: conserved oligomeric Golgi comple...  57.8    3e-06   
ref|XP_005494576.1|  PREDICTED: conserved oligomeric Golgi comple...  57.8    3e-06   
gb|KFM12505.1|  Conserved oligomeric Golgi complex subunit 7          57.8    3e-06   
ref|XP_009318776.1|  PREDICTED: conserved oligomeric Golgi comple...  57.8    3e-06   
gb|KFW64649.1|  Conserved oligomeric Golgi complex subunit 7          57.8    3e-06   
ref|XP_009919151.1|  PREDICTED: conserved oligomeric Golgi comple...  57.4    3e-06   
ref|XP_005426090.1|  PREDICTED: conserved oligomeric Golgi comple...  57.8    4e-06   
ref|XP_009284907.1|  PREDICTED: conserved oligomeric Golgi comple...  57.4    4e-06   
ref|XP_003230252.2|  PREDICTED: conserved oligomeric Golgi comple...  57.4    4e-06   
ref|XP_008933945.1|  PREDICTED: conserved oligomeric Golgi comple...  57.4    4e-06   
gb|KFV44518.1|  Conserved oligomeric Golgi complex subunit 7          57.4    4e-06   
ref|XP_009974505.1|  PREDICTED: conserved oligomeric Golgi comple...  57.4    4e-06   
gb|KFQ25509.1|  Conserved oligomeric Golgi complex subunit 7          57.4    4e-06   
ref|XP_002953697.1|  component of oligomeric golgi complex 7          57.4    4e-06   
ref|XP_010568816.1|  PREDICTED: conserved oligomeric Golgi comple...  57.4    4e-06   
ref|XP_009919150.1|  PREDICTED: conserved oligomeric Golgi comple...  57.4    4e-06   
gb|KFQ05597.1|  Conserved oligomeric Golgi complex subunit 7          57.4    4e-06   
ref|XP_005018689.1|  PREDICTED: conserved oligomeric Golgi comple...  57.4    5e-06   
ref|XP_008926490.1|  PREDICTED: conserved oligomeric Golgi comple...  57.4    5e-06   
gb|KFZ48154.1|  Conserved oligomeric Golgi complex subunit 7          57.0    5e-06   
gb|KFO84349.1|  Conserved oligomeric Golgi complex subunit 7          57.0    5e-06   
ref|XP_010171643.1|  PREDICTED: conserved oligomeric Golgi comple...  57.0    5e-06   
ref|XP_005229099.1|  PREDICTED: conserved oligomeric Golgi comple...  57.0    5e-06   
ref|XP_010299541.1|  PREDICTED: conserved oligomeric Golgi comple...  57.0    5e-06   
gb|KFW84542.1|  Conserved oligomeric Golgi complex subunit 7          57.0    5e-06   
ref|XP_010144199.1|  PREDICTED: conserved oligomeric Golgi comple...  57.0    5e-06   
ref|XP_010717801.1|  PREDICTED: conserved oligomeric Golgi comple...  57.0    5e-06   
ref|XP_005443671.1|  PREDICTED: conserved oligomeric Golgi comple...  57.4    5e-06   
ref|XP_010568814.1|  PREDICTED: conserved oligomeric Golgi comple...  57.0    5e-06   
ref|XP_004586873.1|  PREDICTED: conserved oligomeric Golgi comple...  57.0    6e-06   
gb|KFW91579.1|  Conserved oligomeric Golgi complex subunit 7          57.0    6e-06   
ref|XP_009503997.1|  PREDICTED: conserved oligomeric Golgi comple...  57.0    6e-06   
ref|XP_010198342.1|  PREDICTED: conserved oligomeric Golgi comple...  57.0    6e-06   
ref|XP_009930601.1|  PREDICTED: conserved oligomeric Golgi comple...  57.0    6e-06   
ref|XP_009815736.1|  PREDICTED: conserved oligomeric Golgi comple...  57.0    6e-06   
gb|KFP63966.1|  Conserved oligomeric Golgi complex subunit 7          57.0    6e-06   
gb|KFR08003.1|  Conserved oligomeric Golgi complex subunit 7          57.0    6e-06   
gb|KFQ70547.1|  Conserved oligomeric Golgi complex subunit 7          57.0    6e-06   
ref|XP_009482406.1|  PREDICTED: conserved oligomeric Golgi comple...  57.0    6e-06   
ref|XP_009696306.1|  PREDICTED: conserved oligomeric Golgi comple...  57.0    6e-06   
ref|XP_005054658.1|  PREDICTED: conserved oligomeric Golgi comple...  57.0    6e-06   
ref|XP_009585506.1|  PREDICTED: conserved oligomeric Golgi comple...  56.6    6e-06   
gb|KFV98617.1|  Conserved oligomeric Golgi complex subunit 7          56.6    6e-06   
ref|XP_010295242.1|  PREDICTED: conserved oligomeric Golgi comple...  56.6    7e-06   
gb|KFQ52210.1|  Conserved oligomeric Golgi complex subunit 7          56.6    7e-06   
ref|XP_010621761.1|  PREDICTED: conserved oligomeric Golgi comple...  56.6    7e-06   
ref|XP_002711891.2|  PREDICTED: conserved oligomeric Golgi comple...  57.0    7e-06   
gb|KFP45453.1|  Conserved oligomeric Golgi complex subunit 7          56.6    7e-06   
ref|XP_009893067.1|  PREDICTED: conserved oligomeric Golgi comple...  56.6    7e-06   
ref|XP_010125973.1|  PREDICTED: conserved oligomeric Golgi comple...  56.6    8e-06   
ref|XP_009983312.1|  PREDICTED: conserved oligomeric Golgi comple...  56.2    9e-06   
gb|KFV17186.1|  Conserved oligomeric Golgi complex subunit 7          56.2    9e-06   
ref|XP_009466130.1|  PREDICTED: conserved oligomeric Golgi comple...  56.2    1e-05   
gb|KFQ99971.1|  Conserved oligomeric Golgi complex subunit 7          56.2    1e-05   
gb|KFO95573.1|  Conserved oligomeric Golgi complex subunit 7          55.8    1e-05   
ref|XP_008488587.1|  PREDICTED: conserved oligomeric Golgi comple...  55.8    1e-05   
ref|XP_002128341.1|  PREDICTED: conserved oligomeric Golgi comple...  55.8    1e-05   
gb|ELW66292.1|  Conserved oligomeric Golgi complex subunit 7          55.8    2e-05   
ref|XP_010073318.1|  PREDICTED: conserved oligomeric Golgi comple...  55.5    2e-05   
gb|KFV74312.1|  Conserved oligomeric Golgi complex subunit 7          55.5    2e-05   
ref|XP_009906223.1|  PREDICTED: conserved oligomeric Golgi comple...  55.5    2e-05   
ref|XP_009646382.1|  PREDICTED: conserved oligomeric Golgi comple...  55.5    2e-05   
gb|KFP10525.1|  Conserved oligomeric Golgi complex subunit 7          55.1    2e-05   
ref|XP_002073360.1|  GK14089                                          55.1    2e-05   
ref|XP_010000872.1|  PREDICTED: conserved oligomeric Golgi comple...  55.1    3e-05   
gb|KFU93333.1|  Conserved oligomeric Golgi complex subunit 7          55.1    3e-05   
ref|XP_009565762.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...  55.1    3e-05   
gb|KFB52038.1|  AGAP004439-PA-like protein                            54.7    3e-05   
gb|KFZ67320.1|  Conserved oligomeric Golgi complex subunit 7          54.3    4e-05   
ref|XP_009839112.1|  hypothetical protein, variant                    54.3    4e-05   
ref|XP_009867466.1|  PREDICTED: conserved oligomeric Golgi comple...  54.3    4e-05   
gb|KFD70340.1|  hypothetical protein M514_06928                       54.3    4e-05   
ref|XP_005709389.1|  hypothetical protein Gasu_02200                  54.3    5e-05   
ref|XP_009839113.1|  hypothetical protein H257_13328                  54.3    5e-05   
gb|KFP88492.1|  Conserved oligomeric Golgi complex subunit 7          54.3    5e-05   
gb|EHJ78638.1|  putative component of oligomeric golgi complex 7      54.3    5e-05   
ref|XP_008619063.1|  hypothetical protein SDRG_14692                  53.9    6e-05   
gb|KGL78321.1|  Conserved oligomeric Golgi complex subunit 7          53.5    8e-05   
ref|XP_010214546.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...  53.5    8e-05   
ref|XP_007442324.1|  PREDICTED: conserved oligomeric Golgi comple...  53.1    1e-04   
ref|XP_003737280.1|  PREDICTED: conserved oligomeric Golgi comple...  53.1    1e-04   
ref|XP_006268482.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...  52.0    2e-04   
ref|XP_005782152.1|  component of oligomeric Golgi complex 7          50.8    5e-04   
gb|KIJ18193.1|  hypothetical protein PAXINDRAFT_32237                 50.8    6e-04   



>ref|XP_009786961.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Nicotiana 
sylvestris]
Length=834

 Score =   314 bits (804),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 146/163 (90%), Positives = 156/163 (96%), Gaps = 0/163 (0%)
 Frame = -3

Query  691  DLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANADE  512
            DLSRLPIWSSVEEHSARPLPTFSAYPQSYVT VGEYLLTLPQQLEPL E ISNSD NADE
Sbjct  672  DLSRLPIWSSVEEHSARPLPTFSAYPQSYVTGVGEYLLTLPQQLEPLVENISNSDPNADE  731

Query  511  AQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVL  332
            AQYFATEWMFKVAEGATALY++QLRGIQYITDRGAQQLSVDIEYLSNVLSALSMP+P VL
Sbjct  732  AQYFATEWMFKVAEGATALYMEQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPIPTVL  791

Query  331  ATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  203
            ATF +C STP++QLK+L+K+DSGNQLDLPTANLVCKMRR+SLE
Sbjct  792  ATFQTCFSTPKNQLKDLIKTDSGNQLDLPTANLVCKMRRISLE  834



>ref|XP_006357255.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Solanum tuberosum]
 gb|AIU51134.1| embryo yellow protein, partial [Solanum tuberosum]
Length=835

 Score =   312 bits (800),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 145/164 (88%), Positives = 154/164 (94%), Gaps = 0/164 (0%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            NDLSRLPIWSS+EEHS RPLPTFSAYPQSYVT VGEYLLTLPQQLEPL E ISNSD NAD
Sbjct  672  NDLSRLPIWSSIEEHSLRPLPTFSAYPQSYVTGVGEYLLTLPQQLEPLVESISNSDPNAD  731

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            EAQYFATEWMFKVAEGATALY++QLRGIQYITDRGAQQLSVDIEYLSNVLSALSMP+P  
Sbjct  732  EAQYFATEWMFKVAEGATALYMEQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPIPTC  791

Query  334  LATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  203
            LATF +C STP+ QLK+L+KSDSGNQLDLPTANLVCKMRR+SLE
Sbjct  792  LATFQTCFSTPKDQLKDLIKSDSGNQLDLPTANLVCKMRRISLE  835



>gb|AIU51140.1| embryo yellow protein, partial [Ricinus communis]
Length=831

 Score =   312 bits (799),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 146/164 (89%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            ND+SRLPIWSSVEE SA PLP FSAYPQSYVT+VGEYLLTLPQQLEPLAEGISNSDAN D
Sbjct  668  NDVSRLPIWSSVEEQSAFPLPIFSAYPQSYVTSVGEYLLTLPQQLEPLAEGISNSDANND  727

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            EAQ+FATEWMFKVAEGA+ALY++QLRGIQYITDRGAQQLSVDIEYLSNVLSALSMP+PP+
Sbjct  728  EAQFFATEWMFKVAEGASALYMEQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPIPPI  787

Query  334  LATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  203
            LATFH+CLSTPR QLK LVKSD+GNQLDLPTANLVCK+RRVSL+
Sbjct  788  LATFHTCLSTPRDQLKYLVKSDAGNQLDLPTANLVCKIRRVSLD  831



>ref|XP_002510953.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51555.1| conserved hypothetical protein [Ricinus communis]
Length=832

 Score =   312 bits (799),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 146/164 (89%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            ND+SRLPIWSSVEE SA PLP FSAYPQSYVT+VGEYLLTLPQQLEPLAEGISNSDAN D
Sbjct  669  NDVSRLPIWSSVEEQSAFPLPIFSAYPQSYVTSVGEYLLTLPQQLEPLAEGISNSDANND  728

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            EAQ+FATEWMFKVAEGA+ALY++QLRGIQYITDRGAQQLSVDIEYLSNVLSALSMP+PP+
Sbjct  729  EAQFFATEWMFKVAEGASALYMEQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPIPPI  788

Query  334  LATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  203
            LATFH+CLSTPR QLK LVKSD+GNQLDLPTANLVCK+RRVSL+
Sbjct  789  LATFHTCLSTPRDQLKYLVKSDAGNQLDLPTANLVCKIRRVSLD  832



>ref|XP_004238762.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Solanum 
lycopersicum]
 gb|AIU51145.1| embryo yellow protein, partial [Solanum lycopersicum]
Length=835

 Score =   311 bits (798),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 145/164 (88%), Positives = 154/164 (94%), Gaps = 0/164 (0%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            NDLSRLPIWSSVEEHS RPLPTFS+YPQSYVT VGEYLLTLPQQLEPL E ISNSD NAD
Sbjct  672  NDLSRLPIWSSVEEHSLRPLPTFSSYPQSYVTGVGEYLLTLPQQLEPLVENISNSDPNAD  731

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            EAQYFATEWMFKVAEGATALY++QLRGIQYITDRGAQQLSVDIEYLSNVLSALSMP+P  
Sbjct  732  EAQYFATEWMFKVAEGATALYMEQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPIPTC  791

Query  334  LATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  203
            LATF +C STP+ QLK+L+KSDSGNQLDLPTANLVCKMRR+SLE
Sbjct  792  LATFQTCFSTPKDQLKDLIKSDSGNQLDLPTANLVCKMRRISLE  835



>gb|KDP22425.1| hypothetical protein JCGZ_26256 [Jatropha curcas]
Length=832

 Score =   311 bits (798),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 144/164 (88%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            +D+SRLPIWSSVEE SA PLPTFSAYPQSYVT+VGEYLLTLPQQLEPLAEGISNSDAN D
Sbjct  669  SDVSRLPIWSSVEEQSAFPLPTFSAYPQSYVTSVGEYLLTLPQQLEPLAEGISNSDANND  728

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            EAQ+FATEWMFKVAEGATALY++QLRGIQY+TDRGAQQLSVDIEYLSNVLSALSMP+PP+
Sbjct  729  EAQFFATEWMFKVAEGATALYMEQLRGIQYVTDRGAQQLSVDIEYLSNVLSALSMPIPPI  788

Query  334  LATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  203
            LATFH+C STPR QLK LVKSD+GNQLD+PTANLVCK+RRVSL+
Sbjct  789  LATFHTCFSTPRDQLKHLVKSDAGNQLDIPTANLVCKIRRVSLD  832



>ref|XP_009625424.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Nicotiana 
tomentosiformis]
Length=835

 Score =   311 bits (797),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 145/162 (90%), Positives = 155/162 (96%), Gaps = 0/162 (0%)
 Frame = -3

Query  688  LSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANADEA  509
            LSRLPIWSSVEEHSARPLPTFSAYPQSYVT VGEYLLTLPQQLEPL E ISNSD NADEA
Sbjct  674  LSRLPIWSSVEEHSARPLPTFSAYPQSYVTGVGEYLLTLPQQLEPLVENISNSDPNADEA  733

Query  508  QYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLA  329
            QYFATEWMFKVAEGATALY++QLRGIQYITDRGAQQLSVDIEYLSNVLSALSMP+P VLA
Sbjct  734  QYFATEWMFKVAEGATALYMEQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPIPTVLA  793

Query  328  TFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  203
            TF +C STP++QLK+L+K+DSGNQLDLPTANLVCKMRR+SLE
Sbjct  794  TFQTCFSTPKNQLKDLIKTDSGNQLDLPTANLVCKMRRISLE  835



>gb|AIU51136.1| embryo yellow protein, partial [Prunus persica]
Length=838

 Score =   310 bits (793),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 144/164 (88%), Positives = 159/164 (97%), Gaps = 0/164 (0%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            +D+SRLPIWSSVEE SA  LPTFSAYPQ+YVT++GEYLLTLPQQLEPLAEGISNSDAN D
Sbjct  675  SDVSRLPIWSSVEEQSAYHLPTFSAYPQAYVTSIGEYLLTLPQQLEPLAEGISNSDANND  734

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            EAQ+FATEWMFKVAEGATALY++QLRGIQYITDRG+QQLSVDIEYLSNVLSALSMP+PPV
Sbjct  735  EAQFFATEWMFKVAEGATALYMEQLRGIQYITDRGSQQLSVDIEYLSNVLSALSMPIPPV  794

Query  334  LATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  203
            LATFH+CLSTPR QLK+L+KSDSGNQLDLPTANLVCKMRR++LE
Sbjct  795  LATFHTCLSTPRDQLKDLLKSDSGNQLDLPTANLVCKMRRLNLE  838



>ref|XP_007218916.1| hypothetical protein PRUPE_ppa001391mg [Prunus persica]
 gb|EMJ20115.1| hypothetical protein PRUPE_ppa001391mg [Prunus persica]
Length=839

 Score =   310 bits (793),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 144/164 (88%), Positives = 159/164 (97%), Gaps = 0/164 (0%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            +D+SRLPIWSSVEE SA  LPTFSAYPQ+YVT++GEYLLTLPQQLEPLAEGISNSDAN D
Sbjct  676  SDVSRLPIWSSVEEQSAYHLPTFSAYPQAYVTSIGEYLLTLPQQLEPLAEGISNSDANND  735

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            EAQ+FATEWMFKVAEGATALY++QLRGIQYITDRG+QQLSVDIEYLSNVLSALSMP+PPV
Sbjct  736  EAQFFATEWMFKVAEGATALYMEQLRGIQYITDRGSQQLSVDIEYLSNVLSALSMPIPPV  795

Query  334  LATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  203
            LATFH+CLSTPR QLK+L+KSDSGNQLDLPTANLVCKMRR++LE
Sbjct  796  LATFHTCLSTPRDQLKDLLKSDSGNQLDLPTANLVCKMRRLNLE  839



>ref|XP_008234406.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Prunus 
mume]
Length=839

 Score =   309 bits (792),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 144/164 (88%), Positives = 159/164 (97%), Gaps = 0/164 (0%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            +D+SRLPIWSSVEE SA  LPTFSAYPQ+YVT++GEYLLTLPQQLEPLAEGISNSDAN D
Sbjct  676  SDVSRLPIWSSVEEQSAYHLPTFSAYPQAYVTSIGEYLLTLPQQLEPLAEGISNSDANND  735

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            EAQ+FATEWMFKVAEGATALY++QLRGIQYITDRG+QQLSVDIEYLSNVLSALSMP+PPV
Sbjct  736  EAQFFATEWMFKVAEGATALYMEQLRGIQYITDRGSQQLSVDIEYLSNVLSALSMPIPPV  795

Query  334  LATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  203
            LATFH+CLSTPR QLK+L+KSDSGNQLDLPTANLVCKMRR++LE
Sbjct  796  LATFHTCLSTPRDQLKDLLKSDSGNQLDLPTANLVCKMRRLNLE  839



>ref|XP_010089680.1| hypothetical protein L484_001268 [Morus notabilis]
 gb|EXC36303.1| hypothetical protein L484_001268 [Morus notabilis]
Length=833

 Score =   309 bits (791),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 144/164 (88%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            +D+S LPIWS+VEE SA PLP+FSAYPQ+YVT+VGEYLLTLPQQLEPLAEGISN+DAN D
Sbjct  670  SDVSHLPIWSAVEEQSAFPLPSFSAYPQAYVTSVGEYLLTLPQQLEPLAEGISNNDANND  729

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            EAQ+FATEWMFKVAEGATALY++QLRGIQYITDRGAQQLSVDIEYLSNVLSALSMP+PPV
Sbjct  730  EAQFFATEWMFKVAEGATALYMEQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPIPPV  789

Query  334  LATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  203
            LATFH+CLST R +LKELVKSDSGNQLDLPTANLVCKMRRVSL+
Sbjct  790  LATFHTCLSTSRDELKELVKSDSGNQLDLPTANLVCKMRRVSLD  833



>ref|XP_011033997.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Populus euphratica]
 ref|XP_011010844.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Populus euphratica]
Length=831

 Score =   307 bits (787),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 142/164 (87%), Positives = 159/164 (97%), Gaps = 0/164 (0%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            +D+SRLPIWS+V+EHS+  LPTFSAYPQSYVT+VGEYLLTLPQQLEPLA+GISN+DAN D
Sbjct  668  SDVSRLPIWSAVDEHSSFRLPTFSAYPQSYVTSVGEYLLTLPQQLEPLADGISNNDANND  727

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            EAQ+FATEWMFKVAEGATALY++QLRGIQYITDRGAQQLSVDIEYLSNVLSALSMP+PP+
Sbjct  728  EAQFFATEWMFKVAEGATALYMEQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPIPPI  787

Query  334  LATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  203
            LATFH+CLSTPR QLK+LVKSDSGNQLDL TANLVCK+RRVSL+
Sbjct  788  LATFHTCLSTPRDQLKQLVKSDSGNQLDLSTANLVCKIRRVSLD  831



>gb|AIU51131.1| embryo yellow protein, partial [Manihot esculenta]
Length=833

 Score =   307 bits (786),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/164 (86%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            +D+SRLPIWSS+EE  A PLPTFSAYPQSYV++VGEYLLTLPQQLEPLAEGIS+SD N D
Sbjct  670  SDVSRLPIWSSIEEQGAFPLPTFSAYPQSYVSSVGEYLLTLPQQLEPLAEGISSSDVNND  729

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            EAQ+FATEWMFKVAEGATALY++QLRGIQYITDRGAQQL+VDIEYLSNVLSALSMP+PPV
Sbjct  730  EAQFFATEWMFKVAEGATALYMEQLRGIQYITDRGAQQLAVDIEYLSNVLSALSMPIPPV  789

Query  334  LATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  203
            LATFH+CLSTPR QLK LVKSD+GNQLDLPTANLVCK+RR+SL+
Sbjct  790  LATFHTCLSTPRDQLKHLVKSDAGNQLDLPTANLVCKIRRISLD  833



>ref|XP_002304412.2| conserved oligomeric Golgi complex component-related family protein 
[Populus trichocarpa]
 gb|EEE79391.2| conserved oligomeric Golgi complex component-related family protein 
[Populus trichocarpa]
 gb|AIU51135.1| embryo yellow protein, partial [Populus trichocarpa]
Length=831

 Score =   305 bits (782),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 141/164 (86%), Positives = 159/164 (97%), Gaps = 0/164 (0%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            +D+SRLPIWS+V+EHS+  LPTFSAYPQSYVT+VGEYLLTLPQQLEPLA+GISN+DAN +
Sbjct  668  SDVSRLPIWSAVDEHSSFRLPTFSAYPQSYVTSVGEYLLTLPQQLEPLADGISNNDANNE  727

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            EAQ+FATEWMFKVAEGATALY++QLRGIQYITDRGAQQLSVDIEYLSNVLSALSMP+PP+
Sbjct  728  EAQFFATEWMFKVAEGATALYMEQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPIPPI  787

Query  334  LATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  203
            LATFH+CLSTPR QLK+LVKSDSGNQLDL TANLVCK+RRVSL+
Sbjct  788  LATFHTCLSTPRDQLKQLVKSDSGNQLDLSTANLVCKIRRVSLD  831



>ref|XP_002267657.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Vitis 
vinifera]
 emb|CBI24597.3| unnamed protein product [Vitis vinifera]
 gb|AIU51148.1| embryo yellow protein, partial [Vitis vinifera]
Length=838

 Score =   305 bits (781),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 141/164 (86%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            +D+SRLPIWS+VEE SA PLP+F+AYPQ+YVT+VGEYLLTLPQQLEPLAEGIS+SD NAD
Sbjct  675  SDVSRLPIWSAVEEPSAFPLPSFNAYPQAYVTSVGEYLLTLPQQLEPLAEGISSSDPNAD  734

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            EAQ+FATEWMFKVAEGATALY++QLRGIQYITDRGAQQLS DIEYLSNVLSALSMP+PP+
Sbjct  735  EAQFFATEWMFKVAEGATALYMEQLRGIQYITDRGAQQLSADIEYLSNVLSALSMPIPPI  794

Query  334  LATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  203
            LATFHSCLSTPR QLK+ VKSD+GNQLDLPTANLVCK+RRV LE
Sbjct  795  LATFHSCLSTPRDQLKDFVKSDAGNQLDLPTANLVCKIRRVGLE  838



>ref|XP_011076371.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Sesamum 
indicum]
Length=838

 Score =   304 bits (778),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 143/164 (87%), Positives = 155/164 (95%), Gaps = 0/164 (0%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            +DLSRLPIWSSVEE SA P+P+FSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANA+
Sbjct  675  SDLSRLPIWSSVEEPSAFPVPSFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAE  734

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            EAQ+FATEWMFKVAEGATALY++QLRGI  ITDRGAQQLSVDIEYLSNVLSALSMP+PPV
Sbjct  735  EAQFFATEWMFKVAEGATALYIEQLRGIHKITDRGAQQLSVDIEYLSNVLSALSMPIPPV  794

Query  334  LATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  203
            L+TFH+C STP  QLK+LVKSDSGNQLDLPTANLVCKMR V L+
Sbjct  795  LSTFHTCFSTPTDQLKDLVKSDSGNQLDLPTANLVCKMRGVRLD  838



>ref|XP_004307803.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Fragaria 
vesca subsp. vesca]
Length=832

 Score =   303 bits (776),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 140/164 (85%), Positives = 156/164 (95%), Gaps = 0/164 (0%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            +D+SRLPIWSSVEE S   LPTFSA PQSYVTNVGEYLLTLPQQLEPLAEGI+NSDAN +
Sbjct  669  SDVSRLPIWSSVEEQSVYHLPTFSASPQSYVTNVGEYLLTLPQQLEPLAEGIANSDANNE  728

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            EAQ+FATEWMFKVAEGATALY++QLRGIQYITDRGAQQLSVDIEYLSNVLSALSMP+PPV
Sbjct  729  EAQFFATEWMFKVAEGATALYMEQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPIPPV  788

Query  334  LATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  203
            L+TFH+CLSTPR QL++L+KSDSGNQLDLPTANL+CKMRRV ++
Sbjct  789  LSTFHTCLSTPRDQLRDLIKSDSGNQLDLPTANLICKMRRVIID  832



>ref|XP_007038383.1| Oligomeric Golgi complex component-related / COG complex component-related 
[Theobroma cacao]
 gb|EOY22884.1| Oligomeric Golgi complex component-related / COG complex component-related 
[Theobroma cacao]
Length=832

 Score =   303 bits (776),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 141/164 (86%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            +D+SRLPIWS+VEE SA PLPTFSAYPQSYVT+VGEYLLTLPQQLEPLAEGISNSDA+ +
Sbjct  668  SDVSRLPIWSAVEEQSAFPLPTFSAYPQSYVTSVGEYLLTLPQQLEPLAEGISNSDASNE  727

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            EAQ+FATEWMFKVAEGATALY++QLRGIQYITDRGAQQLSVDIEYLSNVLSALSMP+PPV
Sbjct  728  EAQFFATEWMFKVAEGATALYMEQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPIPPV  787

Query  334  LATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  203
            LATF +C  TPR QLK+L+KSDSGNQLDLPTANLVCK+RRV+L+
Sbjct  788  LATFQTCFGTPRDQLKDLLKSDSGNQLDLPTANLVCKIRRVNLD  831



>gb|AIU51110.1| embryo yellow protein, partial [Theobroma cacao]
Length=831

 Score =   303 bits (775),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 141/164 (86%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            +D+SRLPIWS+VEE SA PLPTFSAYPQSYVT+VGEYLLTLPQQLEPLAEGISNSDA+ +
Sbjct  668  SDVSRLPIWSAVEEQSAFPLPTFSAYPQSYVTSVGEYLLTLPQQLEPLAEGISNSDASNE  727

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            EAQ+FATEWMFKVAEGATALY++QLRGIQYITDRGAQQLSVDIEYLSNVLSALSMP+PPV
Sbjct  728  EAQFFATEWMFKVAEGATALYMEQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPIPPV  787

Query  334  LATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  203
            LATF +C  TPR QLK+L+KSDSGNQLDLPTANLVCK+RRV+L+
Sbjct  788  LATFQTCFGTPRDQLKDLLKSDSGNQLDLPTANLVCKIRRVNLD  831



>ref|XP_003534367.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
isoform X1 [Glycine max]
Length=834

 Score =   303 bits (775),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 142/164 (87%), Positives = 158/164 (96%), Gaps = 1/164 (1%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            +D+SRLPIWSSVEE  A PLPTFSAYPQSYVT+VGEYLLTLPQQLEPLAEGISN++ N D
Sbjct  671  SDVSRLPIWSSVEEQGAFPLPTFSAYPQSYVTSVGEYLLTLPQQLEPLAEGISNNEVN-D  729

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            EAQ+FATEWMFKVAEGATALY++QLRGIQYI+DRGAQQLSVDIEYLSNVLSALSMP+PPV
Sbjct  730  EAQFFATEWMFKVAEGATALYIEQLRGIQYISDRGAQQLSVDIEYLSNVLSALSMPIPPV  789

Query  334  LATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  203
            LATF SCLSTPR+QLK+L+K+DSGNQLDLPTANLVCKMRRV+L+
Sbjct  790  LATFQSCLSTPRNQLKDLLKTDSGNQLDLPTANLVCKMRRVNLD  833



>gb|AIU51125.1| embryo yellow protein, partial [Chimonanthus praecox]
Length=828

 Score =   302 bits (774),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 141/168 (84%), Positives = 157/168 (93%), Gaps = 0/168 (0%)
 Frame = -3

Query  712  KYDNTSNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISN  533
            K  +  +D+SRLPIWSSVEE SA  LP+FSAYPQSYVT+VGEYLLTLPQQLEPLAEGISN
Sbjct  661  KVRHRLSDVSRLPIWSSVEEASAFHLPSFSAYPQSYVTSVGEYLLTLPQQLEPLAEGISN  720

Query  532  SDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALS  353
            SDAN DEAQ+FATEWMFKVAEGATALY++QLRGIQY+TDRGAQQLS DIEYLSNVLSALS
Sbjct  721  SDANTDEAQFFATEWMFKVAEGATALYIEQLRGIQYMTDRGAQQLSADIEYLSNVLSALS  780

Query  352  MPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVS  209
            MP+PPVLATFH+CLSTPR QL++L+KSD GNQLDLPTANLVCK+RRV+
Sbjct  781  MPIPPVLATFHTCLSTPRDQLRDLLKSDGGNQLDLPTANLVCKIRRVN  828



>gb|AIU51119.1| embryo yellow protein, partial [Glycine max]
Length=833

 Score =   302 bits (774),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 142/164 (87%), Positives = 158/164 (96%), Gaps = 1/164 (1%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            +D+SRLPIWSSVEE  A PLPTFSAYPQSYVT+VGEYLLTLPQQLEPLAEGISN++ N D
Sbjct  671  SDVSRLPIWSSVEEQGAFPLPTFSAYPQSYVTSVGEYLLTLPQQLEPLAEGISNNEVN-D  729

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            EAQ+FATEWMFKVAEGATALY++QLRGIQYI+DRGAQQLSVDIEYLSNVLSALSMP+PPV
Sbjct  730  EAQFFATEWMFKVAEGATALYIEQLRGIQYISDRGAQQLSVDIEYLSNVLSALSMPIPPV  789

Query  334  LATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  203
            LATF SCLSTPR+QLK+L+K+DSGNQLDLPTANLVCKMRRV+L+
Sbjct  790  LATFQSCLSTPRNQLKDLLKTDSGNQLDLPTANLVCKMRRVNLD  833



>ref|XP_009372929.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Pyrus x bretschneideri]
Length=651

 Score =   298 bits (763),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 141/161 (88%), Positives = 152/161 (94%), Gaps = 1/161 (1%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            +D+SRLPIWSSVEE SA  LPTFSAYPQ+YVT++GEYLLTLPQQLEPL EGISNSDAN D
Sbjct  488  SDVSRLPIWSSVEEQSAYNLPTFSAYPQAYVTSIGEYLLTLPQQLEPLVEGISNSDANND  547

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            EAQ FATEWMFKVAEGATALY +QLRGIQYITDRGAQQLSVDIEYLSNVLSALSMP+PPV
Sbjct  548  EAQIFATEWMFKVAEGATALYTEQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPIPPV  607

Query  334  LATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRV  212
            LATFH+CLSTPR QLK+LVKSD+GN LDLPTANLVCKMRR+
Sbjct  608  LATFHTCLSTPRDQLKDLVKSDAGN-LDLPTANLVCKMRRL  647



>gb|KHN11738.1| Conserved oligomeric Golgi complex subunit 7 [Glycine soja]
Length=834

 Score =   302 bits (774),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 142/164 (87%), Positives = 158/164 (96%), Gaps = 1/164 (1%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            +D+SRLPIWSSVEE  A PLPTFSAYPQSYVT+VGEYLLTLPQQLEPLAEGISN++ N D
Sbjct  671  SDVSRLPIWSSVEEQGAFPLPTFSAYPQSYVTSVGEYLLTLPQQLEPLAEGISNNEVN-D  729

