BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF026F15

Length=733
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAD18097.1|  putative serine/threonine protein kinase               316   2e-105   Ipomoea batatas [batate]
dbj|BAD18102.1|  leucine-rich repeat receptor-like kinase               315   9e-100   Ipomoea batatas [batate]
ref|XP_004159592.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    290   1e-94    
emb|CAN75190.1|  hypothetical protein VITISV_035381                     293   1e-91    Vitis vinifera
ref|XP_010651607.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        293   2e-91    Vitis vinifera
ref|XP_009626005.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        293   2e-91    
ref|XP_011086598.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        292   5e-91    
ref|XP_009800027.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        291   1e-90    Nicotiana sylvestris
ref|XP_002525400.1|  BRASSINOSTEROID INSENSITIVE 1-associated rec...    289   6e-90    
ref|XP_004142972.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    289   7e-90    Cucumis sativus [cucumbers]
ref|XP_008444352.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    289   7e-90    Cucumis melo [Oriental melon]
ref|XP_008444353.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    289   8e-90    Cucumis melo [Oriental melon]
ref|XP_011045286.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        284   1e-89    Populus euphratica
ref|XP_007044708.1|  Nsp-interacting kinase 3 isoform 1                 288   2e-89    Theobroma cacao [chocolate]
gb|KDP26621.1|  hypothetical protein JCGZ_17779                         288   3e-89    Jatropha curcas
ref|XP_007044709.1|  Nsp-interacting kinase 3 isoform 2                 281   9e-89    
ref|XP_011463143.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    286   1e-88    Fragaria vesca subsp. vesca
ref|XP_004297396.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    286   1e-88    Fragaria vesca subsp. vesca
ref|XP_006366916.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    286   1e-88    Solanum tuberosum [potatoes]
ref|XP_002315684.2|  hypothetical protein POPTR_0010s05300g             285   3e-88    
ref|XP_006378225.1|  hypothetical protein POPTR_0010s05300g             285   3e-88    
ref|XP_010100426.1|  Protein NSP-INTERACTING KINASE 3                   284   9e-88    Morus notabilis
ref|XP_006380012.1|  hypothetical protein POPTR_0008s19310g             282   5e-87    
ref|XP_002312685.1|  leucine-rich repeat family protein                 282   5e-87    
ref|XP_007222912.1|  hypothetical protein PRUPE_ppa003642mg             280   7e-87    
ref|XP_007222911.1|  hypothetical protein PRUPE_ppa003642mg             280   8e-87    
ref|XP_008221853.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    280   1e-86    Prunus mume [ume]
ref|XP_010248542.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    279   3e-86    Nelumbo nucifera [Indian lotus]
ref|XP_010251173.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        280   5e-86    Nelumbo nucifera [Indian lotus]
ref|XP_008221852.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    280   7e-86    Prunus mume [ume]
ref|XP_008221850.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    280   7e-86    Prunus mume [ume]
ref|XP_010248541.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    279   9e-86    Nelumbo nucifera [Indian lotus]
ref|XP_011034116.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    278   9e-86    Populus euphratica
ref|XP_011034114.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    278   1e-85    Populus euphratica
emb|CDP13189.1|  unnamed protein product                                278   1e-85    Coffea canephora [robusta coffee]
ref|XP_008389685.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    277   4e-85    Malus domestica [apple tree]
ref|XP_008389687.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    277   4e-85    Malus domestica [apple tree]
gb|EYU28436.1|  hypothetical protein MIMGU_mgv1a002888mg                277   4e-85    Erythranthe guttata [common monkey flower]
ref|XP_008389688.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    277   4e-85    Malus domestica [apple tree]
ref|XP_003613191.1|  Leucine-rich repeat receptor-like kinase           276   9e-85    Medicago truncatula
gb|KDO82334.1|  hypothetical protein CISIN_1g006968mg                   276   1e-84    Citrus sinensis [apfelsine]
ref|XP_010319667.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    273   2e-84    Solanum lycopersicum
ref|XP_004237339.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    273   8e-84    Solanum lycopersicum
ref|XP_009596637.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    272   2e-83    Nicotiana tomentosiformis
ref|XP_004489819.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    272   3e-83    Cicer arietinum [garbanzo]
ref|XP_007157369.1|  hypothetical protein PHAVU_002G064400g             272   3e-83    Phaseolus vulgaris [French bean]
ref|XP_003517653.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    271   4e-83    Glycine max [soybeans]
gb|KHN14560.1|  Protein NSP-INTERACTING KINASE 3                        271   5e-83    Glycine soja [wild soybean]
gb|KJB61045.1|  hypothetical protein B456_009G337000                    271   5e-83    Gossypium raimondii
gb|KJB61041.1|  hypothetical protein B456_009G337000                    271   5e-83    Gossypium raimondii
ref|XP_006438322.1|  hypothetical protein CICLE_v10030967mg             271   8e-83    Citrus clementina [clementine]
ref|XP_003519642.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    271   8e-83    Glycine max [soybeans]
gb|KHN00370.1|  Protein NSP-INTERACTING KINASE 3                        271   8e-83    Glycine soja [wild soybean]
ref|XP_006483905.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    271   1e-82    Citrus sinensis [apfelsine]
ref|XP_006841062.1|  hypothetical protein AMTR_s00085p00173590          270   2e-82    Amborella trichopoda
ref|XP_010910388.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    267   2e-81    Elaeis guineensis
ref|XP_010682518.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        266   3e-81    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006356418.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    265   8e-81    Solanum tuberosum [potatoes]
ref|XP_008812173.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        265   1e-80    Phoenix dactylifera
ref|XP_008340072.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    265   1e-80    
ref|XP_008340070.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    265   1e-80    
ref|XP_008340071.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    265   1e-80    
ref|XP_008813583.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    265   2e-80    Phoenix dactylifera
ref|XP_010940158.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        265   2e-80    Elaeis guineensis
ref|XP_008813582.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    265   2e-80    Phoenix dactylifera
ref|XP_010023506.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        264   3e-80    Eucalyptus grandis [rose gum]
ref|XP_009403878.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    260   1e-78    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009403877.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    259   2e-78    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009390158.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    257   3e-77    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009390157.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    257   4e-77    
ref|XP_006605000.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    242   3e-76    
ref|XP_006844161.1|  hypothetical protein AMTR_s00006p00261510          251   4e-75    Amborella trichopoda
ref|XP_004238646.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        249   1e-74    Solanum lycopersicum
ref|XP_002455108.1|  hypothetical protein SORBIDRAFT_03g004450          249   1e-74    
ref|XP_010261784.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    247   3e-74    Nelumbo nucifera [Indian lotus]
ref|XP_011070875.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    246   2e-73    Sesamum indicum [beniseed]
gb|KEH21800.1|  NSP-interacting kinase-like protein                     246   2e-73    Medicago truncatula
ref|XP_010261776.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    246   2e-73    Nelumbo nucifera [Indian lotus]
ref|XP_006603947.1|  PREDICTED: protein NSP-INTERACTING KINASE 1 ...    243   2e-73    
ref|XP_010257839.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    246   2e-73    Nelumbo nucifera [Indian lotus]
ref|XP_003637897.1|  Receptor-like kinase                               243   3e-73    
ref|XP_004968347.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    246   3e-73    Setaria italica
emb|CAN63733.1|  hypothetical protein VITISV_025883                     245   4e-73    Vitis vinifera
ref|XP_002532890.1|  BRASSINOSTEROID INSENSITIVE 1-associated rec...    245   4e-73    Ricinus communis
ref|XP_006593318.1|  PREDICTED: NSP-interacting kinase isoform X2       243   4e-73    Glycine max [soybeans]
emb|CDP00520.1|  unnamed protein product                                245   4e-73    Coffea canephora [robusta coffee]
ref|XP_002269902.1|  PREDICTED: protein NSP-INTERACTING KINASE 1        245   5e-73    Vitis vinifera
ref|XP_006643812.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    244   8e-73    
ref|XP_008446509.1|  PREDICTED: protein NSP-INTERACTING KINASE 2 ...    242   1e-72    Cucumis melo [Oriental melon]
gb|KHN07744.1|  Protein NSP-INTERACTING KINASE 2                        244   1e-72    Glycine soja [wild soybean]
ref|XP_006574993.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    244   1e-72    
dbj|BAD68255.1|  putative brassinosteroid insensitive 1-associate...    244   1e-72    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006482337.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    244   1e-72    Citrus sinensis [apfelsine]
gb|KDO58880.1|  hypothetical protein CISIN_1g036225mg                   244   1e-72    Citrus sinensis [apfelsine]
ref|XP_004171526.1|  PREDICTED: LOW QUALITY PROTEIN: protein NSP-...    234   2e-72    
ref|NP_001238448.1|  NSP-interacting kinase precursor                   243   3e-72    Glycine max [soybeans]
gb|KHN30771.1|  Protein NSP-INTERACTING KINASE 1                        243   3e-72    Glycine soja [wild soybean]
ref|XP_003555046.1|  PREDICTED: protein NSP-INTERACTING KINASE 1 ...    243   3e-72    Glycine max [soybeans]
ref|XP_008797566.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    243   3e-72    Phoenix dactylifera
gb|KHN07168.1|  Protein NSP-INTERACTING KINASE 1                        242   5e-72    Glycine soja [wild soybean]
ref|XP_006593317.1|  PREDICTED: NSP-interacting kinase isoform X1       243   5e-72    Glycine max [soybeans]
gb|KDP24340.1|  hypothetical protein JCGZ_25636                         243   6e-72    Jatropha curcas
gb|KEH17048.1|  NSP-interacting kinase-like protein                     241   6e-72    Medicago truncatula
ref|XP_004490300.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    242   6e-72    Cicer arietinum [garbanzo]
ref|XP_006430876.1|  hypothetical protein CICLE_v10011302mg             242   7e-72    Citrus clementina [clementine]
ref|XP_009625494.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    242   1e-71    Nicotiana tomentosiformis
ref|XP_007153543.1|  hypothetical protein PHAVU_003G044400g             241   1e-71    Phaseolus vulgaris [French bean]
ref|XP_003517902.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    241   1e-71    Glycine max [soybeans]
ref|XP_010681338.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    242   1e-71    Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001140727.1|  uncharacterized LOC100272802                       231   1e-71    
ref|XP_011020829.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    241   1e-71    Populus euphratica
ref|XP_004507264.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    241   1e-71    Cicer arietinum [garbanzo]
ref|XP_008446507.1|  PREDICTED: protein NSP-INTERACTING KINASE 1 ...    241   1e-71    Cucumis melo [Oriental melon]
ref|XP_008446508.1|  PREDICTED: protein NSP-INTERACTING KINASE 1 ...    241   1e-71    Cucumis melo [Oriental melon]
tpg|DAA53257.1|  TPA: putative leucine-rich repeat receptor-like ...    236   1e-71    
ref|XP_003552626.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    241   1e-71    Glycine max [soybeans]
gb|KHN13790.1|  Protein NSP-INTERACTING KINASE 1                        241   1e-71    Glycine soja [wild soybean]
ref|XP_011009019.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    241   1e-71    Populus euphratica
ref|XP_004238998.1|  PREDICTED: protein NSP-INTERACTING KINASE 1        241   2e-71    Solanum lycopersicum
ref|XP_006301740.1|  hypothetical protein CARUB_v10022201mg             241   2e-71    
ref|XP_002886588.1|  nsp-interacting kinase 3                           241   2e-71    
gb|KJB43139.1|  hypothetical protein B456_007G186300                    237   2e-71    Gossypium raimondii
gb|KJB80538.1|  hypothetical protein B456_013G102600                    241   2e-71    Gossypium raimondii
ref|XP_004135130.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    241   3e-71    Cucumis sativus [cucumbers]
gb|KHG05227.1|  nsp-interacting kinase 2 -like protein                  241   3e-71    Gossypium arboreum [tree cotton]
gb|AAB71968.1|  Putative Serine/Threonine protein kinase                240   3e-71    Arabidopsis thaliana [mouse-ear cress]
gb|KDO70180.1|  hypothetical protein CISIN_1g007025mg                   239   3e-71    Citrus sinensis [apfelsine]
ref|XP_002311408.2|  hypothetical protein POPTR_0008s10970g             240   3e-71    Populus trichocarpa [western balsam poplar]
dbj|BAK02609.1|  predicted protein                                      240   4e-71    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KEH17047.1|  NSP-interacting kinase-like protein                     240   4e-71    Medicago truncatula
ref|NP_176279.1|  NSP-interacting kinase 3                              240   4e-71    Arabidopsis thaliana [mouse-ear cress]
gb|KDO70181.1|  hypothetical protein CISIN_1g007025mg                   238   4e-71    Citrus sinensis [apfelsine]
ref|XP_008465988.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    240   5e-71    Cucumis melo [Oriental melon]
ref|XP_009765506.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    240   5e-71    Nicotiana sylvestris
ref|XP_007139356.1|  hypothetical protein PHAVU_008G022700g             239   6e-71    Phaseolus vulgaris [French bean]
ref|XP_007151443.1|  hypothetical protein PHAVU_004G046800g             239   7e-71    Phaseolus vulgaris [French bean]
ref|XP_010032589.1|  PREDICTED: protein NSP-INTERACTING KINASE 1        239   7e-71    Eucalyptus grandis [rose gum]
ref|XP_007033440.1|  NSP-interacting kinase 1                           240   8e-71    
ref|XP_010528022.1|  PREDICTED: protein NSP-INTERACTING KINASE 2        240   8e-71    Tarenaya hassleriana [spider flower]
ref|XP_011077619.1|  PREDICTED: protein NSP-INTERACTING KINASE 2        240   8e-71    Sesamum indicum [beniseed]
ref|XP_006348615.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    239   8e-71    
emb|CDY44608.1|  BnaCnng11570D                                          236   8e-71    Brassica napus [oilseed rape]
emb|CDY61508.1|  BnaCnng37930D                                          236   8e-71    Brassica napus [oilseed rape]
ref|XP_010533910.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        239   9e-71    Tarenaya hassleriana [spider flower]
ref|XP_002305306.2|  hypothetical protein POPTR_0004s10790g             239   1e-70    Populus trichocarpa [western balsam poplar]
ref|XP_011011496.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    239   1e-70    Populus euphratica
ref|XP_006384231.1|  hypothetical protein POPTR_0004s10790g             239   1e-70    Populus trichocarpa [western balsam poplar]
ref|XP_009378313.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    239   1e-70    Pyrus x bretschneideri [bai li]
ref|XP_010942232.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    239   1e-70    Elaeis guineensis
ref|XP_008379484.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    239   2e-70    
gb|ABG73621.1|  leucine-rich repeat receptor-like kinase                238   2e-70    Populus tomentosa [Chinese white poplar]
ref|XP_006437790.1|  hypothetical protein CICLE_v10030970mg             238   3e-70    Citrus clementina [clementine]