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            EAQ+FATEWMFKVAEGATALY++QLRGIQYI+DRGAQQLSVDIEYLSNVLSALSMP+PPV
Sbjct  730  EAQFFATEWMFKVAEGATALYIEQLRGIQYISDRGAQQLSVDIEYLSNVLSALSMPIPPV  789

Query  334  LATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  203
            LATF SCLSTPR+QLK+L+K+DSGNQLDLPTANLVCKMRRV+L+
Sbjct  790  LATFQSCLSTPRNQLKDLLKTDSGNQLDLPTANLVCKMRRVNLD  833



>gb|KHG21476.1| Conserved oligomeric Golgi complex subunit 7 [Gossypium arboreum]
Length=420

 Score =   291 bits (746),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 136/164 (83%), Positives = 154/164 (94%), Gaps = 0/164 (0%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            +++SR+PIWS+ EE SA  LPTFSAYPQ YVT+VGEYLLTLPQQLEPLAEGISNSDAN D
Sbjct  257  SEVSRMPIWSAAEEQSAFRLPTFSAYPQPYVTSVGEYLLTLPQQLEPLAEGISNSDANND  316

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            EAQ+FATEWMFKVAEGATALY++QLRGIQYITD GAQQLSVDIEYLSNVLSALSMP+PPV
Sbjct  317  EAQFFATEWMFKVAEGATALYMEQLRGIQYITDGGAQQLSVDIEYLSNVLSALSMPIPPV  376

Query  334  LATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  203
            LATF +CL TPR QLK+L+KSD+GNQLDLPTANLVCK+RR++L+
Sbjct  377  LATFQTCLGTPRDQLKDLLKSDNGNQLDLPTANLVCKIRRLNLD  420



>ref|XP_007131467.1| hypothetical protein PHAVU_011G016000g [Phaseolus vulgaris]
 gb|ESW03461.1| hypothetical protein PHAVU_011G016000g [Phaseolus vulgaris]
Length=834

 Score =   302 bits (773),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 141/164 (86%), Positives = 158/164 (96%), Gaps = 1/164 (1%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            +++SRLPIWSSVEE    PLPTFSAYPQSYVT+VGEYLLTLPQQLEPLAEGISNS+AN D
Sbjct  671  SEVSRLPIWSSVEEQGGYPLPTFSAYPQSYVTSVGEYLLTLPQQLEPLAEGISNSEAN-D  729

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            EAQ+FATEWMFKVAEGATALY+DQLRGIQYI+DRGAQQLSVDIEYLSNVLSALSMP+PPV
Sbjct  730  EAQFFATEWMFKVAEGATALYIDQLRGIQYISDRGAQQLSVDIEYLSNVLSALSMPIPPV  789

Query  334  LATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  203
            LATF SCLS+PR+QLK+L+K+DSGNQLD+PTANLVCKMRRV+L+
Sbjct  790  LATFQSCLSSPRNQLKDLLKTDSGNQLDMPTANLVCKMRRVNLD  833



>gb|AIU51138.1| embryo yellow protein, partial [Phaseolus vulgaris]
Length=833

 Score =   302 bits (773),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 141/164 (86%), Positives = 158/164 (96%), Gaps = 1/164 (1%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            +++SRLPIWSSVEE    PLPTFSAYPQSYVT+VGEYLLTLPQQLEPLAEGISNS+AN D
Sbjct  671  SEVSRLPIWSSVEEQGGYPLPTFSAYPQSYVTSVGEYLLTLPQQLEPLAEGISNSEAN-D  729

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            EAQ+FATEWMFKVAEGATALY+DQLRGIQYI+DRGAQQLSVDIEYLSNVLSALSMP+PPV
Sbjct  730  EAQFFATEWMFKVAEGATALYIDQLRGIQYISDRGAQQLSVDIEYLSNVLSALSMPIPPV  789

Query  334  LATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  203
            LATF SCLS+PR+QLK+L+K+DSGNQLD+PTANLVCKMRRV+L+
Sbjct  790  LATFQSCLSSPRNQLKDLLKTDSGNQLDMPTANLVCKMRRVNLD  833



>gb|AIU51115.1| embryo yellow protein, partial [Carica papaya]
Length=839

 Score =   301 bits (772),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 141/164 (86%), Positives = 156/164 (95%), Gaps = 0/164 (0%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            +D++ LPIWS+VEE SA PLPTFSAYPQSYVT+VGEYLLTLPQQLEPLAEGISNSD N+D
Sbjct  676  SDVAHLPIWSAVEEQSAFPLPTFSAYPQSYVTSVGEYLLTLPQQLEPLAEGISNSDINSD  735

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            EAQ+FATEWMFKVAEGATALY++QLRGIQYITD GAQQLSVDIEYLSNVLSALSMPVPPV
Sbjct  736  EAQFFATEWMFKVAEGATALYMEQLRGIQYITDHGAQQLSVDIEYLSNVLSALSMPVPPV  795

Query  334  LATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  203
            LATF +CLST R QLK+L+K+DSGNQLDLPTANLVCK+RRVSL+
Sbjct  796  LATFQTCLSTQRDQLKDLIKADSGNQLDLPTANLVCKIRRVSLD  839



>ref|XP_008376080.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Malus domestica]
Length=838

 Score =   301 bits (771),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 143/164 (87%), Positives = 157/164 (96%), Gaps = 1/164 (1%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            +D+SRLPIWSSVEE SA  LPTFSAYPQ+YVT++GEYLLTLPQQLEPLAEGISNSDAN D
Sbjct  676  SDVSRLPIWSSVEEQSAYHLPTFSAYPQAYVTSIGEYLLTLPQQLEPLAEGISNSDANND  735

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            EAQ FATEWMFKVAEGATALY++QLRGIQYITDRGAQQLSVDIEYLSNVLSALSMP+PPV
Sbjct  736  EAQIFATEWMFKVAEGATALYMEQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPIPPV  795

Query  334  LATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  203
            LATFH+CLSTPR QLK+LVKSD+GN LDLPTANLVCK+RR+SL+
Sbjct  796  LATFHTCLSTPRDQLKDLVKSDAGN-LDLPTANLVCKIRRLSLD  838



>ref|XP_009340575.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Pyrus x bretschneideri]
Length=837

 Score =   301 bits (771),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 143/164 (87%), Positives = 157/164 (96%), Gaps = 1/164 (1%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            +D+SRLPIWSSVEE SA  LPTFSAYPQ+YVT++GEYLLTLPQQLEPLAEGISNSDAN D
Sbjct  675  SDVSRLPIWSSVEEQSAYHLPTFSAYPQAYVTSIGEYLLTLPQQLEPLAEGISNSDANND  734

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            EAQ FATEWMFKVAEGATALY++QLRGIQYITDRGAQQLSVDIEYLSNVLSALSMP+PPV
Sbjct  735  EAQIFATEWMFKVAEGATALYMEQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPIPPV  794

Query  334  LATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  203
            LATFH+CLSTPR QLK+LVKSD+GN LDLPTANLVCK+RR+SL+
Sbjct  795  LATFHTCLSTPRDQLKDLVKSDAGN-LDLPTANLVCKIRRLSLD  837



>gb|KHN46499.1| Conserved oligomeric Golgi complex subunit 7 [Glycine soja]
Length=834

 Score =   300 bits (768),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 140/164 (85%), Positives = 158/164 (96%), Gaps = 1/164 (1%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            +D+SRLPIWSSVEE  + PLPTFSAYPQSYVT+VGEYLLTLPQQLEPLAEGISN++ N D
Sbjct  671  SDVSRLPIWSSVEEQGSFPLPTFSAYPQSYVTSVGEYLLTLPQQLEPLAEGISNNEVN-D  729

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            EAQ+FATEWMFKVAEGATALY++QLRGIQYI+DRGAQQLSVDIEYLSNVLSALSMP+PPV
Sbjct  730  EAQFFATEWMFKVAEGATALYIEQLRGIQYISDRGAQQLSVDIEYLSNVLSALSMPIPPV  789

Query  334  LATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  203
            LATF SCLSTPR+QLK+L+K+DSGNQLD+PTANLVCKMRRV+L+
Sbjct  790  LATFQSCLSTPRNQLKDLLKTDSGNQLDMPTANLVCKMRRVNLD  833



>emb|CDP05334.1| unnamed protein product [Coffea canephora]
Length=845

 Score =   300 bits (769),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 141/165 (85%), Positives = 157/165 (95%), Gaps = 1/165 (1%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            NDLSRLP+WSSV+E SA PLP+FS+YPQSYVTNVGEYLLTLPQQLEPLAEGIS+SD NAD
Sbjct  681  NDLSRLPVWSSVDEPSAFPLPSFSSYPQSYVTNVGEYLLTLPQQLEPLAEGISSSDTNAD  740

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            EAQ+FATEWMFKVAEGA+ LY++QLRGIQY+TDRGAQQL+ DIEYLSNVLSALSMP+PPV
Sbjct  741  EAQFFATEWMFKVAEGASTLYMEQLRGIQYVTDRGAQQLAADIEYLSNVLSALSMPIPPV  800

Query  334  LATFHSCLSTPRSQLKELVK-SDSGNQLDLPTANLVCKMRRVSLE  203
            LATF +CLSTPR QLK+LVK SDSGNQLDLPTANLVCKMRR+SL+
Sbjct  801  LATFQTCLSTPREQLKDLVKSSDSGNQLDLPTANLVCKMRRLSLD  845



>ref|XP_009374477.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Pyrus x bretschneideri]
Length=837

 Score =   300 bits (767),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 142/164 (87%), Positives = 156/164 (95%), Gaps = 1/164 (1%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            +D+SRLPIWSSVEE SA  LPTFSAYPQ+YVT++GEYLLTLPQQLEPLAEGISNSD N D
Sbjct  675  SDVSRLPIWSSVEEQSAYHLPTFSAYPQAYVTSIGEYLLTLPQQLEPLAEGISNSDVNND  734

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            EAQ FATEWMFKVAEGATALY++QLRGIQYITDRGAQQLSVDIEYLSNVLSALSMP+PPV
Sbjct  735  EAQIFATEWMFKVAEGATALYMEQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPIPPV  794

Query  334  LATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  203
            LATFH+CLSTPR QLKELV+SD+GN LDLPTANLVCK+RR+SL+
Sbjct  795  LATFHTCLSTPRDQLKELVQSDAGN-LDLPTANLVCKIRRLSLD  837



>gb|AIU51152.1| embryo yellow protein, partial [Platanus x acerifolia]
Length=839

 Score =   298 bits (762),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 139/164 (85%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            +D+SRLPIWSSVEE SA PLP+FSAYPQSYVT+VGEYLLTLPQQLEPLAEGIS+SDAN D
Sbjct  676  SDVSRLPIWSSVEEPSAFPLPSFSAYPQSYVTSVGEYLLTLPQQLEPLAEGISSSDANTD  735

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            EAQ+FATEWMFKVAEGATALY++QLRGIQYITDRGA QLS DIEYLSNVLSALSMP+P V
Sbjct  736  EAQFFATEWMFKVAEGATALYMEQLRGIQYITDRGALQLSADIEYLSNVLSALSMPIPQV  795

Query  334  LATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  203
            LATFH+CLSTPR QL++L+KSD+GNQLDLPTA+LVCK+RRV+L+
Sbjct  796  LATFHTCLSTPRDQLRDLLKSDAGNQLDLPTAHLVCKIRRVTLD  839



>gb|AIU51106.1| embryo yellow protein, partial [Magnolia denudata]
Length=829

 Score =   296 bits (758),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 135/162 (83%), Positives = 155/162 (96%), Gaps = 0/162 (0%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            +D+SR+PIWSSVEE +A PLP+FSAYPQ+YVT+VGEYLLTLPQQLEPLAEGIS+SD N D
Sbjct  668  SDVSRMPIWSSVEEPTAFPLPSFSAYPQAYVTSVGEYLLTLPQQLEPLAEGISSSDPNTD  727

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            EAQ+FATEWMFKVAEGAT LY++QLRGIQYITDRGAQQLS DIEYLSNVLSALSMP+PP+
Sbjct  728  EAQFFATEWMFKVAEGATTLYMEQLRGIQYITDRGAQQLSADIEYLSNVLSALSMPIPPI  787

Query  334  LATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVS  209
            LATFH+CLSTPR QL++LVKSD+GNQLDLPTA+LVCK+RRV+
Sbjct  788  LATFHTCLSTPRDQLRDLVKSDAGNQLDLPTAHLVCKIRRVT  829



>gb|AIU51151.1| embryo yellow protein, partial [Cinnamomum camphora]
Length=838

 Score =   295 bits (756),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 136/164 (83%), Positives = 156/164 (95%), Gaps = 0/164 (0%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            +D++RLPIWSSVEE SA  LP+FSAYPQ+YVT+VGEYLLTLPQQLEPLAEGIS+S+AN D
Sbjct  675  SDVARLPIWSSVEEASAFHLPSFSAYPQAYVTSVGEYLLTLPQQLEPLAEGISSSEANTD  734

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            EAQ+FATEWMFKVAEGATALY++QLRGI YITDRGAQQLS DIEYLSNVLSALSMP+PPV
Sbjct  735  EAQFFATEWMFKVAEGATALYMEQLRGIHYITDRGAQQLSTDIEYLSNVLSALSMPIPPV  794

Query  334  LATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  203
            +ATFH+CLSTPR QL++LVKSDSG+QLDLP ANLVCK+RRV+L+
Sbjct  795  MATFHTCLSTPRDQLRDLVKSDSGSQLDLPIANLVCKIRRVNLD  838



>ref|XP_006490119.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Citrus sinensis]
Length=835

 Score =   295 bits (755),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 140/164 (85%), Positives = 155/164 (95%), Gaps = 1/164 (1%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            +D+SRLPIWSSVEE SA  LPTFSAYPQ+YVT+VGEYLLTLPQQLEPLAEGIS SD N D
Sbjct  673  SDVSRLPIWSSVEEQSAFHLPTFSAYPQTYVTSVGEYLLTLPQQLEPLAEGISTSDNN-D  731

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            EAQ+FATEWMFKVAEGA+ALY++QLRGIQYITD GAQQLSVDIEYLSNVLSALS+P+PP 
Sbjct  732  EAQFFATEWMFKVAEGASALYMEQLRGIQYITDHGAQQLSVDIEYLSNVLSALSVPIPPA  791

Query  334  LATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  203
            LATFH+CLSTPR QLK+L+KSDSGNQLDLPTANLVCK+RRVSL+
Sbjct  792  LATFHTCLSTPRDQLKDLLKSDSGNQLDLPTANLVCKIRRVSLD  835



>gb|KDO65493.1| hypothetical protein CISIN_1g003266mg [Citrus sinensis]
 gb|AIU51117.1| embryo yellow protein, partial [Citrus sinensis]
Length=835

 Score =   295 bits (755),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 140/164 (85%), Positives = 155/164 (95%), Gaps = 1/164 (1%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            +D+SRLPIWSSVEE SA  LPTFSAYPQ+YVT+VGEYLLTLPQQLEPLAEGIS SD N D
Sbjct  673  SDVSRLPIWSSVEEQSAFHLPTFSAYPQTYVTSVGEYLLTLPQQLEPLAEGISTSDNN-D  731

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            EAQ+FATEWMFKVAEGA+ALY++QLRGIQYITD GAQQLSVDIEYLSNVLSALS+P+PP 
Sbjct  732  EAQFFATEWMFKVAEGASALYMEQLRGIQYITDHGAQQLSVDIEYLSNVLSALSVPIPPA  791

Query  334  LATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  203
            LATFH+CLSTPR QLK+L+KSDSGNQLDLPTANLVCK+RRVSL+
Sbjct  792  LATFHTCLSTPRDQLKDLLKSDSGNQLDLPTANLVCKIRRVSLD  835



>gb|AIU51123.1| embryo yellow protein, partial [Chloranthus japonicus]
Length=567

 Score =   288 bits (737),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 135/161 (84%), Positives = 151/161 (94%), Gaps = 0/161 (0%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            ND+SRLPIWSS +E SA PLP+FSAYPQ YVT+VGEYLLTLPQQLEPLAEGIS+S+AN D
Sbjct  407  NDVSRLPIWSSFDEPSAFPLPSFSAYPQPYVTSVGEYLLTLPQQLEPLAEGISSSEANTD  466

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            EAQ+FATEWMFKVAEGATALY++QLRGIQYIT+RGAQQLS DIEYLSNVLSALSMP+PP+
Sbjct  467  EAQFFATEWMFKVAEGATALYMEQLRGIQYITERGAQQLSADIEYLSNVLSALSMPMPPI  526

Query  334  LATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRV  212
            LATFH+CLST R QL +LVKSD GNQLDLPTA+LVCK+RRV
Sbjct  527  LATFHTCLSTQRDQLHDLVKSDGGNQLDLPTAHLVCKIRRV  567



>gb|EYU24953.1| hypothetical protein MIMGU_mgv1a001327mg [Erythranthe guttata]
 gb|AIU51132.1| embryo yellow protein, partial [Erythranthe guttata]
Length=839

 Score =   294 bits (753),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 138/164 (84%), Positives = 153/164 (93%), Gaps = 0/164 (0%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            N+LSRLP+WSSVEE SA P+P+FSAYPQ YVTNVGEYLLTLPQQLEPLAEGISNS+ANA+
Sbjct  676  NELSRLPVWSSVEETSAHPVPSFSAYPQPYVTNVGEYLLTLPQQLEPLAEGISNSEANAE  735

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            EAQ+FATEWMFKVAEGATALY++QLRGIQ ITDRGAQQLSVDIEYLSNVLSALSMP P V
Sbjct  736  EAQFFATEWMFKVAEGATALYIEQLRGIQKITDRGAQQLSVDIEYLSNVLSALSMPTPLV  795

Query  334  LATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  203
            L+TFH+C STP  QLKE+VKSDSGNQLD+PTANLVCKMR + L+
Sbjct  796  LSTFHTCSSTPTDQLKEIVKSDSGNQLDIPTANLVCKMRGLRLD  839



>gb|AIU51111.1| embryo yellow protein, partial [Acorus calamus]
Length=827

 Score =   294 bits (752),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 137/162 (85%), Positives = 152/162 (94%), Gaps = 0/162 (0%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            +D+SRLPIWSSVEE +ARPLP+FSAYPQ YVT+VGEYLLTLPQQLEPLAEGIS+S+AN D
Sbjct  666  SDVSRLPIWSSVEEPTARPLPSFSAYPQPYVTSVGEYLLTLPQQLEPLAEGISSSEANTD  725

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            EAQ+FATEWMFKVAEGATALY +QLRGIQYITDRGAQQLS DIEYLSNVLSALSMP+P +
Sbjct  726  EAQFFATEWMFKVAEGATALYTEQLRGIQYITDRGAQQLSTDIEYLSNVLSALSMPIPQI  785

Query  334  LATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVS  209
            LATF +CLSTP  QL+EL+KSDS NQLDLPTANLVCK+RRVS
Sbjct  786  LATFQTCLSTPNDQLRELLKSDSANQLDLPTANLVCKIRRVS  827



>gb|AIU51147.1| embryo yellow protein, partial [Schrenkiella parvula]
Length=831

 Score =   293 bits (749),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 132/164 (80%), Positives = 154/164 (94%), Gaps = 0/164 (0%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
             D+SRLPIWSSVEE +A PLP FS+YPQSYVT+VGEYLLTLPQQLEPLAEGISN D+N +
Sbjct  668  GDVSRLPIWSSVEEQTAFPLPNFSSYPQSYVTSVGEYLLTLPQQLEPLAEGISNGDSNNE  727

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            +AQ+FATEWMFKVAEGATALYVDQLRGIQYI+DRGAQQLSVDIEYLSNVLSALSMP+PPV
Sbjct  728  DAQFFATEWMFKVAEGATALYVDQLRGIQYISDRGAQQLSVDIEYLSNVLSALSMPIPPV  787

Query  334  LATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  203
            LATF +CL+TPR +LK+++KS++G++LD PTANLVCKMRR+S +
Sbjct  788  LATFQTCLATPRDELKDVMKSEAGSELDFPTANLVCKMRRISFD  831



>ref|XP_006421663.1| hypothetical protein CICLE_v10004313mg [Citrus clementina]
 gb|ESR34903.1| hypothetical protein CICLE_v10004313mg [Citrus clementina]
 gb|AIU51113.1| embryo yellow protein, partial [Citrus clementina]
Length=835

 Score =   292 bits (748),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 139/164 (85%), Positives = 154/164 (94%), Gaps = 1/164 (1%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            +D+SRLPIWSSVEE SA  LPTFSAYPQ+YVT+VGEYLLTLPQQLEPLAEGIS SD N D
Sbjct  673  SDVSRLPIWSSVEEQSAFHLPTFSAYPQTYVTSVGEYLLTLPQQLEPLAEGISTSDNN-D  731

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            EAQ+FATEWMFKVAEGA+ALY++QLRGIQYITD GAQQLSVDIEYLSNVLSALS+P+PP 
Sbjct  732  EAQFFATEWMFKVAEGASALYMEQLRGIQYITDHGAQQLSVDIEYLSNVLSALSVPIPPA  791

Query  334  LATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  203
            LATFH+CLSTPR QLK+ +KSDSGNQLDLPTANLVCK+RRVSL+
Sbjct  792  LATFHTCLSTPRDQLKDQLKSDSGNQLDLPTANLVCKIRRVSLD  835



>gb|AIU51114.1| embryo yellow protein, partial [Gossypium raimondii]
 gb|KJB51433.1| hypothetical protein B456_008G216000 [Gossypium raimondii]
Length=830

 Score =   292 bits (747),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 136/164 (83%), Positives = 154/164 (94%), Gaps = 0/164 (0%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            +++SR+PIWS+ EE SA  LPTFSAYPQ YVT+VGEYLLTLPQQLEPLAEGISNSDAN D
Sbjct  667  SEVSRMPIWSAAEEQSAFRLPTFSAYPQPYVTSVGEYLLTLPQQLEPLAEGISNSDANND  726

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            EAQ+FATEWMFKVAEGATALY++QLRGIQYITD GAQQLSVDIEYLSNVLSALSMP+PPV
Sbjct  727  EAQFFATEWMFKVAEGATALYMEQLRGIQYITDGGAQQLSVDIEYLSNVLSALSMPIPPV  786

Query  334  LATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  203
            LATF +CL TPR QLK+L+KSD+GNQLDLPTANLVCK+RR++L+
Sbjct  787  LATFQTCLGTPRDQLKDLLKSDNGNQLDLPTANLVCKIRRLNLD  830



>gb|AIU51126.1| embryo yellow protein, partial [Pandanus utilis]
Length=477

 Score =   283 bits (724),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 129/162 (80%), Positives = 151/162 (93%), Gaps = 0/162 (0%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            +D+SRLPIWSSVEE SA PLP+FSAYPQ YVT+VGEYLLTLPQQLEPLAEGIS+S+A +D
Sbjct  316  SDVSRLPIWSSVEEQSALPLPSFSAYPQPYVTSVGEYLLTLPQQLEPLAEGISSSEAGSD  375

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            EAQ+FATEWMFKVAEGATAL+++QLRGI YITDRGAQQLS DIEYLSNVLSALSMP+PP 
Sbjct  376  EAQFFATEWMFKVAEGATALFMEQLRGIHYITDRGAQQLSADIEYLSNVLSALSMPIPPF  435

Query  334  LATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVS  209
            L+T+H+CLSTPR QL++L+KSD   QLDLPTA+LVCK+RR++
Sbjct  436  LSTYHTCLSTPRDQLRDLLKSDGATQLDLPTAHLVCKIRRIA  477



>ref|XP_003618197.1| Conserved oligomeric Golgi complex subunit [Medicago truncatula]
 gb|AES74415.1| oligomeric component-related/COG complex component [Medicago 
truncatula]
Length=755

 Score =   290 bits (743),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 139/171 (81%), Positives = 158/171 (92%), Gaps = 3/171 (2%)
 Frame = -3

Query  709  YDNTSN--DLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGIS  536
            +++T N  D+SRL IWSSVEE +A  LPTFSAYPQSYVT+VGEYLLTLPQQLEPLAEG+S
Sbjct  585  FEDTINELDVSRLSIWSSVEEQTAFRLPTFSAYPQSYVTSVGEYLLTLPQQLEPLAEGVS  644

Query  535  NSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSAL  356
            +S+AN DEAQ+FATEWMFKVAEGAT LY++QLRG+QYITDRGAQQLSVDI+YLSNVLSAL
Sbjct  645  SSEAN-DEAQFFATEWMFKVAEGATTLYIEQLRGVQYITDRGAQQLSVDIDYLSNVLSAL  703

Query  355  SMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  203
            SMP+P VLATFHSCLST R QLK+LVK+DS NQLDLPTANLVCKMRRV+L+
Sbjct  704  SMPIPAVLATFHSCLSTSRDQLKDLVKTDSANQLDLPTANLVCKMRRVNLD  754



>ref|XP_010062289.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X2 [Eucalyptus grandis]
Length=722

 Score =   289 bits (740),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 136/163 (83%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = -3

Query  691  DLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANADE  512
            D+SRLP+WSSVEE SA  LPTFS+YPQ YVT++GEYLLTLPQQLEPLAEGIS+ DA+ DE
Sbjct  560  DVSRLPVWSSVEEPSAFHLPTFSSYPQPYVTSIGEYLLTLPQQLEPLAEGISSGDASNDE  619

Query  511  AQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVL  332
            AQ+FATEWMFKVAEGATAL+++QLRGIQY+TDRGAQQLSVDIEYLSNVLSALSMPVP VL
Sbjct  620  AQFFATEWMFKVAEGATALFMEQLRGIQYMTDRGAQQLSVDIEYLSNVLSALSMPVPAVL  679

Query  331  ATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  203
            ATF +C STPR QLK+LVKSD+ NQLDLPTANLVCKMRRVSL+
Sbjct  680  ATFQTCFSTPRDQLKDLVKSDAANQLDLPTANLVCKMRRVSLD  722



>gb|KEH17632.1| oligomeric component-related/COG complex component [Medicago 
truncatula]
Length=834

 Score =   291 bits (746),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 138/164 (84%), Positives = 155/164 (95%), Gaps = 1/164 (1%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            +D+SRLPIWSSVEE  A  LPTFSAYPQSYVT+VGEYLLTLPQQLEPLAEGIS+S+AN D
Sbjct  671  SDVSRLPIWSSVEEQGAFHLPTFSAYPQSYVTSVGEYLLTLPQQLEPLAEGISSSEAN-D  729

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            EAQ+FATEWMFKVAEGATALY++QLRGIQYITDRGAQQLSVDI+YLSNVLSALSMP+P V
Sbjct  730  EAQFFATEWMFKVAEGATALYIEQLRGIQYITDRGAQQLSVDIDYLSNVLSALSMPIPAV  789

Query  334  LATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  203
            LATFHSCLST R QLK+L+K+DS NQLDLPTANLVCKMR+++L+
Sbjct  790  LATFHSCLSTSRDQLKDLLKTDSANQLDLPTANLVCKMRQLNLD  833



>emb|CDY00472.1| BnaA10g08010D [Brassica napus]
Length=234

 Score =   274 bits (701),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 126/165 (76%), Positives = 151/165 (92%), Gaps = 1/165 (1%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGIS-NSDANA  518
             ++SRLPIWSSVEE +A  LP FS+YPQ+YVT+VGEYLLTLPQQLEPLAEGIS N D+N 
Sbjct  70   GEVSRLPIWSSVEEQTAFALPNFSSYPQAYVTSVGEYLLTLPQQLEPLAEGISTNGDSNN  129

Query  517  DEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPP  338
            ++AQ+FATEWMFKVAEGATALY++QLRGIQYI+DRGAQQL VDIEYLSNVL+ALSMP+PP
Sbjct  130  EDAQFFATEWMFKVAEGATALYMEQLRGIQYISDRGAQQLCVDIEYLSNVLAALSMPIPP  189

Query  337  VLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  203
            VLATF +CL+TPR +LK+++KSD+G +LD PTANLVCKMRR+S +
Sbjct  190  VLATFQTCLATPRDELKDVMKSDAGRELDFPTANLVCKMRRISFD  234



>gb|AIU51121.1| embryo yellow protein, partial [Buxus sinica]
Length=839

 Score =   291 bits (746),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 135/164 (82%), Positives = 155/164 (95%), Gaps = 0/164 (0%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            +D+SRLPIWS VEE SA PLP+FSAYPQSYVT+VGEYLLTLPQQLEPLAEGIS+SDAN D
Sbjct  676  SDVSRLPIWSLVEEPSAFPLPSFSAYPQSYVTSVGEYLLTLPQQLEPLAEGISSSDANTD  735

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            EAQ+FATEWMFKVAEGATALY++QLRGIQYITDRG++QLS DIEYLSNVLSALSMP+P  
Sbjct  736  EAQFFATEWMFKVAEGATALYMEQLRGIQYITDRGSKQLSADIEYLSNVLSALSMPIPST  795

Query  334  LATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  203
            LATFH+CLSTPR QL++LVKSD G+QLDLPTA+LVCK+RR++L+
Sbjct  796  LATFHTCLSTPRDQLRDLVKSDQGSQLDLPTAHLVCKIRRINLD  839



>gb|AIU51103.1| embryo yellow protein, partial [Arabidopsis lyrata]
Length=835

 Score =   291 bits (745),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 131/164 (80%), Positives = 153/164 (93%), Gaps = 0/164 (0%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
             ++SRLPIWSSVEE +A PLP FS+YPQSYVT+VGEYLLTLPQQLEPLAEGI+N D+N +
Sbjct  672  GEVSRLPIWSSVEEQTAFPLPNFSSYPQSYVTSVGEYLLTLPQQLEPLAEGITNGDSNNE  731

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            +AQ+FATEWMFKVAEGATALY+DQLRGIQYI+DRGAQQLSVDIEYLSNVLSALSMP+PPV
Sbjct  732  DAQFFATEWMFKVAEGATALYMDQLRGIQYISDRGAQQLSVDIEYLSNVLSALSMPIPPV  791

Query  334  LATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  203
            LATF +CL+TPR  LK+L+KS++GN+LD PTANLVCKMRR+S +
Sbjct  792  LATFQTCLATPRDDLKDLMKSEAGNELDFPTANLVCKMRRISFD  835



>ref|XP_010692941.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Beta 
vulgaris subsp. vulgaris]
Length=836

 Score =   291 bits (744),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 132/164 (80%), Positives = 154/164 (94%), Gaps = 0/164 (0%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            +DLSR+PIWSS EE SA  LP+FSAYPQSYVT+VGEYLLTLPQQLEPLAEGIS+ DAN D
Sbjct  672  SDLSRMPIWSSAEETSAFHLPSFSAYPQSYVTSVGEYLLTLPQQLEPLAEGISSDDANTD  731

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            EAQ+FATEWMFKVAEGATA+Y++QLRGIQYITDRGAQQLSVDIEYL+NVLSALS+P+PP+
Sbjct  732  EAQFFATEWMFKVAEGATAIYIEQLRGIQYITDRGAQQLSVDIEYLANVLSALSVPIPPI  791

Query  334  LATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  203
            L+TF +CLSTPR QL++L+KSDSG QLDL TANL+CKMRR++L+
Sbjct  792  LSTFQTCLSTPRDQLRDLIKSDSGTQLDLSTANLICKMRRLNLD  835



>gb|AIU51104.1| embryo yellow protein, partial [Arabidopsis thaliana]
Length=835

 Score =   290 bits (743),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 130/164 (79%), Positives = 154/164 (94%), Gaps = 0/164 (0%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
             ++SRLPIWSSVEE +A PLP FS+YPQSYVT+VGEYLLTLPQQLEPLAEGI+N D+N +
Sbjct  672  GEVSRLPIWSSVEEQTAFPLPNFSSYPQSYVTSVGEYLLTLPQQLEPLAEGITNGDSNNE  731

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            +AQ+FATEWMFKVAEGATALY+DQLRGIQYI+DRGAQQLSVDIEYLSNVLSALSMP+PPV
Sbjct  732  DAQFFATEWMFKVAEGATALYMDQLRGIQYISDRGAQQLSVDIEYLSNVLSALSMPIPPV  791

Query  334  LATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  203
            LATF +CL+TPR +LK+++KS++GN+LD PTANLVCKMRR+S +
Sbjct  792  LATFQTCLATPRGELKDVMKSEAGNELDCPTANLVCKMRRISFD  835



>ref|XP_004506344.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Cicer arietinum]
Length=835

 Score =   290 bits (741),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 140/165 (85%), Positives = 155/165 (94%), Gaps = 2/165 (1%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            +D+SRLPIWSSVEE SA PLPTFSAYPQSYVT+VGEYLLTLPQQLEPLAEGIS+S+ N D
Sbjct  671  SDVSRLPIWSSVEEQSAFPLPTFSAYPQSYVTSVGEYLLTLPQQLEPLAEGISSSETN-D  729

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            EAQ+FATEWMFKVAEGATALY++QLRGIQYITDRGAQQLSVDI+YLSNVLSALSMP+P V
Sbjct  730  EAQFFATEWMFKVAEGATALYIEQLRGIQYITDRGAQQLSVDIDYLSNVLSALSMPIPAV  789

Query  334  LATFHSCLSTPRSQLKELVKS-DSGNQLDLPTANLVCKMRRVSLE  203
            LATF SCLST R QLK+L+K+ DS NQLDLPTANLVCKMRRV+L+
Sbjct  790  LATFQSCLSTSRDQLKDLLKTPDSANQLDLPTANLVCKMRRVNLD  834



>ref|XP_010062284.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X1 [Eucalyptus grandis]
 gb|KCW90838.1| hypothetical protein EUGRSUZ_A02893 [Eucalyptus grandis]
 gb|AIU51118.1| embryo yellow protein, partial [Eucalyptus grandis]
Length=838

 Score =   290 bits (741),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 136/163 (83%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = -3

Query  691  DLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANADE  512
            D+SRLP+WSSVEE SA  LPTFS+YPQ YVT++GEYLLTLPQQLEPLAEGIS+ DA+ DE
Sbjct  676  DVSRLPVWSSVEEPSAFHLPTFSSYPQPYVTSIGEYLLTLPQQLEPLAEGISSGDASNDE  735

Query  511  AQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVL  332
            AQ+FATEWMFKVAEGATAL+++QLRGIQY+TDRGAQQLSVDIEYLSNVLSALSMPVP VL
Sbjct  736  AQFFATEWMFKVAEGATALFMEQLRGIQYMTDRGAQQLSVDIEYLSNVLSALSMPVPAVL  795

Query  331  ATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  203
            ATF +C STPR QLK+LVKSD+ NQLDLPTANLVCKMRRVSL+
Sbjct  796  ATFQTCFSTPRDQLKDLVKSDAANQLDLPTANLVCKMRRVSLD  838



>gb|AIU51116.1| embryo yellow protein, partial [Capsella rubella]
Length=835

 Score =   290 bits (741),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 130/164 (79%), Positives = 154/164 (94%), Gaps = 0/164 (0%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
             ++SRLPIWSSVEE +A PLP FS+YPQSYVT+VGEYLLTLPQQLEPLAEGI+N D+N +
Sbjct  672  GEVSRLPIWSSVEEQTAFPLPNFSSYPQSYVTSVGEYLLTLPQQLEPLAEGITNGDSNNE  731

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            +AQ+FATEWMFKVAEGATALY+DQLRGIQYI+DRGAQQLSVDIEYLSNVLSALSMP+PPV
Sbjct  732  DAQFFATEWMFKVAEGATALYMDQLRGIQYISDRGAQQLSVDIEYLSNVLSALSMPIPPV  791

Query  334  LATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  203
            LATF +CL+TPR QLK+++KS++G++LD PTANLVCKMRR+S +
Sbjct  792  LATFQTCLATPRDQLKDVMKSEAGSELDFPTANLVCKMRRISFD  835



>gb|AIU51108.1| embryo yellow protein, partial [Pinellia ternata]
Length=829

 Score =   289 bits (739),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 132/162 (81%), Positives = 151/162 (93%), Gaps = 0/162 (0%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            ND++RLPIWSSVEE SA PLPTFSAYPQSYVT++GEYLLTLPQQLEPLAEGIS+S+  A+
Sbjct  668  NDVARLPIWSSVEEQSAHPLPTFSAYPQSYVTSIGEYLLTLPQQLEPLAEGISSSEPGAE  727

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            EAQ FATEWMFKVAEGATALY++QLRGIQYITDRGAQQLS DIEYLSNVLSALSMP+PP 
Sbjct  728  EAQLFATEWMFKVAEGATALYMEQLRGIQYITDRGAQQLSADIEYLSNVLSALSMPIPPF  787

Query  334  LATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVS  209
            LATFH+C+STPR QL E +KSD G+QLDLPTA+LVC++RR++
Sbjct  788  LATFHTCVSTPRDQLPEQIKSDGGSQLDLPTAHLVCRIRRIT  829



>ref|XP_006401980.1| hypothetical protein EUTSA_v10012691mg [Eutrema salsugineum]
 gb|ESQ43433.1| hypothetical protein EUTSA_v10012691mg [Eutrema salsugineum]
Length=832

 Score =   288 bits (737),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 132/165 (80%), Positives = 154/165 (93%), Gaps = 1/165 (1%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGIS-NSDANA  518
             D+SRLPIWSSVEE +A PLP FS+YPQSYVT+VGEYLLTLPQQLEPLAEGIS N D+N 
Sbjct  668  GDVSRLPIWSSVEEQTAFPLPNFSSYPQSYVTSVGEYLLTLPQQLEPLAEGISSNGDSNN  727

Query  517  DEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPP  338
            ++AQ+FATEWMFKVAEGATALYVDQLRGIQYI+DRGAQQLSVDIEYLSNVLSALSMP+PP
Sbjct  728  EDAQFFATEWMFKVAEGATALYVDQLRGIQYISDRGAQQLSVDIEYLSNVLSALSMPIPP  787

Query  337  VLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  203
            VLATF +CL+TPR +LK+++KS++G++LD PTANLVCKMRR+S +
Sbjct  788  VLATFQTCLATPRDELKDVMKSEAGSELDFPTANLVCKMRRISFD  832



>gb|AIU51112.1| embryo yellow protein, partial [Sarcandra glabra]
Length=836

 Score =   288 bits (736),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 133/161 (83%), Positives = 152/161 (94%), Gaps = 0/161 (0%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            +D+SRLPIWSS++E SA PLP+FSAYPQ YVT+VGEYLLTLPQQLEPLAEGIS+S+AN D
Sbjct  676  SDVSRLPIWSSIDEPSAFPLPSFSAYPQPYVTSVGEYLLTLPQQLEPLAEGISSSEANTD  735

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            EAQ+FATEWMFKVAEGATALY++QLRGIQYITDRGAQQLS DIEYLSNVLSALSMP+PP+
Sbjct  736  EAQFFATEWMFKVAEGATALYMEQLRGIQYITDRGAQQLSADIEYLSNVLSALSMPIPPI  795

Query  334  LATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRV  212
            LATFH+CLST R QL++LVKS+  NQLDLPTA+LVCK+RRV
Sbjct  796  LATFHTCLSTQRDQLRDLVKSEGSNQLDLPTAHLVCKIRRV  836



>ref|XP_002865861.1| hypothetical protein ARALYDRAFT_495214 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42120.1| hypothetical protein ARALYDRAFT_495214 [Arabidopsis lyrata subsp. 
lyrata]
Length=836

 Score =   287 bits (735),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 132/165 (80%), Positives = 153/165 (93%), Gaps = 1/165 (1%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGIS-NSDANA  518
             ++SRLPIWSSVEE +A PLP FS+YPQSYVT+VGEYLLTLPQQLEPLAEGIS N D+N 
Sbjct  672  GEVSRLPIWSSVEEQTAFPLPNFSSYPQSYVTSVGEYLLTLPQQLEPLAEGISTNGDSNN  731

Query  517  DEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPP  338
            ++AQ+FATEWMFKVAEGATALY+DQLRGIQYI+DRGAQQLSVDIEYLSNVLSALSMP+PP
Sbjct  732  EDAQFFATEWMFKVAEGATALYMDQLRGIQYISDRGAQQLSVDIEYLSNVLSALSMPIPP  791

Query  337  VLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  203
            VLATF +CL+TPR  LK+L+KS++GN+LD PTANLVCKMRR+S +
Sbjct  792  VLATFQTCLATPRDDLKDLMKSEAGNELDFPTANLVCKMRRISFD  836



>gb|AIU51128.1| embryo yellow protein, partial [Aristolochia tagala]
Length=834

 Score =   287 bits (734),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 132/162 (81%), Positives = 152/162 (94%), Gaps = 0/162 (0%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            +D+SRLPIWSSVEE SA PLP+FSAYPQSYVT+VGEYLLTLPQQLEPLAEGI++ ++N D
Sbjct  673  SDVSRLPIWSSVEEPSAHPLPSFSAYPQSYVTSVGEYLLTLPQQLEPLAEGIASRESNTD  732

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            EAQ+FATEWMFKVAEGATALY +QLRGIQYITDRGAQQL+ DIEYLSNVLSALS+P+P V
Sbjct  733  EAQFFATEWMFKVAEGATALYTEQLRGIQYITDRGAQQLAADIEYLSNVLSALSVPIPQV  792

Query  334  LATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVS  209
            LATF +CLSTPR QL++LVKSD GNQLDLPTANL+CK+RR++
Sbjct  793  LATFLTCLSTPREQLRDLVKSDGGNQLDLPTANLICKIRRIA  834



>ref|XP_008439087.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Cucumis 
melo]
Length=834

 Score =   287 bits (734),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 133/164 (81%), Positives = 151/164 (92%), Gaps = 0/164 (0%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            +D+SRLPIWSSVEEHSA PLPTFS+YPQSYVT+VGEYLLTLPQQLEPLAEGISNS+AN D
Sbjct  671  SDVSRLPIWSSVEEHSALPLPTFSSYPQSYVTSVGEYLLTLPQQLEPLAEGISNSNANND  730

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            EAQ+FA EWM KVAEG  ALY +QLRGIQ++TDRGAQQLSVDIEYL+NVLSALSM +PP 
Sbjct  731  EAQFFAAEWMCKVAEGTAALYTEQLRGIQHVTDRGAQQLSVDIEYLTNVLSALSMEIPPA  790

Query  334  LATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  203
            L+TF +C STPR QLK+L+KSDSG +LDLPTANLVCKMRRV+L+
Sbjct  791  LSTFLTCFSTPREQLKDLLKSDSGRELDLPTANLVCKMRRVNLD  834



>gb|AIU51129.1| embryo yellow protein, partial [Medicago truncatula]
Length=827

 Score =   286 bits (733),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 135/164 (82%), Positives = 150/164 (91%), Gaps = 1/164 (1%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            +D+SRLPIWSSVEE SA  LP FSAYPQSYVT+VGEYLLTLPQQLEPLAEGIS  +AN D
Sbjct  665  SDVSRLPIWSSVEEQSAFHLPAFSAYPQSYVTSVGEYLLTLPQQLEPLAEGISTGEAN-D  723

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            EAQ+FATEWMFK+AEGAT LY++QLRGIQYITDRGAQQLSVDI+YLSNVLSALSMP+P V
Sbjct  724  EAQFFATEWMFKIAEGATTLYIEQLRGIQYITDRGAQQLSVDIDYLSNVLSALSMPIPAV  783

Query  334  LATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  203
            L TFHSCLST R QLK+L+K+DS N LDLPTANLVCKMRRV+L+
Sbjct  784  LTTFHSCLSTSRDQLKDLLKTDSANHLDLPTANLVCKMRRVNLD  827



>ref|XP_003618191.1| Conserved oligomeric Golgi complex subunit [Medicago truncatula]
 gb|AES74409.1| oligomeric component-related/COG complex component [Medicago 
truncatula]
Length=828

 Score =   286 bits (733),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 135/164 (82%), Positives = 150/164 (91%), Gaps = 1/164 (1%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            +D+SRLPIWSSVEE SA  LP FSAYPQSYVT+VGEYLLTLPQQLEPLAEGIS  +AN D
Sbjct  665  SDVSRLPIWSSVEEQSAFHLPAFSAYPQSYVTSVGEYLLTLPQQLEPLAEGISTGEAN-D  723

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            EAQ+FATEWMFK+AEGAT LY++QLRGIQYITDRGAQQLSVDI+YLSNVLSALSMP+P V
Sbjct  724  EAQFFATEWMFKIAEGATTLYIEQLRGIQYITDRGAQQLSVDIDYLSNVLSALSMPIPAV  783

Query  334  LATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  203
            L TFHSCLST R QLK+L+K+DS N LDLPTANLVCKMRRV+L+
Sbjct  784  LTTFHSCLSTSRDQLKDLLKTDSANHLDLPTANLVCKMRRVNLD  827



>ref|XP_004148143.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Cucumis sativus]
 gb|KGN57266.1| hypothetical protein Csa_3G175670 [Cucumis sativus]
Length=834

 Score =   286 bits (733),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 134/164 (82%), Positives = 151/164 (92%), Gaps = 0/164 (0%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            +D+SRLPIWSSVEEHSA PLPTFS+YPQSYVT+VGEYLLTLPQQLEPLAEGISNS+AN D
Sbjct  671  SDVSRLPIWSSVEEHSALPLPTFSSYPQSYVTSVGEYLLTLPQQLEPLAEGISNSNANND  730

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            EAQ+FA EWM KVAEG  ALY +QLRGIQ++TDRGAQQLSVDIEYL+NVLSALSM +PP 
Sbjct  731  EAQFFAAEWMCKVAEGTAALYTEQLRGIQHVTDRGAQQLSVDIEYLTNVLSALSMEIPPA  790

Query  334  LATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  203
            LATF +CLST R QLK+L+KSDSG +LDLPTANLVCKMRRV+L+
Sbjct  791  LATFLTCLSTSREQLKDLLKSDSGRELDLPTANLVCKMRRVNLD  834



>ref|XP_004165037.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Cucumis sativus]
Length=834

 Score =   286 bits (733),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 134/164 (82%), Positives = 151/164 (92%), Gaps = 0/164 (0%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            +D+SRLPIWSSVEEHSA PLPTFS+YPQSYVT+VGEYLLTLPQQLEPLAEGISNS+AN D
Sbjct  671  SDVSRLPIWSSVEEHSALPLPTFSSYPQSYVTSVGEYLLTLPQQLEPLAEGISNSNANND  730

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            EAQ+FA EWM KVAEG  ALY +QLRGIQ++TDRGAQQLSVDIEYL+NVLSALSM +PP 
Sbjct  731  EAQFFAAEWMCKVAEGTAALYTEQLRGIQHVTDRGAQQLSVDIEYLTNVLSALSMEIPPA  790

Query  334  LATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  203
            LATF +CLST R QLK+L+KSDSG +LDLPTANLVCKMRRV+L+
Sbjct  791  LATFLTCLSTSREQLKDLLKSDSGRELDLPTANLVCKMRRVNLD  834



>ref|NP_199956.1| COG7-like protein EYE [Arabidopsis thaliana]
 dbj|BAB09754.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED96080.1| COG complex component-related protein [Arabidopsis thaliana]
Length=836

 Score =   286 bits (733),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 131/165 (79%), Positives = 154/165 (93%), Gaps = 1/165 (1%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGIS-NSDANA  518
             ++SRLPIWSSVEE +A PLP FS+YPQSYVT+VGEYLLTLPQQLEPLAEGIS N D+N 
Sbjct  672  GEVSRLPIWSSVEEQTAFPLPNFSSYPQSYVTSVGEYLLTLPQQLEPLAEGISTNGDSNN  731

Query  517  DEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPP  338
            ++AQ+FATEWMFKVAEGATALY+DQLRGIQYI+DRGAQQLSVDIEYLSNVLSALSMP+PP
Sbjct  732  EDAQFFATEWMFKVAEGATALYMDQLRGIQYISDRGAQQLSVDIEYLSNVLSALSMPIPP  791

Query  337  VLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  203
            VLATF +CL+TPR +LK+++KS++GN+LD PTANLVCKMRR+S +
Sbjct  792  VLATFQTCLATPRGELKDVMKSEAGNELDCPTANLVCKMRRISFD  836



>dbj|BAF00649.1| hypothetical protein [Arabidopsis thaliana]
Length=836

 Score =   286 bits (733),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 131/165 (79%), Positives = 154/165 (93%), Gaps = 1/165 (1%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGIS-NSDANA  518
             ++SRLPIWSSVEE +A PLP FS+YPQSYVT+VGEYLLTLPQQLEPLAEGIS N D+N 
Sbjct  672  GEVSRLPIWSSVEEQTAFPLPNFSSYPQSYVTSVGEYLLTLPQQLEPLAEGISTNGDSNN  731

Query  517  DEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPP  338
            ++AQ+FATEWMFKVAEGATALY+DQLRGIQYI+DRGAQQLSVDIEYLSNVLSALSMP+PP
Sbjct  732  EDAQFFATEWMFKVAEGATALYMDQLRGIQYISDRGAQQLSVDIEYLSNVLSALSMPIPP  791

Query  337  VLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  203
            VLATF +CL+TPR +LK+++KS++GN+LD PTANLVCKMRR+S +
Sbjct  792  VLATFQTCLATPRGELKDVMKSEAGNELDCPTANLVCKMRRISFD  836



>ref|XP_006280007.1| hypothetical protein CARUB_v10025880mg [Capsella rubella]
 gb|EOA12905.1| hypothetical protein CARUB_v10025880mg [Capsella rubella]
Length=836

 Score =   286 bits (732),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 131/165 (79%), Positives = 154/165 (93%), Gaps = 1/165 (1%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGIS-NSDANA  518
             ++SRLPIWSSVEE +A PLP FS+YPQSYVT+VGEYLLTLPQQLEPLAEGIS N D+N 
Sbjct  672  GEVSRLPIWSSVEEQTAFPLPNFSSYPQSYVTSVGEYLLTLPQQLEPLAEGISTNGDSNN  731

Query  517  DEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPP  338
            ++AQ+FATEWMFKVAEGATALY+DQLRGIQYI+DRGAQQLSVDIEYLSNVLSALSMP+PP
Sbjct  732  EDAQFFATEWMFKVAEGATALYMDQLRGIQYISDRGAQQLSVDIEYLSNVLSALSMPIPP  791

Query  337  VLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  203
            VLATF +CL+TPR QLK+++KS++G++LD PTANLVCKMRR+S +
Sbjct  792  VLATFQTCLATPRDQLKDVMKSEAGSELDFPTANLVCKMRRISFD  836



>ref|XP_006838140.1| hypothetical protein AMTR_s00106p00086320 [Amborella trichopoda]
 gb|ERN00709.1| hypothetical protein AMTR_s00106p00086320 [Amborella trichopoda]
Length=827

 Score =   286 bits (731),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 130/164 (79%), Positives = 152/164 (93%), Gaps = 0/164 (0%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            +D+++LP+WSSVEE  +  +P+FSAYPQ+YVT+VGEYLLTLPQQLEPLAEGISNS++NAD
Sbjct  664  SDVAKLPVWSSVEETVSHKMPSFSAYPQAYVTSVGEYLLTLPQQLEPLAEGISNSESNAD  723

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            E+Q+FATEWMFKVAEGATALY++QLRGIQYITDRGAQQLS DIEYLSNVLSALSMPV P 
Sbjct  724  ESQFFATEWMFKVAEGATALYIEQLRGIQYITDRGAQQLSADIEYLSNVLSALSMPVAPF  783

Query  334  LATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  203
            L+TFH+CL T R QL++LVKSD GNQLDLPTA L+CKMRRVSL+
Sbjct  784  LSTFHTCLLTQRDQLRDLVKSDGGNQLDLPTARLLCKMRRVSLD  827



>ref|XP_010934963.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Elaeis 
guineensis]
Length=824

 Score =   285 bits (730),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 130/164 (79%), Positives = 155/164 (95%), Gaps = 1/164 (1%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            ND+SR+PIWSSVEE SA PLP+FSAYPQ+YVT++GEYLLTLPQQLEPLAEGIS+S+A  +
Sbjct  661  NDVSRMPIWSSVEEPSALPLPSFSAYPQAYVTSIGEYLLTLPQQLEPLAEGISSSEAGTE  720

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            EAQ+FA+EWMFKVAEGATAL+++QLRGIQYITDRGAQQLS DIEYLSNVLSALSMP+PP 
Sbjct  721  EAQFFASEWMFKVAEGATALFMEQLRGIQYITDRGAQQLSADIEYLSNVLSALSMPIPPF  780

Query  334  LATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  203
            L TFH+CLSTPR Q+++L+KSD GNQLDLPTA+LVCK+RR++L+
Sbjct  781  LTTFHTCLSTPRDQIRDLLKSD-GNQLDLPTAHLVCKIRRIALD  823



>ref|XP_010443240.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Camelina sativa]
Length=836

 Score =   285 bits (730),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 131/165 (79%), Positives = 154/165 (93%), Gaps = 1/165 (1%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGIS-NSDANA  518
             ++SRLPIWSSVEE +A PLP FS+YPQSYVT+VGEYLLTLPQQLEPLAEGIS N D+N 
Sbjct  672  GEVSRLPIWSSVEEQTAFPLPNFSSYPQSYVTSVGEYLLTLPQQLEPLAEGISTNGDSNN  731

Query  517  DEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPP  338
            ++AQ+FATEWMFKVAEGATALY+DQLRGIQYI+DRGAQQLSVDIEYLSNVLSALSMPVPP
Sbjct  732  EDAQFFATEWMFKVAEGATALYMDQLRGIQYISDRGAQQLSVDIEYLSNVLSALSMPVPP  791

Query  337  VLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  203
            VLATF +CL+TPR +LK+++KS++G++LD PTANLVCKMRR+S +
Sbjct  792  VLATFQTCLATPRDELKDVMKSEAGSELDFPTANLVCKMRRISFD  836



>ref|XP_010482477.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Camelina sativa]
Length=836

 Score =   285 bits (729),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 131/165 (79%), Positives = 154/165 (93%), Gaps = 1/165 (1%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGIS-NSDANA  518
             ++SRLPIWSSVEE +A PLP FS+YPQSYVT+VGEYLLTLPQQLEPLAEGIS N D+N 
Sbjct  672  GEVSRLPIWSSVEEQTAFPLPNFSSYPQSYVTSVGEYLLTLPQQLEPLAEGISTNGDSNN  731

Query  517  DEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPP  338
            ++AQ+FATEWMFKVAEGATALY+DQLRGIQYI+DRGAQQLSVDIEYLSNVLSALSMPVPP
Sbjct  732  EDAQFFATEWMFKVAEGATALYMDQLRGIQYISDRGAQQLSVDIEYLSNVLSALSMPVPP  791

Query  337  VLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  203
            VLATF +CL+TPR +LK+++KS++G++LD PTANLVCKMRR+S +
Sbjct  792  VLATFQTCLATPRDELKDVMKSEAGSELDFPTANLVCKMRRISFD  836



>ref|XP_008796946.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Phoenix 
dactylifera]
Length=824

 Score =   285 bits (728),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 131/164 (80%), Positives = 154/164 (94%), Gaps = 1/164 (1%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            ND+SR+PIWSSVEE SA PLP+FSAYPQ+YVT+VGEYLLTLPQQLEPLAEGIS+S+A  +
Sbjct  661  NDVSRMPIWSSVEEPSALPLPSFSAYPQAYVTSVGEYLLTLPQQLEPLAEGISSSEAGTE  720

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            EAQ+FATEWMFKVAEGATAL+++QLRGIQYITDRGAQQLS DIEYLSNVLSALSMP+P  
Sbjct  721  EAQFFATEWMFKVAEGATALFMEQLRGIQYITDRGAQQLSADIEYLSNVLSALSMPIPAF  780

Query  334  LATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  203
            L TFH+CLSTPR Q+++L+KSD GNQLDLPTA+LVCK+RR++L+
Sbjct  781  LTTFHTCLSTPRDQIRDLLKSD-GNQLDLPTAHLVCKIRRIALD  823



>dbj|BAG15881.1| conserved oligomeric Golgi complex component 7-related [Arabidopsis 
thaliana]
Length=836

 Score =   285 bits (728),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 130/165 (79%), Positives = 154/165 (93%), Gaps = 1/165 (1%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGIS-NSDANA  518
             ++SRLPIWSSVEE +A PLP FS+YPQSYVT+VGEYLLTLPQQLEPLAEGIS N D+N 
Sbjct  672  GEVSRLPIWSSVEEQTAFPLPNFSSYPQSYVTSVGEYLLTLPQQLEPLAEGISTNGDSNN  731

Query  517  DEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPP  338
            ++AQ+FATEWMFKVAEGATALY+DQLRGIQYI+DRGAQQLSVDIEYLSNVLSALSMP+PP
Sbjct  732  EDAQFFATEWMFKVAEGATALYMDQLRGIQYISDRGAQQLSVDIEYLSNVLSALSMPIPP  791

Query  337  VLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  203
            VLATF +CL+TPR +LK+++KS++GN+LD PTA+LVCKMRR+S +
Sbjct  792  VLATFQTCLATPRGELKDVMKSEAGNELDCPTASLVCKMRRISFD  836



>ref|NP_001132532.1| uncharacterized protein LOC100193995 [Zea mays]
 gb|ACF81411.1| unknown [Zea mays]
Length=344

 Score =   271 bits (693),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 119/164 (73%), Positives = 150/164 (91%), Gaps = 0/164 (0%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            ++++RLPIWSSVEE    PLP+FSAYPQ+YVT+VGEYLLTLPQQLEPLAEGIS ++A  D
Sbjct  181  SEVARLPIWSSVEEQGGLPLPSFSAYPQAYVTSVGEYLLTLPQQLEPLAEGISGNEAGND  240

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            EAQ+FATEW+FKVAEGATAL+++QLRGI YITDRG+QQL+ DIEYL+NVLSALSMP+PP 
Sbjct  241  EAQFFATEWIFKVAEGATALFMEQLRGIHYITDRGSQQLAADIEYLNNVLSALSMPIPPF  300

Query  334  LATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  203
            L+TFH+C+STPR Q+++L+KSD  +QLDLPT +LVCK+RR++L+
Sbjct  301  LSTFHACVSTPRDQVRDLIKSDGASQLDLPTTHLVCKIRRITLD  344



>gb|AIU51154.1| embryo yellow protein, partial [Houttuynia cordata]
Length=833

 Score =   284 bits (726),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 132/168 (79%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = -3

Query  712  KYDNTSNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISN  533
            K  +  ND+S+LPIWS+VEE SA PLP+FSAYPQ YVT++GEYLLTLPQQLEPLAEGIS+
Sbjct  666  KVRHRLNDVSQLPIWSAVEEPSAFPLPSFSAYPQLYVTSIGEYLLTLPQQLEPLAEGISS  725

Query  532  SDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALS  353
            +D+N+DEAQ+FATEWMFKVAEGATALY++QLRGIQYITDRGAQQLS DIEYLSNVLSALS
Sbjct  726  NDSNSDEAQFFATEWMFKVAEGATALYLEQLRGIQYITDRGAQQLSADIEYLSNVLSALS  785

Query  352  MPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVS  209
             P+P  LATFH+CLST R QL +LVKSD GNQLDLPTA+LVCK+RR++
Sbjct  786  TPIPLALATFHTCLSTARDQLHDLVKSDGGNQLDLPTAHLVCKIRRIT  833



>ref|XP_010264264.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Nelumbo 
nucifera]
Length=839

 Score =   283 bits (725),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 133/164 (81%), Positives = 154/164 (94%), Gaps = 0/164 (0%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            +D+SRLPIWSSVEE SA PLP+FSAYPQ+YVT+VGEYLLTLPQQLEPLAEGIS+SDANAD
Sbjct  675  SDVSRLPIWSSVEEPSAFPLPSFSAYPQTYVTSVGEYLLTLPQQLEPLAEGISSSDANAD  734

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            EAQ+FATEWMFKVAEGA A+Y +QLRGIQYITDRGAQQLS DIEYLSNVLSALSMPVP V
Sbjct  735  EAQFFATEWMFKVAEGAVAIYTEQLRGIQYITDRGAQQLSADIEYLSNVLSALSMPVPQV  794

Query  334  LATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  203
            L+TFH+ LST R ++++L+KSD+ +QLDLPTA+LVCKMRRV+L+
Sbjct  795  LSTFHTFLSTSRDKIQDLLKSDAVSQLDLPTAHLVCKMRRVTLD  838



>gb|AIU51143.1| embryo yellow protein, partial [Yucca filamentosa]
Length=822

 Score =   283 bits (723),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 125/162 (77%), Positives = 153/162 (94%), Gaps = 0/162 (0%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            +D+SR+P+WSSVEE SA PLP+FSAYPQ+Y+T+VGEYLLTLPQQLEPLAEGIS+SD   D
Sbjct  661  SDVSRMPVWSSVEEPSALPLPSFSAYPQAYITSVGEYLLTLPQQLEPLAEGISSSDGGTD  720

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            EAQ+FATEWMFKVAEGATAL+++QLRGI YITDRGAQQLS DIEYLSNVLSALSMP+PP 
Sbjct  721  EAQFFATEWMFKVAEGATALFMEQLRGIHYITDRGAQQLSADIEYLSNVLSALSMPIPPF  780

Query  334  LATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVS  209
            L+T+H+CLSTPR QL++L+KS++G+QLD+PTA+LVCK+RR++
Sbjct  781  LSTYHTCLSTPRDQLQDLIKSEAGSQLDIPTAHLVCKIRRIA  822



>gb|AIU51105.1| embryo yellow protein, partial [Lilium brownii]
Length=450

 Score =   273 bits (699),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 124/161 (77%), Positives = 149/161 (93%), Gaps = 0/161 (0%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            +++SRLPIWSSVEE S+ PLP+FSAYPQ+YVT+VGEYLLTLPQQLEPLAEGIS+S+ NA+
Sbjct  290  SEVSRLPIWSSVEEPSSLPLPSFSAYPQAYVTSVGEYLLTLPQQLEPLAEGISSSENNAE  349

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            EAQ+FATEWMFKVAEGAT L+++QLRGI YIT+RGAQQLS DIEYL+NVLSALSMP+PP 
Sbjct  350  EAQFFATEWMFKVAEGATDLFMEQLRGIHYITERGAQQLSADIEYLTNVLSALSMPIPPF  409

Query  334  LATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRV  212
            L TFH+CLSTPR Q +EL+K+D G+QLD PTA+LVCK+RR+
Sbjct  410  LTTFHTCLSTPRDQFRELLKADGGSQLDQPTAHLVCKIRRL  450



>ref|XP_006657236.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Oryza brachyantha]
Length=824

 Score =   283 bits (723),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 126/162 (78%), Positives = 149/162 (92%), Gaps = 0/162 (0%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            N+++RLPIWSSVEE    PLP+FSAYPQ+YVT+VGEYLLTLPQQLEPLAEGIS S+A  +
Sbjct  661  NEVARLPIWSSVEEQGGLPLPSFSAYPQAYVTSVGEYLLTLPQQLEPLAEGISGSEAGNE  720

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            EAQ+FATEW+FKVAEGATAL+ +QLRGI YITDRGAQQL+ DIEYLSNVLSALSMP+PP 
Sbjct  721  EAQFFATEWIFKVAEGATALFTEQLRGIHYITDRGAQQLAADIEYLSNVLSALSMPIPPF  780

Query  334  LATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVS  209
            LATFH+C+STPR Q++EL+KSD G+QLDLPTA+LVCK+RR+S
Sbjct  781  LATFHTCISTPRDQVRELIKSDGGSQLDLPTAHLVCKIRRIS  822



>gb|KFK26748.1| hypothetical protein AALP_AA8G288200 [Arabis alpina]
Length=836

 Score =   282 bits (722),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 129/165 (78%), Positives = 153/165 (93%), Gaps = 1/165 (1%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGIS-NSDANA  518
             D+S LPIWSSVEE +A PLP FS+YPQSYVT+VGEYLLTLPQQLEPLAEGIS N D+N 
Sbjct  672  GDVSHLPIWSSVEEQTAFPLPNFSSYPQSYVTSVGEYLLTLPQQLEPLAEGISSNGDSNN  731

Query  517  DEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPP  338
            ++AQ+FATEWMFKVAEGATALY++QLRGIQYI+DRGAQQLSVDIEYLSNVLSALSMP+PP
Sbjct  732  EDAQFFATEWMFKVAEGATALYMEQLRGIQYISDRGAQQLSVDIEYLSNVLSALSMPIPP  791

Query  337  VLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  203
            VLATF +CL+TPR +LK+++KS++G++LD PTANLVCKMRR+S +
Sbjct  792  VLATFQTCLATPRDELKDVMKSEAGSELDFPTANLVCKMRRISFD  836



>ref|XP_009127310.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Brassica rapa]
Length=829

 Score =   282 bits (722),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 130/165 (79%), Positives = 153/165 (93%), Gaps = 1/165 (1%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGIS-NSDANA  518
             ++SRLPIWSS EE SA PLP+FS+YPQSYVT+VGEYLLTLPQQLEPLAEGIS N D+N 
Sbjct  665  GEVSRLPIWSSSEEQSAFPLPSFSSYPQSYVTSVGEYLLTLPQQLEPLAEGISTNGDSNN  724

Query  517  DEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPP  338
            ++AQ+FATEWMFKVAEGATALYV+QLRGIQYITDRGAQQLSVDIEYLSNVL ALSMP+PP
Sbjct  725  EDAQFFATEWMFKVAEGATALYVEQLRGIQYITDRGAQQLSVDIEYLSNVLLALSMPIPP  784

Query  337  VLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  203
            VLATF +CL+TPR +LK+++KS++G++LD PTANLVCKMRR+S +
Sbjct  785  VLATFQTCLATPRDELKDVMKSEAGSELDFPTANLVCKMRRISFD  829



>ref|XP_010442640.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Camelina sativa]
Length=681

 Score =   278 bits (712),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 129/165 (78%), Positives = 152/165 (92%), Gaps = 1/165 (1%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGIS-NSDANA  518
             ++SRLPIWSSVEE +A  LP FS+YPQSYVT+VGEYLLTLPQQLEPLAEGIS N D+N 
Sbjct  517  GEVSRLPIWSSVEEQTAFSLPNFSSYPQSYVTSVGEYLLTLPQQLEPLAEGISTNGDSNN  576

Query  517  DEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPP  338
            ++AQ+FATEWMFKVAEGATALY+DQLRGIQYI+DRGAQQLSVDIEYLSNVLSALSMPVPP
Sbjct  577  EDAQFFATEWMFKVAEGATALYMDQLRGIQYISDRGAQQLSVDIEYLSNVLSALSMPVPP  636