ref|XP_010418025.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    238   3e-70    Camelina sativa [gold-of-pleasure]
ref|XP_006484307.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    238   3e-70    Citrus sinensis [apfelsine]
ref|XP_010418023.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    238   3e-70    Camelina sativa [gold-of-pleasure]
ref|XP_011012714.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    238   3e-70    Populus euphratica
emb|CDP02372.1|  unnamed protein product                                238   4e-70    Coffea canephora [robusta coffee]
ref|XP_011012715.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    238   4e-70    Populus euphratica
gb|KHN14464.1|  Protein NSP-INTERACTING KINASE 1                        238   4e-70    Glycine soja [wild soybean]
ref|XP_010510907.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    238   4e-70    Camelina sativa [gold-of-pleasure]
emb|CBI16897.3|  unnamed protein product                                237   4e-70    Vitis vinifera
ref|XP_010510906.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    238   5e-70    Camelina sativa [gold-of-pleasure]
ref|XP_002278965.1|  PREDICTED: protein NSP-INTERACTING KINASE 1        237   5e-70    Vitis vinifera
ref|XP_004149504.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    237   7e-70    Cucumis sativus [cucumbers]
ref|XP_006392114.1|  hypothetical protein EUTSA_v10023342mg             236   1e-69    Eutrema salsugineum [saltwater cress]
ref|XP_003531900.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    236   1e-69    Glycine max [soybeans]
ref|XP_011099082.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    236   2e-69    Sesamum indicum [beniseed]
ref|XP_008341829.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    236   2e-69    Malus domestica [apple tree]
gb|KJB43138.1|  hypothetical protein B456_007G186300                    236   2e-69    Gossypium raimondii
ref|XP_010473260.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    236   2e-69    Camelina sativa [gold-of-pleasure]
ref|XP_010473259.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    236   2e-69    Camelina sativa [gold-of-pleasure]
ref|XP_011099081.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    236   2e-69    Sesamum indicum [beniseed]
ref|XP_010230510.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    235   2e-69    
ref|XP_010230511.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    235   2e-69    
ref|NP_001169689.1|  LOC100383570 precursor                             236   2e-69    Zea mays [maize]
ref|XP_008459453.1|  PREDICTED: protein NSP-INTERACTING KINASE 1        236   2e-69    Cucumis melo [Oriental melon]
ref|XP_008230341.1|  PREDICTED: protein NSP-INTERACTING KINASE 1        236   2e-69    Prunus mume [ume]
ref|XP_009803320.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    236   2e-69    Nicotiana sylvestris
ref|XP_009104018.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    236   2e-69    Brassica rapa
gb|KEH25223.1|  NSP-interacting kinase-like protein                     235   3e-69    Medicago truncatula
ref|XP_006373507.1|  hypothetical protein POPTR_0017s14360g             235   3e-69    
ref|XP_010929457.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    235   3e-69    Elaeis guineensis
ref|XP_009803321.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    235   3e-69    Nicotiana sylvestris
ref|XP_009803966.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    235   3e-69    Nicotiana sylvestris
ref|XP_004141483.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    235   3e-69    Cucumis sativus [cucumbers]
ref|XP_003569325.2|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    236   3e-69    Brachypodium distachyon [annual false brome]
ref|XP_010230509.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    236   3e-69    Brachypodium distachyon [annual false brome]
emb|CDY46185.1|  BnaA01g23070D                                          236   3e-69    Brassica napus [oilseed rape]
gb|AFO67891.1|  leucine-rich repeat receptor-like kinase                236   3e-69    Brassica rapa subsp. oleifera [biennial turnip rape]
ref|XP_009596697.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    235   3e-69    Nicotiana tomentosiformis
ref|XP_009104025.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    235   3e-69    Brassica rapa
ref|XP_009596696.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    235   3e-69    Nicotiana tomentosiformis
ref|XP_009803965.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    235   3e-69    Nicotiana sylvestris
ref|XP_008807034.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    234   4e-69    Phoenix dactylifera
ref|XP_006344295.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    235   4e-69    Solanum tuberosum [potatoes]
gb|EEC73926.1|  hypothetical protein OsI_08784                          235   4e-69    Oryza sativa Indica Group [Indian rice]
gb|EEE57731.1|  hypothetical protein OsJ_08242                          235   4e-69    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004236956.1|  PREDICTED: protein NSP-INTERACTING KINASE 2        234   5e-69    Solanum lycopersicum
ref|XP_011021148.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    235   5e-69    Populus euphratica
ref|XP_006647834.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    235   5e-69    Oryza brachyantha
ref|XP_011021146.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    234   5e-69    Populus euphratica
ref|XP_002314905.1|  hypothetical protein POPTR_0010s14410g             234   5e-69    
ref|XP_002514536.1|  BRASSINOSTEROID INSENSITIVE 1-associated rec...    233   6e-69    
ref|XP_008807033.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    234   6e-69    Phoenix dactylifera
ref|XP_004965216.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    235   8e-69    Setaria italica
ref|XP_010236002.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    234   9e-69    Brachypodium distachyon [annual false brome]
ref|XP_003572984.2|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    234   9e-69    Brachypodium distachyon [annual false brome]
ref|XP_009373732.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    234   1e-68    Pyrus x bretschneideri [bai li]
ref|XP_007045670.1|  LRR receptor-like serine/threonine-protein k...    238   1e-68    
ref|XP_009630581.1|  PREDICTED: protein NSP-INTERACTING KINASE 1        234   1e-68    Nicotiana tomentosiformis
ref|XP_004232118.1|  PREDICTED: protein NSP-INTERACTING KINASE 1        234   1e-68    Solanum lycopersicum
ref|XP_004953781.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    233   2e-68    Setaria italica
ref|XP_007214944.1|  hypothetical protein PRUPE_ppa002897mg             233   2e-68    Prunus persica
ref|NP_001042146.2|  Os01g0171000                                       221   2e-68    
gb|ABD96908.1|  hypothetical protein                                    233   2e-68    Tarenaya spinosa
ref|XP_004304172.1|  PREDICTED: protein NSP-INTERACTING KINASE 1        233   2e-68    Fragaria vesca subsp. vesca
ref|XP_002436855.1|  hypothetical protein SORBIDRAFT_10g010010          233   2e-68    Sorghum bicolor [broomcorn]
ref|XP_004491764.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    233   2e-68    Cicer arietinum [garbanzo]
ref|XP_010927979.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    232   3e-68    
ref|XP_010558548.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    233   3e-68    Tarenaya hassleriana [spider flower]
ref|XP_010558545.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    233   3e-68    Tarenaya hassleriana [spider flower]
emb|CDY61461.1|  BnaC01g43240D                                          233   4e-68    Brassica napus [oilseed rape]
ref|XP_010927978.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    232   5e-68    Elaeis guineensis
ref|XP_008783060.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    232   5e-68    Phoenix dactylifera
dbj|BAJ89901.1|  predicted protein                                      231   1e-67    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010905760.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    231   1e-67    Elaeis guineensis
ref|XP_003563960.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    231   2e-67    Brachypodium distachyon [annual false brome]
ref|XP_008654537.1|  PREDICTED: uncharacterized LOC100272802 isof...    230   3e-67    
ref|XP_009396215.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    229   4e-67    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008243752.1|  PREDICTED: protein NSP-INTERACTING KINASE 2        229   5e-67    
ref|XP_006338306.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    229   6e-67    Solanum tuberosum [potatoes]
ref|XP_008389350.1|  PREDICTED: LOW QUALITY PROTEIN: protein NSP-...    229   7e-67    
ref|XP_009407942.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    229   9e-67    Musa acuminata subsp. malaccensis [pisang utan]
gb|KDP31451.1|  hypothetical protein JCGZ_11827                         228   1e-66    Jatropha curcas
gb|EYU44266.1|  hypothetical protein MIMGU_mgv1a002951mg                228   1e-66    Erythranthe guttata [common monkey flower]
ref|XP_010091686.1|  Protein NSP-INTERACTING KINASE 2                   228   2e-66    
ref|XP_004297175.1|  PREDICTED: protein NSP-INTERACTING KINASE 2        228   2e-66    Fragaria vesca subsp. vesca
ref|XP_007221991.1|  hypothetical protein PRUPE_ppa002873mg             228   2e-66    Prunus persica
gb|AHF18212.1|  brassinosteroid insensitive 1-associated receptor...    227   3e-66    Saccharum hybrid cultivar [sugarcane]
ref|XP_002452616.1|  hypothetical protein SORBIDRAFT_04g029170          227   3e-66    Sorghum bicolor [broomcorn]
dbj|BAB01326.1|  receptor-like kinase                                   227   4e-66    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006290715.1|  hypothetical protein CARUB_v10016813mg             227   5e-66    Capsella rubella
ref|NP_974360.1|  NSP-interacting kinase 2                              227   5e-66    Arabidopsis thaliana [mouse-ear cress]
ref|NP_189183.2|  NSP-interacting kinase 2                              227   5e-66    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002876917.1|  nsp-interacting kinase 2                           227   5e-66    
ref|XP_009356495.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    226   6e-66    Pyrus x bretschneideri [bai li]
ref|XP_008811184.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    226   7e-66    Phoenix dactylifera
gb|KFK39862.1|  hypothetical protein AALP_AA3G298400                    226   8e-66    Arabis alpina [alpine rockcress]
gb|EPS73511.1|  hypothetical protein M569_01245                         226   1e-65    Genlisea aurea
ref|XP_008339771.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    226   1e-65    
ref|NP_197104.1|  NSP-interacting kinase 1                              226   1e-65    Arabidopsis thaliana [mouse-ear cress]
gb|AAM65586.1|  receptor protein kinase-like protein                    226   2e-65    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010492459.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    225   2e-65    Camelina sativa [gold-of-pleasure]
ref|NP_001146634.1|  uncharacterized LOC100280233 precursor             225   2e-65    Zea mays [maize]
ref|XP_009391273.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    225   3e-65    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009391272.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    225   3e-65    Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB60823.1|  hypothetical protein B456_009G327400                    224   4e-65    Gossypium raimondii
ref|XP_010453748.1|  PREDICTED: protein NSP-INTERACTING KINASE 1        224   4e-65    Camelina sativa [gold-of-pleasure]
ref|XP_010549936.1|  PREDICTED: protein NSP-INTERACTING KINASE 1        224   4e-65    Tarenaya hassleriana [spider flower]
gb|EMT25229.1|  Putative LRR receptor-like serine/threonine-prote...    226   6e-65    
ref|XP_010514169.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    224   6e-65    Camelina sativa [gold-of-pleasure]
gb|EYU28925.1|  hypothetical protein MIMGU_mgv1a003010mg                223   9e-65    Erythranthe guttata [common monkey flower]
ref|XP_009417562.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    224   9e-65    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006395648.1|  hypothetical protein EUTSA_v10003811mg             223   1e-64    Eutrema salsugineum [saltwater cress]
ref|XP_006400129.1|  hypothetical protein EUTSA_v10012948mg             223   2e-64    Eutrema salsugineum [saltwater cress]
ref|XP_009418103.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    221   2e-64    
ref|XP_010044332.1|  PREDICTED: protein NSP-INTERACTING KINASE 2        222   2e-64    Eucalyptus grandis [rose gum]
ref|XP_002871697.1|  nsp-interacting kinase 1                           222   3e-64    Arabidopsis lyrata subsp. lyrata
ref|XP_010502426.1|  PREDICTED: protein NSP-INTERACTING KINASE 2        222   4e-64    Camelina sativa [gold-of-pleasure]
ref|XP_010044599.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    221   4e-64    Eucalyptus grandis [rose gum]
ref|NP_001189971.1|  NSP-interacting kinase 2                           222   5e-64    Arabidopsis thaliana [mouse-ear cress]
gb|KCW86687.1|  hypothetical protein EUGRSUZ_B03306                     221   6e-64    Eucalyptus grandis [rose gum]
ref|XP_009418102.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    221   6e-64    Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001168791.1|  uncharacterized LOC100382590                       218   7e-64    Zea mays [maize]
gb|EMT30099.1|  Putative LRR receptor-like serine/threonine-prote...    221   7e-64    
ref|XP_006287253.1|  hypothetical protein CARUB_v10000442mg             221   9e-64    Capsella rubella
ref|XP_010044594.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    220   1e-63    Eucalyptus grandis [rose gum]
ref|XP_010044596.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    220   1e-63    
ref|XP_010044595.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    220   1e-63    
ref|XP_010044598.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    220   1e-63    
ref|XP_010044597.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    220   2e-63    
gb|AFW86330.1|  putative leucine-rich repeat receptor-like protei...    218   2e-63    
ref|XP_009152132.1|  PREDICTED: LOW QUALITY PROTEIN: protein NSP-...    220   2e-63    
emb|CDY48073.1|  BnaA06g33550D                                          220   3e-63    
emb|CDX83534.1|  BnaC07g22740D                                          218   1e-62    
gb|ACN30679.1|  unknown                                                 217   2e-62    
ref|XP_008658830.1|  PREDICTED: uncharacterized LOC100382590 isof...    217   2e-62    
ref|XP_009131513.1|  PREDICTED: protein NSP-INTERACTING KINASE 1        216   4e-62    
gb|KFK25832.1|  hypothetical protein AALP_AA8G167900                    216   5e-62    
gb|AFW76893.1|  putative leucine-rich repeat receptor-like protei...    212   1e-61    
gb|ADD60669.1|  putative somatic embryogenesis protein kinase 1         214   4e-61    
gb|ACN34523.1|  unknown                                                 212   9e-61    
ref|XP_010100900.1|  Protein NSP-INTERACTING KINASE 1                   213   1e-60    
ref|XP_008647815.1|  PREDICTED: BRASSINOSTEROID INSENSITIVE 1-ass...    212   1e-60    
gb|AFW76897.1|  putative leucine-rich repeat receptor-like protei...    213   2e-60    
ref|NP_001147975.1|  BRASSINOSTEROID INSENSITIVE 1-associated rec...    212   2e-60    
ref|XP_009400110.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    211   2e-60    
ref|XP_009400102.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    211   2e-60    
gb|ADG39068.1|  AT5G16000-like protein                                  199   2e-60    
gb|AEN83023.1|  AT5G16000-like protein                                  199   3e-60    
gb|AEN83026.1|  AT5G16000-like protein                                  198   1e-59    
ref|XP_008658828.1|  PREDICTED: uncharacterized LOC100382590 isof...    209   2e-59    
gb|ADG39062.1|  AT5G16000-like protein                                  197   3e-59    
emb|CDY26481.1|  BnaC09g41870D                                          208   4e-59    
gb|AFO67892.1|  leucine-rich repeat receptor-like kinase                207   8e-59    
emb|CDX69484.1|  BnaA10g18330D                                          207   9e-59    
ref|XP_009121529.1|  PREDICTED: protein NSP-INTERACTING KINASE 1        207   9e-59    
gb|ADD60706.1|  putative somatic embryogenesis protein kinase 1         206   3e-58    