Query  337  VLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  203
            VLATF +CL+TPR +LK+++KS++G++LD  TANLVCKMRR+S +
Sbjct  637  VLATFQTCLATPRDELKDVMKSEAGSELDFHTANLVCKMRRISFD  681



>gb|EMS57916.1| hypothetical protein TRIUR3_24838 [Triticum urartu]
Length=706

 Score =   278 bits (712),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 125/163 (77%), Positives = 149/163 (91%), Gaps = 0/163 (0%)
 Frame = -3

Query  691  DLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANADE  512
            +++RLPIWSSVEE    PLP+FSAYPQSYVT+VGEYLLTLPQQLEPLAEGIS S+A  DE
Sbjct  544  EIARLPIWSSVEEQGGLPLPSFSAYPQSYVTSVGEYLLTLPQQLEPLAEGISGSEAGNDE  603

Query  511  AQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVL  332
            AQ+FATEW+FKVAEGATAL+++QLRGI YITDRGAQQL+ DIEYL+NVLSALSMP+PP L
Sbjct  604  AQFFATEWIFKVAEGATALFMEQLRGIHYITDRGAQQLAADIEYLNNVLSALSMPIPPFL  663

Query  331  ATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  203
            +TFH+C+STPR Q+++L+KSD G QLDLPTA+LV K+RR+SLE
Sbjct  664  STFHACISTPRDQVRDLIKSDGGTQLDLPTAHLVSKIRRISLE  706



>ref|XP_003563389.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Brachypodium 
distachyon]
Length=825

 Score =   281 bits (718),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 126/164 (77%), Positives = 150/164 (91%), Gaps = 0/164 (0%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            +++SRLPIWSSVEE    PLP+FSAYPQ+YVT+VGEYLLTLPQQLEPLAEGIS S+A  D
Sbjct  662  SEISRLPIWSSVEEQGGLPLPSFSAYPQAYVTSVGEYLLTLPQQLEPLAEGISGSEAGND  721

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            EAQ+FATEW+FKVAEGATAL+++QLRGI YITDRGAQQL+ DIEYL+NVLSALSMP+PP 
Sbjct  722  EAQFFATEWIFKVAEGATALFMEQLRGIHYITDRGAQQLAADIEYLNNVLSALSMPIPPF  781

Query  334  LATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  203
            L+TFH+C+STPR Q++ L+KSD G+QLDLPTANLVCK+RR+ LE
Sbjct  782  LSTFHTCISTPRDQVRGLIKSDGGSQLDLPTANLVCKIRRIPLE  825



>gb|AIU51127.1| embryo yellow protein, partial [Asparagus officinalis]
Length=822

 Score =   281 bits (718),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 125/162 (77%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            ND+SR+PIWSSVEE SA PLP+FSAYPQ+YVT+VGEYLLTLPQQLEPLAEGIS++D   D
Sbjct  661  NDVSRMPIWSSVEEQSALPLPSFSAYPQAYVTSVGEYLLTLPQQLEPLAEGISSNDGGTD  720

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            EAQ+FATEWMFKVAEGATAL+++QLRGI YITDRGAQQLS DIEYLSNVL ALSMP+PP 
Sbjct  721  EAQFFATEWMFKVAEGATALFMEQLRGIHYITDRGAQQLSADIEYLSNVLFALSMPIPPF  780

Query  334  LATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVS  209
            L+T+H+CLS PR QL++L+KS+ G+QLD+PTA+LVCK+RR++
Sbjct  781  LSTYHTCLSKPRDQLRDLIKSEPGSQLDVPTAHLVCKIRRIA  822



>ref|XP_010536539.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Tarenaya 
hassleriana]
Length=837

 Score =   280 bits (717),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 130/165 (79%), Positives = 152/165 (92%), Gaps = 1/165 (1%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISN-SDANA  518
             D+S +PIWS+ EE +A PLPTFS+YPQSYVT+VGEYLLTLPQQLEPLAEGISN SDAN 
Sbjct  673  GDVSHMPIWSAAEEQTAFPLPTFSSYPQSYVTSVGEYLLTLPQQLEPLAEGISNNSDANN  732

Query  517  DEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPP  338
            ++AQ+FATEWMFKVAEGATALY++QLRGIQ+ +DRGAQQLSVDIEYLSNVLSALSMP+PP
Sbjct  733  EDAQFFATEWMFKVAEGATALYMEQLRGIQHASDRGAQQLSVDIEYLSNVLSALSMPIPP  792

Query  337  VLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  203
            VLATF +CL+T R QLK+L++S++ NQLDLPTANLVCKMRRVS +
Sbjct  793  VLATFQTCLATSREQLKDLMRSEAANQLDLPTANLVCKMRRVSFD  837



>gb|EMT03910.1| hypothetical protein F775_26031 [Aegilops tauschii]
Length=697

 Score =   277 bits (709),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 124/164 (76%), Positives = 150/164 (91%), Gaps = 0/164 (0%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            ++++RLPIWSSVEE    PLP+FSAYPQ+YVT+VGEYLLTLPQQLEPLAEGIS S+A  D
Sbjct  534  SEIARLPIWSSVEEQGGLPLPSFSAYPQAYVTSVGEYLLTLPQQLEPLAEGISGSEAGND  593

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            EAQ+FATEW+FKVAEGATAL+++QLRGI YITDRGAQQL+ DIEYL+NVLSALSMP+PP 
Sbjct  594  EAQFFATEWIFKVAEGATALFMEQLRGIHYITDRGAQQLAADIEYLNNVLSALSMPIPPF  653

Query  334  LATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  203
            L+TFH+C+STPR Q+++L+KSD G QLDLPTA+LV K+RR+SLE
Sbjct  654  LSTFHACISTPRDQVRDLIKSDGGAQLDLPTAHLVSKIRRISLE  697



>gb|AIU51102.1| embryo yellow protein, partial [Aquilegia coerulea]
Length=835

 Score =   280 bits (716),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 128/164 (78%), Positives = 144/164 (88%), Gaps = 0/164 (0%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            +D++RLPIWS +EE S   LP+FS YPQSYVT+VGEYLLTLPQQ EPLAEGIS  D+N D
Sbjct  672  SDVARLPIWSKIEEPSTFALPSFSVYPQSYVTSVGEYLLTLPQQFEPLAEGISGGDSNTD  731

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            EAQ+ ATEWMFKVAEGA  LY +QLRGI YIT+RGAQQLS DIEYLSNVLSALSMP+PPV
Sbjct  732  EAQFLATEWMFKVAEGAAVLYTEQLRGIHYITERGAQQLSADIEYLSNVLSALSMPIPPV  791

Query  334  LATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  203
            LATFH+C STPR QL ELVKSD GN+LDLPTANLVCK+RRV+L+
Sbjct  792  LATFHTCFSTPREQLPELVKSDGGNELDLPTANLVCKIRRVALD  835



>gb|AIU51109.1| embryo yellow protein, partial [Brachypodium distachyon]
Length=784

 Score =   279 bits (713),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 124/161 (77%), Positives = 148/161 (92%), Gaps = 0/161 (0%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            +++SRLPIWSSVEE    PLP+FSAYPQ+YVT+VGEYLLTLPQQLEPLAEGIS S+A  D
Sbjct  624  SEISRLPIWSSVEEQGGLPLPSFSAYPQAYVTSVGEYLLTLPQQLEPLAEGISGSEAGND  683

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            EAQ+FATEW+FKVAEGATAL+++QLRGI YITDRGAQQL+ DIEYL+NVLSALSMP+PP 
Sbjct  684  EAQFFATEWIFKVAEGATALFMEQLRGIHYITDRGAQQLAADIEYLNNVLSALSMPIPPF  743

Query  334  LATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRV  212
            L+TFH+C+STPR Q++ L+KSD G+QLDLPTANLVCK+RR+
Sbjct  744  LSTFHTCISTPRDQVRGLIKSDGGSQLDLPTANLVCKIRRI  784



>gb|EEE66191.1| hypothetical protein OsJ_22310 [Oryza sativa Japonica Group]
Length=790

 Score =   279 bits (713),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 124/162 (77%), Positives = 149/162 (92%), Gaps = 0/162 (0%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            N+++RLPIWSSVEE    PLP+FSAYPQ+YVT+VGEYLLTLPQQLEPLAEGIS  +A  +
Sbjct  626  NEVARLPIWSSVEEPGGLPLPSFSAYPQAYVTSVGEYLLTLPQQLEPLAEGISGGEAGNE  685

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            EAQ+FATEW+FKVAEGATAL+++QLRGI YITDRGAQQL+ DIEYLSNVLSALSMP+PP 
Sbjct  686  EAQFFATEWIFKVAEGATALFMEQLRGIHYITDRGAQQLAADIEYLSNVLSALSMPIPPF  745

Query  334  LATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVS  209
            LATFH+C+STPR Q+++L+KSD G+QLDLPTA+LVCK+RR+S
Sbjct  746  LATFHTCISTPRDQVRDLIKSDGGSQLDLPTAHLVCKIRRIS  787



>gb|AIU51153.1| embryo yellow protein, partial [Ginkgo biloba]
Length=816

 Score =   279 bits (714),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 130/170 (76%), Positives = 150/170 (88%), Gaps = 0/170 (0%)
 Frame = -3

Query  712  KYDNTSNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISN  533
            K  +  +D+SR+ IW+SVEE +A  LP+FSAYPQ YVT++GEYLLTLPQQLEPL  G+SN
Sbjct  647  KIRHRLSDVSRMAIWTSVEEDNAFSLPSFSAYPQPYVTSIGEYLLTLPQQLEPLTTGLSN  706

Query  532  SDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALS  353
            +DA ADEAQ+FATEWMFKVAEGATALY++QLRGIQ ITDRGAQQLS DIEYL NVLSALS
Sbjct  707  ADATADEAQFFATEWMFKVAEGATALYIEQLRGIQSITDRGAQQLSADIEYLCNVLSALS  766

Query  352  MPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  203
            MP PPVLATFHSCL+T R QL+ELVKSD+G+QLDLPTA LVCK+R V+LE
Sbjct  767  MPTPPVLATFHSCLATSREQLRELVKSDAGSQLDLPTARLVCKIRHVTLE  816



>gb|AIU51142.1| embryo yellow protein, partial [Dioscorea oppositifolia]
Length=831

 Score =   279 bits (714),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 127/162 (78%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            +DLSRLPIWSSVEE SA PLP+FSAYPQ YVT+VGEYLLTLPQQLEPLAEGIS+S+   D
Sbjct  670  SDLSRLPIWSSVEEQSALPLPSFSAYPQPYVTSVGEYLLTLPQQLEPLAEGISSSETGTD  729

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            EAQ+FATEW+FKVAEGATAL+++QLRGI YITDRGAQQLS DIEYLSNVLSALSMP+PP 
Sbjct  730  EAQFFATEWVFKVAEGATALFMEQLRGIHYITDRGAQQLSADIEYLSNVLSALSMPIPPF  789

Query  334  LATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVS  209
            L+TFH+CLSTPR Q+++L+K D+ +QLDLPTA+LVCK+RR++
Sbjct  790  LSTFHTCLSTPRDQVRDLLKLDAASQLDLPTAHLVCKIRRIA  831



>gb|AIU51130.1| embryo yellow protein, partial [Canna indica]
Length=815

 Score =   278 bits (712),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 126/162 (78%), Positives = 149/162 (92%), Gaps = 0/162 (0%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            +D+SRLPIWSSVEE S+ PLP+FSAYPQ+YVT+VGEYLLTLPQQLEPLAEGIS S+A  +
Sbjct  654  SDVSRLPIWSSVEEQSSLPLPSFSAYPQAYVTSVGEYLLTLPQQLEPLAEGISGSEAGTE  713

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            EAQ+FATEWMFKVAEGATAL+++QLRGIQYITDRGA QLS DIEYL+NVLSALSM +PP 
Sbjct  714  EAQFFATEWMFKVAEGATALFMEQLRGIQYITDRGALQLSADIEYLNNVLSALSMTIPPF  773

Query  334  LATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVS  209
            L TFH+C+STPR QL +L+KSD GNQLD+PTA+LVCK+RR++
Sbjct  774  LMTFHTCISTPREQLPDLIKSDGGNQLDIPTAHLVCKIRRIT  815



>gb|EEC81147.1| hypothetical protein OsI_24056 [Oryza sativa Indica Group]
Length=825

 Score =   278 bits (712),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 124/162 (77%), Positives = 149/162 (92%), Gaps = 0/162 (0%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            N+++RLPIWSSVEE    PLP+FSAYPQ+YVT+VGEYLLTLPQQLEPLAEGIS  +A  +
Sbjct  661  NEVARLPIWSSVEEPGGLPLPSFSAYPQAYVTSVGEYLLTLPQQLEPLAEGISGGEAGNE  720

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            EAQ+FATEW+FKVAEGATAL+++QLRGI YITDRGAQQL+ DIEYLSNVLSALSMP+PP 
Sbjct  721  EAQFFATEWIFKVAEGATALFMEQLRGIHYITDRGAQQLAADIEYLSNVLSALSMPIPPF  780

Query  334  LATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVS  209
            LATFH+C+STPR Q+++L+KSD G+QLDLPTA+LVCK+RR+S
Sbjct  781  LATFHTCISTPRDQVRDLIKSDGGSQLDLPTAHLVCKIRRIS  822



>gb|AIU51157.1| embryo yellow protein, partial [Trachycarpus fortunei]
Length=821

 Score =   278 bits (710),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 128/162 (79%), Positives = 150/162 (93%), Gaps = 1/162 (1%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            ND+SR+ IWSSVEE SA PLP+FSAYPQ+YVT+VGEYLLTLPQQLEPLAEGIS+S+A  +
Sbjct  661  NDVSRMSIWSSVEEPSALPLPSFSAYPQAYVTSVGEYLLTLPQQLEPLAEGISSSEAGTE  720

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            EAQ+FATEWMFKV EGATAL+++QLRGIQYITDRGA QLS DIEYLSNVLSALSMP+PP 
Sbjct  721  EAQFFATEWMFKVVEGATALFMEQLRGIQYITDRGALQLSADIEYLSNVLSALSMPIPPF  780

Query  334  LATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVS  209
            L TFH+CLSTPR Q+++L+KSD GNQLDLPTA+LVCK+RR++
Sbjct  781  LTTFHACLSTPRDQIRDLLKSD-GNQLDLPTAHLVCKIRRIA  821



>dbj|BAD45448.1| oligomeric golgi complex 7-like [Oryza sativa Japonica Group]
Length=873

 Score =   278 bits (711),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 124/162 (77%), Positives = 149/162 (92%), Gaps = 0/162 (0%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            N+++RLPIWSSVEE    PLP+FSAYPQ+YVT+VGEYLLTLPQQLEPLAEGIS  +A  +
Sbjct  709  NEVARLPIWSSVEEPGGLPLPSFSAYPQAYVTSVGEYLLTLPQQLEPLAEGISGGEAGNE  768

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            EAQ+FATEW+FKVAEGATAL+++QLRGI YITDRGAQQL+ DIEYLSNVLSALSMP+PP 
Sbjct  769  EAQFFATEWIFKVAEGATALFMEQLRGIHYITDRGAQQLAADIEYLSNVLSALSMPIPPF  828

Query  334  LATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVS  209
            LATFH+C+STPR Q+++L+KSD G+QLDLPTA+LVCK+RR+S
Sbjct  829  LATFHTCISTPRDQVRDLIKSDGGSQLDLPTAHLVCKIRRIS  870



>ref|XP_009399332.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Musa 
acuminata subsp. malaccensis]
Length=818

 Score =   277 bits (709),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 126/164 (77%), Positives = 151/164 (92%), Gaps = 0/164 (0%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            +D+SRLPIWSSVEE S+ PLP+FSAYPQ+YVT+VGEYLLTLPQQLEPLAEGIS+S++  +
Sbjct  654  SDVSRLPIWSSVEEQSSLPLPSFSAYPQAYVTSVGEYLLTLPQQLEPLAEGISSSESGTE  713

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            EAQ+FATEWMFKVAEGATAL+++QLRGIQYI+DRGAQQLS DIEYLSNVLSALSM +PP 
Sbjct  714  EAQFFATEWMFKVAEGATALFMEQLRGIQYISDRGAQQLSADIEYLSNVLSALSMAIPPF  773

Query  334  LATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  203
            LATFH+CL+TPR QL   +KSD G+QLD+PTA+LVCK+RR+ L+
Sbjct  774  LATFHTCLATPRDQLPAFLKSDGGSQLDIPTAHLVCKIRRIPLD  817



>gb|AIU51107.1| embryo yellow protein, partial [Musa acuminata]
Length=814

 Score =   276 bits (706),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 125/161 (78%), Positives = 149/161 (93%), Gaps = 0/161 (0%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            +D+SRLPIWSSVEE S+ PLP+FSAYPQ+YVT+VGEYLLTLPQQLEPLAEGIS+S++  +
Sbjct  654  SDVSRLPIWSSVEEQSSLPLPSFSAYPQAYVTSVGEYLLTLPQQLEPLAEGISSSESGTE  713

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            EAQ+FATEWMFKVAEGATAL+++QLRGIQYI+DRGAQQLS DIEYLSNVLSALSM +PP 
Sbjct  714  EAQFFATEWMFKVAEGATALFMEQLRGIQYISDRGAQQLSADIEYLSNVLSALSMAIPPF  773

Query  334  LATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRV  212
            LATFH+CL+TPR QL   +KSD G+QLD+PTA+LVCK+RR+
Sbjct  774  LATFHTCLATPRDQLPAFLKSDGGSQLDIPTAHLVCKIRRI  814



>ref|XP_002438832.1| hypothetical protein SORBIDRAFT_10g026850 [Sorghum bicolor]
 gb|EER90199.1| hypothetical protein SORBIDRAFT_10g026850 [Sorghum bicolor]
Length=820

 Score =   276 bits (706),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 121/164 (74%), Positives = 152/164 (93%), Gaps = 0/164 (0%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            ++++RLPIWSSVEE    PLP+FSAYPQ+YVT+VGEYLLTLPQQLEPLAEGIS ++A  D
Sbjct  657  SEVARLPIWSSVEEQGGLPLPSFSAYPQAYVTSVGEYLLTLPQQLEPLAEGISGNEAGND  716

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            EAQ+FATEW+FKVAEGATAL+++QLRGI YITDRG+QQL+ DIEYL+NVLSALSMP+PP 
Sbjct  717  EAQFFATEWIFKVAEGATALFMEQLRGIHYITDRGSQQLAADIEYLNNVLSALSMPIPPF  776

Query  334  LATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  203
            L+TFH+C+STPR Q+++L+KSD G+QLDLPTA+LVCK+RR++L+
Sbjct  777  LSTFHACVSTPRDQVRDLIKSDGGSQLDLPTAHLVCKIRRITLD  820



>ref|XP_004966309.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Setaria italica]
Length=820

 Score =   276 bits (705),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 150/164 (91%), Gaps = 0/164 (0%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            ++++RLPIWSSVEE    PLP+FSAYPQ+YVT+VGEYLLTLPQQLEPLAEGIS ++   D
Sbjct  657  SEVARLPIWSSVEEQGGLPLPSFSAYPQAYVTSVGEYLLTLPQQLEPLAEGISGNETGND  716

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            EAQ+FATEW+FKVAEGATAL+++QLRGI YITDRGAQQL+ DIEYL+NVLSALSMP+PP 
Sbjct  717  EAQFFATEWIFKVAEGATALFMEQLRGIHYITDRGAQQLAADIEYLNNVLSALSMPIPPF  776

Query  334  LATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  203
            L+TFH+C+STPR Q++ L+KSD G+QLDLPTA+LVCK+RR+SL+
Sbjct  777  LSTFHACVSTPRDQVRGLIKSDGGSQLDLPTAHLVCKIRRISLD  820



>gb|AIU51137.1| embryo yellow protein, partial [Panicum virgatum]
Length=818

 Score =   275 bits (704),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 122/162 (75%), Positives = 149/162 (92%), Gaps = 0/162 (0%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            ++++RLPIWSSVEE    PLP+FSAYPQ+YVT+VGEYLLTLPQQLEPLAEGIS ++A  D
Sbjct  657  SEVARLPIWSSVEEQGGLPLPSFSAYPQAYVTSVGEYLLTLPQQLEPLAEGISGNEAGND  716

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            EAQ+FATEW+FKVAEGATAL+++QLRGI YITDRGAQQL+ DIEYL+NVLSALSMP+PP 
Sbjct  717  EAQFFATEWIFKVAEGATALFMEQLRGIHYITDRGAQQLAADIEYLNNVLSALSMPIPPF  776

Query  334  LATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVS  209
            L+TFH+C+STPR Q++ L+KSD G+QLDLPTA+LVCK+RR+S
Sbjct  777  LSTFHACVSTPRDQVRGLIKSDGGSQLDLPTAHLVCKIRRIS  818



>ref|XP_009107451.1| PREDICTED: LOW QUALITY PROTEIN: conserved oligomeric Golgi complex 
subunit 7-like [Brassica rapa]
Length=831

 Score =   275 bits (704),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 125/165 (76%), Positives = 151/165 (92%), Gaps = 1/165 (1%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGIS-NSDANA  518
             ++SRLPIWSSVEE +A  LP FS+YPQ+YVT+VG YLLTLPQQLEPLAEGIS N D+N 
Sbjct  667  GEVSRLPIWSSVEEQTAFALPNFSSYPQAYVTSVGXYLLTLPQQLEPLAEGISTNGDSNN  726

Query  517  DEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPP  338
            ++AQ+FATEWMFKVAEGATALY++QLRGIQYI+DRGAQQL VDIEYLSNVL+ALSMP+PP
Sbjct  727  EDAQFFATEWMFKVAEGATALYMEQLRGIQYISDRGAQQLCVDIEYLSNVLAALSMPIPP  786

Query  337  VLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  203
            VLATF +CL+TPR +LK+++KSD+G++LD PTANLVCKMRR+S +
Sbjct  787  VLATFQTCLATPRDELKDVMKSDAGSELDFPTANLVCKMRRISFD  831



>emb|CDX99921.1| BnaC09g27840D [Brassica napus]
Length=641

 Score =   271 bits (693),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/165 (75%), Positives = 151/165 (92%), Gaps = 1/165 (1%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGIS-NSDANA  518
             ++SRLPIWSSVEE +A  LP FS+YPQ+YVT+VGEYLLTLPQQLEPLAEGIS N D+N 
Sbjct  477  GEVSRLPIWSSVEEQTAFALPNFSSYPQAYVTSVGEYLLTLPQQLEPLAEGISTNGDSNN  536

Query  517  DEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPP  338
            ++AQ+FATEWMFKVAEGATALY++QLRGIQYI+DRGAQQL VDIEYLSNVL+ALSMP+PP
Sbjct  537  EDAQFFATEWMFKVAEGATALYMEQLRGIQYISDRGAQQLCVDIEYLSNVLAALSMPIPP  596

Query  337  VLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  203
            VLATF +CL+TPR +LK+++KS++G++LD  TANLVCKMRR+S +
Sbjct  597  VLATFQTCLATPRDELKDVMKSEAGSELDFLTANLVCKMRRISFD  641



>gb|AIU51149.1| embryo yellow protein, partial [Lactuca sativa]
Length=827

 Score =   275 bits (702),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 129/164 (79%), Positives = 148/164 (90%), Gaps = 1/164 (1%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            N +S LPIWSSVEE +   LP+FSAY QSY+T VGEYLLTLPQQLEPLAE ISN+DANA+
Sbjct  665  NGVSNLPIWSSVEEQTTFHLPSFSAYAQSYITTVGEYLLTLPQQLEPLAETISNNDANAE  724

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            EAQ+FATEWMFKVAEGA  L+++QLRGIQYIT+RGAQQLSVDIEYLSNVLSALSMP+PP+
Sbjct  725  EAQFFATEWMFKVAEGAAGLFMEQLRGIQYITERGAQQLSVDIEYLSNVLSALSMPIPPI  784

Query  334  LATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  203
            LATFH+CLSTPR QLK+++K+D    LD+PTANLVCKMRRVSLE
Sbjct  785  LATFHTCLSTPRDQLKDVMKNDL-ESLDVPTANLVCKMRRVSLE  827



>dbj|BAJ94393.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=823

 Score =   275 bits (702),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 149/164 (91%), Gaps = 0/164 (0%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            ++++RLPIWSSVEE    PLP+FSAYPQ+YVT+VGEYLLTLPQQLEPL EGIS S+A  D
Sbjct  660  SEIARLPIWSSVEEQGGLPLPSFSAYPQAYVTSVGEYLLTLPQQLEPLTEGISGSEAGND  719

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            EAQ+FATEW+FKVAEGATAL+++QLRGI YITDRGAQQL+ DIEYL+NVLSALSMP+PP 
Sbjct  720  EAQFFATEWIFKVAEGATALFMEQLRGIHYITDRGAQQLAADIEYLNNVLSALSMPIPPF  779

Query  334  LATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  203
            L+TFH+C+STPR Q+++L+KS+ G QLDLPTA+LV K+RR+SLE
Sbjct  780  LSTFHACISTPRDQVRDLIKSEGGTQLDLPTAHLVSKIRRISLE  823



>dbj|BAJ95800.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=823

 Score =   275 bits (702),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 149/164 (91%), Gaps = 0/164 (0%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            ++++RLPIWSSVEE    PLP+FSAYPQ+YVT+VGEYLLTLPQQLEPL EGIS S+A  D
Sbjct  660  SEIARLPIWSSVEEQGGLPLPSFSAYPQAYVTSVGEYLLTLPQQLEPLTEGISGSEAGND  719

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            EAQ+FATEW+FKVAEGATAL+++QLRGI YITDRGAQQL+ DIEYL+NVLSALSMP+PP 
Sbjct  720  EAQFFATEWIFKVAEGATALFMEQLRGIHYITDRGAQQLAADIEYLNNVLSALSMPIPPF  779

Query  334  LATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  203
            L+TFH+C+STPR Q+++L+KS+ G QLDLPTA+LV K+RR+SLE
Sbjct  780  LSTFHACISTPRDQVRDLIKSEGGTQLDLPTAHLVSKIRRISLE  823



>gb|AIU51146.1| embryo yellow protein, partial [Sorghum bicolor]
Length=818

 Score =   274 bits (701),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 120/162 (74%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            ++++RLPIWSSVEE    PLP+FSAYPQ+YVT+VGEYLLTLPQQLEPLAEGIS ++A  D
Sbjct  657  SEVARLPIWSSVEEQGGLPLPSFSAYPQAYVTSVGEYLLTLPQQLEPLAEGISGNEAGND  716

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            EAQ+FATEW+FKVAEGATAL+++QLRGI YITDRG+QQL+ DIEYL+NVLSALSMP+PP 
Sbjct  717  EAQFFATEWIFKVAEGATALFMEQLRGIHYITDRGSQQLAADIEYLNNVLSALSMPIPPF  776

Query  334  LATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVS  209
            L+TFH+C+STPR Q+++L+KSD G+QLDLPTA+LVCK+RR++
Sbjct  777  LSTFHACVSTPRDQVRDLIKSDGGSQLDLPTAHLVCKIRRIT  818



>gb|AIU51144.1| embryo yellow protein, partial [Setaria italica]
Length=818

 Score =   273 bits (699),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 121/162 (75%), Positives = 148/162 (91%), Gaps = 0/162 (0%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            ++++RLPIWSSVEE    PLP+FSAYPQ+YVT+VGEYLLTLPQQLEPLAEGIS ++   D
Sbjct  657  SEVARLPIWSSVEEQGGLPLPSFSAYPQAYVTSVGEYLLTLPQQLEPLAEGISGNETGND  716

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            EAQ+FATEW+FKVAEGATAL+++QLRGI YITDRGAQQL+ DIEYL+NVLSALSMP+PP 
Sbjct  717  EAQFFATEWIFKVAEGATALFMEQLRGIHYITDRGAQQLAADIEYLNNVLSALSMPIPPF  776

Query  334  LATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVS  209
            L+TFH+C+STPR Q++ L+KSD G+QLDLPTA+LVCK+RR+S
Sbjct  777  LSTFHACVSTPRDQVRGLIKSDGGSQLDLPTAHLVCKIRRIS  818



>ref|XP_008658135.1| PREDICTED: uncharacterized protein LOC100193995 isoform X1 [Zea 
mays]
 gb|AFW87715.1| hypothetical protein ZEAMMB73_766806 [Zea mays]
Length=820

 Score =   272 bits (695),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 119/164 (73%), Positives = 150/164 (91%), Gaps = 0/164 (0%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            ++++RLPIWSSVEE    PLP+FSAYPQ+YVT+VGEYLLTLPQQLEPLAEGIS ++A  D
Sbjct  657  SEVARLPIWSSVEEQGGLPLPSFSAYPQAYVTSVGEYLLTLPQQLEPLAEGISGNEAGND  716

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            EAQ+FATEW+FKVAEGATAL+++QLRGI YITDRG+QQL+ DIEYL+NVLSALSMP+PP 
Sbjct  717  EAQFFATEWIFKVAEGATALFMEQLRGIHYITDRGSQQLAADIEYLNNVLSALSMPIPPF  776

Query  334  LATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  203
            L+TFH+C+STPR Q+++L+KSD  +QLDLPT +LVCK+RR++L+
Sbjct  777  LSTFHACVSTPRDQVRDLIKSDGASQLDLPTTHLVCKIRRITLD  820



>gb|AIU51124.1| embryo yellow protein, partial [Ceratophyllum demersum]
Length=813

 Score =   271 bits (693),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 126/162 (78%), Positives = 148/162 (91%), Gaps = 0/162 (0%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
             ++SRLPIWSSVEE +A PLPTFS+YPQ YVT+VGEYLLTLPQQLEPLAEGI  ++ NAD
Sbjct  652  KEVSRLPIWSSVEEPTAFPLPTFSSYPQPYVTSVGEYLLTLPQQLEPLAEGILTNETNAD  711

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            E+QYFATEWMFKVAEGAT LY++QLRGIQ+ITD GAQQLSVDIEYLSNVLSALSMPVP  
Sbjct  712  ESQYFATEWMFKVAEGATNLYLEQLRGIQHITDHGAQQLSVDIEYLSNVLSALSMPVPQP  771

Query  334  LATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVS  209
            LATFH C+ST R +L++L+KSDSGNQLD+PTA+L+CK+R+V+
Sbjct  772  LATFHICMSTSRDKLRDLIKSDSGNQLDIPTAHLICKIRQVT  813



>gb|AIU51155.1| embryo yellow protein, partial [Zea mays]
Length=818

 Score =   270 bits (690),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 118/162 (73%), Positives = 148/162 (91%), Gaps = 0/162 (0%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            ++++RLPIWSSVEE    PLP+FSAYPQ+YVT+VGEYLLTLPQQLEPLAEGIS ++A  D
Sbjct  657  SEVARLPIWSSVEEQGGLPLPSFSAYPQAYVTSVGEYLLTLPQQLEPLAEGISGNEAGND  716

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            EAQ+FATEW+FKVAEGATAL+++QLRGI YITDRG+QQL+ DIEYL+NVLSALSMP+PP 
Sbjct  717  EAQFFATEWIFKVAEGATALFMEQLRGIHYITDRGSQQLAADIEYLNNVLSALSMPIPPF  776

Query  334  LATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVS  209
            L+TFH+C+STPR Q+++L+KSD  +QLDLPT +LVCK+RR++
Sbjct  777  LSTFHACVSTPRDQVRDLIKSDGASQLDLPTTHLVCKIRRIT  818



>gb|AIU51150.1| embryo yellow protein, partial [Ceratophyllum platyacanthum subsp. 
oryzetorum]
Length=813

 Score =   267 bits (682),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 124/162 (77%), Positives = 147/162 (91%), Gaps = 0/162 (0%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
             ++SRL IW+SVEE +A PLPTFS+YPQ YVT+VGEYLLTLPQQLEPLAEGI  ++ NAD
Sbjct  652  KEVSRLSIWTSVEEPTAFPLPTFSSYPQPYVTSVGEYLLTLPQQLEPLAEGILTNETNAD  711

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            E+QYFATEWMFKVAEGAT LY++QLRGIQ+ITD GAQQLSVDIEYLSNVLSALSMPVP  
Sbjct  712  ESQYFATEWMFKVAEGATNLYLEQLRGIQHITDHGAQQLSVDIEYLSNVLSALSMPVPQP  771

Query  334  LATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVS  209
            LATFH C+ST R +L++L+KSDSGNQLD+PTA+L+CK+R+V+
Sbjct  772  LATFHICMSTSRDKLRDLIKSDSGNQLDIPTAHLICKIRQVT  813



>gb|AIU51156.1| embryo yellow protein, partial [Alisma plantago-aquatica]
Length=823

 Score =   265 bits (678),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 148/161 (92%), Gaps = 1/161 (1%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            +D+SRLPIWSSVEE    PLP+FSAYPQ+YVT+VGEYLLTLPQQLEPLAEGIS +D   +
Sbjct  664  SDVSRLPIWSSVEEQGGLPLPSFSAYPQAYVTSVGEYLLTLPQQLEPLAEGISGADTATE  723