ref|XP_010914291.1|  PREDICTED: probable LRR receptor-like serine...    206   4e-58    
ref|XP_008781387.1|  PREDICTED: probable LRR receptor-like serine...    204   2e-57    
dbj|BAF79962.1|  receptor-like kinase                                   202   4e-57    
ref|XP_009394555.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    202   7e-57    
ref|XP_010277988.1|  PREDICTED: probable LRR receptor-like serine...    199   5e-56    
emb|CAM31941.1|  hypothetical protein                                   199   8e-56    
ref|XP_008664634.1|  PREDICTED: probable LRR receptor-like serine...    201   1e-55    
ref|XP_008664633.1|  PREDICTED: probable LRR receptor-like serine...    201   1e-55    
ref|XP_010268431.1|  PREDICTED: probable LRR receptor-like serine...    199   1e-55    
ref|XP_010277987.1|  PREDICTED: probable LRR receptor-like serine...    199   2e-55    
gb|ADD60695.1|  putative somatic embryogenesis protein kinase 1         197   4e-55    
ref|XP_006845438.1|  hypothetical protein AMTR_s00019p00103320          197   8e-55    
ref|XP_011462643.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...    196   2e-54    
ref|NP_001057376.1|  Os06g0274500                                       195   4e-54    
ref|XP_008664639.1|  PREDICTED: probable LRR receptor-like serine...    194   7e-54    
ref|XP_006659455.1|  PREDICTED: probable LRR receptor-like serine...    192   7e-54    
dbj|BAD10033.1|  somatic embryogenesis receptor kinase-like protein     192   8e-54    
gb|EPS59992.1|  hypothetical protein M569_14812                         192   8e-54    
gb|KCW86689.1|  hypothetical protein EUGRSUZ_B03306                     192   2e-53    
ref|XP_008664637.1|  PREDICTED: probable LRR receptor-like serine...    193   2e-53    
gb|KCW86690.1|  hypothetical protein EUGRSUZ_B03306                     192   3e-53    
ref|XP_008664635.1|  PREDICTED: probable LRR receptor-like serine...    194   3e-53    
gb|KCW86693.1|  hypothetical protein EUGRSUZ_B03306                     192   3e-53    
gb|KCW86692.1|  hypothetical protein EUGRSUZ_B03306                     192   3e-53    
gb|KCW86691.1|  hypothetical protein EUGRSUZ_B03306                     192   3e-53    
ref|XP_008664636.1|  PREDICTED: probable LRR receptor-like serine...    193   3e-53    
ref|XP_009345903.1|  PREDICTED: probable LRR receptor-like serine...    192   3e-53    
ref|XP_004973571.1|  PREDICTED: probable LRR receptor-like serine...    192   4e-53    
ref|XP_010047875.1|  PREDICTED: probable LRR receptor-like serine...    192   4e-53    
ref|XP_002325107.1|  leucine-rich repeat family protein                 192   5e-53    
ref|XP_010687665.1|  PREDICTED: probable LRR receptor-like serine...    192   6e-53    
ref|XP_010687666.1|  PREDICTED: probable LRR receptor-like serine...    192   6e-53    
ref|XP_009360005.1|  PREDICTED: probable LRR receptor-like serine...    191   7e-53    
ref|XP_010235160.1|  PREDICTED: probable LRR receptor-like serine...    189   8e-53    
gb|ADD60682.1|  putative somatic embryogenesis protein kinase 1         191   8e-53    
ref|NP_001061919.1|  Os08g0442700                                       191   1e-52    
ref|XP_008359493.1|  PREDICTED: probable LRR receptor-like serine...    191   1e-52    
ref|XP_011018089.1|  PREDICTED: probable LRR receptor-like serine...    191   1e-52    
emb|CDX78667.1|  BnaA03g05790D                                          191   1e-52    
dbj|BAJ91470.1|  predicted protein                                      191   1e-52    
ref|XP_007225632.1|  hypothetical protein PRUPE_ppa003371mg             190   1e-52    
emb|CDP02874.1|  unnamed protein product                                190   2e-52    
ref|XP_008223590.1|  PREDICTED: probable LRR receptor-like serine...    190   3e-52    
gb|KDO62317.1|  hypothetical protein CISIN_1g039819mg                   188   4e-52    
ref|XP_011033358.1|  PREDICTED: probable LRR receptor-like serine...    189   4e-52    
ref|XP_007013912.1|  Leucine-rich repeat protein kinase family pr...    189   4e-52    
emb|CDX70667.1|  BnaC03g07510D                                          190   5e-52    
gb|EAZ07144.1|  hypothetical protein OsI_29394                          189   5e-52    
gb|AFW62720.1|  putative leucine-rich repeat receptor-like protei...    177   7e-52    
ref|XP_002965655.1|  hypothetical protein SELMODRAFT_167872             189   8e-52    
gb|EAZ42894.1|  hypothetical protein OsJ_27488                          189   8e-52    
ref|XP_008647814.1|  PREDICTED: BRASSINOSTEROID INSENSITIVE 1-ass...    188   8e-52    
ref|XP_002971685.1|  hypothetical protein SELMODRAFT_172211             189   9e-52    
ref|XP_002445573.1|  hypothetical protein SORBIDRAFT_07g021820          189   9e-52    
ref|XP_011069822.1|  PREDICTED: probable LRR receptor-like serine...    188   1e-51    
ref|XP_006474063.1|  PREDICTED: probable LRR receptor-like serine...    188   1e-51    
ref|XP_006453537.1|  hypothetical protein CICLE_v10007718mg             188   1e-51    
ref|XP_003633168.1|  PREDICTED: probable LRR receptor-like serine...    188   1e-51    
gb|KDP38737.1|  hypothetical protein JCGZ_04090                         188   2e-51    
ref|XP_002309372.1|  leucine-rich repeat family protein                 188   2e-51    
ref|XP_009417455.1|  PREDICTED: probable LRR receptor-like serine...    187   2e-51    
ref|XP_010059023.1|  PREDICTED: probable LRR receptor-like serine...    185   2e-51    
ref|XP_009390537.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...    187   2e-51    
ref|XP_006656876.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    186   3e-51    
emb|CAN63294.1|  hypothetical protein VITISV_040285                     187   3e-51    
ref|XP_009611184.1|  PREDICTED: probable LRR receptor-like serine...    187   3e-51    
ref|XP_010108365.1|  putative LRR receptor-like serine/threonine-...    187   4e-51    
ref|XP_001756895.1|  predicted protein                                  186   5e-51    
ref|XP_009796362.1|  PREDICTED: probable LRR receptor-like serine...    186   7e-51    
gb|KCW74133.1|  hypothetical protein EUGRSUZ_E02764                     185   1e-50    
ref|XP_008443821.1|  PREDICTED: probable LRR receptor-like serine...    185   1e-50    
ref|XP_004146714.1|  PREDICTED: probable LRR receptor-like serine...    185   2e-50    
ref|XP_001785606.1|  predicted protein                                  184   2e-50    
gb|ADT91694.1|  somatic embryogenesis receptor-like kinase 1            176   3e-50    
gb|AGS80343.1|  somatic embryogenesis receptor kinase 1                 184   3e-50    
gb|ACZ56417.1|  somatic embryogenesis receptor-like kinase 1            184   3e-50    
gb|ACY91853.1|  somatic embryogenesis receptor-like kinase 1            184   3e-50    
ref|XP_004242632.1|  PREDICTED: probable LRR receptor-like serine...    184   4e-50    
gb|KJB53859.1|  hypothetical protein B456_009G008400                    183   4e-50    
ref|XP_007213585.1|  hypothetical protein PRUPE_ppa003046mg             183   4e-50    
gb|AAC63680.1|  putative LRR receptor protein kinase                    183   5e-50    
ref|XP_006343723.1|  PREDICTED: probable LRR receptor-like serine...    183   6e-50    
ref|XP_010274437.1|  PREDICTED: probable LRR receptor-like serine...    183   7e-50    
ref|NP_179973.2|  leucine-rich repeat protein kinase family protein     183   7e-50    
ref|XP_007154851.1|  hypothetical protein PHAVU_003G152900g             183   8e-50    
ref|XP_001759122.1|  predicted protein                                  182   8e-50    
ref|XP_010274436.1|  PREDICTED: probable LRR receptor-like serine...    183   8e-50    
ref|XP_001767678.1|  predicted protein                                  182   8e-50    
gb|KFK32690.1|  hypothetical protein AALP_AA6G276300                    183   8e-50    
ref|XP_010274434.1|  PREDICTED: probable LRR receptor-like serine...    183   1e-49    
gb|KHN30285.1|  Putative LRR receptor-like serine/threonine-prote...    182   1e-49    
ref|XP_010274433.1|  PREDICTED: probable LRR receptor-like serine...    183   1e-49    
ref|XP_003518230.1|  PREDICTED: probable LRR receptor-like serine...    182   1e-49    
ref|XP_010274432.1|  PREDICTED: probable LRR receptor-like serine...    183   1e-49    
gb|KDP21117.1|  hypothetical protein JCGZ_21588                         182   1e-49    
ref|XP_010274431.1|  PREDICTED: probable LRR receptor-like serine...    183   1e-49    
gb|ABK25941.1|  unknown                                                 172   1e-49    
ref|XP_002533758.1|  BRASSINOSTEROID INSENSITIVE 1-associated rec...    178   1e-49    
ref|XP_010274435.1|  PREDICTED: probable LRR receptor-like serine...    182   1e-49    
ref|XP_011079354.1|  PREDICTED: probable LRR receptor-like serine...    182   2e-49    
ref|XP_002976976.1|  hypothetical protein SELMODRAFT_443356             182   2e-49    
ref|XP_002980714.1|  hypothetical protein SELMODRAFT_444590             182   2e-49    
ref|XP_001763339.1|  predicted protein                                  181   2e-49    
ref|XP_008366037.1|  PREDICTED: probable LRR receptor-like serine...    174   2e-49    
gb|KEH32608.1|  LRR receptor-like kinase                                181   2e-49    
ref|XP_002880534.1|  leucine-rich repeat family protein                 182   2e-49    
emb|CDY65182.1|  BnaC04g56200D                                          181   3e-49    
ref|XP_010472390.1|  PREDICTED: probable LRR receptor-like serine...    181   3e-49    
ref|XP_010417134.1|  PREDICTED: probable LRR receptor-like serine...    181   3e-49    
gb|KHG18235.1|  hypothetical protein F383_07279                         181   3e-49    
emb|CDY39685.1|  BnaA04g14020D                                          181   3e-49    
ref|XP_009140509.1|  PREDICTED: probable LRR receptor-like serine...    181   4e-49    
gb|AET86626.2|  somatic embryogenesis receptor kinase 1                 175   4e-49    
ref|XP_010429349.1|  PREDICTED: probable LRR receptor-like serine...    181   4e-49    
ref|XP_003610256.1|  Somatic embryogenesis receptor-like kinase         181   4e-49    
ref|XP_002305735.1|  leucine-rich repeat transmembrane protein ki...    181   5e-49    
gb|ADW65656.1|  somatic embryogenesis receptor kinase 1                 175   6e-49    
gb|AFK41856.1|  unknown                                                 168   7e-49    
emb|CDX72249.1|  BnaC07g42710D                                          180   7e-49    
gb|AIA99455.1|  putative somatic embryogenesis receptor kinase          180   9e-49    
ref|XP_006282454.1|  hypothetical protein CARUB_v10004330mg             180   9e-49    
ref|XP_009137929.1|  PREDICTED: probable LRR receptor-like serine...    180   1e-48    
ref|XP_008225339.1|  PREDICTED: probable LRR receptor-like serine...    180   1e-48    
ref|XP_010530140.1|  PREDICTED: somatic embryogenesis receptor ki...    179   1e-48    
gb|KDO83985.1|  hypothetical protein CISIN_1g007020mg                   177   1e-48    
ref|XP_002867342.1|  predicted protein                                  179   2e-48    
gb|EYU37129.1|  hypothetical protein MIMGU_mgv1a003448mg                179   2e-48    
gb|AHI59639.1|  somatic embryogenesis receptor-like kinase              179   2e-48    
ref|XP_002978309.1|  hypothetical protein SELMODRAFT_268158             179   2e-48    
ref|XP_002966264.1|  hypothetical protein SELMODRAFT_85471              179   2e-48    
ref|XP_004134925.1|  PREDICTED: probable LRR receptor-like serine...    179   2e-48    
gb|KDP35227.1|  hypothetical protein JCGZ_09386                         179   2e-48    
ref|XP_006295562.1|  hypothetical protein CARUB_v10024669mg             179   3e-48    
ref|XP_009591346.1|  PREDICTED: somatic embryogenesis receptor ki...    175   3e-48    
ref|XP_009105842.1|  PREDICTED: somatic embryogenesis receptor ki...    179   3e-48    
ref|XP_002270847.1|  PREDICTED: somatic embryogenesis receptor ki...    179   3e-48    
emb|CDX72833.1|  BnaC06g32810D                                          179   3e-48    
ref|XP_006404888.1|  hypothetical protein EUTSA_v10000081mg             179   3e-48    
gb|AFO67896.1|  leucine-rich repeat receptor-like kinase                179   3e-48    
ref|XP_010999766.1|  PREDICTED: probable LRR receptor-like serine...    178   3e-48    
ref|XP_004149147.1|  PREDICTED: somatic embryogenesis receptor ki...    179   3e-48    
ref|XP_007020221.1|  Somatic embryogenesis receptor-like kinase 1...    176   3e-48    
ref|XP_010432978.1|  PREDICTED: probable LRR receptor-like serine...    179   4e-48    
gb|EPS63998.1|  somatic embryogenesis receptor-like kinase 1            178   4e-48    
ref|XP_010548642.1|  PREDICTED: probable LRR receptor-like serine...    178   4e-48    
ref|XP_010438169.1|  PREDICTED: probable LRR receptor-like serine...    179   4e-48    
ref|XP_010447704.1|  PREDICTED: probable LRR receptor-like serine...    178   4e-48    
ref|XP_010999763.1|  PREDICTED: probable LRR receptor-like serine...    178   4e-48    
gb|EMS65008.1|  Somatic embryogenesis receptor kinase 2                 177   5e-48    
gb|KJB69703.1|  hypothetical protein B456_011G038400                    178   5e-48    
gb|AEC46975.1|  somatic embryogenesis receptor-like kinase              178   5e-48    
gb|KHN20603.1|  Protein NSP-INTERACTING KINASE 1                        166   5e-48    
ref|XP_010939572.1|  PREDICTED: somatic embryogenesis receptor ki...    178   5e-48    
ref|XP_010543171.1|  PREDICTED: somatic embryogenesis receptor ki...    178   5e-48    
gb|AAB61708.1|  somatic embryogenesis receptor-like kinase              177   5e-48    
gb|ACD56664.1|  putative leucine-rich repeat transmembrane protein      178   5e-48    
gb|KJB69704.1|  hypothetical protein B456_011G038400                    177   5e-48    
gb|ACM89547.1|  somatic embryogenesis receptor kinase                   175   5e-48    
gb|AAT64032.1|  putative leucine-rich repeat transmembrane protein      177   6e-48    
gb|KJB69702.1|  hypothetical protein B456_011G038400                    177   6e-48    
emb|CDP01160.1|  unnamed protein product                                177   6e-48    
gb|AAT64017.1|  putative leucine-rich repeat transmembrane protein      177   6e-48    
ref|XP_008453749.1|  PREDICTED: somatic embryogenesis receptor ki...    177   6e-48    
dbj|BAF79961.1|  receptor-like kinase                                   177   6e-48    
emb|CAB79770.1|  receptor-like kinase homolog                           177   7e-48    
ref|XP_008439728.1|  PREDICTED: probable LRR receptor-like serine...    177   7e-48    
ref|XP_011074139.1|  PREDICTED: somatic embryogenesis receptor ki...    177   7e-48    
ref|XP_010245869.1|  PREDICTED: somatic embryogenesis receptor ki...    177   8e-48    
dbj|BAD32780.1|  somatic embryogenesis receptor kinase 1                177   8e-48    
emb|CDY36679.1|  BnaCnng07810D                                          177   8e-48    
ref|XP_009104891.1|  PREDICTED: somatic embryogenesis receptor ki...    177   8e-48    
ref|NP_001275800.1|  somatic embryogenesis receptor-like kinase p...    177   8e-48    
ref|XP_004496399.1|  PREDICTED: somatic embryogenesis receptor ki...    177   9e-48    
ref|XP_004162174.1|  PREDICTED: somatic embryogenesis receptor ki...    175   9e-48    
ref|NP_194781.2|  senescence-associated receptor-like kinase            177   1e-47    
ref|XP_010525766.1|  PREDICTED: probable LRR receptor-like serine...    177   1e-47    
ref|XP_002276414.2|  PREDICTED: somatic embryogenesis receptor ki...    177   1e-47    
gb|KJB76635.1|  hypothetical protein B456_012G097800                    176   1e-47    
gb|EMS66270.1|  Somatic embryogenesis receptor kinase 1                 174   1e-47    
ref|XP_006300879.1|  hypothetical protein CARUB_v10019969mg             177   1e-47    
ref|XP_007201734.1|  hypothetical protein PRUPE_ppa002871mg             177   1e-47    
gb|EEC82980.1|  hypothetical protein OsI_28003                          177   1e-47    
ref|XP_008245841.1|  PREDICTED: somatic embryogenesis receptor ki...    177   1e-47    
gb|KHG07759.1|  hypothetical protein F383_34545                         177   1e-47    
ref|XP_006659883.1|  PREDICTED: somatic embryogenesis receptor ki...    177   1e-47    
ref|XP_003556185.1|  PREDICTED: somatic embryogenesis receptor ki...    177   1e-47    
ref|XP_010471192.1|  PREDICTED: somatic embryogenesis receptor ki...    177   1e-47    
ref|NP_001061108.1|  Os08g0174700                                       177   1e-47    
ref|XP_010415894.1|  PREDICTED: somatic embryogenesis receptor ki...    177   1e-47    
ref|XP_010100747.1|  putative LRR receptor-like serine/threonine-...    176   1e-47    
ref|XP_010937037.1|  PREDICTED: somatic embryogenesis receptor ki...    177   1e-47    
gb|AAR26543.1|  benzothiadiazole-induced somatic embryogenesis re...    177   1e-47    