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            +AQ+FATEWMFKVAEGATALY++QLRGIQY+TDRGAQQL+ DIEYLSNVLSALSMP+PP 
Sbjct  724  DAQFFATEWMFKVAEGATALYMEQLRGIQYLTDRGAQQLAADIEYLSNVLSALSMPIPPF  783

Query  334  LATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRV  212
            L T+H+C++TPR +L++L+KS++ +QLDLPTA+LVCK+RR+
Sbjct  784  LVTYHNCVATPRDELRDLLKSEN-HQLDLPTAHLVCKIRRL  823



>gb|AIU51158.1| embryo yellow protein, partial [Cabomba caroliniana]
Length=804

 Score =   259 bits (662),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 118/164 (72%), Positives = 144/164 (88%), Gaps = 0/164 (0%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            ++++++PIWSS+EE S  P+P+FSAYPQ+YVT+VGEYLLTLPQQLEPL   +S+ ++N D
Sbjct  641  SNVAQMPIWSSIEEQSGFPIPSFSAYPQAYVTSVGEYLLTLPQQLEPLGGTVSSGESNND  700

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            EAQ+FA EWMFKVAEGATALY++QLR IQ ITDRGAQQL+ DIEYLSNVLSALSMP+PP+
Sbjct  701  EAQFFAAEWMFKVAEGATALYIEQLRSIQSITDRGAQQLATDIEYLSNVLSALSMPIPPI  760

Query  334  LATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  203
            L TF +CLSTP  QL ELVKSD+G+QLDLP A LVCK+ RV+LE
Sbjct  761  LYTFQACLSTPADQLPELVKSDAGSQLDLPAARLVCKILRVNLE  804



>gb|EPS73811.1| hypothetical protein M569_00940, partial [Genlisea aurea]
Length=838

 Score =   241 bits (616),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 121/172 (70%), Positives = 141/172 (82%), Gaps = 10/172 (6%)
 Frame = -3

Query  694  NDLSRLPIWSS--------VEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGI  539
            +DLSR P WSS         +E SA P+P+FSAYPQ YVTNVGEYLLTLPQQLEPLAEGI
Sbjct  669  HDLSRQPTWSSSSSSSSSSTDEPSAHPVPSFSAYPQPYVTNVGEYLLTLPQQLEPLAEGI  728

Query  538  SNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSA  359
            +NS AN++EAQ+FATEWMFKVAEGATALYV+QLR IQ +TDRGA+QLSVDIEYLSNVLSA
Sbjct  729  ANSHANSEEAQFFATEWMFKVAEGATALYVEQLRAIQKVTDRGAEQLSVDIEYLSNVLSA  788

Query  358  LSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  203
            LSMP+P VL+TFH+C S    +L++LVK  S + LD+  ANLVCKMR V L+
Sbjct  789  LSMPIPQVLSTFHACFSGSMDELRDLVK--SRDDLDVVAANLVCKMRGVRLD  838



>emb|CDY56655.1| BnaA02g11250D [Brassica napus]
Length=788

 Score =   209 bits (532),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/122 (78%), Positives = 114/122 (93%), Gaps = 1/122 (1%)
 Frame = -3

Query  565  QLEPLAEGIS-NSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVD  389
            +LEPLAEGIS N D+N ++AQ+FATEWMFKVAEGATALYV+QLRGIQYITDRGAQQLSVD
Sbjct  667  ELEPLAEGISTNGDSNNEDAQFFATEWMFKVAEGATALYVEQLRGIQYITDRGAQQLSVD  726

Query  388  IEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVS  209
            IEYLSNVL ALSMP+PPVLATF +CL+TPR +LK+++KS++G++LD PTANLVCKMRR+S
Sbjct  727  IEYLSNVLLALSMPIPPVLATFQTCLATPRDELKDVMKSEAGSELDFPTANLVCKMRRIS  786

Query  208  LE  203
             +
Sbjct  787  FD  788



>emb|CDY00475.1| BnaA10g07980D [Brassica napus]
Length=788

 Score =   207 bits (528),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 114/122 (93%), Gaps = 1/122 (1%)
 Frame = -3

Query  565  QLEPLAEGIS-NSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVD  389
            +LEPLAEGIS N D+N ++AQ+FATEWMFKVAEGATALY++QLRGIQYI+DRGAQQL VD
Sbjct  667  ELEPLAEGISTNGDSNNEDAQFFATEWMFKVAEGATALYMEQLRGIQYISDRGAQQLCVD  726

Query  388  IEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVS  209
            IEYLSNVL+ALSMP+PPVLATF +CL+TPR +LK+++KSD+G++LD PTANLVCKMRR+S
Sbjct  727  IEYLSNVLAALSMPIPPVLATFQTCLATPRDELKDVMKSDAGSELDFPTANLVCKMRRIS  786

Query  208  LE  203
             +
Sbjct  787  FD  788



>emb|CDX91578.1| BnaC02g15820D [Brassica napus]
Length=801

 Score =   207 bits (528),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 94/122 (77%), Positives = 114/122 (93%), Gaps = 1/122 (1%)
 Frame = -3

Query  565  QLEPLAEGIS-NSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVD  389
            +LEPLAEGIS N D+N ++AQ+FATEWMFKVAEGATALYV+QLRGI+YITDRGAQQLSVD
Sbjct  667  ELEPLAEGISTNGDSNNEDAQFFATEWMFKVAEGATALYVEQLRGIEYITDRGAQQLSVD  726

Query  388  IEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVS  209
            IEYLSNVL ALSMP+PPVLATF +CL+TPR +LK+++KS++G++LD PTANLVCKMRR+S
Sbjct  727  IEYLSNVLLALSMPIPPVLATFQTCLATPRDELKDVMKSEAGSELDFPTANLVCKMRRIS  786

Query  208  LE  203
             +
Sbjct  787  FD  788



>ref|XP_002992562.1| hypothetical protein SELMODRAFT_135591 [Selaginella moellendorffii]
 gb|EFJ06368.1| hypothetical protein SELMODRAFT_135591 [Selaginella moellendorffii]
Length=779

 Score =   197 bits (501),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 100/166 (60%), Positives = 124/166 (75%), Gaps = 4/166 (2%)
 Frame = -3

Query  691  DLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANA--  518
            D++ +P+WS+ +E +   LP+FSAYP  YVT++GEYLLTLPQQLEPL   ++ SD +   
Sbjct  615  DVASMPVWSAPQEDNPYALPSFSAYPLPYVTSIGEYLLTLPQQLEPLTSSMTTSDTSDDI  674

Query  517  -DEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVP  341
             +E QYFATEWMFKVAEGATALYVDQ+RGI+ + +RGAQQLS DI+YL NVL+ALSM VP
Sbjct  675  DEEGQYFATEWMFKVAEGATALYVDQIRGIRNLNERGAQQLSADIDYLCNVLTALSMNVP  734

Query  340  PVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  203
             VL+TF  C+   R QL E  K   G  LD PT  LVCKMR+V +E
Sbjct  735  AVLSTFQQCVGATRDQLAEFAKG-VGPDLDGPTVRLVCKMRQVPVE  779



>ref|XP_002972505.1| hypothetical protein SELMODRAFT_148467 [Selaginella moellendorffii]
 gb|EFJ26591.1| hypothetical protein SELMODRAFT_148467 [Selaginella moellendorffii]
Length=779

 Score =   197 bits (500),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 100/166 (60%), Positives = 124/166 (75%), Gaps = 4/166 (2%)
 Frame = -3

Query  691  DLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANA--  518
            D++ +P+WS+ +E +   LP+FSAYP  YVT++GEYLLTLPQQLEPL   ++ SD +   
Sbjct  615  DVASMPVWSAPQEDNPYALPSFSAYPLPYVTSIGEYLLTLPQQLEPLTSSMTTSDTSDDI  674

Query  517  -DEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVP  341
             +E QYFATEWMFKVAEGATALYVDQ+RGI+ + +RGAQQLS DI+YL NVL+ALSM VP
Sbjct  675  NEEGQYFATEWMFKVAEGATALYVDQIRGIRNLNERGAQQLSADIDYLCNVLTALSMNVP  734

Query  340  PVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  203
             VL+TF  C+   R QL E  K   G  LD PT  LVCKMR+V +E
Sbjct  735  AVLSTFQQCVGATREQLAEFTKG-VGPDLDGPTVRLVCKMRQVLVE  779



>gb|AIU51139.1| embryo yellow protein, partial [Artemisia annua]
Length=98

 Score =   177 bits (448),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 82/99 (83%), Positives = 93/99 (94%), Gaps = 1/99 (1%)
 Frame = -3

Query  499  ATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFH  320
            +TEWMFKVAEGA AL+++QLRGIQYITDRGAQQLSVDIEYLSNVLS LSMP+PP+LATFH
Sbjct  1    STEWMFKVAEGAAALFMEQLRGIQYITDRGAQQLSVDIEYLSNVLSVLSMPIPPILATFH  60

Query  319  SCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  203
            +CLSTPR QLK+++K+DS   LDLPTANLVCKMRRVSLE
Sbjct  61   TCLSTPRDQLKDVIKTDS-ESLDLPTANLVCKMRRVSLE  98



>ref|XP_001770876.1| predicted protein [Physcomitrella patens]
 gb|EDQ64400.1| predicted protein [Physcomitrella patens]
Length=849

 Score =   179 bits (454),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 100/168 (60%), Positives = 125/168 (74%), Gaps = 11/168 (7%)
 Frame = -3

Query  691  DLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLA-----EGISNSD  527
            D++R  +W+  EE +   LP FSAY   Y+T++GEYLLTLPQQL PLA     EG+   +
Sbjct  686  DMAREAVWNQQEEQNLFSLPNFSAYASEYITSIGEYLLTLPQQLLPLAGSGNPEGV---E  742

Query  526  ANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMP  347
              +D+AQYFATEWMFKVAEGATA Y +Q+RGIQ +++RGAQQLS DIEYL NVL+ALSM 
Sbjct  743  EGSDDAQYFATEWMFKVAEGATAAYTEQIRGIQALSERGAQQLSADIEYLCNVLNALSMS  802

Query  346  VPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  203
             PPVL TFH C+STPR++L E+V+ D    +D  T  LVCKMR+V LE
Sbjct  803  TPPVLHTFHVCVSTPRNKLFEVVEQDG---IDNATFRLVCKMRQVKLE  847



>ref|XP_008376425.1| PREDICTED: LOW QUALITY PROTEIN: conserved oligomeric Golgi complex 
subunit 7 [Malus domestica]
Length=648

 Score =   138 bits (347),  Expect(3) = 1e-37, Method: Compositional matrix adjust.
 Identities = 63/82 (77%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = -3

Query  712  KYDNTSNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISN  533
            K     +D+SRLPIWSSVEE SA  LPTFSAYPQ+YVT++GEY+LTLPQQLEPL EG+SN
Sbjct  541  KVRQCFSDVSRLPIWSSVEEQSAYNLPTFSAYPQAYVTSIGEYILTLPQQLEPLTEGVSN  600

Query  532  SDANADEAQYFATEWMFKVAEG  467
            SD N DEAQ FATEWMFKVAEG
Sbjct  601  SDTNNDEAQIFATEWMFKVAEG  622


 Score = 38.5 bits (88),  Expect(3) = 1e-37, Method: Compositional matrix adjust.
 Identities = 18/20 (90%), Positives = 18/20 (90%), Gaps = 0/20 (0%)
 Frame = -2

Query  755  ADAVNELVYDVLISKVRQHF  696
            AD VNELVYDVLISKVRQ F
Sbjct  527  ADTVNELVYDVLISKVRQCF  546


 Score = 28.5 bits (62),  Expect(3) = 1e-37, Method: Compositional matrix adjust.
 Identities = 14/23 (61%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = -1

Query  459  LFMWINCVAFSISPIVERSNSLL  391
            LF   NC  FSIS IV+RS+ LL
Sbjct  625  LFTRSNCEGFSISRIVQRSSYLL  647



>ref|XP_006491716.1| PREDICTED: uncharacterized protein LOC102619662 [Citrus sinensis]
Length=870

 Score =   128 bits (321),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 65/81 (80%), Positives = 71/81 (88%), Gaps = 5/81 (6%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            +D+SRLPIWSSVEE SA  LPTFSAYPQ+YVT+VGEYLLTLPQQLEPLAEGIS SD N D
Sbjct  379  SDVSRLPIWSSVEEQSAFHLPTFSAYPQTYVTSVGEYLLTLPQQLEPLAEGISTSD-NND  437

Query  514  EAQYFATEWMFKVAEGATALY  452
            EAQ+FATEWMFKV    T+LY
Sbjct  438  EAQFFATEWMFKV----TSLY  454


 Score = 38.1 bits (87),  Expect(2) = 3e-32, Method: Composition-based stats.
 Identities = 18/20 (90%), Positives = 18/20 (90%), Gaps = 0/20 (0%)
 Frame = -2

Query  755  ADAVNELVYDVLISKVRQHF  696
            ADAVNELVYDVLISKVRQ  
Sbjct  359  ADAVNELVYDVLISKVRQRL  378



>ref|NP_001058323.2| Os06g0669600 [Oryza sativa Japonica Group]
 dbj|BAF20237.2| Os06g0669600, partial [Oryza sativa Japonica Group]
Length=160

 Score =   122 bits (305),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/73 (75%), Positives = 65/73 (89%), Gaps = 0/73 (0%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            N+++RLPIWSSVEE    PLP+FSAYPQ+YVT+VGEYLLTLPQQLEPLAEGIS  +A  +
Sbjct  49   NEVARLPIWSSVEEPGGLPLPSFSAYPQAYVTSVGEYLLTLPQQLEPLAEGISGGEAGNE  108

Query  514  EAQYFATEWMFKV  476
            EAQ+FATEW+FKV
Sbjct  109  EAQFFATEWIFKV  121



>ref|XP_001418731.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO97024.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=816

 Score =   119 bits (298),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 61/162 (38%), Positives = 94/162 (58%), Gaps = 6/162 (4%)
 Frame = -3

Query  673  IWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLE-----PLAEGIS-NSDANADE  512
            +WS+    SA  LPTFSAYPQ  +TN GEYLL+LPQ L+      LA   S + D+NA +
Sbjct  651  VWSAKPAESAYKLPTFSAYPQERMTNAGEYLLSLPQHLDNMHDDDLARATSLSGDSNAAQ  710

Query  511  AQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVL  332
                +  W+ K+AE +  L + ++R I  +TD+GA QLS D+EY SN+++ALS+  P  L
Sbjct  711  EPATSEAWIAKIAEASAELLLKEVRAIASLTDQGAAQLSADLEYFSNIVAALSLAPPSAL  770

Query  331  ATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSL  206
              ++ C S PR + ++  ++ +   +D+         R + L
Sbjct  771  IAWYKCASAPRDEYEDFARAATSEGIDVRVVRAAAATRGIKL  812



>ref|XP_003080398.1| conserved oligomeric Golgi complex component-related / COG complex 
component-related (ISS) [Ostreococcus tauri]
Length=396

 Score =   111 bits (278),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 58/160 (36%), Positives = 93/160 (58%), Gaps = 6/160 (4%)
 Frame = -3

Query  673  IWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLE-----PLAEGISNSDANADEA  509
            +WS+    SA  LPTFSAYPQ  +TN GEYLL+LPQ L+      +   +S SD +    
Sbjct  235  VWSAKPTESAYKLPTFSAYPQERMTNAGEYLLSLPQHLDGANDDDIPRTVSLSD-DVRSG  293

Query  508  QYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLA  329
            Q  + +W+ K+AE +  L + +++ I  +T++GA QL+VD+EY SN+++ALS   P  L+
Sbjct  294  QDTSEDWIAKIAEASAELLLKEVQSIGSLTEQGAAQLAVDLEYFSNIVAALSFDPPSALS  353

Query  328  TFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVS  209
             ++ C+S PR +     +S +   +D      V   R ++
Sbjct  354  AWYRCVSVPREEYDAFARSANAEGIDARIVRAVAATRGIA  393



>emb|CEF98773.1| Conserved oligomeric Golgi complex subunit 7 [Ostreococcus tauri]
Length=786

 Score =   111 bits (278),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 58/160 (36%), Positives = 93/160 (58%), Gaps = 6/160 (4%)
 Frame = -3

Query  673  IWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLE-----PLAEGISNSDANADEA  509
            +WS+    SA  LPTFSAYPQ  +TN GEYLL+LPQ L+      +   +S SD +    
Sbjct  625  VWSAKPTESAYKLPTFSAYPQERMTNAGEYLLSLPQHLDGANDDDIPRTVSLSD-DVRSG  683

Query  508  QYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLA  329
            Q  + +W+ K+AE +  L + +++ I  +T++GA QL+VD+EY SN+++ALS   P  L+
Sbjct  684  QDTSEDWIAKIAEASAELLLKEVQSIGSLTEQGAAQLAVDLEYFSNIVAALSFDPPSALS  743

Query  328  TFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVS  209
             ++ C+S PR +     +S +   +D      V   R ++
Sbjct  744  AWYRCVSVPREEYDAFARSANAEGIDARIVRAVAATRGIA  783



>emb|CBI21190.3| unnamed protein product [Vitis vinifera]
Length=135

 Score =   103 bits (256),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  637  LPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATA  458
            LP+F+AYPQ+YVT+VGEYLLTLPQQLEPLAEGI +SD NADEAQ+FATEWMFKV     +
Sbjct  55   LPSFNAYPQAYVTSVGEYLLTLPQQLEPLAEGICSSDPNADEAQFFATEWMFKVTNLYCS  114

Query  457  LY  452
            L+
Sbjct  115  LH  116



>gb|AIU51120.1| embryo yellow protein, partial [Illicium henryi]
Length=720

 Score = 95.5 bits (236),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGI  539
            ND+SR+PIWSSVEE S  PLP+FSAYPQ YVT+VGEYLLTLPQQLEPL+EGI
Sbjct  669  NDVSRMPIWSSVEETSGLPLPSFSAYPQPYVTSVGEYLLTLPQQLEPLSEGI  720


 Score = 35.4 bits (80),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 16/20 (80%), Positives = 17/20 (85%), Gaps = 0/20 (0%)
 Frame = -2

Query  755  ADAVNELVYDVLISKVRQHF  696
            +D VNELVYDVLISKVRQ  
Sbjct  649  SDMVNELVYDVLISKVRQRL  668



>ref|XP_002731007.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Saccoglossus kowalevskii]
Length=259

 Score = 94.0 bits (232),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 57/176 (32%), Positives = 89/176 (51%), Gaps = 21/176 (12%)
 Frame = -3

Query  691  DLSRLPIWSSVEEHS--ARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANA  518
            DLS + +WSSV   +  +  LP+FS  P  Y+T +G+YL+TLPQQLE      + +   A
Sbjct  88   DLSTMEVWSSVGSGAVLSVDLPSFSLSPMEYITKIGQYLMTLPQQLESFTTQDNTALEKA  147

Query  517  --------------DEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEY  380
                           E      +W+  +A      YV+Q+  +  +T +G +QLS DI+Y
Sbjct  148  LQMGKLPFPDTQGEHEEDTVVDQWIGSIARATMHHYVEQILMVPQLTTQGTKQLSADIDY  207

Query  379  LSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRV  212
            L NVL AL +P    L++  + L TP +Q +E+     G+ ++    N V  MR +
Sbjct  208  LCNVLDALGIPASTSLSSVDTLLKTPIAQYEEI-----GDDIEARLINAVVGMRSI  258



>ref|XP_007513783.1| predicted protein [Bathycoccus prasinos]
 emb|CCO16308.1| predicted protein [Bathycoccus prasinos]
Length=978

 Score = 96.7 bits (239),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 49/133 (37%), Positives = 77/133 (58%), Gaps = 11/133 (8%)
 Frame = -3

Query  673  IWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSD-----------  527
            IW+ +   +A  LPTFSAYPQ   TN GEYLL+LP +LE L   + +             
Sbjct  796  IWTKMAAQTAHDLPTFSAYPQEKATNSGEYLLSLPTRLEALVNVVGDDVGSAASASAGIF  855

Query  526  ANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMP  347
             N DE +  A+ WM +VAE +  +++++++ I+ +++ GA QL+ D+EY SNV++AL+  
Sbjct  856  GNDDEDEDLASIWMERVAEASATIFLERVKSIRRLSEPGAAQLAADLEYFSNVVTALTSR  915

Query  346  VPPVLATFHSCLS  308
                L  +  C S
Sbjct  916  PQRGLLAYMQCAS  928



>ref|XP_005847546.1| hypothetical protein CHLNCDRAFT_133750 [Chlorella variabilis]
 gb|EFN55444.1| hypothetical protein CHLNCDRAFT_133750 [Chlorella variabilis]
Length=753

 Score = 93.2 bits (230),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 69/119 (58%), Gaps = 6/119 (5%)
 Frame = -3

Query  688  LSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANADEA  509
            L RL  W   +   A  LPTFSAYP  YVT+VGEYL+ LPQQLE    G    + N +EA
Sbjct  591  LPRLGEWQ--QRAGALLLPTFSAYPLQYVTSVGEYLMMLPQQLESALLG----EDNGEEA  644

Query  508  QYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVL  332
                 +W+ KVA    A Y  QL  +  +T +GA QL+ D+EY  NVL+ L + VPP L
Sbjct  645  GQLVGDWIDKVALDTAAHYQQQLAALPGLTAQGAAQLAADLEYFCNVLTTLGVAVPPSL  703



>ref|XP_002503576.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO64834.1| predicted protein [Micromonas sp. RCC299]
Length=770

 Score = 90.5 bits (223),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 66/172 (38%), Positives = 91/172 (53%), Gaps = 13/172 (8%)
 Frame = -3

Query  688  LSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANADE-  512
            L++   WS+  E S   LPTFSAYPQ YVT  GEYLL+LPQ LE +A+      A A   
Sbjct  600  LAKRAEWSTSAESSDFDLPTFSAYPQGYVTTAGEYLLSLPQHLESIADAAEEERAAAAAA  659

Query  511  ---------AQYF-ATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLS  362
                     A++F + EWM +VAE A  L + ++R I  + + GA QL+ D+EY +N++S
Sbjct  660  GEMGRAATAAEHFDSGEWMTRVAEAAAGLLLAEVRAITTLGEPGAAQLAADLEYFNNIIS  719

Query  361  ALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSL  206
            AL    P  L T+  C +  R      V+   G   D+  A  V K R + L
Sbjct  720  ALFSEPPSALRTYAVCAAAARDSYAISVRDVEGMDEDVIRA--VAKARGIKL  769



>ref|XP_003055554.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH60806.1| predicted protein [Micromonas pusilla CCMP1545]
Length=809

 Score = 90.1 bits (222),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 59/163 (36%), Positives = 86/163 (53%), Gaps = 10/163 (6%)
 Frame = -3

Query  670  WSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANA-----DEAQ  506
            W          LPTFSAYPQ Y+TN GEYLL+LP  L+ +A   + + A       D  +
Sbjct  632  WGETRASGGLNLPTFSAYPQEYMTNAGEYLLSLPTTLDAIAGAGAVAGAAGPGGADDVPE  691

Query  505  YFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSM---PVPPV  335
              A EWM KVA  A +L + ++RGI  +TD GA QL+ D++Y  NV++ALS+   P    
Sbjct  692  LDAGEWMAKVAAAAASLLLTEVRGISALTDLGAAQLAADLDYFVNVIAALSLDDVPDAKK  751

Query  334  LATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSL  206
            L  F +C +  R     ++ +  G+ +D     +V   R + L
Sbjct  752  LRCFATCCAAARDAY--VMSTRDGDAVDEDIVKIVAAARGIKL  792



>ref|XP_005643872.1| hypothetical protein COCSUDRAFT_67854 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE19328.1| hypothetical protein COCSUDRAFT_67854 [Coccomyxa subellipsoidea 
C-169]
Length=731

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 65/107 (61%), Gaps = 5/107 (5%)
 Frame = -3

Query  640  PLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGAT  461
            PLP FSAYPQ  VT  GEYL+ LPQ LE L  G S +     E +    EW+ +VA GA 
Sbjct  590  PLPAFSAYPQQAVTAAGEYLMMLPQTLEGLLGGDSEA-----EEEAVDAEWLDRVAAGAA  644

Query  460  ALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFH  320
             LYV +L  I  +++ GA QL+ D++Y  NVL+AL + VP  L T+ 
Sbjct  645  ELYVRELAKIAALSESGAAQLAADLDYFCNVLAALGVAVPLQLVTWQ  691



>ref|XP_797564.3| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Strongylocentrotus purpuratus]
Length=348

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 51/152 (34%), Positives = 76/152 (50%), Gaps = 14/152 (9%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            + +S++ +W+      +  LPTFS  PQ Y+T +G+YL+TLPQQLE      + +   A 
Sbjct  176  SQVSQMEVWTDEGGMLSADLPTFSLSPQEYITKIGQYLMTLPQQLETCTSQDNPAMEKAL  235

Query  514  EAQ--------------YFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYL  377
            EA               + A  W+  VA     +YV+ +  I  +T + A+QLS DI+YL
Sbjct  236  EASQLPFPPSPGSPEVAHLADYWIGSVARATMHMYVEVILRINGLTQQAARQLSTDIDYL  295

Query  376  SNVLSALSMPVPPVLATFHSCLSTPRSQLKEL  281
             NV+ AL +   P L      L  P SQ  E+
Sbjct  296  CNVVDALGIHPSPNLKHIEELLKMPLSQYGEV  327



>ref|XP_786237.3| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Strongylocentrotus purpuratus]
Length=762

 Score = 84.0 bits (206),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 51/150 (34%), Positives = 75/150 (50%), Gaps = 14/150 (9%)
 Frame = -3

Query  688  LSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANADEA  509
            +S++ +W+      +  LPTFS  PQ Y+T +G+YL+TLPQQLE      + +   A EA
Sbjct  592  VSQMEVWTDEGGMLSADLPTFSLSPQEYITKIGQYLMTLPQQLETCTSQDNPAMEKALEA  651

Query  508  Q--------------YFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSN  371
                           + A  W+  VA     +YV+ +  I  +T + A+QLS DI+YL N
Sbjct  652  SQLPFPPSPGSPEVAHLADYWIGSVARATMHMYVEVILRINELTQQAARQLSTDIDYLCN  711

Query  370  VLSALSMPVPPVLATFHSCLSTPRSQLKEL  281
            V+ AL +   P L      L  P SQ  E+
Sbjct  712  VVDALGIHPSPNLKHIEELLKMPLSQYGEV  741



>ref|XP_001701937.1| component of oligomeric golgi complex 7 [Chlamydomonas reinhardtii]
 gb|EDP06912.1| component of oligomeric golgi complex 7 [Chlamydomonas reinhardtii]
Length=758

 Score = 81.3 bits (199),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 58/177 (33%), Positives = 81/177 (46%), Gaps = 19/177 (11%)
 Frame = -3

Query  679  LPIWSSVEE---HSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANADEA  509
            LP W    E   H A PLP+F+ YP  YVT +G++L+ +PQQLE L  G +  D +A  A
Sbjct  574  LPEWRKGAEGSAHPAAPLPSFNTYPLPYVTAIGDHLMAMPQQLEVLM-GDTGDDTSATAA  632

Query  508  QYFATEWMF--------------KVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSN  371
               A                   K   GA A+Y D +  I  +  +G  QL+ D+EY  N
Sbjct  633  AGGADASGGGAAEWEELAAEWLDKAVSGAAAMYADAIFKIGDLGQQGGCQLATDVEYFVN  692

Query  370  VLSALSMPVPPVLATFHSCLSTPRSQLKELVKSD-SGNQLDLPTANLVCKMRRVSLE  203
            V+ AL +  PP L T          +  EL +   +    D P    +  MRR++LE
Sbjct  693  VMGALHVAPPPSLLTVQLLAGAAPEEFAELGRGALAEGAADGPALRALAGMRRIALE  749



>ref|XP_011431811.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Crassostrea gigas]
Length=754

 Score = 80.9 bits (198),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 46/128 (36%), Positives = 66/128 (52%), Gaps = 14/128 (11%)
 Frame = -3

Query  691  DLSRLPIWSSVEEHSA--RPLPTFSAYPQSYVTNVGEYLLTLPQQLEP------------  554
            D+S + IW+S     A    LPTFS  PQ Y+T VG++L+TLPQ LEP            
Sbjct  584  DVSNMEIWTSKSAGGALTSDLPTFSLSPQEYITKVGQFLMTLPQHLEPFTMQDNPSVLVA  643

Query  553  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  374
            L  G        +  ++ A  W+  +A G   LY +Q+  IQ +++   +QL  DI+YL 
Sbjct  644  LKHGKLPYTDETELPEHVADLWLESIARGTMHLYCEQILKIQELSNHAVKQLITDIDYLC  703

Query  373  NVLSALSM  350
            NVL  L +
Sbjct  704  NVLDDLGL  711



>gb|EKC24157.1| Conserved oligomeric Golgi complex subunit 7 [Crassostrea gigas]
Length=774

 Score = 80.9 bits (198),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 46/128 (36%), Positives = 66/128 (52%), Gaps = 14/128 (11%)
 Frame = -3

Query  691  DLSRLPIWSSVEEHSA--RPLPTFSAYPQSYVTNVGEYLLTLPQQLEP------------  554
            D+S + IW+S     A    LPTFS  PQ Y+T VG++L+TLPQ LEP            
Sbjct  604  DVSNMEIWTSKSAGGALTSDLPTFSLSPQEYITKVGQFLMTLPQHLEPFTMQDNPSVLVA  663

Query  553  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  374
            L  G        +  ++ A  W+  +A G   LY +Q+  IQ +++   +QL  DI+YL 
Sbjct  664  LKHGKLPYTDETELPEHVADLWLESIARGTMHLYCEQILKIQELSNHAVKQLITDIDYLC  723

Query  373  NVLSALSM  350
            NVL  L +
Sbjct  724  NVLDDLGL  731



>gb|EFA86654.1| oligomeric Golgi complex component [Polysphondylium pallidum 
PN500]
Length=785

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 59/201 (29%), Positives = 90/201 (45%), Gaps = 49/201 (24%)
 Frame = -3

Query  691  DLSRLPIW---SSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAE--------  545
            DL RLP W   S  E +   P         SY+T + E+LL +PQQL+P +E        
Sbjct  592  DLPRLPEWKQQSGTESYQTNPSQV------SYITQIAEHLLNIPQQLDPYSEEELIRFSY  645

Query  544  --GISNSDANADEAQYF----------------------------ATEWMFKVAEGATAL  455
               +S   AN D  Q                              A +WM  VA+    L
Sbjct  646  RIALSQPIANDDFYQNLVRQLYKSEQTTSAATISEDEEEEEEDGIAHQWMSLVAKATEKL  705

Query  454  YVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVK  275
            Y+  +  I  +TD G QQL+ DI YL N+LSA+ +P  P+L+     +S P+ +  E + 
Sbjct  706  YLQSIVEISTLTDSGCQQLANDISYLFNILSAIGVPHDPLLSLTQQLISIPKDKYLESIA  765

Query  274  SDSGNQLDLPTANLVCKMRRV  212
            +   ++ ++  +NL+ KMR +
Sbjct  766  NYESSEKNI--SNLISKMRGI  784



>ref|XP_005105726.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Aplysia californica]
Length=750

 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 48/142 (34%), Positives = 68/142 (48%), Gaps = 14/142 (10%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSARP--LPTFSAYPQSYVTNVGEYLLTLPQQLEP-----------  554
            N +S + IW+S     A    LPTFS  PQ Y+T VG+YL+TLPQ L+P           
Sbjct  579  NGVSIMEIWTSQSAGGAMTSDLPTFSLSPQEYITKVGQYLMTLPQHLDPFTLQESPALIT  638

Query  553  -LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYL  377
             L  G      + +  ++ A  W+  VA G    Y +++  I Y T  G +QL  DI+YL
Sbjct  639  ALKHGRLPYTNHQELPEHLADIWLESVAMGTMHTYTEEILKIPYATPHGCKQLITDIDYL  698

Query  376  SNVLSALSMPVPPVLATFHSCL  311
             NVL  L +     +    + L
Sbjct  699  CNVLEDLGLKASETMTHIQTLL  720



>ref|XP_001844946.1| conserved hypothetical protein [Culex quinquefasciatus]
 gb|EDS38841.1| conserved hypothetical protein [Culex quinquefasciatus]
Length=727

 Score = 77.8 bits (190),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 48/134 (36%), Positives = 70/134 (52%), Gaps = 8/134 (6%)
 Frame = -3

Query  670  WSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAE--------GISNSDANAD  515
            +S+ +E     LP +S  PQ Y+T +G+YLLTLPQ LEPL           + + D    
Sbjct  569  FSANKEGEGFNLPDYSYAPQEYITQIGQYLLTLPQHLEPLLLSPSPSLKFALQSCDDAYS  628

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            + ++ A   +  + E  TA Y + +  IQ +T  G++QL+VDIEY  NVL  +S+P    
Sbjct  629  KDKFCADVLLALIVEETTAFYQESIDNIQSLTAAGSKQLAVDIEYFGNVLEEMSLPFNAT  688

Query  334  LATFHSCLSTPRSQ  293
            L      L TP  Q
Sbjct  689  LQQTVVLLRTPLEQ  702



>emb|CDS12214.1| hypothetical protein LRAMOSA04409 [Absidia idahoensis var. thermophila]
Length=892

 Score = 76.3 bits (186),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 52/149 (35%), Positives = 69/149 (46%), Gaps = 39/149 (26%)
 Frame = -3