>dbj|BAD18097.1| putative serine/threonine protein kinase [Ipomoea batatas]
Length=232

 Score =   316 bits (810),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 152/154 (99%), Positives = 153/154 (99%), Gaps = 0/154 (0%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN
Sbjct  79   IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  138

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQ ND
Sbjct  139  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRND  198

Query  371  TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
            TPR+RTHENTPQRYSDFIEESSLIVEAMELSGPR
Sbjct  199  TPRYRTHENTPQRYSDFIEESSLIVEAMELSGPR  232



>dbj|BAD18102.1| leucine-rich repeat receptor-like kinase [Ipomoea batatas]
Length=627

 Score =   315 bits (807),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 152/154 (99%), Positives = 153/154 (99%), Gaps = 0/154 (0%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN
Sbjct  474  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  533

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQ ND
Sbjct  534  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRND  593

Query  371  TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
            TPR+RTHENTPQRYSDFIEESSLIVEAMELSGPR
Sbjct  594  TPRYRTHENTPQRYSDFIEESSLIVEAMELSGPR  627



>ref|XP_004159592.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like, partial [Cucumis 
sativus]
Length=235

 Score =   290 bits (741),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 140/154 (91%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGRGANQKGV+LDWVK LHQEGKLN
Sbjct  82   IAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRGANQKGVMLDWVKKLHQEGKLN  141

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            +MVDKDLK NFDRVELEEMVQVALLCTQFNPSHRPKMSEVL+MLEGDGLAEKWEASQ  +
Sbjct  142  MMVDKDLKGNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLKMLEGDGLAEKWEASQHIE  201

Query  371  TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
            TPR R  EN PQRYSD+IEESSLIVEAMELSGPR
Sbjct  202  TPRCRPCENPPQRYSDYIEESSLIVEAMELSGPR  235



>emb|CAN75190.1| hypothetical protein VITISV_035381 [Vitis vinifera]
Length=608

 Score =   293 bits (751),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 139/154 (90%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ANQKGV+LDWVK LHQEGKLN
Sbjct  455  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRAANQKGVMLDWVKKLHQEGKLN  514

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            LMVDKDLKNNFDRVELEEMV+VALLCTQFNPSHRPKMSE+LRMLEGDGLAEKWEASQ  +
Sbjct  515  LMVDKDLKNNFDRVELEEMVKVALLCTQFNPSHRPKMSEILRMLEGDGLAEKWEASQKVE  574

Query  371  TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
            TPRFR+ EN PQRYSD+IEESSL++EAMELSGPR
Sbjct  575  TPRFRSCENPPQRYSDYIEESSLVIEAMELSGPR  608



>ref|XP_010651607.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Vitis vinifera]
 emb|CBI28568.3| unnamed protein product [Vitis vinifera]
Length=626

 Score =   293 bits (751),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 139/154 (90%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ANQKGV+LDWVK LHQEGKLN
Sbjct  473  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRAANQKGVMLDWVKKLHQEGKLN  532

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            LMVDKDLKNNFDRVELEEMV+VALLCTQFNPSHRPKMSE+LRMLEGDGLAEKWEASQ  +
Sbjct  533  LMVDKDLKNNFDRVELEEMVKVALLCTQFNPSHRPKMSEILRMLEGDGLAEKWEASQKVE  592

Query  371  TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
            TPRFR+ EN PQRYSD+IEESSL++EAMELSGPR
Sbjct  593  TPRFRSCENPPQRYSDYIEESSLVIEAMELSGPR  626



>ref|XP_009626005.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Nicotiana tomentosiformis]
Length=626

 Score =   293 bits (750),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 140/154 (91%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGV+LDWVKTLHQE KLN
Sbjct  473  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVMLDWVKTLHQEKKLN  532

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            LMVDKDLKN+FDR+ELEEMVQVALLCT F+PSHRPKMSEVLRMLEGDGLAEKWEASQ  +
Sbjct  533  LMVDKDLKNSFDRIELEEMVQVALLCTHFSPSHRPKMSEVLRMLEGDGLAEKWEASQKVE  592

Query  371  TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
            TPR+RT ENTP+RYSD+IEESSL+VEAMELSGPR
Sbjct  593  TPRYRTSENTPKRYSDYIEESSLVVEAMELSGPR  626



>ref|XP_011086598.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Sesamum indicum]
Length=625

 Score =   292 bits (748),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 141/154 (92%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRG NQKGVILDWVK LHQEGKLN
Sbjct  472  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGTNQKGVILDWVKKLHQEGKLN  531

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            LMVDKDLKN+FDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWE SQ  +
Sbjct  532  LMVDKDLKNDFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEQSQNIE  591

Query  371  TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
            TPR+R+ E+ PQRYSDFIEESSL+VEAMELSGPR
Sbjct  592  TPRYRSFEHPPQRYSDFIEESSLVVEAMELSGPR  625



>ref|XP_009800027.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Nicotiana sylvestris]
Length=626

 Score =   291 bits (746),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 139/154 (90%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGV+LDWVK LHQE KLN
Sbjct  473  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVMLDWVKKLHQEKKLN  532

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            LMVDKDLKN+FDR+ELEEMVQVALLCT F+PSHRPKMSEVLRMLEGDGLAEKWEASQ  +
Sbjct  533  LMVDKDLKNSFDRIELEEMVQVALLCTHFSPSHRPKMSEVLRMLEGDGLAEKWEASQKVE  592

Query  371  TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
            TPR+RT ENTP+RYSD+IEESSL+VEAMELSGPR
Sbjct  593  TPRYRTSENTPKRYSDYIEESSLVVEAMELSGPR  626



>ref|XP_002525400.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor, 
putative [Ricinus communis]
 gb|EEF37038.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor, 
putative [Ricinus communis]
Length=618

 Score =   289 bits (740),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 139/154 (90%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ANQKGV+LDWVK LHQEGKLN
Sbjct  465  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRAANQKGVMLDWVKKLHQEGKLN  524

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            L+VDKDLK NFDRVELEEMVQVALLCTQFNPSHRPKMSEVL+MLEGDGLAEKWEASQ  +
Sbjct  525  LLVDKDLKGNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLKMLEGDGLAEKWEASQKIE  584

Query  371  TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
            TPRFR+ E+ PQRYSDFIEESSL+VEAMELSGPR
Sbjct  585  TPRFRSCESHPQRYSDFIEESSLVVEAMELSGPR  618



>ref|XP_004142972.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like [Cucumis sativus]
 gb|KGN62304.1| hypothetical protein Csa_2G348900 [Cucumis sativus]
Length=621

 Score =   289 bits (740),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 140/154 (91%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGRGANQKGV+LDWVK LHQEGKLN
Sbjct  468  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRGANQKGVMLDWVKKLHQEGKLN  527

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            +MVDKDLK NFDRVELEEMVQVALLCTQFNPSHRPKMSEVL+MLEGDGLAEKWEASQ  +
Sbjct  528  MMVDKDLKGNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLKMLEGDGLAEKWEASQHIE  587

Query  371  TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
            TPR R  EN PQRYSD+IEESSLIVEAMELSGPR
Sbjct  588  TPRCRPCENPPQRYSDYIEESSLIVEAMELSGPR  621



>ref|XP_008444352.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X1 [Cucumis 
melo]
Length=621

 Score =   289 bits (740),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 140/154 (91%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGRGANQKGV+LDWVK LHQEGKLN
Sbjct  468  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRGANQKGVMLDWVKKLHQEGKLN  527

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            +MVDKDLK NFDRVELEEMVQVALLCTQFNPSHRPKMSEVL+MLEGDGLAEKWEASQ  +
Sbjct  528  MMVDKDLKGNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLKMLEGDGLAEKWEASQHIE  587

Query  371  TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
            TPR R  EN PQRYSD+IEESSLIVEAMELSGPR
Sbjct  588  TPRCRPCENPPQRYSDYIEESSLIVEAMELSGPR  621



>ref|XP_008444353.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X2 [Cucumis 
melo]
Length=609

 Score =   289 bits (739),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 140/154 (91%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGRGANQKGV+LDWVK LHQEGKLN
Sbjct  456  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRGANQKGVMLDWVKKLHQEGKLN  515

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            +MVDKDLK NFDRVELEEMVQVALLCTQFNPSHRPKMSEVL+MLEGDGLAEKWEASQ  +
Sbjct  516  MMVDKDLKGNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLKMLEGDGLAEKWEASQHIE  575

Query  371  TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
            TPR R  EN PQRYSD+IEESSLIVEAMELSGPR
Sbjct  576  TPRCRPCENPPQRYSDYIEESSLIVEAMELSGPR  609



>ref|XP_011045286.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Populus euphratica]
Length=452

 Score =   284 bits (726),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 135/154 (88%), Positives = 145/154 (94%), Gaps = 0/154 (0%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ANQKGV+LDWVK LH + KLN
Sbjct  299  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRAANQKGVMLDWVKKLHHDRKLN  358

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            LMVDKDL+ NFDR+ELEEMVQVALLCTQFNPSHRPKMSEVL+MLEGDGLAEKWEASQ  +
Sbjct  359  LMVDKDLRGNFDRIELEEMVQVALLCTQFNPSHRPKMSEVLKMLEGDGLAEKWEASQRVE  418

Query  371  TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
            TPRFR+ EN PQRYSD+IEESSL+VEAMELSGPR
Sbjct  419  TPRFRSCENPPQRYSDYIEESSLVVEAMELSGPR  452



>ref|XP_007044708.1| Nsp-interacting kinase 3 isoform 1 [Theobroma cacao]
 gb|EOY00540.1| Nsp-interacting kinase 3 isoform 1 [Theobroma cacao]
Length=626

 Score =   288 bits (737),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 136/154 (88%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ANQKGV+LDWVK LHQEGKL+
Sbjct  473  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRAANQKGVMLDWVKKLHQEGKLS  532

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            L+VDKDLK NFDR+ELEEMVQVALLCTQFNPSHRP+MSEVLRMLEGDGLAEKWEASQ  +
Sbjct  533  LLVDKDLKGNFDRIELEEMVQVALLCTQFNPSHRPRMSEVLRMLEGDGLAEKWEASQKVE  592

Query  371  TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
            TPRFR+ +N PQRYSDFIEESSL++EAMELSGPR
Sbjct  593  TPRFRSCDNPPQRYSDFIEESSLVIEAMELSGPR  626



>gb|KDP26621.1| hypothetical protein JCGZ_17779 [Jatropha curcas]
Length=626

 Score =   288 bits (737),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 138/154 (90%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ANQKGV+LDWVK LHQEGKLN
Sbjct  473  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRAANQKGVMLDWVKKLHQEGKLN  532

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            L+VDKDLK NFDR+ELEEMVQVALLCTQFNPSHRPKMSEVL+MLEGDGLAEKWEASQ  +
Sbjct  533  LLVDKDLKGNFDRIELEEMVQVALLCTQFNPSHRPKMSEVLKMLEGDGLAEKWEASQKIE  592

Query  371  TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
            TPR R+ EN PQRYSDFIEESSL+VEAMELSGPR
Sbjct  593  TPRLRSCENHPQRYSDFIEESSLVVEAMELSGPR  626



>ref|XP_007044709.1| Nsp-interacting kinase 3 isoform 2 [Theobroma cacao]
 gb|EOY00541.1| Nsp-interacting kinase 3 isoform 2 [Theobroma cacao]
Length=451

 Score =   281 bits (720),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 136/157 (87%), Positives = 147/157 (94%), Gaps = 3/157 (2%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWV---KTLHQEG  561
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ANQKGV+LDWV   K LHQEG
Sbjct  295  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRAANQKGVMLDWVLSVKKLHQEG  354