Query  637  LPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEG------------ISNSDANA---DEAQY  503
            +P FS  P +Y+T +GE LL LPQ+ E  A+             I  SD +A   +E   
Sbjct  743  MPQFSLSPNAYITRIGEKLLMLPQEFEVYADDSSLRYHIESAPFIEKSDLSAHDEEEDTI  802

Query  502  FATE------------------------WMFKVAEGATALYVDQLRGIQYITDRGAQQLS  395
             A+E                        W   +A G  A ++D++R IQ  T +G +QL 
Sbjct  803  DASEEHQQQPLDNEEEEEEEEGSDVIQLWTTSIARGTMARFLDEIRKIQKTTPQGQRQLR  862

Query  394  VDIEYLSNVLSALSMPVPPVLATFHSCLS  308
             DIEYL NVLSAL +   P L  FHS LS
Sbjct  863  TDIEYLVNVLSALDVQPLPDLVEFHSTLS  891



>ref|XP_011402672.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Amphimedon queenslandica]
Length=553

 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 64/127 (50%), Gaps = 14/127 (11%)
 Frame = -3

Query  637  LPTFSAYPQSYVTNVGEYLLTLPQQLEP--------LAEGISNS------DANADEAQYF  500
            LP+FS  P +Y+T +G++LLTLP+QLEP        LA  + +       D   +     
Sbjct  400  LPSFSLSPLTYITEIGDHLLTLPEQLEPFTSQDNPSLAAAMKHGRLPFTEDDGENRDLSL  459

Query  499  ATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFH  320
            +  W+  +A G    YV+ +  I  +TD  A QLS DI YL NVL+AL  P  P L    
Sbjct  460  SDMWLDAIARGTMETYVESILKIPRLTDAAALQLSTDIGYLCNVLAALDQPPIPALTALE  519

Query  319  SCLSTPR  299
              L + +
Sbjct  520  KLLKSDK  526



>ref|XP_004535745.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Ceratitis capitata]
Length=751

 Score = 75.1 bits (183),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 52/151 (34%), Positives = 76/151 (50%), Gaps = 22/151 (15%)
 Frame = -3

Query  637  LPTFSAYPQSYVTNVGEYLLTLPQQLEP--------LAEGISNSDANADEAQYFATEWMF  482
            +P FS  PQ  +T +G+YLLTLPQ LEP        L + +   +A   ++   A   + 
Sbjct  603  MPEFSFVPQESITQIGQYLLTLPQHLEPLLFTPSALLKQALEICNAKYTQSIPCADILLS  662

Query  481  KVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTP  302
             V E    LY  Q+  ++ +    ++Q +VDIEYLSNVL  L + +           ST 
Sbjct  663  LVVEQCCQLYQSQILQVKVMPVSSSKQFAVDIEYLSNVLEELGLNI-----------STS  711

Query  301  RSQLKELVKSDSGNQLDLPTANLVCKMRRVS  209
             SQ+  L+K+DSGN L L      C+ R V+
Sbjct  712  LSQILVLLKADSGNYLALSVG---CEPRLVT  739



>ref|XP_004206189.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Hydra vulgaris]
Length=216

 Score = 71.6 bits (174),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 49/155 (32%), Positives = 77/155 (50%), Gaps = 12/155 (8%)
 Frame = -3

Query  694  NDLSRLPIWSSVEEHSAR-PLPTFSAYPQSYVTNVGEYLLTLPQQLEP----------LA  548
            + +S + +W + E+ +A   LP FS  PQSY+T +G+ LLTLPQQLE           ++
Sbjct  47   DGVSSMEVWRTEEKEAAGGDLPKFSLSPQSYITQIGDSLLTLPQQLEGYFNEQNVSLIVS  106

Query  547  EGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNV  368
              +        E  +    W+  +A  A+A YV+ +  I Y+T  G +QL  DI+Y   +
Sbjct  107  LKVGRLPFQETEGAHLDHCWLESLARSASANYVEAIIKIPYLTAYGTRQLLADIDYYLKI  166

Query  367  LSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSG  263
            L AL + V   L T    +    S   E V +++G
Sbjct  167  LGALEVNVNEKLLTIQKLMIADPSSFNE-VAAETG  200



>dbj|GAM17697.1| hypothetical protein SAMD00019534_008720 [Acytostelium subglobosum 
LB1]
Length=735

 Score = 74.7 bits (182),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 60/110 (55%), Gaps = 2/110 (2%)
 Frame = -3

Query  529  DANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSM  350
            D N DE    A +WM  VA     LY+  +  I  +++ G QQLS DI YL NVLSAL +
Sbjct  626  DENIDEMDGIAHQWMTLVASATEKLYLQSIVEISMLSEFGCQQLSNDIGYLFNVLSALGV  685

Query  349  PVPPVLATFHSCLSTPRSQLKELVKS--DSGNQLDLPTANLVCKMRRVSL  206
               P+L+     +STP+ +  E++ +   S N  +   ANL+ KMR + L
Sbjct  686  SADPLLSRTQQLVSTPKERYAEIISNIMKSDNNAEKNIANLIAKMRGIKL  735



>ref|XP_002109935.1| hypothetical protein TRIADDRAFT_53345 [Trichoplax adhaerens]
 gb|EDV28101.1| hypothetical protein TRIADDRAFT_53345 [Trichoplax adhaerens]
Length=710

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 53/152 (35%), Positives = 73/152 (48%), Gaps = 22/152 (14%)
 Frame = -3

Query  688  LSRLPIWSS---VEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLA----------  548
            L  + +WS+   V + S   LPTF + P SY+T +G+YLL LPQQLEP A          
Sbjct  539  LKSVKVWSAEKEVSDVSNEDLPTFIS-PSSYITQIGDYLLNLPQQLEPFATQNNPSLEMA  597

Query  547  --EG------ISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSV  392
              EG       S+++  +         W+  VA G    YV+ +  I  +TD  A+QL  
Sbjct  598  LKEGKLPYPDTSDNEDTSLNVNDTTIYWLGAVARGTVLTYVENIMKIPTLTDHAARQLIE  657

Query  391  DIEYLSNVLSALSMPVPPVLATFHSCLSTPRS  296
            DIEYL N+L AL +     L      L +P S
Sbjct  658  DIEYLFNILEALEISPGIKLKQIVLLLKSPSS  689



>ref|XP_009062761.1| hypothetical protein LOTGIDRAFT_194952 [Lottia gigantea]
 gb|ESO86524.1| hypothetical protein LOTGIDRAFT_194952 [Lottia gigantea]
Length=737

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/128 (34%), Positives = 66/128 (52%), Gaps = 14/128 (11%)
 Frame = -3

Query  691  DLSRLPIWSSVEEHSA--RPLPTFSAYPQSYVTNVGEYLLTLPQQLEP------------  554
            ++S + IW+S     A    LP+FS  PQ Y+T +G+YL+T+PQ LEP            
Sbjct  567  NISNMEIWTSKRAEGALTSDLPSFSLSPQEYITKIGQYLMTIPQHLEPFMLHDNPTLTTA  626

Query  553  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  374
            L  G      + D  ++ A  W+  VA+G   +Y +++  I  ++    +QL  DIEYL 
Sbjct  627  LKYGKLPYIDDQDLPEHLADLWLESVAKGTMHIYCEEILKIINLSPHATKQLITDIEYLL  686

Query  373  NVLSALSM  350
            NVL  L +
Sbjct  687  NVLDDLGL  694



>ref|XP_003703617.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Megachile rotundata]
Length=764

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 48/134 (36%), Positives = 71/134 (53%), Gaps = 15/134 (11%)
 Frame = -3

Query  688  LSRLPIWSSVEE---HSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP--LAEGIS-NSD  527
            + + P WS+      H +  LP +S  PQ Y+T VG+YL+TLPQ LEP  L E  S N  
Sbjct  592  VQKAPAWSTETNKMTHLSADLPDYSFAPQEYITQVGQYLMTLPQHLEPFLLRENPSLNQA  651

Query  526  ANADEAQY--------FATEWMFKVAEGATALYVDQLRGI-QYITDRGAQQLSVDIEYLS  374
              A + QY        F    +  +A+G   +++DQ  GI Q+++    +QL+ DI+YL 
Sbjct  652  LKAADPQYAQGTTESGFTGILLDIIAKGTCQMFLDQTLGICQFLSSAACKQLATDIDYLG  711

Query  373  NVLSALSMPVPPVL  332
            NVL  L + +   L
Sbjct  712  NVLEELGLSLSENL  725



>gb|ELT88100.1| hypothetical protein CAPTEDRAFT_161050 [Capitella teleta]
Length=754

 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 42/128 (33%), Positives = 62/128 (48%), Gaps = 15/128 (12%)
 Frame = -3

Query  688  LSRLPIWSSVEEHSA--RPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEG---------  542
            L    IW S  +  A    LP F   PQ Y+T +G+YL+TLPQQLEP  +          
Sbjct  583  LPDFEIWQSESQAGAITTNLPAFGLTPQEYITKIGQYLMTLPQQLEPFTQEDNPALCVAL  642

Query  541  ----ISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  374
                + ++    D  +  A  W+  VA G+  LY +Q+  I  ++    QQL +DI+Y  
Sbjct  643  KHGRLPHTLDQTDMPEQLADLWLESVANGSMRLYAEQILNIPKLSTLATQQLLIDIDYFC  702

Query  373  NVLSALSM  350
            NV+  L +
Sbjct  703  NVMDDLGL  710



>ref|XP_011299085.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X3 [Fopius arisanus]
Length=698

 Score = 72.4 bits (176),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 47/141 (33%), Positives = 69/141 (49%), Gaps = 16/141 (11%)
 Frame = -3

Query  688  LSRLPIW----SSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP--------LAE  545
            + R P W    + V+  S+  LP +S  PQ Y+T VG+YL+TLPQ LEP        L  
Sbjct  527  IQRAPAWFGDGAKVQGLSS-DLPDYSFAPQEYITQVGQYLMTLPQHLEPFLLRDNPSLVH  585

Query  544  GISNSDANADEAQY---FATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  374
             +  +DA   +      F    +  VA+G   ++ DQ  GI  +     +QL+ DI+YL 
Sbjct  586  ALRAADAQYTQGSAEGGFTATLLGIVAKGTCQMFQDQALGICELNTGACKQLATDIDYLG  645

Query  373  NVLSALSMPVPPVLATFHSCL  311
            NVL  L +P+   L    + L
Sbjct  646  NVLEELGLPLSDNLQQMSTLL  666



>ref|XP_011299070.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X1 [Fopius arisanus]
Length=750

 Score = 72.4 bits (176),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 47/141 (33%), Positives = 69/141 (49%), Gaps = 16/141 (11%)
 Frame = -3

Query  688  LSRLPIW----SSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP--------LAE  545
            + R P W    + V+  S+  LP +S  PQ Y+T VG+YL+TLPQ LEP        L  
Sbjct  579  IQRAPAWFGDGAKVQGLSS-DLPDYSFAPQEYITQVGQYLMTLPQHLEPFLLRDNPSLVH  637

Query  544  GISNSDANADEAQY---FATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  374
             +  +DA   +      F    +  VA+G   ++ DQ  GI  +     +QL+ DI+YL 
Sbjct  638  ALRAADAQYTQGSAEGGFTATLLGIVAKGTCQMFQDQALGICELNTGACKQLATDIDYLG  697

Query  373  NVLSALSMPVPPVLATFHSCL  311
            NVL  L +P+   L    + L
Sbjct  698  NVLEELGLPLSDNLQQMSTLL  718



>ref|XP_011299078.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X2 [Fopius arisanus]
Length=736

 Score = 72.4 bits (176),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 47/141 (33%), Positives = 69/141 (49%), Gaps = 16/141 (11%)
 Frame = -3

Query  688  LSRLPIW----SSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP--------LAE  545
            + R P W    + V+  S+  LP +S  PQ Y+T VG+YL+TLPQ LEP        L  
Sbjct  565  IQRAPAWFGDGAKVQGLSS-DLPDYSFAPQEYITQVGQYLMTLPQHLEPFLLRDNPSLVH  623

Query  544  GISNSDANADEAQY---FATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  374
             +  +DA   +      F    +  VA+G   ++ DQ  GI  +     +QL+ DI+YL 
Sbjct  624  ALRAADAQYTQGSAEGGFTATLLGIVAKGTCQMFQDQALGICELNTGACKQLATDIDYLG  683

Query  373  NVLSALSMPVPPVLATFHSCL  311
            NVL  L +P+   L    + L
Sbjct  684  NVLEELGLPLSDNLQQMSTLL  704



>gb|KDR16116.1| Conserved oligomeric Golgi complex subunit 7 [Zootermopsis nevadensis]
Length=742

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/131 (34%), Positives = 66/131 (50%), Gaps = 16/131 (12%)
 Frame = -3

Query  676  PIWSSVEEHSAR---PLPTFSAYPQSYVTNVGEYLLTLPQQLEP----------LAEGIS  536
            P WS+  + +A     LP FS  PQ Y+T +G+YL+TLPQ LEP          LA  ++
Sbjct  573  PAWSNANKQAATVAADLPDFSFAPQEYITQIGQYLMTLPQHLEPFLLQDNPSLTLALQVA  632

Query  535  NSD---ANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVL  365
            + +    +A+    FA   +  +A G    Y D + GI  +     +QL+ DI+YL NVL
Sbjct  633  DVEYGLLSAEAEGGFAGVLLGIIARGTCQTYCDNILGICELGSSSCKQLATDIDYLGNVL  692

Query  364  SALSMPVPPVL  332
              L + +   L
Sbjct  693  EDLGLSLSEHL  703



>ref|XP_001652664.1| AAEL007307-PA [Aedes aegypti]
 gb|EAT41036.1| AAEL007307-PA [Aedes aegypti]
Length=708

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 67/133 (50%), Gaps = 9/133 (7%)
 Frame = -3

Query  664  SVEEHSAR-PLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEG--------ISNSDANADE  512
            ++++HS    LP +S  PQ YVT +G+YLLTLPQ LEPL           +   +     
Sbjct  551  TIKQHSENYDLPDYSYAPQEYVTQIGQYLLTLPQHLEPLLLSPSPALKFIMEFCEDKYKG  610

Query  511  AQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVL  332
             +  A   +F + E  TA+Y +++  I  ++   A+QL+ DIEY  NVL  +S+ +   L
Sbjct  611  EKACADVLLFLIVEETTAMYQEKIDEILSLSASSAKQLATDIEYFGNVLEEMSLTLSTNL  670

Query  331  ATFHSCLSTPRSQ  293
                  L  P  Q
Sbjct  671  QQIIVLLRAPLDQ  683



>ref|XP_006682175.1| hypothetical protein BATDEDRAFT_27828 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF77069.1| hypothetical protein BATDEDRAFT_27828 [Batrachochytrium dendrobatidis 
JAM81]
Length=846

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/143 (30%), Positives = 66/143 (46%), Gaps = 13/143 (9%)
 Frame = -3

Query  637  LPTFSAYPQSYVTNVGEYLLTLPQQLEPLAE------------GISNSDANADEAQYFAT  494
            LP FS  P +Y+TN+GE LL LP  L+  A             G+   D    E+     
Sbjct  685  LPEFSLLPLAYMTNIGEQLLALPLHLDTFAGEQSLQYSLATLPGVECIDLEDQESIDVTH  744

Query  493  EWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSC  314
             W+  ++    +  +DQ++ I  ++ RG +QL+ DI YLSNV SA+ +     L     C
Sbjct  745  VWILSMSRAIESRLMDQVKRIPTLSSRGCRQLATDINYLSNVFSAMEIEPHMTLQVMIQC  804

Query  313  LSTPRSQL-KELVKSDSGNQLDL  248
            L      L K + + D+    D+
Sbjct  805  LECNEQDLEKRMTEQDTAENSDI  827



>ref|XP_003490215.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Bombus impatiens]
Length=783

 Score = 70.1 bits (170),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 58/175 (33%), Positives = 86/175 (49%), Gaps = 19/175 (11%)
 Frame = -3

Query  688  LSRLPIWSS---VEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP--LAEGISNSDA  524
            + + P WS+      H +  LP +S  PQ Y+T VG+YL+TLPQ LEP  L E  S + A
Sbjct  612  VQKAPAWSTEINKMTHLSADLPDYSFAPQEYITQVGQYLMTLPQHLEPFLLRENPSLTQA  671

Query  523  -NADEAQYF--ATEWMFK------VAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSN  371
              A + QY   +TE  F       +A+    +++DQ  GI  ++    +QL+ DI+YL N
Sbjct  672  LKAADPQYAQSSTESGFTGILLEIIAKETCQMFLDQTLGICQLSSAACKQLATDIDYLGN  731

Query  370  VLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSL  206
            VL  L + +   L      L  P    +   KS SG    +  A  V +MR ++ 
Sbjct  732  VLEELGLSLSENLQHMSLLLRLPPEDYQ---KSSSGCNARVVAA--VRQMRNITF  781



>ref|XP_003397366.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Bombus terrestris]
Length=735

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 58/175 (33%), Positives = 87/175 (50%), Gaps = 19/175 (11%)
 Frame = -3

Query  688  LSRLPIWSS---VEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP--LAEGISNSDA  524
            + + P WS+      H +  LP +S  PQ Y+T VG+YL+TLPQ LEP  L E  S + A
Sbjct  564  VQKAPAWSTEINKMTHLSADLPDYSFAPQEYITQVGQYLMTLPQHLEPFLLRENPSLTQA  623

Query  523  -NADEAQYF--ATEWMFK------VAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSN  371
              A + QY   +TE  F       +A+    +++DQ  GI  ++    +QL+ DI+YL N
Sbjct  624  LKAADPQYAQSSTESGFTGILLEIIAKETCQMFLDQTLGICQLSSAACKQLATDIDYLGN  683

Query  370  VLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSL  206
            VL  L + +   L      L  P    ++  KS SG    +  A  V +MR ++ 
Sbjct  684  VLEELGLSLSENLQHMSLLLRLPP---EDYHKSSSGCNARVVAA--VRQMRNITF  733



>ref|XP_005810284.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Xiphophorus maculatus]
Length=769

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 41/125 (33%), Positives = 61/125 (49%), Gaps = 22/125 (18%)
 Frame = -3

Query  667  SSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANADEAQY-----  503
            S++ E     LPTFS  PQ Y+TN+G+YL++LP  LEP    ++  D   D A +     
Sbjct  605  SAIGESYTEDLPTFSLSPQEYITNIGQYLMSLPLHLEPF---VTQEDPALDMALHAGKLP  661

Query  502  --------------FATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVL  365
                           A  W+  +A      Y D +  I +++    +QL+ DIEYLSNV+
Sbjct  662  FPPEQGDDLPELDNTADYWLGSIARATMQTYCDAILLIPHLSPHSTKQLATDIEYLSNVM  721

Query  364  SALSM  350
             AL +
Sbjct  722  DALGL  726



>ref|XP_011159533.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Solenopsis 
invicta]
Length=735

 Score = 69.3 bits (168),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 47/144 (33%), Positives = 68/144 (47%), Gaps = 16/144 (11%)
 Frame = -3

Query  688  LSRLPIWSSVEEHS----ARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP--------LAE  545
            + + P WS VE +     +  LP +S  PQ Y+T VG+YL+TLPQ LEP        L +
Sbjct  564  VQKAPAWS-VETNKMSNLSSELPDYSFAPQEYITQVGQYLMTLPQHLEPFLLRDNPSLTQ  622

Query  544  GISNSD---ANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  374
             +  +D   A       F +  +  VA G   ++ DQ  GI  +     +QL+ DI+YL 
Sbjct  623  ALKAADPQYAQGSTESGFTSILLDIVARGTCQMFQDQTLGICQLNSVACKQLATDIDYLG  682

Query  373  NVLSALSMPVPPVLATFHSCLSTP  302
            NVL  L + +   L      L  P
Sbjct  683  NVLEELGLCLSENLQHMSLLLRLP  706



>gb|EFZ22757.1| hypothetical protein SINV_01051 [Solenopsis invicta]
Length=780

 Score = 69.3 bits (168),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 47/144 (33%), Positives = 68/144 (47%), Gaps = 16/144 (11%)
 Frame = -3

Query  688  LSRLPIWSSVEEHS----ARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP--------LAE  545
            + + P WS VE +     +  LP +S  PQ Y+T VG+YL+TLPQ LEP        L +
Sbjct  609  VQKAPAWS-VETNKMSNLSSELPDYSFAPQEYITQVGQYLMTLPQHLEPFLLRDNPSLTQ  667

Query  544  GISNSD---ANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  374
             +  +D   A       F +  +  VA G   ++ DQ  GI  +     +QL+ DI+YL 
Sbjct  668  ALKAADPQYAQGSTESGFTSILLDIVARGTCQMFQDQTLGICQLNSVACKQLATDIDYLG  727

Query  373  NVLSALSMPVPPVLATFHSCLSTP  302
            NVL  L + +   L      L  P
Sbjct  728  NVLEELGLCLSENLQHMSLLLRLP  751



>ref|XP_011340196.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X2 [Cerapachys biroi]
Length=705

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 64/129 (50%), Gaps = 14/129 (11%)
 Frame = -3

Query  688  LSRLPIWS---SVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP--------LAEG  542
            + + P WS   S   + +  LP +S  PQ Y+T VG+YL+TLPQ LEP        L + 
Sbjct  534  VQKAPAWSADTSKMSNLSSDLPDYSFAPQEYITQVGQYLMTLPQHLEPFLLRDNPSLTQA  593

Query  541  ISNSD---ANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSN  371
            +  +D   A       F    +  VA G   +++DQ  GI  +     +QL+ DI+YL N
Sbjct  594  LKAADPQYAQVSTESGFTGILLDIVARGTCQMFLDQTLGICQLNSVACKQLATDIDYLGN  653

Query  370  VLSALSMPV  344
            VL  L + +
Sbjct  654  VLEELGLCL  662



>ref|XP_007571518.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Poecilia formosa]
Length=224

 Score = 66.6 bits (161),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 60/125 (48%), Gaps = 22/125 (18%)
 Frame = -3

Query  667  SSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANADEAQY-----  503
            S++ E     LPTFS  PQ Y+TN+G+YL++LP  LEP    ++  D   + A +     
Sbjct  60   SAIGESYTEDLPTFSLSPQEYITNIGQYLMSLPLHLEPF---VTQEDPALEMALHAGKLP  116

Query  502  --------------FATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVL  365
                           A  W+  +A      Y D +  I  ++    +QL+ DIEYLSNV+
Sbjct  117  FPPDQGDDLPELDNTADYWLGSIARATMQTYCDAILLIPRLSPHSTKQLATDIEYLSNVM  176

Query  364  SALSM  350
             AL +
Sbjct  177  DALGL  181



>ref|XP_011340195.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X1 [Cerapachys biroi]
 gb|EZA53204.1| Conserved oligomeric Golgi complex subunit [Cerapachys biroi]
Length=735

 Score = 68.9 bits (167),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 65/133 (49%), Gaps = 14/133 (11%)
 Frame = -3

Query  688  LSRLPIWS---SVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP--------LAEG  542
            + + P WS   S   + +  LP +S  PQ Y+T VG+YL+TLPQ LEP        L + 
Sbjct  564  VQKAPAWSADTSKMSNLSSDLPDYSFAPQEYITQVGQYLMTLPQHLEPFLLRDNPSLTQA  623

Query  541  ISNSD---ANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSN  371
            +  +D   A       F    +  VA G   +++DQ  GI  +     +QL+ DI+YL N
Sbjct  624  LKAADPQYAQVSTESGFTGILLDIVARGTCQMFLDQTLGICQLNSVACKQLATDIDYLGN  683

Query  370  VLSALSMPVPPVL  332
            VL  L + +   L
Sbjct  684  VLEELGLCLSENL  696



>ref|XP_005825555.1| oligomeric Golgi complex subunit 7 [Guillardia theta CCMP2712]
 gb|EKX38575.1| oligomeric Golgi complex subunit 7 [Guillardia theta CCMP2712]
Length=842

 Score = 68.6 bits (166),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 68/128 (53%), Gaps = 15/128 (12%)
 Frame = -3

Query  691  DLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEG---ISNSDA-  524
            ++++L +W   E      LP+FS+ P  +VTN+ E+L +LP+QL+P A      S S A 
Sbjct  669  NVAKLQVWG--ENKKKGHLPSFSSSPLPHVTNIAEHLFSLPEQLDPAAHDEVPCSTSAAL  726

Query  523  ------NADEA---QYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSN  371
                  N DE      F  +W+ ++     +LYV+++  I  ++  G  QL  DI+Y+S+
Sbjct  727  QLTQPQNVDEGSSEHKFMQKWLSRITGEVVSLYVEKILEIPALSPSGRVQLGTDIQYISS  786

Query  370  VLSALSMP  347
            +L  L  P
Sbjct  787  ILDTLGAP  794



>ref|XP_002407978.1| conserved oligomeric golgi complex subunit, putative [Ixodes 
scapularis]
 gb|EEC12391.1| conserved oligomeric golgi complex subunit, putative [Ixodes 
scapularis]
Length=749

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 63/127 (50%), Gaps = 12/127 (9%)
 Frame = -3

Query  646  ARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP--------LAEGISNSD----ANADEAQY  503
            AR LP FS  P  Y+T +G+YLLT+PQ +EP        LA  +  S+      +    +
Sbjct  597  ARDLPAFSISPLEYITQIGQYLLTIPQHIEPFIVEENEALAMALKYSNLPHVIESTSTDH  656

Query  502  FATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATF  323
             A   +  VA+     Y+D +  I  +T + + QL+ DI YL NVL  L +P+   L   
Sbjct  657  VADYLLGCVAQATMYTYLDTVMQIDRLTQQASAQLATDIGYLCNVLDDLGLPLLENLQQL  716

Query  322  HSCLSTP  302
             + L +P
Sbjct  717  AALLKSP  723



>ref|XP_008559723.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Microplitis 
demolitor]
Length=771

 Score = 67.8 bits (164),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 59/108 (55%), Gaps = 12/108 (11%)
 Frame = -3

Query  637  LPTFSAYPQSYVTNVGEYLLTLPQQLEPL----------AEGISNSDANADEAQY--FAT  494
            LP +S  PQ ++T +G+YL+TLPQ LEP           A  +++   N  E     F  
Sbjct  620  LPDYSFIPQEFITLIGQYLMTLPQHLEPFLLTDNPSLNYALKMADDKFNHLEGGSGGFTG  679

Query  493  EWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSM  350
              +  VA+ A  ++ DQ+ GI+ +  +G +QL+VDI+YL N+   L +
Sbjct  680  ILLGIVAKDACQMFFDQILGIRELDAKGCKQLAVDIDYLGNIFEELGL  727



>ref|XP_007233023.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Astyanax mexicanus]
Length=545

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 40/140 (29%), Positives = 63/140 (45%), Gaps = 22/140 (16%)
 Frame = -3

Query  637  LPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSD-------------------ANAD  515
            LPTFS  PQ Y+TN+G+Y+++LP  LEP    ++  D                    +  
Sbjct  391  LPTFSLSPQEYITNIGQYIMSLPLHLEPF---VTQEDPALELALHTGKLPYPPEQGDDVP  447

Query  514  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
            E +  A  W+  +A      Y D +  IQ +     +QL+ DI+YLSNV+ AL +     
Sbjct  448  ELENTADYWLGSIARATMQTYCDVILQIQELNPHSTKQLATDIDYLSNVMDALGLQTSRT  507

Query  334  LATFHSCLSTPRSQLKELVK  275
            L    + L     + ++  K
Sbjct  508  LQNITTLLRAKPEEFRQTAK  527



>ref|XP_002293816.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gb|EED88825.1| predicted protein [Thalassiosira pseudonana CCMP1335]
Length=162

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 57/105 (54%), Gaps = 7/105 (7%)
 Frame = -3

Query  631  TFSAYPQSYVTNVGEYLLTLPQQLEPLAE-----GISNSDANADE--AQYFATEWMFKVA  473
            ++   PQS++T+VGE++L L Q LEP A      G++N D + +   +  F  +W+  V 
Sbjct  5    SYGILPQSFITHVGEHMLALVQALEPFASDSEALGLANEDGDVESKASTAFCNQWLDVVG  64

Query  472  EGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPP  338
               T   +++   I  +  +GA+ L+ D+ Y+ NV +AL +   P
Sbjct  65   LAVTGRILERTMRIPRLGRKGAEHLAADLNYIRNVFTALGVAGHP  109



>ref|XP_003961343.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Takifugu rubripes]
Length=769

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 59/121 (49%), Gaps = 22/121 (18%)
 Frame = -3

Query  655  EHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANADEAQY---------  503
            E+    LPTFS  PQ Y+TN+G+YL++LP  LEP    ++  D   + A +         
Sbjct  609  ENYTEDLPTFSLSPQEYITNIGQYLMSLPLHLEPF---VTQEDPALEMALHAGKLPFPPE  665

Query  502  ----------FATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALS  353
                       A  W+  +A      Y D +  I  ++ R  +QL+ DI+YLSNV+ AL 
Sbjct  666  QGDDLPELDNVADYWLGSIARATMQTYCDAILLIPQLSTRSTKQLATDIDYLSNVMDALG  725

Query  352  M  350
            +
Sbjct  726  L  726



>ref|XP_006623838.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
isoform X1 [Apis dorsata]
Length=760

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 69/133 (52%), Gaps = 14/133 (11%)
 Frame = -3

Query  688  LSRLPIWSSVEE---HSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP--LAEGISNSDA  524
            + + P WS+      H +  LP +S  PQ Y+T VG+YL+TLPQ LEP  L E  S + A
Sbjct  589  VQKAPAWSTEANKMIHLSADLPDYSFAPQEYITQVGQYLMTLPQHLEPFLLRENPSLTQA  648

Query  523  -NADEAQYF--ATEWMFK------VAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSN  371
              A + QY   +TE  F       + +    +++DQ  GI  +     +QL+ DI+YL N
Sbjct  649  LKAADPQYTQSSTESGFTDILLEIITKETCQMFLDQTLGICQLNSAACKQLATDIDYLGN  708

Query  370  VLSALSMPVPPVL  332
            VL  L + +   L
Sbjct  709  VLEELGLSLSENL  721



>ref|XP_006623839.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
isoform X2 [Apis dorsata]
Length=734

 Score = 67.0 bits (162),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 45/133 (34%), Positives = 67/133 (50%), Gaps = 14/133 (11%)
 Frame = -3

Query  688  LSRLPIWSSVEE---HSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP--LAEGISNSDA  524
            + + P WS+      H +  LP +S  PQ Y+T VG+YL+TLPQ LEP  L E  S + A
Sbjct  563  VQKAPAWSTEANKMIHLSADLPDYSFAPQEYITQVGQYLMTLPQHLEPFLLRENPSLTQA  622

Query  523  -NADEAQY--------FATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSN  371
              A + QY        F    +  + +    +++DQ  GI  +     +QL+ DI+YL N
Sbjct  623  LKAADPQYTQSSTESGFTDILLEIITKETCQMFLDQTLGICQLNSAACKQLATDIDYLGN  682

Query  370  VLSALSMPVPPVL  332
            VL  L + +   L
Sbjct  683  VLEELGLSLSENL  695



>ref|XP_008434639.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Poecilia 
reticulata]
Length=769

 Score = 67.0 bits (162),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 61/125 (49%), Gaps = 22/125 (18%)
 Frame = -3

Query  667  SSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANADEAQY-----  503
            S++ E     LPTFS  PQ Y+TN+G+YL++LP  LEP    ++  D   + A +     
Sbjct  605  SAIGESYTEDLPTFSLSPQEYITNIGQYLMSLPLHLEPF---VTQEDPALELALHAGKLP  661

Query  502  --------------FATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVL  365
                           A  W+  +A      Y D +  I +++    +QL+ DIEYLSNV+
Sbjct  662  FPPEQGDDLPELDNTADYWLGSIARATMQTYCDAILLIPHLSPHSTKQLATDIEYLSNVM  721

Query  364  SALSM  350
             AL +
Sbjct  722  DALGL  726



>ref|XP_003691700.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Apis florea]
Length=697

 Score = 67.0 bits (162),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 45/133 (34%), Positives = 67/133 (50%), Gaps = 14/133 (11%)
 Frame = -3

Query  688  LSRLPIWSSVEE---HSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP--LAEGISNSDA  524
            + + P WS+      H +  LP +S  PQ Y+T VG+YL+TLPQ LEP  L E  S + A
Sbjct  526  VQKAPAWSTEANKMIHLSADLPDYSFAPQEYITQVGQYLMTLPQHLEPFLLRENPSLTQA  585

Query  523  -NADEAQY--------FATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSN  371
              A + QY        F    +  + +    +++DQ  GI  +     +QL+ DI+YL N
Sbjct  586  LKAADPQYTQSSTESGFTDILLEIITKETCQMFLDQTLGICQLNSAACKQLATDIDYLGN  645

Query  370  VLSALSMPVPPVL  332
            VL  L + +   L
Sbjct  646  VLEELGLSLSENL  658



>ref|XP_011068677.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Acromyrmex 
echinatior]
Length=735

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 62/123 (50%), Gaps = 11/123 (9%)
 Frame = -3

Query  637  LPTFSAYPQSYVTNVGEYLLTLPQQLEP--LAEGISNSDA-NADEAQY--------FATE  491
            LP +S  PQ Y+T VG+YL+TLPQ LEP  L +  S + A  A + QY        F + 
Sbjct  584  LPDYSFAPQEYITQVGQYLMTLPQHLEPFLLRDNPSLTQALKAADPQYVQGSSESGFTSI  643