Query  560  KLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQ  381
            KL+L+VDKDLK NFDR+ELEEMVQVALLCTQFNPSHRP+MSEVLRMLEGDGLAEKWEASQ
Sbjct  355  KLSLLVDKDLKGNFDRIELEEMVQVALLCTQFNPSHRPRMSEVLRMLEGDGLAEKWEASQ  414

Query  380  XNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
              +TPRFR+ +N PQRYSDFIEESSL++EAMELSGPR
Sbjct  415  KVETPRFRSCDNPPQRYSDFIEESSLVIEAMELSGPR  451



>ref|XP_011463143.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=626

 Score =   286 bits (733),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 137/154 (89%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ANQKGV+LDWVK LHQEGKLN
Sbjct  473  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRAANQKGVMLDWVKKLHQEGKLN  532

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            LMVDKDLK NFDR+ELEEMVQVALLCTQFNP HRPKMSEVL+MLEGDGLAEKWEASQ  +
Sbjct  533  LMVDKDLKGNFDRIELEEMVQVALLCTQFNPLHRPKMSEVLKMLEGDGLAEKWEASQGVE  592

Query  371  TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
            TPRFR+ E+ PQRYSDFI+ESSL+VEAMELSGPR
Sbjct  593  TPRFRSCEHPPQRYSDFIDESSLVVEAMELSGPR  626



>ref|XP_004297396.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=629

 Score =   286 bits (733),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 137/154 (89%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ANQKGV+LDWVK LHQEGKLN
Sbjct  476  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRAANQKGVMLDWVKKLHQEGKLN  535

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            LMVDKDLK NFDR+ELEEMVQVALLCTQFNP HRPKMSEVL+MLEGDGLAEKWEASQ  +
Sbjct  536  LMVDKDLKGNFDRIELEEMVQVALLCTQFNPLHRPKMSEVLKMLEGDGLAEKWEASQGVE  595

Query  371  TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
            TPRFR+ E+ PQRYSDFI+ESSL+VEAMELSGPR
Sbjct  596  TPRFRSCEHPPQRYSDFIDESSLVVEAMELSGPR  629



>ref|XP_006366916.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like [Solanum tuberosum]
Length=622

 Score =   286 bits (732),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 137/154 (89%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRG NQKGV+LDWVK LH E KLN
Sbjct  469  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGVNQKGVMLDWVKKLHAEKKLN  528

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            LMVDKDLKNNFDR+ELEEMVQVALLCTQF P++RPKMSEVLRMLEGDGLAEKWEASQ  +
Sbjct  529  LMVDKDLKNNFDRIELEEMVQVALLCTQFIPTYRPKMSEVLRMLEGDGLAEKWEASQKVE  588

Query  371  TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
            TPR+RT ENTP+RYSD+IEESSL+VEAMELSGPR
Sbjct  589  TPRYRTSENTPKRYSDYIEESSLVVEAMELSGPR  622



>ref|XP_002315684.2| hypothetical protein POPTR_0010s05300g [Populus trichocarpa]
 gb|EEF01855.2| hypothetical protein POPTR_0010s05300g [Populus trichocarpa]
Length=628

 Score =   285 bits (730),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 135/154 (88%), Positives = 145/154 (94%), Gaps = 0/154 (0%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLEL+TGQKA+DFGR ANQKGV+LDWVK LH E KLN
Sbjct  475  IAPEYLSTGQSSEKTDVFGFGILLLELVTGQKALDFGRAANQKGVMLDWVKKLHHERKLN  534

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            LMVDKDL+ NFDR+ELEEMVQVALLCTQFNPSHRPKMSEVL+MLEGDGLAEKWEASQ  +
Sbjct  535  LMVDKDLRGNFDRIELEEMVQVALLCTQFNPSHRPKMSEVLKMLEGDGLAEKWEASQRVE  594

Query  371  TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
            TPRFR+ EN PQRYSD+IEESSL+VEAMELSGPR
Sbjct  595  TPRFRSCENPPQRYSDYIEESSLVVEAMELSGPR  628



>ref|XP_006378225.1| hypothetical protein POPTR_0010s05300g [Populus trichocarpa]
 gb|ERP56022.1| hypothetical protein POPTR_0010s05300g [Populus trichocarpa]
Length=624

 Score =   285 bits (729),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 135/154 (88%), Positives = 145/154 (94%), Gaps = 0/154 (0%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLEL+TGQKA+DFGR ANQKGV+LDWVK LH E KLN
Sbjct  471  IAPEYLSTGQSSEKTDVFGFGILLLELVTGQKALDFGRAANQKGVMLDWVKKLHHERKLN  530

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            LMVDKDL+ NFDR+ELEEMVQVALLCTQFNPSHRPKMSEVL+MLEGDGLAEKWEASQ  +
Sbjct  531  LMVDKDLRGNFDRIELEEMVQVALLCTQFNPSHRPKMSEVLKMLEGDGLAEKWEASQRVE  590

Query  371  TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
            TPRFR+ EN PQRYSD+IEESSL+VEAMELSGPR
Sbjct  591  TPRFRSCENPPQRYSDYIEESSLVVEAMELSGPR  624



>ref|XP_010100426.1| Protein NSP-INTERACTING KINASE 3 [Morus notabilis]
 gb|EXB82560.1| Protein NSP-INTERACTING KINASE 3 [Morus notabilis]
Length=637

 Score =   284 bits (727),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 135/154 (88%), Positives = 145/154 (94%), Gaps = 0/154 (0%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR A QKGV+LDWVK LHQEGKLN
Sbjct  484  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRQAKQKGVMLDWVKKLHQEGKLN  543

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            LMVDKD+K NFDRVELEEMVQ+ALLCTQFNPSHRPKMS+VL+MLEGDGLAEKWEASQ  +
Sbjct  544  LMVDKDIKGNFDRVELEEMVQIALLCTQFNPSHRPKMSDVLKMLEGDGLAEKWEASQKVE  603

Query  371  TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
            TPR R+ EN PQRYSDFIEESSL++EAMELSGPR
Sbjct  604  TPRIRSCENPPQRYSDFIEESSLVIEAMELSGPR  637



>ref|XP_006380012.1| hypothetical protein POPTR_0008s19310g [Populus trichocarpa]
 gb|ERP57809.1| hypothetical protein POPTR_0008s19310g [Populus trichocarpa]
Length=622

 Score =   282 bits (721),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 134/154 (87%), Positives = 145/154 (94%), Gaps = 0/154 (0%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            I+PEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ANQKGV+LDWVK LHQ+ KLN
Sbjct  469  ISPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRAANQKGVMLDWVKKLHQDRKLN  528

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            LMVDKDL+  FDR+ELEEMVQVALLCTQFNPSHRPKMSEVL+MLEGDGLAEKWEASQ  +
Sbjct  529  LMVDKDLRGKFDRIELEEMVQVALLCTQFNPSHRPKMSEVLKMLEGDGLAEKWEASQKVE  588

Query  371  TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
            TPRFR+ EN PQ+YSDFIEESSL+VEAMELSGPR
Sbjct  589  TPRFRSCENPPQKYSDFIEESSLVVEAMELSGPR  622



>ref|XP_002312685.1| leucine-rich repeat family protein [Populus trichocarpa]
 gb|EEE90052.1| leucine-rich repeat family protein [Populus trichocarpa]
Length=625

 Score =   282 bits (721),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 134/154 (87%), Positives = 145/154 (94%), Gaps = 0/154 (0%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            I+PEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ANQKGV+LDWVK LHQ+ KLN
Sbjct  472  ISPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRAANQKGVMLDWVKKLHQDRKLN  531

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            LMVDKDL+  FDR+ELEEMVQVALLCTQFNPSHRPKMSEVL+MLEGDGLAEKWEASQ  +
Sbjct  532  LMVDKDLRGKFDRIELEEMVQVALLCTQFNPSHRPKMSEVLKMLEGDGLAEKWEASQKVE  591

Query  371  TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
            TPRFR+ EN PQ+YSDFIEESSL+VEAMELSGPR
Sbjct  592  TPRFRSCENPPQKYSDFIEESSLVVEAMELSGPR  625



>ref|XP_007222912.1| hypothetical protein PRUPE_ppa003642mg [Prunus persica]
 gb|EMJ24111.1| hypothetical protein PRUPE_ppa003642mg [Prunus persica]
Length=560

 Score =   280 bits (716),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 135/154 (88%), Positives = 145/154 (94%), Gaps = 0/154 (0%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSS+KTDVFGFGILLLELITGQKA+DFGR ANQKGV+LDWVK LHQEGK+N
Sbjct  407  IAPEYLSTGQSSDKTDVFGFGILLLELITGQKALDFGRVANQKGVMLDWVKKLHQEGKVN  466

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            LMVDKDLK NFDRVELEEMVQVALLCTQFNP HRPKMSEVL+MLEGDGLAEKWEASQ  +
Sbjct  467  LMVDKDLKGNFDRVELEEMVQVALLCTQFNPLHRPKMSEVLKMLEGDGLAEKWEASQKVE  526

Query  371  TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
            TPRFR+ E+  QRYSDFIEESSL++EAMELSGPR
Sbjct  527  TPRFRSCEHPRQRYSDFIEESSLVLEAMELSGPR  560



>ref|XP_007222911.1| hypothetical protein PRUPE_ppa003642mg [Prunus persica]
 gb|EMJ24110.1| hypothetical protein PRUPE_ppa003642mg [Prunus persica]
Length=559

 Score =   280 bits (715),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 135/154 (88%), Positives = 145/154 (94%), Gaps = 0/154 (0%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSS+KTDVFGFGILLLELITGQKA+DFGR ANQKGV+LDWVK LHQEGK+N
Sbjct  406  IAPEYLSTGQSSDKTDVFGFGILLLELITGQKALDFGRVANQKGVMLDWVKKLHQEGKVN  465

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            LMVDKDLK NFDRVELEEMVQVALLCTQFNP HRPKMSEVL+MLEGDGLAEKWEASQ  +
Sbjct  466  LMVDKDLKGNFDRVELEEMVQVALLCTQFNPLHRPKMSEVLKMLEGDGLAEKWEASQKVE  525

Query  371  TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
            TPRFR+ E+  QRYSDFIEESSL++EAMELSGPR
Sbjct  526  TPRFRSCEHPRQRYSDFIEESSLVLEAMELSGPR  559



>ref|XP_008221853.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X3 [Prunus 
mume]
Length=560

 Score =   280 bits (715),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 135/154 (88%), Positives = 145/154 (94%), Gaps = 0/154 (0%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSS+KTDVFGFGILLLELITGQKA+DFGR ANQKGV+LDWVK LHQEGK+N
Sbjct  407  IAPEYLSTGQSSDKTDVFGFGILLLELITGQKALDFGRVANQKGVMLDWVKKLHQEGKVN  466

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            LMVDKDLK NFDRVELEEMVQVALLCTQFNP HRPKMSEVL+MLEGDGLAEKWEASQ  +
Sbjct  467  LMVDKDLKGNFDRVELEEMVQVALLCTQFNPLHRPKMSEVLKMLEGDGLAEKWEASQKIE  526

Query  371  TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
            TPRFR+ E+  QRYSDFIEESSL++EAMELSGPR
Sbjct  527  TPRFRSCEHPRQRYSDFIEESSLVLEAMELSGPR  560



>ref|XP_010248542.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Nelumbo 
nucifera]
Length=582

 Score =   279 bits (713),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 134/154 (87%), Positives = 143/154 (93%), Gaps = 0/154 (0%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR  +QKGV+LDWVK LHQEGKLN
Sbjct  429  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRAVSQKGVMLDWVKKLHQEGKLN  488

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            LMVDK L NNFDRVELEEMV+VALLCTQF+PS RPKMSEVLRMLEGDGLAEKWEASQ  +
Sbjct  489  LMVDKCLNNNFDRVELEEMVKVALLCTQFHPSQRPKMSEVLRMLEGDGLAEKWEASQRAE  548

Query  371  TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
            TPR R+ EN PQRYSD+IEESSL+VEAMELSGPR
Sbjct  549  TPRLRSSENLPQRYSDYIEESSLVVEAMELSGPR  582



>ref|XP_010251173.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Nelumbo nucifera]
 ref|XP_010251174.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Nelumbo nucifera]
Length=628

 Score =   280 bits (715),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 136/154 (88%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ANQKGV+LDWVK LHQEGKLN
Sbjct  475  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRVANQKGVMLDWVKKLHQEGKLN  534

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
             MVDK L NNFDRVELEEMVQVALLCTQF+PS RPKM EVLRMLEGDGLAEKWEASQ  +
Sbjct  535  QMVDKCLNNNFDRVELEEMVQVALLCTQFHPSQRPKMCEVLRMLEGDGLAEKWEASQKVE  594

Query  371  TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
            TPRFR+ E  PQRYSDFIEESSL+VEAMELSGPR
Sbjct  595  TPRFRSSETMPQRYSDFIEESSLVVEAMELSGPR  628



>ref|XP_008221852.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X2 [Prunus 
mume]
Length=655

 Score =   280 bits (715),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 135/154 (88%), Positives = 145/154 (94%), Gaps = 0/154 (0%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSS+KTDVFGFGILLLELITGQKA+DFGR ANQKGV+LDWVK LHQEGK+N
Sbjct  502  IAPEYLSTGQSSDKTDVFGFGILLLELITGQKALDFGRVANQKGVMLDWVKKLHQEGKVN  561

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            LMVDKDLK NFDRVELEEMVQVALLCTQFNP HRPKMSEVL+MLEGDGLAEKWEASQ  +
Sbjct  562  LMVDKDLKGNFDRVELEEMVQVALLCTQFNPLHRPKMSEVLKMLEGDGLAEKWEASQKIE  621

Query  371  TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
            TPRFR+ E+  QRYSDFIEESSL++EAMELSGPR
Sbjct  622  TPRFRSCEHPRQRYSDFIEESSLVLEAMELSGPR  655



>ref|XP_008221850.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X1 [Prunus 
mume]
Length=656

 Score =   280 bits (715),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 135/154 (88%), Positives = 145/154 (94%), Gaps = 0/154 (0%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSS+KTDVFGFGILLLELITGQKA+DFGR ANQKGV+LDWVK LHQEGK+N
Sbjct  503  IAPEYLSTGQSSDKTDVFGFGILLLELITGQKALDFGRVANQKGVMLDWVKKLHQEGKVN  562

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            LMVDKDLK NFDRVELEEMVQVALLCTQFNP HRPKMSEVL+MLEGDGLAEKWEASQ  +
Sbjct  563  LMVDKDLKGNFDRVELEEMVQVALLCTQFNPLHRPKMSEVLKMLEGDGLAEKWEASQKIE  622

Query  371  TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
            TPRFR+ E+  QRYSDFIEESSL++EAMELSGPR
Sbjct  623  TPRFRSCEHPRQRYSDFIEESSLVLEAMELSGPR  656



>ref|XP_010248541.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Nelumbo 
nucifera]
Length=626

 Score =   279 bits (713),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 134/154 (87%), Positives = 143/154 (93%), Gaps = 0/154 (0%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR  +QKGV+LDWVK LHQEGKLN
Sbjct  473  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRAVSQKGVMLDWVKKLHQEGKLN  532

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            LMVDK L NNFDRVELEEMV+VALLCTQF+PS RPKMSEVLRMLEGDGLAEKWEASQ  +
Sbjct  533  LMVDKCLNNNFDRVELEEMVKVALLCTQFHPSQRPKMSEVLRMLEGDGLAEKWEASQRAE  592

Query  371  TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
            TPR R+ EN PQRYSD+IEESSL+VEAMELSGPR
Sbjct  593  TPRLRSSENLPQRYSDYIEESSLVVEAMELSGPR  626



>ref|XP_011034116.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Populus 
euphratica]
Length=624

 Score =   278 bits (712),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 133/154 (86%), Positives = 143/154 (93%), Gaps = 0/154 (0%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ANQKGV+LDWVK LH + KLN
Sbjct  471  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRAANQKGVMLDWVKKLHHDRKLN  530

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            LMVDKDL+  FDR+ELEEMVQVALLCTQFNPSHRPKMSEVL+MLEGDGLAEKWEASQ  +
Sbjct  531  LMVDKDLRGKFDRIELEEMVQVALLCTQFNPSHRPKMSEVLKMLEGDGLAEKWEASQKVE  590

Query  371  TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
            TPRFR+ EN  Q+YSDFIEESSL+VEAMELSGPR
Sbjct  591  TPRFRSCENPAQKYSDFIEESSLVVEAMELSGPR  624



>ref|XP_011034114.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Populus 
euphratica]
 ref|XP_011034115.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Populus 
euphratica]
Length=627

 Score =   278 bits (712),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 133/154 (86%), Positives = 143/154 (93%), Gaps = 0/154 (0%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ANQKGV+LDWVK LH + KLN
Sbjct  474  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRAANQKGVMLDWVKKLHHDRKLN  533

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            LMVDKDL+  FDR+ELEEMVQVALLCTQFNPSHRPKMSEVL+MLEGDGLAEKWEASQ  +
Sbjct  534  LMVDKDLRGKFDRIELEEMVQVALLCTQFNPSHRPKMSEVLKMLEGDGLAEKWEASQKVE  593

Query  371  TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
            TPRFR+ EN  Q+YSDFIEESSL+VEAMELSGPR
Sbjct  594  TPRFRSCENPAQKYSDFIEESSLVVEAMELSGPR  627



>emb|CDP13189.1| unnamed protein product [Coffea canephora]
Length=624

 Score =   278 bits (712),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 133/154 (86%), Positives = 144/154 (94%), Gaps = 0/154 (0%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGRGA QKG++LDWVK LHQ+ KL 
Sbjct  471  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRGAKQKGIMLDWVKKLHQDAKLE  530

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            LMVDKDLKN++D VELEEMVQVALLCT FNPS+RPKMSEVLRMLEGDGLAEKWEASQ  +
Sbjct  531  LMVDKDLKNDYDNVELEEMVQVALLCTVFNPSNRPKMSEVLRMLEGDGLAEKWEASQTIE  590

Query  371  TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
            TPRFRT E+ PQRYSD+IEESSL+VEAMELSGPR
Sbjct  591  TPRFRTFEHIPQRYSDYIEESSLVVEAMELSGPR  624



>ref|XP_008389685.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Malus 
domestica]
 ref|XP_008389686.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Malus 
domestica]
Length=632

 Score =   277 bits (709),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 135/154 (88%), Positives = 144/154 (94%), Gaps = 0/154 (0%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSS+KTDVFGFGILLLELITGQKA+DFGR ANQKGV+LDWVK LHQEGKLN
Sbjct  479  IAPEYLSTGQSSDKTDVFGFGILLLELITGQKALDFGRVANQKGVMLDWVKKLHQEGKLN  538

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            LMVDKDLK N DRVELEEMVQVALLCTQFNP +RPKMSEVL+MLEGDGLAEKWEASQ  +
Sbjct  539  LMVDKDLKGNIDRVELEEMVQVALLCTQFNPLYRPKMSEVLKMLEGDGLAEKWEASQKVE  598

Query  371  TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
            TPRFR+ E+  QRYSDFIEESSL+VEAMELSGPR
Sbjct  599  TPRFRSCEHPRQRYSDFIEESSLVVEAMELSGPR  632



>ref|XP_008389687.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Malus 
domestica]
Length=631

 Score =   277 bits (709),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 135/154 (88%), Positives = 144/154 (94%), Gaps = 0/154 (0%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSS+KTDVFGFGILLLELITGQKA+DFGR ANQKGV+LDWVK LHQEGKLN
Sbjct  478  IAPEYLSTGQSSDKTDVFGFGILLLELITGQKALDFGRVANQKGVMLDWVKKLHQEGKLN  537

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            LMVDKDLK N DRVELEEMVQVALLCTQFNP +RPKMSEVL+MLEGDGLAEKWEASQ  +
Sbjct  538  LMVDKDLKGNIDRVELEEMVQVALLCTQFNPLYRPKMSEVLKMLEGDGLAEKWEASQKVE  597

Query  371  TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
            TPRFR+ E+  QRYSDFIEESSL+VEAMELSGPR
Sbjct  598  TPRFRSCEHPRQRYSDFIEESSLVVEAMELSGPR  631



>gb|EYU28436.1| hypothetical protein MIMGU_mgv1a002888mg [Erythranthe guttata]
Length=628

 Score =   277 bits (708),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 134/157 (85%), Positives = 144/157 (92%), Gaps = 3/157 (2%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITG KAVDFGRGANQKGVILDWVK LHQEGKLN
Sbjct  472  IAPEYLSTGQSSEKTDVFGFGILLLELITGHKAVDFGRGANQKGVILDWVKKLHQEGKLN  531

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            LMVDK+LK++FD +ELEEMVQVALLCT FNP+HRPKMSEVLRMLEGDGLAEKWE SQ  D
Sbjct  532  LMVDKELKSDFDMIELEEMVQVALLCTHFNPTHRPKMSEVLRMLEGDGLAEKWEQSQKVD  591

Query  371  TPRF---RTHENTPQRYSDFIEESSLIVEAMELSGPR  270
            TPR+   R+ +N PQRYSD+IEESSL+VE MELSGPR
Sbjct  592  TPRYNNSRSFQNLPQRYSDYIEESSLVVEDMELSGPR  628



>ref|XP_008389688.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X3 [Malus 
domestica]
Length=630

 Score =   277 bits (708),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 135/154 (88%), Positives = 144/154 (94%), Gaps = 0/154 (0%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSS+KTDVFGFGILLLELITGQKA+DFGR ANQKGV+LDWVK LHQEGKLN
Sbjct  477  IAPEYLSTGQSSDKTDVFGFGILLLELITGQKALDFGRVANQKGVMLDWVKKLHQEGKLN  536

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            LMVDKDLK N DRVELEEMVQVALLCTQFNP +RPKMSEVL+MLEGDGLAEKWEASQ  +
Sbjct  537  LMVDKDLKGNIDRVELEEMVQVALLCTQFNPLYRPKMSEVLKMLEGDGLAEKWEASQKVE  596

Query  371  TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
            TPRFR+ E+  QRYSDFIEESSL+VEAMELSGPR
Sbjct  597  TPRFRSCEHPRQRYSDFIEESSLVVEAMELSGPR  630



>ref|XP_003613191.1| Leucine-rich repeat receptor-like kinase [Medicago truncatula]
 gb|ADO15296.1| somatic embryogenesis receptor kinase-like protein 2 [Medicago 
truncatula]
 gb|AES96149.1| LRR receptor-like kinase [Medicago truncatula]
Length=625

 Score =   276 bits (706),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 135/154 (88%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFG+GILLLELITG KA+DFGR ANQKGV+LDWVK LH EGKL+
Sbjct  472  IAPEYLSTGQSSEKTDVFGYGILLLELITGHKALDFGRAANQKGVMLDWVKKLHLEGKLS  531

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
             MVDKDLK NFD VEL EMVQVALLCTQFNPSHRPKMSEVL+MLEGDGLAEKWEASQ  +
Sbjct  532  QMVDKDLKGNFDIVELGEMVQVALLCTQFNPSHRPKMSEVLKMLEGDGLAEKWEASQRIE  591

Query  371  TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
            TPRFR  EN PQRYSDFIEESSLIVEAMELSGPR
Sbjct  592  TPRFRFCENPPQRYSDFIEESSLIVEAMELSGPR  625



>gb|KDO82334.1| hypothetical protein CISIN_1g006968mg [Citrus sinensis]
Length=623

 Score =   276 bits (705),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 132/154 (86%), Positives = 144/154 (94%), Gaps = 3/154 (2%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A+DFGR ANQ+GV+LDWVK LHQEGKL+
Sbjct  473  IAPEYLSTGQSSEKTDVFGFGILLLELITGQRALDFGRAANQRGVMLDWVKKLHQEGKLS  532

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
             MVDKDLK NFDR+ELEEMVQVALLCTQFNP HRPKMSEVL+MLEGDGLAEKWEASQ  +
Sbjct  533  QMVDKDLKGNFDRIELEEMVQVALLCTQFNPLHRPKMSEVLKMLEGDGLAEKWEASQKIE  592

Query  371  TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
            TPR+RTHE   +RYSDFIEESSL++EAMELSGPR
Sbjct  593  TPRYRTHE---KRYSDFIEESSLVIEAMELSGPR  623



>ref|XP_010319667.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Solanum 
lycopersicum]
Length=575

 Score =   273 bits (699),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 134/156 (86%), Positives = 143/156 (92%), Gaps = 2/156 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAV+FGRGANQKGV+LDWVK LH E KLN
Sbjct  420  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGRGANQKGVMLDWVKKLHVEKKLN  479

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQX--  378
            LMVDKDLKNNFD +ELEEMVQVALLCT F P++RPKMSEVLRMLEGDGLAEKWEASQ   
Sbjct  480  LMVDKDLKNNFDGIELEEMVQVALLCTHFIPTYRPKMSEVLRMLEGDGLAEKWEASQKVE  539

Query  377  NDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
              TPRF T ENTP+RYSD+I+ESSL+VEAMELSGPR
Sbjct  540  TPTPRFTTSENTPKRYSDYIQESSLVVEAMELSGPR  575



>ref|XP_004237339.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Solanum 
lycopersicum]
 ref|XP_010319665.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Solanum 
lycopersicum]
 ref|XP_010319666.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Solanum 
lycopersicum]
Length=623

 Score =   273 bits (699),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 134/156 (86%), Positives = 143/156 (92%), Gaps = 2/156 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAV+FGRGANQKGV+LDWVK LH E KLN
Sbjct  468  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGRGANQKGVMLDWVKKLHVEKKLN  527

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQX--  378
            LMVDKDLKNNFD +ELEEMVQVALLCT F P++RPKMSEVLRMLEGDGLAEKWEASQ   
Sbjct  528  LMVDKDLKNNFDGIELEEMVQVALLCTHFIPTYRPKMSEVLRMLEGDGLAEKWEASQKVE  587

Query  377  NDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
              TPRF T ENTP+RYSD+I+ESSL+VEAMELSGPR
Sbjct  588  TPTPRFTTSENTPKRYSDYIQESSLVVEAMELSGPR  623



>ref|XP_009596637.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like [Nicotiana tomentosiformis]
Length=601

 Score =   272 bits (695),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 143/155 (92%), Gaps = 2/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVI-LDWVKTLHQEGKL  555
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGRGANQKGV+ LDWVK LHQEGK 
Sbjct  448  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAMDFGRGANQKGVVMLDWVKELHQEGKS  507

Query  554  NLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXN  375
            NLMVDKDLKNNFDR+ELEEMV+VALLCTQFNPSHRPKMSE LRMLEGDGLAEKWEASQ  
Sbjct  508  NLMVDKDLKNNFDRIELEEMVKVALLCTQFNPSHRPKMSEALRMLEGDGLAEKWEASQKL  567

Query  374  DTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
            + PR R  E+TPQRYS+++EESSL VE MELSGPR
Sbjct  568  EAPRNRAFEHTPQRYSNYVEESSL-VEPMELSGPR  601



>ref|XP_004489819.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like [Cicer arietinum]
Length=625

 Score =   272 bits (695),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 133/154 (86%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITG KA+DFGR ANQKGV+LDWVK LH EG+L+
Sbjct  472  IAPEYLSTGQSSEKTDVFGFGILLLELITGHKALDFGRAANQKGVMLDWVKKLHLEGRLS  531

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
             MVDKDLK  FD VEL EMVQVALLCTQFNPSHRPKMSEVL+MLEGDGLAE+WEASQ  +
Sbjct  532  QMVDKDLKGIFDIVELGEMVQVALLCTQFNPSHRPKMSEVLKMLEGDGLAERWEASQRIE  591

Query  371  TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
            TPRFR  EN PQRYSDFIEESSLIVEAMELSGPR
Sbjct  592  TPRFRLCENPPQRYSDFIEESSLIVEAMELSGPR  625



>ref|XP_007157369.1| hypothetical protein PHAVU_002G064400g [Phaseolus vulgaris]
 gb|ESW29363.1| hypothetical protein PHAVU_002G064400g [Phaseolus vulgaris]
Length=623

 Score =   272 bits (695),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 132/154 (86%), Positives = 142/154 (92%), Gaps = 2/154 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITG KA+DFGR ANQKGV+LDWVK LHQ+G+L+
Sbjct  472  IAPEYLSTGQSSEKTDVFGFGILLLELITGHKALDFGRAANQKGVMLDWVKKLHQDGRLS  531

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
             MVDKDLK NFD +ELEEMVQVALLCTQFNPSHRPKMSEVL+MLEGDGLAE+WEASQ  +
Sbjct  532  QMVDKDLKGNFDLIELEEMVQVALLCTQFNPSHRPKMSEVLKMLEGDGLAERWEASQRIE  591

Query  371  TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
            TPRFR+ E  PQRYSD IEESSLIVEAMELSGPR
Sbjct  592  TPRFRSCE--PQRYSDLIEESSLIVEAMELSGPR  623



>ref|XP_003517653.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like [Glycine max]
Length=623

 Score =   271 bits (694),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 132/154 (86%), Positives = 142/154 (92%), Gaps = 2/154 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITG KA+DFGR ANQKGV+LDWVK LHQ+G+L+
Sbjct  472  IAPEYLSTGQSSEKTDVFGFGILLLELITGHKALDFGRAANQKGVMLDWVKKLHQDGRLS  531

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
             MVDKDLK NFD +ELEEMVQVALLCTQFNPSHRPKMSEVL+MLEGDGLAE+WEASQ  +
Sbjct  532  QMVDKDLKGNFDLIELEEMVQVALLCTQFNPSHRPKMSEVLKMLEGDGLAERWEASQRIE  591

Query  371  TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
            TPRFR+ E  PQRYSD IEESSLIVEAMELSGPR
Sbjct  592  TPRFRSCE--PQRYSDLIEESSLIVEAMELSGPR  623