Query  490  WMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCL  311
             +  +A G   ++ DQ  GI  +     +QL+ DI+YL NVL  L + +   L      L
Sbjct  644  LLDIIARGTCQMFQDQTLGICQLNSVACKQLATDIDYLGNVLEELGLCLSENLQHMSLLL  703

Query  310  STP  302
              P
Sbjct  704  RLP  706



>gb|EGI69206.1| Conserved oligomeric Golgi complex subunit 7 [Acromyrmex echinatior]
Length=864

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 62/123 (50%), Gaps = 11/123 (9%)
 Frame = -3

Query  637  LPTFSAYPQSYVTNVGEYLLTLPQQLEP--LAEGISNSDA-NADEAQY--------FATE  491
            LP +S  PQ Y+T VG+YL+TLPQ LEP  L +  S + A  A + QY        F + 
Sbjct  713  LPDYSFAPQEYITQVGQYLMTLPQHLEPFLLRDNPSLTQALKAADPQYVQGSSESGFTSI  772

Query  490  WMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCL  311
             +  +A G   ++ DQ  GI  +     +QL+ DI+YL NVL  L + +   L      L
Sbjct  773  LLDIIARGTCQMFQDQTLGICQLNSVACKQLATDIDYLGNVLEELGLCLSENLQHMSLLL  832

Query  310  STP  302
              P
Sbjct  833  RLP  835



>ref|XP_394713.2| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Apis 
mellifera]
Length=733

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 66/129 (51%), Gaps = 14/129 (11%)
 Frame = -3

Query  688  LSRLPIWSSVEE---HSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP--LAEGISNSDA  524
            + + P WS+      H +  LP +S  PQ Y+T VG+YL+TLPQ LEP  L E  S + A
Sbjct  562  VQKAPAWSTEANKMIHLSADLPDYSFAPQEYITQVGQYLMTLPQHLEPFLLRENPSLTQA  621

Query  523  -NADEAQY--------FATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSN  371
              A + QY        F    +  + +    +++DQ  GI  +     +QL+ DI+YL N
Sbjct  622  LKAADPQYTQSSTESGFTDILLEIITKETCQMFLDQTLGICQLNSAACKQLATDIDYLGN  681

Query  370  VLSALSMPV  344
            VL  L + +
Sbjct  682  VLEELGLCL  690



>ref|XP_006637161.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Lepisosteus oculatus]
Length=728

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 47/157 (30%), Positives = 68/157 (43%), Gaps = 24/157 (15%)
 Frame = -3

Query  682  RLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSD------  527
            R+  WSS    E     LPTFS  P  Y+TN+G+Y+++LP  LEP    ++  D      
Sbjct  557  RMESWSSSGTGETLTEDLPTFSLSPLEYITNIGQYIMSLPLHLEPF---VTQEDPALELA  613

Query  526  ----------ANAD---EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  386
                        AD   E    A  W+  +A      Y D +  I  +T   A+QL+ DI
Sbjct  614  LHAGKLPFPPEQADDLPELDNIADYWLGSIARATMQTYCDAILQIPELTPHSAKQLATDI  673

Query  385  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVK  275
            +YLSNV+ AL +     L    + L       ++  K
Sbjct  674  DYLSNVMDALGLQASRTLQQIVTLLKAKPEDFRQTAK  710



>ref|XP_004080382.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Oryzias 
latipes]
Length=769

 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 60/125 (48%), Gaps = 22/125 (18%)
 Frame = -3

Query  667  SSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANADEAQY-----  503
            S + E+    LPTFS  PQ Y+TN+G+YL++LP  LEP    ++  D   + A +     
Sbjct  605  SGIGENFTEDLPTFSLSPQEYITNIGQYLMSLPLHLEPF---VTQEDPALEMALHAGKLP  661

Query  502  --------------FATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVL  365
                           A  W+  +A      Y D +  I  +T    +QL+ DI+YLSNV+
Sbjct  662  FPPEQGDDLPELDNTADYWLGSIARATMQTYCDAILLIPQLTPHSTKQLATDIDYLSNVM  721

Query  364  SALSM  350
             AL +
Sbjct  722  DALGL  726



>ref|XP_006872058.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Chrysochloris 
asiatica]
Length=770

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 45/160 (28%), Positives = 74/160 (46%), Gaps = 24/160 (15%)
 Frame = -3

Query  688  LSRLPIWS--SVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            +S++  W+  SV E  A  LPTFS  P  Y++N+G+Y+++LP  LEP    ++  D+  +
Sbjct  597  VSKMDSWNAVSVGEPLAEDLPTFSLTPLEYISNIGQYIMSLPLNLEPF---VTQEDSALE  653

Query  514  EAQY-------------------FATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSV  392
             A +                    A  W+  +A      Y D +  I  +T    +QL+ 
Sbjct  654  LALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCDVILQIPELTPHSTKQLAT  713

Query  391  DIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKS  272
            DI+YL+NV+ AL +     L    + L T     ++  KS
Sbjct  714  DIDYLTNVMDALGLQPSRTLQNIVTLLKTKPEDYRQATKS  753



>gb|ABC86343.1| IP14069p [Drosophila melanogaster]
Length=271

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 45/116 (39%), Positives = 63/116 (54%), Gaps = 10/116 (9%)
 Frame = -3

Query  661  VEEHSAR--PLPTFSAYPQSYVTNVGEYLLTLPQQLEPLA--------EGISNSDANADE  512
            V++H+A    +P+FS  PQ  +T +G+YLLTLPQ LEPL         + +   +    +
Sbjct  113  VQDHAASGIEMPSFSFAPQESITQIGQYLLTLPQHLEPLLLSPSSLLKQALEVCNIKYTQ  172

Query  511  AQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPV  344
            A   A   +  V E    LYV Q+  I+ +    A QLSVDIEYLSNVL  L + +
Sbjct  173  AIPCADVLLSLVVEQCCVLYVTQILQIKSLPSSAATQLSVDIEYLSNVLEELGLSI  228



>ref|XP_007571519.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Poecilia formosa]
Length=769

 Score = 66.2 bits (160),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 60/125 (48%), Gaps = 22/125 (18%)
 Frame = -3

Query  667  SSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANADEAQY-----  503
            S++ E     LPTFS  PQ Y+TN+G+YL++LP  LEP    ++  D   + A +     
Sbjct  605  SAIGESYTEDLPTFSLSPQEYITNIGQYLMSLPLHLEPF---VTQEDPALEMALHAGKLP  661

Query  502  --------------FATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVL  365
                           A  W+  +A      Y D +  I  ++    +QL+ DIEYLSNV+
Sbjct  662  FPPDQGDDLPELDNTADYWLGSIARATMQTYCDAILLIPRLSPHSTKQLATDIEYLSNVM  721

Query  364  SALSM  350
             AL +
Sbjct  722  DALGL  726



>ref|XP_007571524.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Poecilia formosa]
Length=769

 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 60/125 (48%), Gaps = 22/125 (18%)
 Frame = -3

Query  667  SSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANADEAQY-----  503
            S++ E     LPTFS  PQ Y+TN+G+YL++LP  LEP    ++  D   + A +     
Sbjct  605  SAIGESYTEDLPTFSLSPQEYITNIGQYLMSLPLHLEPF---VTQEDPALEMALHAGKLP  661

Query  502  --------------FATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVL  365
                           A  W+  +A      Y D +  I  ++    +QL+ DIEYLSNV+
Sbjct  662  FPPEQGDDLPELDNTADYWLGSIARATMQTYCDAILLIPRLSPHSTKQLATDIEYLSNVM  721

Query  364  SALSM  350
             AL +
Sbjct  722  DALGL  726



>ref|XP_010903275.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Esox 
lucius]
 ref|XP_010903283.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Esox 
lucius]
 ref|XP_010903290.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Esox 
lucius]
Length=768

 Score = 65.9 bits (159),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 58/121 (48%), Gaps = 22/121 (18%)
 Frame = -3

Query  655  EHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANADEAQY---------  503
            E  A  LPTFS  PQ Y+TN+G+Y+++LP  LEP    ++  D   + A +         
Sbjct  608  ESYAEDLPTFSLSPQEYITNIGQYIMSLPLHLEPF---VTQEDPALELALHAGKLPFPPE  664

Query  502  ----------FATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALS  353
                       A  W+  +A      Y D +  I  +T    +QL+ DIEYLSNV+ AL 
Sbjct  665  QGDDLPELDNTADYWLGSIARATMQTYCDAILLIPELTAHSTKQLATDIEYLSNVMDALG  724

Query  352  M  350
            +
Sbjct  725  L  725



>ref|XP_011264700.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X1 [Camponotus floridanus]
Length=747

 Score = 65.5 bits (158),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 39/109 (36%), Positives = 55/109 (50%), Gaps = 11/109 (10%)
 Frame = -3

Query  637  LPTFSAYPQSYVTNVGEYLLTLPQQLEP--------LAEGISNSD---ANADEAQYFATE  491
            LP +S  PQ Y+T VG+YL+TLPQ LEP        L + +  +D   A       F   
Sbjct  596  LPDYSFAPQEYITQVGQYLMTLPQHLEPFLLRDNPSLTQALKAADPQYAQGLTESGFTGI  655

Query  490  WMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPV  344
             +  VA G   ++ DQ  GI  +     +QL+ DI+YL NVL  L + +
Sbjct  656  LLDIVARGTCQMFQDQTLGICQLNSVACKQLATDIDYLGNVLEELGLCL  704



>ref|XP_011186252.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Bactrocera 
cucurbitae]
Length=754

 Score = 65.5 bits (158),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 72/151 (48%), Gaps = 22/151 (15%)
 Frame = -3

Query  637  LPTFSAYPQSYVTNVGEYLLTLPQQLEP--------LAEGISNSDANADEAQYFATEWMF  482
            +P FS  PQ  +T +G+YLLTLPQ LEP        L + +   +    +    A   + 
Sbjct  606  MPEFSFVPQECITQIGQYLLTLPQHLEPLLFTPSPLLKQALEICNVKYTQPVPCADILLS  665

Query  481  KVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTP  302
             V E    LY  Q+  ++ ++   ++Q +VDIEYLSNV+  L + +           S  
Sbjct  666  LVVEQCCLLYQSQILQVKTLSQTSSKQFAVDIEYLSNVVEELGLSI-----------SVG  714

Query  301  RSQLKELVKSDSGNQLDLPTANLVCKMRRVS  209
             SQ+  L+K+D  N L L      C+ R V+
Sbjct  715  LSQILTLLKADPENYLALSGG---CEPRLVT  742



>ref|XP_004706118.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Echinops 
telfairi]
Length=770

 Score = 65.5 bits (158),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 41/134 (31%), Positives = 65/134 (49%), Gaps = 24/134 (18%)
 Frame = -3

Query  688  LSRLPIWS--SVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            +S++  WS  SV E     LPTFS  P  Y++N+G+YL++LP  LEP    ++  D+  +
Sbjct  597  ISKMDSWSTASVGETLTDDLPTFSLTPLEYISNIGQYLMSLPLNLEPF---VTQEDSALE  653

Query  514  EAQY-------------------FATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSV  392
             A +                    A  W+  +A      Y D +  I  +T    +QL+ 
Sbjct  654  LALHAGKLPFPPEQGDEPPELDNMADNWLGAIARATMQTYCDVILQIPELTPHSTKQLAT  713

Query  391  DIEYLSNVLSALSM  350
            DI+YL+NV+ AL +
Sbjct  714  DIDYLTNVMDALGL  727



>ref|XP_002431030.1| conserved hypothetical protein [Pediculus humanus corporis]
 gb|EEB18292.1| conserved hypothetical protein [Pediculus humanus corporis]
Length=731

 Score = 65.5 bits (158),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 62/122 (51%), Gaps = 16/122 (13%)
 Frame = -3

Query  649  SARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP----------LAEGISNS------DANA  518
            S   LP +S  PQ Y+T +G+YL+ +PQ L+P          LA  +  S      D+ A
Sbjct  578  STSDLPDYSFVPQEYITQIGQYLMNMPQLLDPFSLSKNLELALALSLVGSYYSELLDSTA  637

Query  517  DEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPP  338
             +   FA  ++ ++++G    Y  Q+  IQ +++  ++QL+ DI YL NVL  +   +  
Sbjct  638  TDENSFAELFLSQISKGTCKAYAKQILAIQKLSNFASKQLATDINYLGNVLEDMGFNLTK  697

Query  337  VL  332
             L
Sbjct  698  KL  699



>ref|XP_011264701.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X2 [Camponotus floridanus]
 gb|EFN62526.1| Conserved oligomeric Golgi complex subunit 7 [Camponotus floridanus]
Length=735

 Score = 65.5 bits (158),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 39/109 (36%), Positives = 55/109 (50%), Gaps = 11/109 (10%)
 Frame = -3

Query  637  LPTFSAYPQSYVTNVGEYLLTLPQQLEP--------LAEGISNSD---ANADEAQYFATE  491
            LP +S  PQ Y+T VG+YL+TLPQ LEP        L + +  +D   A       F   
Sbjct  584  LPDYSFAPQEYITQVGQYLMTLPQHLEPFLLRDNPSLTQALKAADPQYAQGLTESGFTGI  643

Query  490  WMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPV  344
             +  VA G   ++ DQ  GI  +     +QL+ DI+YL NVL  L + +
Sbjct  644  LLDIVARGTCQMFQDQTLGICQLNSVACKQLATDIDYLGNVLEELGLCL  692



>ref|XP_006892752.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Elephantulus 
edwardii]
Length=770

 Score = 65.5 bits (158),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 42/149 (28%), Positives = 71/149 (48%), Gaps = 24/149 (16%)
 Frame = -3

Query  688  LSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            +S++  WS+  + E  A  LPTFS  P  Y++N+G+Y+++LP  LEP    ++  D+  +
Sbjct  597  VSKMDSWSTAGIGETLADDLPTFSLTPLEYISNIGQYIMSLPLNLEPF---VTQEDSALE  653

Query  514  EAQY-------------------FATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSV  392
             A +                    A  W+  +A      Y D +  I  +T    +QL+ 
Sbjct  654  LALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCDVILQIPELTPHSTKQLTT  713

Query  391  DIEYLSNVLSALSMPVPPVLATFHSCLST  305
            DI+YL+NV+ AL +    +L    + L T
Sbjct  714  DIDYLTNVMDALGLQPSRLLQNIVTLLKT  742



>emb|CDQ68336.1| unnamed protein product [Oncorhynchus mykiss]
Length=469

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 58/121 (48%), Gaps = 22/121 (18%)
 Frame = -3

Query  655  EHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANADEAQY---------  503
            E  A  LPTFS  PQ Y+TN+G+Y+++LP  LEP    ++  D   + A +         
Sbjct  309  ESYAEDLPTFSLSPQEYITNIGQYIMSLPLHLEPF---VTQEDPALELALHAGKLPFPPE  365

Query  502  ----------FATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALS  353
                       A  W+  +A      Y D +  I  +T    +QL+ DI+YLSNV+ AL 
Sbjct  366  QGDDLPELDNTADYWLGSIARATMQTYCDAILLIPELTAHSTKQLATDIDYLSNVMDALG  425

Query  352  M  350
            +
Sbjct  426  L  426



>ref|XP_008202374.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X2 [Nasonia vitripennis]
Length=737

 Score = 64.7 bits (156),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 66/129 (51%), Gaps = 14/129 (11%)
 Frame = -3

Query  688  LSRLPIWSSVEEHSA---RPLPTFSAYPQSYVTNVGEYLLTLPQQLEP--LAEGISNSDA  524
            + + P WS+    ++     LP FS  PQ Y+T VG+YL+TLPQ LEP  L +  S +  
Sbjct  566  VRKAPAWSANANKTSTISSDLPDFSFAPQEYITQVGQYLMTLPQHLEPFLLRDNPSLTKT  625

Query  523  -NADEAQY--------FATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSN  371
              A ++QY        F    +  VA+    ++ DQ  GI  +     +QL+ DI+YL N
Sbjct  626  LKAADSQYSQESCESGFTNILLGIVAKETCQMFQDQTWGIYELNAAACKQLATDIDYLGN  685

Query  370  VLSALSMPV  344
            +L  L + +
Sbjct  686  ILEELGLSL  694



>ref|XP_008202373.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X1 [Nasonia vitripennis]
Length=749

 Score = 64.7 bits (156),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 64/129 (50%), Gaps = 14/129 (11%)
 Frame = -3

Query  688  LSRLPIWSSVEEHSA---RPLPTFSAYPQSYVTNVGEYLLTLPQQLEP--------LAEG  542
            + + P WS+    ++     LP FS  PQ Y+T VG+YL+TLPQ LEP        L + 
Sbjct  578  VRKAPAWSANANKTSTISSDLPDFSFAPQEYITQVGQYLMTLPQHLEPFLLRDNPSLTKT  637

Query  541  ISNSDANADEAQY---FATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSN  371
            +  +D+   +      F    +  VA+    ++ DQ  GI  +     +QL+ DI+YL N
Sbjct  638  LKAADSQYSQESCESGFTNILLGIVAKETCQMFQDQTWGIYELNAAACKQLATDIDYLGN  697

Query  370  VLSALSMPV  344
            +L  L + +
Sbjct  698  ILEELGLSL  706



>gb|ENN72949.1| hypothetical protein YQE_10420, partial [Dendroctonus ponderosae]
Length=247

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 62/127 (49%), Gaps = 12/127 (9%)
 Frame = -3

Query  637  LPTFSAYPQSYVTNVGEYLLTLPQQLEPL-----------AEGISNSDANA-DEAQYFAT  494
            LP +S  PQ Y+T +G+YLL LPQ LEP             + I    A+A D     A 
Sbjct  96   LPDYSFSPQEYITQIGQYLLELPQHLEPFLFKENPALTCALKAIDQEYADAPDREGALAQ  155

Query  493  EWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSC  314
             ++ KVA G    + +++  I  ++   ++QLS DI YL+N+L  L + +   L    + 
Sbjct  156  IFLQKVARGICNSFAEKVLSISTLSQPASRQLSHDINYLNNILQDLGITMSENLQQLLAL  215

Query  313  LSTPRSQ  293
            L  P  Q
Sbjct  216  LKIPPDQ  222



>ref|XP_008202375.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X3 [Nasonia vitripennis]
Length=706

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 66/129 (51%), Gaps = 14/129 (11%)
 Frame = -3

Query  688  LSRLPIWSSVEEHSA---RPLPTFSAYPQSYVTNVGEYLLTLPQQLEP--LAEGISNSDA  524
            + + P WS+    ++     LP FS  PQ Y+T VG+YL+TLPQ LEP  L +  S +  
Sbjct  535  VRKAPAWSANANKTSTISSDLPDFSFAPQEYITQVGQYLMTLPQHLEPFLLRDNPSLTKT  594

Query  523  -NADEAQY--------FATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSN  371
              A ++QY        F    +  VA+    ++ DQ  GI  +     +QL+ DI+YL N
Sbjct  595  LKAADSQYSQESCESGFTNILLGIVAKETCQMFQDQTWGIYELNAAACKQLATDIDYLGN  654

Query  370  VLSALSMPV  344
            +L  L + +
Sbjct  655  ILEELGLSL  663



>ref|XP_008202376.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X4 [Nasonia vitripennis]
Length=698

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 65/129 (50%), Gaps = 14/129 (11%)
 Frame = -3

Query  688  LSRLPIWSSVEEHSA---RPLPTFSAYPQSYVTNVGEYLLTLPQQLEP--LAEGIS-NSD  527
            + + P WS+    ++     LP FS  PQ Y+T VG+YL+TLPQ LEP  L +  S    
Sbjct  527  VRKAPAWSANANKTSTISSDLPDFSFAPQEYITQVGQYLMTLPQHLEPFLLRDNPSLTKT  586

Query  526  ANADEAQY--------FATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSN  371
              A ++QY        F    +  VA+    ++ DQ  GI  +     +QL+ DI+YL N
Sbjct  587  LKAADSQYSQESCESGFTNILLGIVAKETCQMFQDQTWGIYELNAAACKQLATDIDYLGN  646

Query  370  VLSALSMPV  344
            +L  L + +
Sbjct  647  ILEELGLSL  655



>emb|CDQ66102.1| unnamed protein product [Oncorhynchus mykiss]
Length=768

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 58/121 (48%), Gaps = 22/121 (18%)
 Frame = -3

Query  655  EHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANADEAQY---------  503
            E  A  LPTFS  PQ Y+TN+G+Y+++LP  LEP    ++  D   + A +         
Sbjct  608  ESYAEDLPTFSLSPQEYITNIGQYIMSLPLHLEPF---VTQEDPALELALHAGKLPFPPE  664

Query  502  ----------FATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALS  353
                       A  W+  +A      Y D +  I  +T    +QL+ DI+YLSNV+ AL 
Sbjct  665  QGDDLPELDNTADYWLGSIARATMQTYCDAILLIPELTAHSTKQLATDIDYLSNVMDALG  724

Query  352  M  350
            +
Sbjct  725  L  725



>ref|XP_007951381.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Orycteropus 
afer afer]
Length=731

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/134 (28%), Positives = 65/134 (49%), Gaps = 24/134 (18%)
 Frame = -3

Query  688  LSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            +S++  WS+  + E     LPTFS  P  Y++N+G+Y+++LP  LEP    ++  D+  +
Sbjct  558  VSKMDSWSTAGIGETLTDDLPTFSLTPLEYISNIGQYIMSLPLNLEPF---VTQEDSALE  614

Query  514  EAQY-------------------FATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSV  392
             A +                    A  W+  +A      Y D +  I  +T    +QL+ 
Sbjct  615  LALHAGKLPFPPEQGDELPELDNMADNWLVSIARATMQTYCDVILQIPELTPHSTKQLAT  674

Query  391  DIEYLSNVLSALSM  350
            DI+YL+NV+ AL +
Sbjct  675  DIDYLTNVMDALGL  688



>ref|XP_010959320.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Camelus 
bactrianus]
 ref|XP_010985220.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X1 [Camelus dromedarius]
Length=770

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 79/180 (44%), Gaps = 29/180 (16%)
 Frame = -3

Query  688  LSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            +S++  WS+  + E     LPTFS  P  Y++N+G+Y+++LP  LEP    ++  D+  +
Sbjct  597  ISKMDSWSTAGIGETLTDDLPTFSLTPLEYISNIGQYIMSLPLNLEPF---VTQEDSALE  653

Query  514  EAQY-------------------FATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSV  392
             A +                    A  W+  +A      Y D L  I  +T    +QL+ 
Sbjct  654  LALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCDALLQIPGLTPHSTKQLAT  713

Query  391  DIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRV  212
            DI+YL NV+ AL +     L    + L T     +++ K      L    A+ V  MR V
Sbjct  714  DIDYLINVMDALGLQPSRTLQNIVTLLKTKPEDYRQVSKG-----LPRRLASTVAAMRSV  768



>ref|XP_011154014.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Harpegnathos 
saltator]
 gb|EFN88360.1| Conserved oligomeric Golgi complex subunit 7 [Harpegnathos saltator]
Length=735

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/113 (35%), Positives = 55/113 (49%), Gaps = 11/113 (10%)
 Frame = -3

Query  637  LPTFSAYPQSYVTNVGEYLLTLPQQLEP--------LAEGISNSD---ANADEAQYFATE  491
            LP +S  PQ Y+T VG+YL+TLPQ LEP        L + +  +D   A       F   
Sbjct  584  LPDYSFAPQEYITQVGQYLMTLPQHLEPFLLRDNPSLTQALKAADPQYAQGSTESGFTGI  643

Query  490  WMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVL  332
             +  VA G   ++ DQ   I  +     +QL+ DI+YL NVL  L + +   L
Sbjct  644  LLDIVARGTCQMFQDQTLSICQLNSIACKQLATDIDYLGNVLEELGLSLSENL  696



>gb|EPY74529.1| conserved oligomeric Golgi complex subunit 7-like protein [Camelus 
ferus]
Length=800

 Score = 63.9 bits (154),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 79/180 (44%), Gaps = 29/180 (16%)
 Frame = -3

Query  688  LSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            +S++  WS+  + E     LPTFS  P  Y++N+G+Y+++LP  LEP    ++  D+  +
Sbjct  627  ISKMDSWSTAGIGETLTDDLPTFSLTPLEYISNIGQYIMSLPLNLEPF---VTQEDSALE  683

Query  514  EAQY-------------------FATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSV  392
             A +                    A  W+  +A      Y D L  I  +T    +QL+ 
Sbjct  684  LALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCDALLQIPGLTPHSTKQLAT  743

Query  391  DIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRV  212
            DI+YL NV+ AL +     L    + L T     +++ K      L    A+ V  MR V
Sbjct  744  DIDYLINVMDALGLQPSRTLQNIVTLLKTKPEDYRQVSKG-----LPRRLASTVATMRSV  798



>ref|XP_006193181.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Camelus 
ferus]
Length=770

 Score = 63.9 bits (154),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 79/180 (44%), Gaps = 29/180 (16%)
 Frame = -3

Query  688  LSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            +S++  WS+  + E     LPTFS  P  Y++N+G+Y+++LP  LEP    ++  D+  +
Sbjct  597  ISKMDSWSTAGIGETLTDDLPTFSLTPLEYISNIGQYIMSLPLNLEPF---VTQEDSALE  653

Query  514  EAQY-------------------FATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSV  392
             A +                    A  W+  +A      Y D L  I  +T    +QL+ 
Sbjct  654  LALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCDALLQIPGLTPHSTKQLAT  713

Query  391  DIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRV  212
            DI+YL NV+ AL +     L    + L T     +++ K      L    A+ V  MR V
Sbjct  714  DIDYLINVMDALGLQPSRTLQNIVTLLKTKPEDYRQVSKG-----LPRRLASTVATMRSV  768



>ref|XP_010985221.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X2 [Camelus dromedarius]
Length=705

 Score = 63.9 bits (154),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 79/180 (44%), Gaps = 29/180 (16%)
 Frame = -3

Query  688  LSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            +S++  WS+  + E     LPTFS  P  Y++N+G+Y+++LP  LEP    ++  D+  +
Sbjct  532  ISKMDSWSTAGIGETLTDDLPTFSLTPLEYISNIGQYIMSLPLNLEPF---VTQEDSALE  588

Query  514  EAQY-------------------FATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSV  392
             A +                    A  W+  +A      Y D L  I  +T    +QL+ 
Sbjct  589  LALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCDALLQIPGLTPHSTKQLAT  648

Query  391  DIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRV  212
            DI+YL NV+ AL +     L    + L T     +++ K      L    A+ V  MR V
Sbjct  649  DIDYLINVMDALGLQPSRTLQNIVTLLKTKPEDYRQVSKG-----LPRRLASTVAAMRSV  703



>ref|XP_006125865.1| PREDICTED: LOW QUALITY PROTEIN: conserved oligomeric Golgi complex 
subunit 7 [Pelodiscus sinensis]
Length=700

 Score = 63.9 bits (154),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 43/160 (27%), Positives = 73/160 (46%), Gaps = 24/160 (15%)
 Frame = -3

Query  688  LSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            +S++  WSS  + E     LP FS  P  Y++N+G+Y+++LP  LEP    ++  D+  +
Sbjct  527  ISKMEGWSSGGIGETLTEDLPNFSLTPLEYISNIGQYIMSLPLHLEPF---VTQEDSALE  583

Query  514  EAQY-------------------FATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSV  392
             A +                    A  W+  +A      Y + +  I  +T   A+QL+ 
Sbjct  584  LALHAGKLPYPPEQGDELPELDNMADYWLGSIARATMQTYCEVILQIPELTLHSAKQLAT  643

Query  391  DIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKS  272
            DI+YL NV+ AL +     L    + L T     +++ KS
Sbjct  644  DIDYLINVMDALGLQPSKTLQNIVTLLKTKPEDYRQIAKS  683



>ref|XP_007058642.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Chelonia 
mydas]
 gb|EMP36935.1| Conserved oligomeric Golgi complex subunit 7 [Chelonia mydas]
Length=770

 Score = 63.9 bits (154),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 45/160 (28%), Positives = 72/160 (45%), Gaps = 24/160 (15%)
 Frame = -3

Query  688  LSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            +SR+  WSS  + E     LP FS  P  Y++N+G+Y+++LP  LEP    ++  D+  +
Sbjct  597  ISRMEGWSSGGIGETLTDDLPNFSLTPLEYISNIGQYIMSLPLHLEPF---VTQEDSALE  653

Query  514  EAQY-------------------FATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSV  392
             A +                    A  W+  VA      Y + +  I  +T   A+QL+ 
Sbjct  654  LALHAGKLPYPPEQGDELPELDNMADYWLGSVARATMQTYCEVILQIPELTLHSAKQLAT  713

Query  391  DIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKS  272
            DI+YL NV+ AL +     L    + L T     ++  KS
Sbjct  714  DIDYLINVMDALGLQPSKTLQNIVTLLKTKPEDYRQTAKS  753



>gb|ERL93874.1| hypothetical protein D910_11160 [Dendroctonus ponderosae]
Length=663

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 62/127 (49%), Gaps = 12/127 (9%)
 Frame = -3

Query  637  LPTFSAYPQSYVTNVGEYLLTLPQQLEPL-----------AEGISNSDANA-DEAQYFAT  494
            LP +S  PQ Y+T +G+YLL LPQ LEP             + I    A+A D     A 
Sbjct  512  LPDYSFSPQEYITQIGQYLLELPQHLEPFLFKENPALTCALKAIDQEYADAPDREGALAQ  571

Query  493  EWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSC  314
             ++ KVA G    + +++  I  ++   ++QLS DI YL+NVL  L + +   L    + 
Sbjct  572  IFLQKVARGICNSFAEKVLSISTLSQPASRQLSHDINYLNNVLQDLGITMSENLQQLLAL  631

Query  313  LSTPRSQ  293
            L  P  Q
Sbjct  632  LKIPPDQ  638



>ref|XP_004373515.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Trichechus 
manatus latirostris]
Length=770

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 42/160 (26%), Positives = 73/160 (46%), Gaps = 24/160 (15%)
 Frame = -3

Query  688  LSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            +S++  W++  + E     LPTFS  P  Y++N+G+Y+++LP  LEP    ++  D+  +
Sbjct  597  VSKMDSWNTAGIGETLTDDLPTFSLTPLEYISNIGQYIMSLPLNLEPF---VTQEDSALE  653

Query  514  EAQY-------------------FATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSV  392
             A +                    A  W+  +A      Y D +  I  +T    +QL+ 
Sbjct  654  LALHAGKLPFPPEQGDELPELDNMADHWLGSIARATMQTYCDVILQIPELTPHSTKQLAT  713

Query  391  DIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKS  272
            DI+YL+NV+ AL +     L    + L T     ++  KS
Sbjct  714  DIDYLTNVMDALGLQPSRTLQNIVTLLKTKPEDYRQATKS  753



>ref|XP_003418948.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Loxodonta 
africana]
Length=770

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 42/160 (26%), Positives = 73/160 (46%), Gaps = 24/160 (15%)
 Frame = -3

Query  688  LSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            +S++  W++  + E     LPTFS  P  Y++N+G+Y+++LP  LEP    ++  D+  +
Sbjct  597  VSKMDSWNTAGIGETLTDDLPTFSLTPLEYISNIGQYIMSLPLNLEPF---VTQEDSALE  653

Query  514  EAQY-------------------FATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSV  392
             A +                    A  W+  +A      Y D +  I  +T    +QL+ 
Sbjct  654  LALHAGKLPFPPEQGDELPELDNMADHWLGSIARATMQTYCDVILQIPELTPHSTKQLAT  713

Query  391  DIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKS  272
            DI+YL+NV+ AL +     L    + L T     ++  KS
Sbjct  714  DIDYLTNVMDALGLQPSRTLQNIVTLLKTKPEDYRQATKS  753



>ref|XP_002105431.1| GD17535 [Drosophila simulans]
 gb|EDX14934.1| GD17535 [Drosophila simulans]
Length=742

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 60/116 (52%), Gaps = 10/116 (9%)
 Frame = -3

Query  661  VEEHSAR--PLPTFSAYPQSYVTNVGEYLLTLPQQ--------LEPLAEGISNSDANADE  512
            V++H+A    LP+FS  PQ  +T +G+YLLTLPQ            L + +   +    +
Sbjct  584  VQDHAASGIDLPSFSFAPQESITQIGQYLLTLPQHLEPLLLSPSSLLKQALEVCNIKYTQ  643

Query  511  AQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPV  344
            A   A   +  V E    LYV Q+  I+ +    A QLSVDIEYLSNVL  L + +
Sbjct  644  AIPCADVLLSLVVEQCCVLYVTQILQIKSLPSSAATQLSVDIEYLSNVLEELGLSI  699



>ref|XP_002037280.1| GM12202 [Drosophila sechellia]
 gb|EDW53439.1| GM12202 [Drosophila sechellia]
Length=652

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 60/116 (52%), Gaps = 10/116 (9%)
 Frame = -3

Query  661  VEEHSAR--PLPTFSAYPQSYVTNVGEYLLTLPQQ--------LEPLAEGISNSDANADE  512
            V++H+A    LP+FS  PQ  +T +G+YLLTLPQ            L + +   +    +
Sbjct  494  VQDHAASGIDLPSFSFAPQESITQIGQYLLTLPQHLEPLLLSPSSLLKQALEVCNIKYTQ  553