>gb|KHN14560.1| Protein NSP-INTERACTING KINASE 3 [Glycine soja]
Length=623

 Score =   271 bits (694),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 132/154 (86%), Positives = 142/154 (92%), Gaps = 2/154 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITG KA+DFGR ANQKGV+LDWVK LHQ+G+L+
Sbjct  472  IAPEYLSTGQSSEKTDVFGFGILLLELITGHKALDFGRAANQKGVMLDWVKKLHQDGRLS  531

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
             MVDKDLK NFD +ELEEMVQVALLCTQFNPSHRPKMSEVL+MLEGDGLAE+WEASQ  +
Sbjct  532  QMVDKDLKGNFDLIELEEMVQVALLCTQFNPSHRPKMSEVLKMLEGDGLAERWEASQRIE  591

Query  371  TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
            TPRFR+ E  PQRYSD IEESSLIVEAMELSGPR
Sbjct  592  TPRFRSCE--PQRYSDLIEESSLIVEAMELSGPR  623



>gb|KJB61045.1| hypothetical protein B456_009G337000 [Gossypium raimondii]
Length=625

 Score =   271 bits (694),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 131/156 (84%), Positives = 144/156 (92%), Gaps = 2/156 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ANQKGV+LDWVK LHQ+GKL+
Sbjct  470  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRAANQKGVMLDWVKKLHQDGKLS  529

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            L+VDKDLK NFDR+ELEEMVQVALLCTQFNP HRP+MSEVLRMLEGDGLAEKWEASQ   
Sbjct  530  LLVDKDLKGNFDRIELEEMVQVALLCTQFNPLHRPRMSEVLRMLEGDGLAEKWEASQMIK  589

Query  371  TPRFRT--HENTPQRYSDFIEESSLIVEAMELSGPR  270
            T + R+  ++N PQRYSDFIEESSL++EAMELSGPR
Sbjct  590  TLKLRSCDNDNPPQRYSDFIEESSLVLEAMELSGPR  625



>gb|KJB61041.1| hypothetical protein B456_009G337000 [Gossypium raimondii]
Length=628

 Score =   271 bits (694),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 131/156 (84%), Positives = 144/156 (92%), Gaps = 2/156 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ANQKGV+LDWVK LHQ+GKL+
Sbjct  473  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRAANQKGVMLDWVKKLHQDGKLS  532

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            L+VDKDLK NFDR+ELEEMVQVALLCTQFNP HRP+MSEVLRMLEGDGLAEKWEASQ   
Sbjct  533  LLVDKDLKGNFDRIELEEMVQVALLCTQFNPLHRPRMSEVLRMLEGDGLAEKWEASQMIK  592

Query  371  TPRFRT--HENTPQRYSDFIEESSLIVEAMELSGPR  270
            T + R+  ++N PQRYSDFIEESSL++EAMELSGPR
Sbjct  593  TLKLRSCDNDNPPQRYSDFIEESSLVLEAMELSGPR  628



>ref|XP_006438322.1| hypothetical protein CICLE_v10030967mg [Citrus clementina]
 gb|ESR51562.1| hypothetical protein CICLE_v10030967mg [Citrus clementina]
Length=623

 Score =   271 bits (693),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 130/154 (84%), Positives = 142/154 (92%), Gaps = 3/154 (2%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A+DFGR ANQ+GV+LDWVK LHQEGKL+
Sbjct  473  IAPEYLSTGQSSEKTDVFGFGILLLELITGQRALDFGRAANQRGVMLDWVKKLHQEGKLS  532

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
             MVDKDLK   DR+ELEEMVQVALLCTQFNP HRPKMSEVL+MLEGDGLAEKWEASQ  +
Sbjct  533  QMVDKDLKGKLDRIELEEMVQVALLCTQFNPLHRPKMSEVLKMLEGDGLAEKWEASQKIE  592

Query  371  TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
            TPR+RTHE   +RYSDFIEESSL++EAMELSGPR
Sbjct  593  TPRYRTHE---KRYSDFIEESSLVIEAMELSGPR  623



>ref|XP_003519642.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform 1 [Glycine 
max]
Length=624

 Score =   271 bits (693),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 131/154 (85%), Positives = 142/154 (92%), Gaps = 2/154 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITG KA+DFGR ANQKGV+LDWVK LHQ+G+L+
Sbjct  473  IAPEYLSTGQSSEKTDVFGFGILLLELITGHKALDFGRAANQKGVMLDWVKKLHQDGRLS  532

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
             MVDKDLK NFD +ELEEMVQVALLCTQFNPSHRPKMSEVL+MLEGDGLAE+WEASQ  +
Sbjct  533  QMVDKDLKGNFDLIELEEMVQVALLCTQFNPSHRPKMSEVLKMLEGDGLAERWEASQRIE  592

Query  371  TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
            TPRFR+ E  PQRYSD IEESSL+VEAMELSGPR
Sbjct  593  TPRFRSCE--PQRYSDLIEESSLVVEAMELSGPR  624



>gb|KHN00370.1| Protein NSP-INTERACTING KINASE 3 [Glycine soja]
Length=624

 Score =   271 bits (693),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 131/154 (85%), Positives = 142/154 (92%), Gaps = 2/154 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITG KA+DFGR ANQKGV+LDWVK LHQ+G+L+
Sbjct  473  IAPEYLSTGQSSEKTDVFGFGILLLELITGHKALDFGRAANQKGVMLDWVKKLHQDGRLS  532

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
             MVDKDLK NFD +ELEEMVQVALLCTQFNPSHRPKMSEVL+MLEGDGLAE+WEASQ  +
Sbjct  533  QMVDKDLKGNFDLIELEEMVQVALLCTQFNPSHRPKMSEVLKMLEGDGLAERWEASQRIE  592

Query  371  TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
            TPRFR+ E  PQRYSD IEESSL+VEAMELSGPR
Sbjct  593  TPRFRSCE--PQRYSDLIEESSLVVEAMELSGPR  624



>ref|XP_006483905.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like [Citrus sinensis]
Length=623

 Score =   271 bits (692),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 130/154 (84%), Positives = 142/154 (92%), Gaps = 3/154 (2%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A+DFGR ANQ+GV+LDWVK LHQEGKL+
Sbjct  473  IAPEYLSTGQSSEKTDVFGFGILLLELITGQRALDFGRAANQRGVMLDWVKKLHQEGKLS  532

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
             MVDKDLK   DR+ELEEMVQVALLCTQFNP HRPKMSEVL+MLEGDGLAEKWEASQ  +
Sbjct  533  QMVDKDLKGKLDRIELEEMVQVALLCTQFNPLHRPKMSEVLKMLEGDGLAEKWEASQKIE  592

Query  371  TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
            TPR+RTHE   +RYSDFIEESSL++EAMELSGPR
Sbjct  593  TPRYRTHE---KRYSDFIEESSLVIEAMELSGPR  623



>ref|XP_006841062.1| hypothetical protein AMTR_s00085p00173590 [Amborella trichopoda]
 gb|ERN02737.1| hypothetical protein AMTR_s00085p00173590 [Amborella trichopoda]
Length=629

 Score =   270 bits (691),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 143/155 (92%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGR ANQKGV+LDWVK LHQE KLN
Sbjct  475  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRLANQKGVMLDWVKKLHQEKKLN  534

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXN-  375
            LMVDKDLKNNFDRVELEEMV+VALLCTQF+P+ RPKMSEV+RMLEGDGLAEKWEASQ   
Sbjct  535  LMVDKDLKNNFDRVELEEMVRVALLCTQFHPACRPKMSEVVRMLEGDGLAEKWEASQQKV  594

Query  374  DTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
            +TPRFR  E  P++YSD IEESSL+VEAMELSGPR
Sbjct  595  ETPRFRGSEFFPRKYSDLIEESSLVVEAMELSGPR  629



>ref|XP_010910388.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like [Elaeis guineensis]
Length=629

 Score =   267 bits (683),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ANQKGV+LDWVK LHQE KL 
Sbjct  476  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRLANQKGVMLDWVKKLHQENKLR  535

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            +MVDKDLKNN+DRVELEEMVQVALLCTQF+PSHRPKMSEV+RMLEGDGLAEKWEASQ  +
Sbjct  536  VMVDKDLKNNYDRVELEEMVQVALLCTQFHPSHRPKMSEVVRMLEGDGLAEKWEASQKIE  595

Query  371  TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
            TP+ R+ E  P +Y DF+E+SSL+VEA+ELSGPR
Sbjct  596  TPKSRSCEQPPPKYLDFVEDSSLVVEAIELSGPR  629



>ref|XP_010682518.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Beta vulgaris subsp. 
vulgaris]
Length=621

 Score =   266 bits (681),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 141/154 (92%), Gaps = 2/154 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYL TGQSSEKTDVFG+GILLLELITGQKA+DFGR +NQKGV+LDWVK LH EGKLN
Sbjct  470  IAPEYLCTGQSSEKTDVFGYGILLLELITGQKAIDFGRASNQKGVMLDWVKKLHTEGKLN  529

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
             +VDKDLKNN+DRVEL EMVQVALLCTQFNP HRPKMS+VLRMLE DGLAEKW+ASQ ++
Sbjct  530  QLVDKDLKNNYDRVELGEMVQVALLCTQFNPLHRPKMSDVLRMLEDDGLAEKWDASQRSE  589

Query  371  TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
            TPR R+ E  PQRYSD+IEESSL+VEAMELSGPR
Sbjct  590  TPRSRSSE--PQRYSDYIEESSLVVEAMELSGPR  621



>ref|XP_006356418.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006356419.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Solanum 
tuberosum]
 ref|XP_006356420.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X3 [Solanum 
tuberosum]
Length=600

 Score =   265 bits (677),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 130/155 (84%), Positives = 142/155 (92%), Gaps = 2/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVI-LDWVKTLHQEGKL  555
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGRGANQKGV+ LDWV+ LHQE KL
Sbjct  447  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAMDFGRGANQKGVVMLDWVRNLHQEEKL  506

Query  554  NLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXN  375
            NLMVD +LKNNFD++ELEEMV+VALLCT FNPSHRPKMSE LRMLEGDGLAEKWEASQ  
Sbjct  507  NLMVDSNLKNNFDQIELEEMVKVALLCTHFNPSHRPKMSEALRMLEGDGLAEKWEASQKL  566

Query  374  DTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
            +TPR R  E+TPQRYS+F+E+SSL VE MELSGPR
Sbjct  567  ETPRNRAFEHTPQRYSNFVEDSSL-VEPMELSGPR  600



>ref|XP_008812173.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Phoenix dactylifera]
Length=629

 Score =   265 bits (678),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 126/154 (82%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFG+LLLELITGQKA+DFGR ANQKGV+LDWVK LHQE KL+
Sbjct  476  IAPEYLSTGQSSEKTDVFGFGVLLLELITGQKALDFGRLANQKGVMLDWVKKLHQENKLS  535

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            +MVDKDLKNN+DRVELEEMVQVALLCTQ++PSHRPKMSEV+RMLEGDGLAEKWEASQ  D
Sbjct  536  MMVDKDLKNNYDRVELEEMVQVALLCTQYHPSHRPKMSEVVRMLEGDGLAEKWEASQKID  595

Query  371  TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
             P+  + E  P RY DF+EESSL+V+A+ELSGPR
Sbjct  596  APKSLSSEQPPPRYLDFVEESSLVVDAIELSGPR  629



>ref|XP_008340072.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X3 [Malus 
domestica]
Length=628

 Score =   265 bits (678),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 130/154 (84%), Positives = 141/154 (92%), Gaps = 1/154 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSS+KTDVFGFGILLLELITGQ+A+DFGR ANQKGV+LDWVK LHQEGKLN
Sbjct  476  IAPEYLSTGQSSDKTDVFGFGILLLELITGQRALDFGRVANQKGVMLDWVKKLHQEGKLN  535

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            LMVDKDL+   DRVELEEMVQVALLCTQFNP +RPKMSEVL+MLEGDGLAEKWEASQ  +
Sbjct  536  LMVDKDLRGKLDRVELEEMVQVALLCTQFNPLYRPKMSEVLKMLEGDGLAEKWEASQKVE  595

Query  371  TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
            TPRFR  +   QRYSDFIEESSL++EAMELSGPR
Sbjct  596  TPRFRPCDPR-QRYSDFIEESSLVLEAMELSGPR  628



>ref|XP_008340070.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Malus 
domestica]
Length=630

 Score =   265 bits (678),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 130/154 (84%), Positives = 141/154 (92%), Gaps = 1/154 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSS+KTDVFGFGILLLELITGQ+A+DFGR ANQKGV+LDWVK LHQEGKLN
Sbjct  478  IAPEYLSTGQSSDKTDVFGFGILLLELITGQRALDFGRVANQKGVMLDWVKKLHQEGKLN  537

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            LMVDKDL+   DRVELEEMVQVALLCTQFNP +RPKMSEVL+MLEGDGLAEKWEASQ  +
Sbjct  538  LMVDKDLRGKLDRVELEEMVQVALLCTQFNPLYRPKMSEVLKMLEGDGLAEKWEASQKVE  597

Query  371  TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
            TPRFR  +   QRYSDFIEESSL++EAMELSGPR
Sbjct  598  TPRFRPCDPR-QRYSDFIEESSLVLEAMELSGPR  630



>ref|XP_008340071.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Malus 
domestica]
Length=629

 Score =   265 bits (678),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 130/154 (84%), Positives = 141/154 (92%), Gaps = 1/154 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSS+KTDVFGFGILLLELITGQ+A+DFGR ANQKGV+LDWVK LHQEGKLN
Sbjct  477  IAPEYLSTGQSSDKTDVFGFGILLLELITGQRALDFGRVANQKGVMLDWVKKLHQEGKLN  536

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            LMVDKDL+   DRVELEEMVQVALLCTQFNP +RPKMSEVL+MLEGDGLAEKWEASQ  +
Sbjct  537  LMVDKDLRGKLDRVELEEMVQVALLCTQFNPLYRPKMSEVLKMLEGDGLAEKWEASQKVE  596

Query  371  TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
            TPRFR  +   QRYSDFIEESSL++EAMELSGPR
Sbjct  597  TPRFRPCDPR-QRYSDFIEESSLVLEAMELSGPR  629



>ref|XP_008813583.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Phoenix 
dactylifera]
Length=643

 Score =   265 bits (678),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 143/154 (93%), Gaps = 0/154 (0%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A+DFGR ANQKGV+LDWVK LHQE KL+
Sbjct  490  IAPEYLSTGQSSEKTDVFGFGILLLELITGQRALDFGRLANQKGVMLDWVKRLHQENKLS  549

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            +MVDKDL+NN+DRVELEEMVQVALLCTQF+PSHRPKMSEV+RMLEGDGLAEKWEASQ  D
Sbjct  550  MMVDKDLRNNYDRVELEEMVQVALLCTQFHPSHRPKMSEVVRMLEGDGLAEKWEASQKVD  609