Query  511  AQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPV  344
            A   A   +  V E    LYV Q+  I+ +    A QLSVDIEYLSNVL  L + +
Sbjct  554  AIPCADVLLSLVVEQCCVLYVTQILQIKSLPSSAATQLSVDIEYLSNVLEELGLSI  609



>ref|XP_011207193.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Bactrocera 
dorsalis]
Length=754

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 71/151 (47%), Gaps = 22/151 (15%)
 Frame = -3

Query  637  LPTFSAYPQSYVTNVGEYLLTLPQQLEP--------LAEGISNSDANADEAQYFATEWMF  482
            +P FS  PQ  +T +G+YLLTLPQ LEP        L + +   +    +    A   + 
Sbjct  606  MPEFSFVPQECITQIGQYLLTLPQHLEPLLFTPSALLKQALEICNVKYTQPVPCADILLS  665

Query  481  KVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTP  302
             V E    LY  Q+  ++ +    ++Q +VDIEYLSNV+  L + +           S  
Sbjct  666  LVVEQCCQLYQSQILQVKTLPPTSSKQFAVDIEYLSNVVEELGLSI-----------SVG  714

Query  301  RSQLKELVKSDSGNQLDLPTANLVCKMRRVS  209
             SQ+  L+K+D  N L L      C+ R V+
Sbjct  715  LSQILTLLKADPENYLALSGG---CEPRLVT  742



>ref|XP_008299300.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Stegastes 
partitus]
Length=769

 Score = 63.5 bits (153),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 56/115 (49%), Gaps = 22/115 (19%)
 Frame = -3

Query  637  LPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANADEAQY---------------  503
            LPTFS  PQ Y+TN+G+YL++LP  LEP    ++  D   + A +               
Sbjct  615  LPTFSLSPQEYITNIGQYLMSLPLHLEPF---VTQEDPALEMALHAGKLPFPPEQGDDLP  671

Query  502  ----FATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSM  350
                 A  W+  +A      Y D +  I  ++    +QL+ DI+YLSNV+ AL +
Sbjct  672  ELDNTADYWLGSIARATMQTYCDAILLIPQLSTHSTKQLATDIDYLSNVMDALGL  726



>ref|XP_005288959.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Chrysemys 
picta bellii]
Length=770

 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 44/160 (28%), Positives = 72/160 (45%), Gaps = 24/160 (15%)
 Frame = -3

Query  688  LSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            +SR+  WSS  + E     LP FS  P  Y++N+G+Y+++LP  LEP    ++  D+  +
Sbjct  597  ISRMEGWSSAGIGETLTDDLPNFSLTPLEYISNIGQYIMSLPLHLEPF---VTQEDSALE  653

Query  514  EAQY-------------------FATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSV  392
             A +                    A  W+  +A      Y + +  I  +T   A+QL+ 
Sbjct  654  LALHAGKLPYPPEQGDELPELDNMADYWLGSIARATMQTYCEVILQIPELTLHSAKQLAT  713

Query  391  DIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKS  272
            DI+YL NV+ AL +     L    + L T     ++  KS
Sbjct  714  DIDYLINVMDALGLQPSKTLQNIVTLLKTKPEDYRQTAKS  753



>ref|XP_006003103.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X1 [Latimeria chalumnae]
 ref|XP_006003104.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X2 [Latimeria chalumnae]
 ref|XP_006003105.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X3 [Latimeria chalumnae]
Length=769

 Score = 63.2 bits (152),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 41/134 (31%), Positives = 64/134 (48%), Gaps = 24/134 (18%)
 Frame = -3

Query  688  LSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            +SR+  WSS  + E     LPTFS  P  Y+TN+G+Y+++LP  LEP    ++  D   +
Sbjct  596  VSRMESWSSGGMGETLTDDLPTFSLTPLEYITNIGQYIMSLPLHLEPF---VTQEDPALE  652

Query  514  EAQY-------------------FATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSV  392
             A +                    A  W+  +A      Y + +  I  +T    +QL+ 
Sbjct  653  LALHAGKLPYPPEQGDELPELDNMADYWLGSIARATMQTYCEIILQIPELTMHSTKQLAT  712

Query  391  DIEYLSNVLSALSM  350
            DI+YLSNV+ AL +
Sbjct  713  DIDYLSNVMDALGL  726



>ref|NP_651750.1| Cog7 [Drosophila melanogaster]
 sp|Q9VAD6.2|COG7_DROME RecName: Full=Conserved oligomeric Golgi complex subunit 7; Short=COG 
complex subunit 7; AltName: Full=Component of oligomeric 
Golgi complex 7 [Drosophila melanogaster]
 gb|AAL39903.1| RE01016p [Drosophila melanogaster]
 gb|AAF56975.2| Cog7 [Drosophila melanogaster]
 gb|ACL88453.1| Cog7-PA, partial [synthetic construct]
Length=742

 Score = 63.2 bits (152),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 60/116 (52%), Gaps = 10/116 (9%)
 Frame = -3

Query  661  VEEHSAR--PLPTFSAYPQSYVTNVGEYLLTLPQQ--------LEPLAEGISNSDANADE  512
            V++H+A    +P+FS  PQ  +T +G+YLLTLPQ            L + +   +    +
Sbjct  584  VQDHAASGIEMPSFSFAPQESITQIGQYLLTLPQHLEPLLLSPSSLLKQALEVCNIKYTQ  643

Query  511  AQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPV  344
            A   A   +  V E    LYV Q+  I+ +    A QLSVDIEYLSNVL  L + +
Sbjct  644  AIPCADVLLSLVVEQCCVLYVTQILQIKSLPSSAATQLSVDIEYLSNVLEELGLSI  699



>ref|XP_004604166.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Sorex 
araneus]
Length=770

 Score = 63.2 bits (152),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 38/134 (28%), Positives = 64/134 (48%), Gaps = 24/134 (18%)
 Frame = -3

Query  688  LSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            + R+  W++  + E     LPTFS  P  Y++N+G+YL++LP  LEP    ++  D+  +
Sbjct  597  VCRMDSWTTAGIGETLTDDLPTFSLTPLEYISNIGQYLMSLPLNLEPF---VTQEDSALE  653

Query  514  EAQY-------------------FATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSV  392
             A +                    A  W+  +A      Y D +  I  +T    +QL+ 
Sbjct  654  LALHAGKLPFPPEQGDELPELDNMADHWLGSIARATMQTYCDVILQIPELTPHSTKQLAT  713

Query  391  DIEYLSNVLSALSM  350
            DI+YL+NV+ AL +
Sbjct  714  DIDYLTNVMDALGL  727



>ref|XP_010731364.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X1 [Larimichthys crocea]
Length=705

 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 55/115 (48%), Gaps = 22/115 (19%)
 Frame = -3

Query  637  LPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANADEAQY---------------  503
            LPTFS  PQ Y+TN+G+YL++LP  LEP    ++  D   + A +               
Sbjct  551  LPTFSLSPQEYITNIGQYLMSLPLHLEPF---VTQEDPALEMALHAGKLPFPPEQGDDLP  607

Query  502  ----FATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSM  350
                 A  W+  +A      Y D +  I  +     +QL+ DI+YLSNV+ AL +
Sbjct  608  ELDNTADYWLGSIARATMQTYCDAILLIPQLGHHSTKQLATDIDYLSNVMDALGL  662



>ref|XP_001357618.1| GA15960 [Drosophila pseudoobscura pseudoobscura]
 ref|XP_002020468.1| GL13495 [Drosophila persimilis]
 gb|EAL26752.1| GA15960 [Drosophila pseudoobscura pseudoobscura]
 gb|EDW39280.1| GL13495 [Drosophila persimilis]
Length=742

 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 56/106 (53%), Gaps = 8/106 (8%)
 Frame = -3

Query  637  LPTFSAYPQSYVTNVGEYLLTLPQQLE--------PLAEGISNSDANADEAQYFATEWMF  482
            +P+FS  PQ  +T +G+YLLTLPQ LE         L + +   +    +A   A   + 
Sbjct  594  MPSFSFAPQESITQIGQYLLTLPQHLEPLLLAPSALLKQALEVCNVKYTQAIPCADVLLS  653

Query  481  KVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPV  344
             V E    LY  Q+  I+ +    A+QLSVDIEYLSNVL  L + +
Sbjct  654  LVVEQCCILYQAQILQIKTLPASAAKQLSVDIEYLSNVLEELGLSI  699



>ref|XP_009194445.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Papio 
anubis]
Length=781

 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 37/134 (28%), Positives = 65/134 (49%), Gaps = 24/134 (18%)
 Frame = -3

Query  688  LSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            +S++ IW++  + E     LP FS  P  Y++N+G+Y+++LP  LEP    ++  D+  +
Sbjct  608  ISKMDIWNTAGIGETLTDDLPAFSLTPLEYISNIGQYIMSLPLNLEPF---VTQEDSALE  664

Query  514  EAQY-------------------FATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSV  392
             A +                    A  W+  +A      Y D +  I  ++   A+QL+ 
Sbjct  665  LALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCDAILQIPELSPHSAKQLAT  724

Query  391  DIEYLSNVLSALSM  350
            DI+YL NV+ AL +
Sbjct  725  DIDYLINVMDALGL  738



>ref|XP_008474511.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Diaphorina citri]
Length=309

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 41/112 (37%), Positives = 56/112 (50%), Gaps = 10/112 (9%)
 Frame = -3

Query  637  LPTFSAYPQSYVTNVGEYLLTLPQQLEP--LAEGISNSDANADEAQYFATE--------W  488
            LP +S  PQ Y+T +GEYLLTLPQ LEP  L E  S S A       + TE         
Sbjct  162  LPDYSFTPQEYITQIGEYLLTLPQHLEPFLLNENPSLSKALECADSEYKTETGGGPANIL  221

Query  487  MFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVL  332
            +  +A G      D++   Q ++    +QL  DI+YL+NVL  L + +   L
Sbjct  222  LGMLARGTCQALCDRILATQKLSAVACKQLITDIDYLNNVLEELGVDLTETL  273



>ref|XP_010731365.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X2 [Larimichthys crocea]
Length=769

 Score = 62.8 bits (151),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 55/115 (48%), Gaps = 22/115 (19%)
 Frame = -3

Query  637  LPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANADEAQY---------------  503
            LPTFS  PQ Y+TN+G+YL++LP  LEP    ++  D   + A +               
Sbjct  615  LPTFSLSPQEYITNIGQYLMSLPLHLEPF---VTQEDPALEMALHAGKLPFPPEQGDDLP  671

Query  502  ----FATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSM  350
                 A  W+  +A      Y D +  I  +     +QL+ DI+YLSNV+ AL +
Sbjct  672  ELDNTADYWLGSIARATMQTYCDAILLIPQLGHHSTKQLATDIDYLSNVMDALGL  726



>ref|XP_002098511.1| GE10410 [Drosophila yakuba]
 gb|EDW98223.1| GE10410 [Drosophila yakuba]
Length=742

 Score = 62.8 bits (151),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 60/116 (52%), Gaps = 10/116 (9%)
 Frame = -3

Query  661  VEEHSAR--PLPTFSAYPQSYVTNVGEYLLTLPQQ--------LEPLAEGISNSDANADE  512
            V++H+A    +P+FS  PQ  +T +G+YLLTLPQ            L + +   +    +
Sbjct  584  VQDHAASGIDMPSFSFAPQESITQIGQYLLTLPQHLEPLLLSPSSLLKQALEVCNIKYTQ  643

Query  511  AQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPV  344
            A   A   +  V E    LYV Q+  I+ +    A QLSVDIEYLSNVL  L + +
Sbjct  644  AIPCADVLLSLVVEQCCVLYVTQILQIKSLPSSAATQLSVDIEYLSNVLEELGLSI  699



>ref|XP_006808092.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Neolamprologus brichardi]
Length=769

 Score = 62.4 bits (150),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 40/140 (29%), Positives = 63/140 (45%), Gaps = 22/140 (16%)
 Frame = -3

Query  637  LPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANADEAQY---------------  503
            LP FS  PQ Y+TN+G+YL++LP  LEP    ++  D   + A +               
Sbjct  615  LPNFSLSPQEYITNIGQYLMSLPLHLEPF---VTQEDPALEMALHAGKLPFPPEQGDELT  671

Query  502  ----FATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
                 A  W+  +A      Y D +  I  ++    +QL+ DI+YLSNV+ AL +     
Sbjct  672  ELDNTADYWLGSIARATMQTYCDAILLIPQLSTHSTKQLATDIDYLSNVMDALGLQPSRT  731

Query  334  LATFHSCLSTPRSQLKELVK  275
            L    + L T   + ++  K
Sbjct  732  LQNIVTLLRTKPQEYRQTAK  751



>ref|XP_313727.3| AGAP004439-PA [Anopheles gambiae str. PEST]
 gb|EAA09296.3| AGAP004439-PA [Anopheles gambiae str. PEST]
Length=735

 Score = 62.4 bits (150),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 60/120 (50%), Gaps = 8/120 (7%)
 Frame = -3

Query  637  LPTFSAYPQSYVTNVGEYLLTLPQQLEP--------LAEGISNSDANADEAQYFATEWMF  482
            LP +S  PQ Y+T + +YLLTLPQ LEP        L   +  +D      +  A  ++ 
Sbjct  588  LPDYSYAPQEYITLISQYLLTLPQHLEPLLLSPAAALKAVLEVADHRYASNRPCADVFLA  647

Query  481  KVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTP  302
             V E + ALYV+Q+  I  ++  GA+QL+ DIEY  +VL  +   +   L      L  P
Sbjct  648  LVVEESEALYVEQIENICSLSVSGAKQLATDIEYFGSVLEEMGQSLGGNLQQTVKLLRAP  707



>ref|XP_006201263.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Vicugna 
pacos]
Length=770

 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/134 (28%), Positives = 64/134 (48%), Gaps = 24/134 (18%)
 Frame = -3

Query  688  LSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            +S++  WS+  + E     LPTFS  P  Y++N+G+Y+++LP  LEP    ++  D+  +
Sbjct  597  ISKMDSWSTAGIGETLTDDLPTFSLTPLEYISNIGQYIMSLPLNLEPF---VTQEDSALE  653

Query  514  EAQY-------------------FATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSV  392
             A +                    A  W+  +A      Y D +  I  +T    +QL+ 
Sbjct  654  LALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCDAILQIPGLTPHSTKQLAT  713

Query  391  DIEYLSNVLSALSM  350
            DI+YL NV+ AL +
Sbjct  714  DIDYLINVMDALGL  727



>ref|XP_001993908.1| GH22206 [Drosophila grimshawi]
 gb|EDV94644.1| GH22206 [Drosophila grimshawi]
Length=766

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 54/151 (36%), Positives = 72/151 (48%), Gaps = 22/151 (15%)
 Frame = -3

Query  637  LPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATA  458
            +PTFS  PQ  +T +G+YLLTLPQ LEPL    S     A E            A+   +
Sbjct  618  MPTFSFAPQESITQIGQYLLTLPQHLEPLLLAPSALLKQALELCNIKYTQAIPCADVLLS  677

Query  457  LYVD--------QLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTP  302
            L VD        Q+  I+ +    A QLSVDIEYLSNVL  L + +   L          
Sbjct  678  LVVDQCCVMFQAQILQIKSLPTSSATQLSVDIEYLSNVLEELGLTINLQL----------  727

Query  301  RSQLKELVKSDSGNQLDLPTANLVCKMRRVS  209
             SQ+  L+K+D    L+L +    C+ R V+
Sbjct  728  -SQILTLLKADPDQYLNLSSG---CEPRLVT  754



>ref|XP_010791235.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Notothenia 
coriiceps]
Length=769

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 55/115 (48%), Gaps = 22/115 (19%)
 Frame = -3

Query  637  LPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANADEAQY---------------  503
            LPTFS  PQ Y+TN+G+YL++LP  LEP    ++  D   + A +               
Sbjct  615  LPTFSLSPQEYITNIGQYLMSLPLHLEPF---VTQEDPALEMALHAGKLPFPPEQGDDLP  671

Query  502  ----FATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSM  350
                 A  W+  +A      Y D +  I  +     +QL+ DI+YLSNV+ AL +
Sbjct  672  ELDNTADYWLGSIARATMQTYCDSILLIPQLGPHSTKQLATDIDYLSNVMDALGL  726



>ref|XP_003341699.1| PREDICTED: LOW QUALITY PROTEIN: conserved oligomeric Golgi complex 
subunit 7 [Monodelphis domestica]
Length=769

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 47/181 (26%), Positives = 80/181 (44%), Gaps = 29/181 (16%)
 Frame = -3

Query  688  LSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            +S++  W++  + E     LPTFS  P  Y++N+G+Y+++LP  LEP    ++  D+  +
Sbjct  596  ISKMESWNTAGIGETLTDDLPTFSLTPLEYISNIGQYIMSLPLNLEPF---VTQEDSALE  652

Query  514  EAQY-------------------FATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSV  392
             A +                    A  W+  +A      Y D +  I  +T    +QL+ 
Sbjct  653  LALHAGKLPFPPEQGDELPELDNMADYWLGSIARATMQTYCDVILQIPELTPHSTKQLAT  712

Query  391  DIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRV  212
            DI+YL NV+ AL +     L    + L T     +++ K      L    A+ V  MR V
Sbjct  713  DIDYLINVMDALGLQPSRTLQNMVTLLKTKPEDYRQVAKG-----LPRRLASKVASMRNV  767

Query  211  S  209
            +
Sbjct  768  N  768



>ref|XP_004398866.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Odobenus 
rosmarus divergens]
Length=770

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 47/180 (26%), Positives = 78/180 (43%), Gaps = 29/180 (16%)
 Frame = -3

Query  688  LSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            +S++  WS+  + E     LPTFS  P  Y++N+G+Y+++LP  LEP    ++  D+  +
Sbjct  597  VSKMDSWSTAGIGETLTDDLPTFSLTPLEYISNIGQYIMSLPLNLEPF---VTQEDSALE  653

Query  514  EAQY-------------------FATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSV  392
             A +                    A  W+  +A      Y D +  I  +T    +QL+ 
Sbjct  654  LALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCDVILHIPELTPHSTKQLAT  713

Query  391  DIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRV  212
            D++YL NV+ AL +     L    + L T     +++ K      L    A  V  MR V
Sbjct  714  DMDYLINVMDALGLQPSRTLQNIVTLLKTKPEDYRQVSKG-----LPRRLATTVANMRNV  768



>ref|XP_011502446.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Ceratosolen 
solmsi marchali]
Length=734

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 41/129 (32%), Positives = 68/129 (53%), Gaps = 14/129 (11%)
 Frame = -3

Query  688  LSRLPIWS-SVEEHS--ARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPL----------A  548
            + + P WS ++++ S  +  LP +S  PQ Y+T VG+YL+TLPQ LEP           A
Sbjct  563  IKKAPAWSMNLDKGSFLSLDLPDYSFAPQEYITQVGQYLMTLPQHLEPFLLKDNPSLTKA  622

Query  547  EGISNSDANADEAQYFATEWMFK-VAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSN  371
              I++S  + D  +   T  + + VA+    ++ DQ   I  +     +QL+ DI+YL N
Sbjct  623  LKIADSRYSEDPCESGFTNILLEIVAKEICQMFQDQTWSICELNTTACKQLATDIDYLGN  682

Query  370  VLSALSMPV  344
            +L  L + +
Sbjct  683  ILEELGLSL  691



>ref|XP_004360949.1| oligomeric Golgi complex component [Dictyostelium fasciculatum]
 gb|EGG23098.1| oligomeric Golgi complex component [Dictyostelium fasciculatum]
Length=861

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 46/177 (26%), Positives = 77/177 (44%), Gaps = 39/177 (22%)
 Frame = -3

Query  631  TFSAYPQSYVTNVGEYLLTLPQQLEPLAE-------------------------------  545
            ++ +   +Y T + ++LLT+PQQL+P +E                               
Sbjct  686  SYQSNQSAYSTQIADHLLTIPQQLDPYSEEISLRFSYQIAISYPTNDEMYQNIIKQLHQT  745

Query  544  ------GISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIE  383
                   IS++    D+    A +W+  VA     LY+  +  I  +TD G   L+ DI 
Sbjct  746  MLNETKDISDTSDIEDDMVGIAHQWIHIVACATEKLYLQSIVEITSLTDYGCHHLANDIT  805

Query  382  YLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRV  212
            YL NVLSAL +   P+L+     +  P+    E ++S  G + ++  A L+ KMR +
Sbjct  806  YLFNVLSALGVAPDPLLSKTQLLVQIPKEAYLESIQSLEGGEKNI--AILISKMRSI  860



>ref|XP_005935571.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Haplochromis burtoni]
Length=769

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 59/130 (45%), Gaps = 22/130 (17%)
 Frame = -3

Query  637  LPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANADEAQY---------------  503
            LP FS  PQ Y+TN+G+YL++LP  LEP    ++  D   + A +               
Sbjct  615  LPNFSLSPQEYITNIGQYLMSLPLHLEPF---VTQEDPALEMALHAGKLPFPPEQGDELT  671

Query  502  ----FATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
                 A  W+  +A      Y D +  I  ++    +QL+ DI+YLSNV+ AL +     
Sbjct  672  ELDNTADYWLGSIARATMQTYCDAILLIPQLSTHSTKQLATDIDYLSNVMDALGLQPSRT  731

Query  334  LATFHSCLST  305
            L    + L T
Sbjct  732  LQNIVTLLRT  741



>ref|XP_004571418.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Maylandia zebra]
Length=769

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 59/130 (45%), Gaps = 22/130 (17%)
 Frame = -3

Query  637  LPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANADEAQY---------------  503
            LP FS  PQ Y+TN+G+YL++LP  LEP    ++  D   + A +               
Sbjct  615  LPNFSLSPQEYITNIGQYLMSLPLHLEPF---VTQEDPALEMALHAGKLPFPPEQGDELT  671

Query  502  ----FATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
                 A  W+  +A      Y D +  I  ++    +QL+ DI+YLSNV+ AL +     
Sbjct  672  ELDNTADYWLGSIARATMQTYCDAILLIPQLSTHSTKQLATDIDYLSNVMDALGLQPSRT  731

Query  334  LATFHSCLST  305
            L    + L T
Sbjct  732  LQNIVTLLRT  741



>ref|XP_005748533.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Pundamilia nyererei]
Length=769

 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 59/130 (45%), Gaps = 22/130 (17%)
 Frame = -3

Query  637  LPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANADEAQY---------------  503
            LP FS  PQ Y+TN+G+YL++LP  LEP    ++  D   + A +               
Sbjct  615  LPNFSLSPQEYITNIGQYLMSLPLHLEPF---VTQEDPALEMALHAGKLPFPPEQGDELT  671

Query  502  ----FATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  335
                 A  W+  +A      Y D +  I  ++    +QL+ DI+YLSNV+ AL +     
Sbjct  672  ELDNTADYWLGSIARATMQTYCDAILLIPQLSTHSTKQLATDIDYLSNVMDALGLQPSRT  731

Query  334  LATFHSCLST  305
            L    + L T
Sbjct  732  LQNIVTLLRT  741



>ref|XP_003438511.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Oreochromis 
niloticus]
Length=769

 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 55/115 (48%), Gaps = 22/115 (19%)
 Frame = -3

Query  637  LPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANADEAQY---------------  503
            LP FS  PQ Y+TN+G+YL++LP  LEP    ++  D   + A +               
Sbjct  615  LPNFSLSPQEYITNIGQYLMSLPLHLEPF---VTQEDPALEMALHAGKLPFPPEQGDELT  671

Query  502  ----FATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSM  350
                 A  W+  +A      Y D +  I  ++    +QL+ DI+YLSNV+ AL +
Sbjct  672  ELDNTADYWLGSIARATMQTYCDAILLIPQLSTHSTKQLATDIDYLSNVMDALGL  726



>gb|KFM79726.1| Conserved oligomeric Golgi complex subunit 7, partial [Stegodyphus 
mimosarum]
Length=150

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 50/108 (46%), Gaps = 12/108 (11%)
 Frame = -3

Query  637  LPTFSAYPQSYVTNVGEYLLTLPQQLEP--------LAEGISNSD----ANADEAQYFAT  494
            LP FS  PQ Y+T VG+YL+T+PQ +EP        L   + N +       D +   A 
Sbjct  16   LPQFSLSPQEYITEVGQYLMTIPQHIEPFILRDNPALHTALKNCNMPHSVEQDSSSNVAD  75

Query  493  EWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSM  350
              +  +A   T  Y + +  I YIT     QL  DI Y  +VL  L +
Sbjct  76   YLLECLARRITDCYCENILRIFYITANAINQLITDIGYFCDVLDDLGL  123



>ref|XP_008695386.1| PREDICTED: LOW QUALITY PROTEIN: conserved oligomeric Golgi complex 
subunit 7 [Ursus maritimus]
Length=761

 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 47/180 (26%), Positives = 78/180 (43%), Gaps = 29/180 (16%)
 Frame = -3

Query  688  LSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            +S++  W++  + E     LPTFS  P  Y++N+G+Y+++LP  LEP    ++  D+  +
Sbjct  588  VSKMDSWNTAGIGETLTDDLPTFSLTPLEYISNIGQYIMSLPLNLEPF---VTQEDSALE  644

Query  514  EAQY-------------------FATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSV  392
             A +                    A  W+  +A      Y D +  I  +T    +QL+ 
Sbjct  645  LALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCDVILQIPELTPHSTKQLAT  704

Query  391  DIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRV  212
            DI+YL NV+ AL +     L    + L T     +++ K      L    A  V  MR V
Sbjct  705  DIDYLINVMDALGLQPSRTLQNIVTLLKTKPEDYRQVSKG-----LPRRLATTVANMRNV  759



>ref|XP_004442758.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Ceratotherium 
simum simum]
Length=770

 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 41/159 (26%), Positives = 72/159 (45%), Gaps = 24/159 (15%)
 Frame = -3

Query  688  LSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            +S++  W++  + E     LPTFS  P  Y++N+G+Y+++LP  LEP    ++  D+  +
Sbjct  597  ISKMDSWNTAGIGETLTDDLPTFSLTPLEYISNIGQYIMSLPLNLEPF---VTQEDSALE  653

Query  514  EAQY-------------------FATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSV  392
             A +                    A  W+  +A      Y D +  I  +T    +QL+ 
Sbjct  654  LALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCDVILQIPELTPHSTKQLAT  713

Query  391  DIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVK  275
            DI+YL NV+ AL +     L    + L T     +++ K
Sbjct  714  DIDYLINVMDALGLQPSRTLQNIVTLLKTKPEDYRQVSK  752



>ref|XP_002927171.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Ailuropoda 
melanoleuca]
 gb|EFB18307.1| hypothetical protein PANDA_016927 [Ailuropoda melanoleuca]
Length=770

 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 47/180 (26%), Positives = 78/180 (43%), Gaps = 29/180 (16%)
 Frame = -3

Query  688  LSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            +S++  W++  + E     LPTFS  P  Y++N+G+Y+++LP  LEP    ++  D+  +
Sbjct  597  VSKMDSWNTAGIGETLTDDLPTFSLTPLEYISNIGQYIMSLPLNLEPF---VTQEDSALE  653

Query  514  EAQY-------------------FATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSV  392
             A +                    A  W+  +A      Y D +  I  +T    +QL+ 
Sbjct  654  LALHAGKLPFPPEQGDELPELDNMADSWLGSIARATMQTYCDVILQIPELTPHSTKQLAT  713

Query  391  DIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRV  212
            DI+YL NV+ AL +     L    + L T     +++ K      L    A  V  MR V
Sbjct  714  DIDYLINVMDALGLQPSRTLQNIVTLLKTKPEDYRQVSKG-----LPRRLATTVAHMRNV  768



>ref|XP_001945391.2| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Acyrthosiphon 
pisum]
Length=711

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/104 (35%), Positives = 59/104 (57%), Gaps = 15/104 (14%)
 Frame = -3

Query  616  PQSYVTNVGEYLLTLPQQLEP----------LAEGISN---SDANADEAQYFATEWMFKV  476
            P+ Y+T +G+YL+TLPQ +EP          L   IS+   +DA+ +E+  F    +  +
Sbjct  569  PREYITQIGQYLITLPQHVEPFLVRDNEAVTLVLSISDRRYTDASLEES--FTNVLLRIL  626

Query  475  AEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPV  344
            A     +YV+Q++ ++ I +  AQQL+ DIEYL  VL  L + +
Sbjct  627  ARNTCDVYVEQIQSLREINNLAAQQLAADIEYLGYVLEELGVKL  670



>ref|XP_004268622.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Orcinus 
orca]
Length=770

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/134 (28%), Positives = 64/134 (48%), Gaps = 24/134 (18%)
 Frame = -3

Query  688  LSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD  515
            +S++  W++  + E     LPTFS  P  Y++N+G+Y+L+LP  LEP    ++  D+  +
Sbjct  597  ISKMDSWNTAGIGETLTDDLPTFSLTPLEYISNIGQYILSLPLNLEPF---VTQEDSALE  653

Query  514  EAQY-------------------FATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSV  392
             A +                    A  W+  +A      Y D +  I  +T    +QL+ 
Sbjct  654  LALHAGKLPFPPEQGDELSELDNMADSWLGSIARATMQTYCDAVLQIPELTPHSTKQLAT  713

Query  391  DIEYLSNVLSALSM  350
            DI+YL NV+ AL +
Sbjct  714  DIDYLINVMDALGL  727



>ref|XP_002058398.1| GJ14333 [Drosophila virilis]
 gb|EDW58366.1| GJ14333 [Drosophila virilis]
Length=751

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 52/150 (35%), Positives = 72/150 (48%), Gaps = 13/150 (9%)
 Frame = -3

Query  637  LPTFSAYPQSYVTNVGEYLLTLPQQLEPLA--------EGISNSDANADEAQYFATEWMF  482
            +P FS  PQ  +T +G+YLLTLPQ LEPL         + +   +    +A   A   + 
Sbjct  603  MPAFSFAPQEGITQIGQYLLTLPQHLEPLLLAPSALLKQALELCNIKYTQAMPCADVLLS  662

Query  481  KVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTP  302
             V E    +Y  Q+  I+ +    A QLSVDIEYLSNVL  L + +   LA   + L   
Sbjct  663  LVVEQCCVMYQAQILQIKSLPASDATQLSVDIEYLSNVLEELGLTINMQLAQILTLLKAA  722

Query  301  RSQLKELVKSDSGNQLDLPTANLVCKMRRV  212
              Q   L    SG +  L TA  + +MR +
Sbjct  723  PEQYLNL---SSGCEPRLVTA--IRQMRNI  747



>gb|ETN63528.1| hypothetical protein AND_004755 [Anopheles darlingi]
Length=733

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 41/124 (33%), Positives = 63/124 (51%), Gaps = 8/124 (6%)
 Frame = -3

Query  649  SARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLA---EGISNSDANADEAQYFATE----  491
            +A  LP +S  PQ Y+T + +YLLTLPQ LEPL      +  +     + +Y +T     
Sbjct  582  AADNLPDYSYAPQEYITLICQYLLTLPQHLEPLLLAPATVLKAVLEVADTRYASTRPCAD  641

Query  490  -WMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSC  314
             ++  + E + ALYV+Q+  I  +T   A+QL+ DIEY  +VL  +   +   L      
Sbjct  642  VFLALIVEESEALYVEQIENICSLTLTEAKQLATDIEYFGSVLEEMGQSLGSNLQQTVKL  701

Query  313  LSTP  302
            L  P
Sbjct  702  LRAP  705



>ref|XP_001981279.1| GG11984 [Drosophila erecta]
 gb|EDV53149.1| GG11984 [Drosophila erecta]
Length=742

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 47/116 (41%), Positives = 64/116 (55%), Gaps = 10/116 (9%)
 Frame = -3

Query  661  VEEHSAR--PLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANADEA---QYFA  497
            +++H+A    +P+FS  PQ  +T +G+YLLTLPQ LEPL    S+    A E    +Y  
Sbjct  584  LQDHAASGIDMPSFSFAPQESITQIGQYLLTLPQHLEPLLLSPSSLLKQALEVCNIKYTQ  643

Query  496  T-----EWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPV  344
            T       +  V E    LYV Q+  I+ +    A QLSVDIEYLSNVL  L + +
Sbjct  644  TIPCADVLLSLVVEQCCVLYVTQILQIKSLPSSAATQLSVDIEYLSNVLEELGLSI  699



>ref|XP_002001440.1| GI21972 [Drosophila mojavensis]
 gb|EDW16901.1| GI21972 [Drosophila mojavensis]
Length=754

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 56/110 (51%), Gaps = 8/110 (7%)
 Frame = -3

Query  649  SARPLPTFSAYPQSYVTNVGEYLLTLPQQLE--------PLAEGISNSDANADEAQYFAT  494
            SA  +P FS  PQ  +T +G+YLLTLPQ LE         L + +   +    +A   A 
Sbjct  602  SAINMPAFSYAPQESITQIGQYLLTLPQHLEPLLLSPSALLKQALELCNIKYTQAIPCAD  661

Query  493  EWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPV  344
              +  V E    +Y  Q+  I+ +    A QLSVDIEYLSNVL  L + +
Sbjct  662  VLLSLVVEQCCVMYQAQILQIKSLPASSATQLSVDIEYLSNVLEELGLTI  711



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1427696849470