Query  371  TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
            TP+  + E  P ++SD++E+SSL+VEA+ELSGPR
Sbjct  610  TPKSGSSEQAPPKHSDYVEDSSLVVEAIELSGPR  643



>ref|XP_010940158.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Elaeis guineensis]
Length=629

 Score =   265 bits (677),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFG+LLLELITGQKA+DFGR ANQKGV+LDWVK LHQE KL+
Sbjct  476  IAPEYLSTGQSSEKTDVFGFGVLLLELITGQKALDFGRLANQKGVMLDWVKKLHQENKLS  535

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            +MVDKDLKNN+D VELEEMVQVALLCTQ++PSHRPKMSEV+RMLEGDGLAEKWEASQ  D
Sbjct  536  MMVDKDLKNNYDSVELEEMVQVALLCTQYHPSHRPKMSEVVRMLEGDGLAEKWEASQKTD  595

Query  371  TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
            TP+  + E  P +Y DF+EESSL+V+A+ELSGPR
Sbjct  596  TPKSLSSEQPPPKYLDFVEESSLVVDAIELSGPR  629



>ref|XP_008813582.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Phoenix 
dactylifera]
Length=649

 Score =   265 bits (677),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 143/154 (93%), Gaps = 0/154 (0%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A+DFGR ANQKGV+LDWVK LHQE KL+
Sbjct  496  IAPEYLSTGQSSEKTDVFGFGILLLELITGQRALDFGRLANQKGVMLDWVKRLHQENKLS  555

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            +MVDKDL+NN+DRVELEEMVQVALLCTQF+PSHRPKMSEV+RMLEGDGLAEKWEASQ  D
Sbjct  556  MMVDKDLRNNYDRVELEEMVQVALLCTQFHPSHRPKMSEVVRMLEGDGLAEKWEASQKVD  615

Query  371  TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
            TP+  + E  P ++SD++E+SSL+VEA+ELSGPR
Sbjct  616  TPKSGSSEQAPPKHSDYVEDSSLVVEAIELSGPR  649



>ref|XP_010023506.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Eucalyptus grandis]
 gb|KCW59799.1| hypothetical protein EUGRSUZ_H02547 [Eucalyptus grandis]
Length=621

 Score =   264 bits (675),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ANQKGV+LDWV  LH++GKLN
Sbjct  468  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRVANQKGVMLDWVNKLHKDGKLN  527

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
             +VDKDL  NFDR+ELEEMV+V+LLCT+FNP  RPKMSEVLRMLEGDGLAEKWEASQ  +
Sbjct  528  QLVDKDLGVNFDRIELEEMVKVSLLCTKFNPLERPKMSEVLRMLEGDGLAEKWEASQKVE  587

Query  371  TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
            TPRFR+ EN   RYSDFIEESSL+VEAMELSGPR
Sbjct  588  TPRFRSCENPTPRYSDFIEESSLVVEAMELSGPR  621



>ref|XP_009403878.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=607

 Score =   260 bits (664),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 123/154 (80%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ANQKGV+LDWVK LHQE +LN
Sbjct  454  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRLANQKGVMLDWVKKLHQENRLN  513

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            +MVDKDLKNN+DRVELEEMVQVALLCTQF+PSHRPKMSEV+RMLEGDGL E W+A Q  D
Sbjct  514  IMVDKDLKNNYDRVELEEMVQVALLCTQFHPSHRPKMSEVVRMLEGDGLVESWDALQKMD  573

Query  371  TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
            TP+ R+ E    +Y DF+E+SSL++EA+ELSGPR
Sbjct  574  TPKCRSLERQSPKYVDFMEDSSLVLEAIELSGPR  607



>ref|XP_009403877.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=626

 Score =   259 bits (663),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 123/154 (80%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ANQKGV+LDWVK LHQE +LN
Sbjct  473  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRLANQKGVMLDWVKKLHQENRLN  532

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            +MVDKDLKNN+DRVELEEMVQVALLCTQF+PSHRPKMSEV+RMLEGDGL E W+A Q  D
Sbjct  533  IMVDKDLKNNYDRVELEEMVQVALLCTQFHPSHRPKMSEVVRMLEGDGLVESWDALQKMD  592

Query  371  TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
            TP+ R+ E    +Y DF+E+SSL++EA+ELSGPR
Sbjct  593  TPKCRSLERQSPKYVDFMEDSSLVLEAIELSGPR  626



>ref|XP_009390158.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=659

 Score =   257 bits (656),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 123/154 (80%), Positives = 138/154 (90%), Gaps = 0/154 (0%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR  NQKGV+LDWVK LHQE KL 
Sbjct  506  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRLTNQKGVMLDWVKKLHQENKLY  565

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            +MVDKDLKNN++RVELEEM+QVALLCTQF+PS RPKMSEV+RMLEGDGLAEKWEASQ  D
Sbjct  566  MMVDKDLKNNYNRVELEEMIQVALLCTQFHPSQRPKMSEVVRMLEGDGLAEKWEASQRMD  625

Query  371  TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
            TP+ R+ E    +Y DF+E+SS +VEA+ELSGPR
Sbjct  626  TPKSRSSEQLTPKYIDFMEDSSFVVEAIELSGPR  659



>ref|XP_009390157.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009390159.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009390160.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=665

 Score =   257 bits (656),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 123/154 (80%), Positives = 138/154 (90%), Gaps = 0/154 (0%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR  NQKGV+LDWVK LHQE KL 
Sbjct  512  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRLTNQKGVMLDWVKKLHQENKLY  571

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            +MVDKDLKNN++RVELEEM+QVALLCTQF+PS RPKMSEV+RMLEGDGLAEKWEASQ  D
Sbjct  572  MMVDKDLKNNYNRVELEEMIQVALLCTQFHPSQRPKMSEVVRMLEGDGLAEKWEASQRMD  631

Query  371  TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
            TP+ R+ E    +Y DF+E+SS +VEA+ELSGPR
Sbjct  632  TPKSRSSEQLTPKYIDFMEDSSFVVEAIELSGPR  665



>ref|XP_006605000.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Glycine max]
Length=230

 Score =   242 bits (618),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 135/154 (88%), Gaps = 1/154 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLS GQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG +LDWV+ LHQE KL 
Sbjct  75   IAPEYLSRGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAMLDWVRKLHQEKKLE  134

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            L+VDKDLK N+DR+ELEE+VQVALLCTQ+ P HRPKMS+V+RMLEGDGLAEKWEASQ  D
Sbjct  135  LLVDKDLKTNYDRIELEEIVQVALLCTQYLPGHRPKMSDVVRMLEGDGLAEKWEASQSAD  194

Query  371  TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGP  273
            T + +  E ++  RYSD I++SSL+V+AMELSGP
Sbjct  195  TTKCKPQELSSSDRYSDLIDDSSLLVQAMELSGP  228



>ref|XP_006844161.1| hypothetical protein AMTR_s00006p00261510 [Amborella trichopoda]
 gb|ERN05836.1| hypothetical protein AMTR_s00006p00261510 [Amborella trichopoda]
Length=620

 Score =   251 bits (640),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 117/154 (76%), Positives = 138/154 (90%), Gaps = 0/154 (0%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQKA++FG+ ANQKG +LDWVK +HQE KL+
Sbjct  467  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKALEFGKAANQKGAMLDWVKKIHQEKKLD  526

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            L+VDKDLK N+DR+ELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE+WEASQ +D
Sbjct  527  LLVDKDLKINYDRIELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAERWEASQRSD  586

Query  371  TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
            T +FR  + + +RYSD  ++SSL+ +AMELSGPR
Sbjct  587  TSKFRGSDLSSERYSDLTDDSSLLAQAMELSGPR  620



>ref|XP_004238646.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Solanum lycopersicum]
Length=603

 Score =   249 bits (636),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 137/155 (88%), Gaps = 2/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVI-LDWVKTLHQEGKL  555
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGRGANQKGV+ LDWV+ LHQE KL
Sbjct  450  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAMDFGRGANQKGVVMLDWVRKLHQEDKL  509

Query  554  NLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXN  375
            NLMVD +L+N+F+R+ELEEMV+VALLCT FNP HRPKMSE LRMLEGDGLAE+W ASQ  
Sbjct  510  NLMVDSNLRNSFERIELEEMVKVALLCTHFNPCHRPKMSEALRMLEGDGLAEQWAASQNL  569

Query  374  DTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
            +T R R  E TPQ YSD++++SSL VE MELSGPR
Sbjct  570  ETRRKRAFEPTPQTYSDYVQDSSL-VEPMELSGPR  603



>ref|XP_002455108.1| hypothetical protein SORBIDRAFT_03g004450 [Sorghum bicolor]
 gb|EES00228.1| hypothetical protein SORBIDRAFT_03g004450 [Sorghum bicolor]
Length=615

 Score =   249 bits (636),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 121/155 (78%), Positives = 138/155 (89%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFG+LL+ELITGQKA+DFGR ANQKG +LDWVK LHQE +LN
Sbjct  461  IAPEYLSTGQSSEKTDVFGFGVLLVELITGQKALDFGRVANQKGGVLDWVKKLHQEKQLN  520

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            +MVDKDL +N+DRVELEEMVQVALLCTQ++PSHRP+MSEV+RMLEGDGLAEKWEASQ  D
Sbjct  521  MMVDKDLGSNYDRVELEEMVQVALLCTQYHPSHRPRMSEVIRMLEGDGLAEKWEASQNVD  580

Query  371  TPRFRTHENTPQRYSDF-IEESSLIVEAMELSGPR  270
            TP+  + E  P +Y DF  +ESSL +EAMELSGPR
Sbjct  581  TPKSVSSEILPPKYMDFAADESSLGLEAMELSGPR  615



>ref|XP_010261784.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Nelumbo 
nucifera]
Length=550

 Score =   247 bits (630),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 138/155 (89%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A+DFG+ ANQKG +LDWVK +HQE KL+
Sbjct  396  IAPEYLSTGQSSEKTDVFGFGILLLELITGQRALDFGKAANQKGAMLDWVKKIHQEKKLD  455

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
             +VDKD+KNN+DRVELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE+WEASQ  +
Sbjct  456  ALVDKDMKNNYDRVELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAERWEASQRAE  515

Query  371  TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
              + + HE ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  516  ATKCKPHEFSSSERYSDLTDDSSLLVQAMELSGPR  550



>ref|XP_011070875.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Sesamum indicum]
Length=623

 Score =   246 bits (629),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 140/155 (90%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG +LDWVK +HQE KL+
Sbjct  469  IAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAMLDWVKKIHQEKKLD  528

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            ++VDKDL+NN+DR+ELEEMVQVALLCTQ+ P+HRPKMSEV+RMLEGDGLAEKWEASQ  +
Sbjct  529  MLVDKDLRNNYDRIELEEMVQVALLCTQYLPNHRPKMSEVVRMLEGDGLAEKWEASQRAE  588

Query  371  TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
              R R +E ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  589  VTRCRANEFSSSERYSDLTDDSSLLVQAMELSGPR  623



>gb|KEH21800.1| NSP-interacting kinase-like protein [Medicago truncatula]
Length=626

 Score =   246 bits (629),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 138/155 (89%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG +LDWVK +HQE KL 
Sbjct  472  IAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAMLDWVKKIHQEKKLE  531

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            L+VDKDLK+N+D++ELEEMVQVALLCTQ+ PSHRPKMSEV+RMLEGDGLAE+WEASQ  D
Sbjct  532  LLVDKDLKSNYDKIELEEMVQVALLCTQYLPSHRPKMSEVVRMLEGDGLAERWEASQKTD  591

Query  371  TPRFRTHENT-PQRYSDFIEESSLIVEAMELSGPR  270
            T +F+  E++   RYSD  ++S L+V+AMELSGPR
Sbjct  592  TSKFKHQESSLSDRYSDLTDDSLLLVQAMELSGPR  626



>ref|XP_010261776.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Nelumbo 
nucifera]
Length=623

 Score =   246 bits (629),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 138/155 (89%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A+DFG+ ANQKG +LDWVK +HQE KL+
Sbjct  469  IAPEYLSTGQSSEKTDVFGFGILLLELITGQRALDFGKAANQKGAMLDWVKKIHQEKKLD  528

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
             +VDKD+KNN+DRVELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE+WEASQ  +
Sbjct  529  ALVDKDMKNNYDRVELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAERWEASQRAE  588

Query  371  TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
              + + HE ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  589  ATKCKPHEFSSSERYSDLTDDSSLLVQAMELSGPR  623



>ref|XP_006603947.1| PREDICTED: protein NSP-INTERACTING KINASE 1 isoform X2 [Glycine 
max]
Length=510

 Score =   243 bits (621),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 136/155 (88%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG +LDWV+ LHQE KL 
Sbjct  356  IAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAMLDWVRKLHQEKKLE  415

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            L+VDKDLK N+DR+ELEE+VQVALLCTQ+ P HRPKMSEV+RMLEGDGLAEKWEASQ  D
Sbjct  416  LLVDKDLKTNYDRIELEEIVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAEKWEASQSAD  475

Query  371  TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
            T + +  E ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  476  TTKCKPQELSSSDRYSDLTDDSSLLVQAMELSGPR  510



>ref|XP_010257839.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Nelumbo nucifera]
Length=624

 Score =   246 bits (628),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 140/155 (90%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG +LDWVK +HQE KL+
Sbjct  470  IAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAMLDWVKKIHQEKKLD  529

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            ++VDKDLK+N+DR+ELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE+WEASQ  +
Sbjct  530  MLVDKDLKDNYDRIELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAERWEASQRAE  589

Query  371  TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
            T + + HE ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  590  TTKCKPHEFSSSERYSDLTDDSSLLVQAMELSGPR  624



>ref|XP_003637897.1| Receptor-like kinase [Medicago truncatula]
Length=496

 Score =   243 bits (619),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 139/155 (90%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELI+GQ+A++FG+ ANQKG +LDWVK +HQE K++
Sbjct  342  IAPEYLSTGQSSEKTDVFGFGILLLELISGQRALEFGKAANQKGAMLDWVKKIHQEKKID  401

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            ++VDKDLKN +DR+EL+E+VQVALLCTQ+ PSHRPKMSEV+RMLEGDGLAEKWEASQ  +
Sbjct  402  VLVDKDLKNKYDRIELDEIVQVALLCTQYLPSHRPKMSEVVRMLEGDGLAEKWEASQRAE  461

Query  371  TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
            + R R +E ++ +RYSD  ++SSL+ +AMELSGPR
Sbjct  462  STRSRGNELSSSERYSDLTDDSSLLAQAMELSGPR  496



>ref|XP_004968347.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like [Setaria italica]
Length=633

 Score =   246 bits (628),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 137/155 (88%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFG+LL+ELITGQKA+DFGR ANQKG +LDWVK LHQE +L+
Sbjct  479  IAPEYLSTGQSSEKTDVFGFGVLLVELITGQKALDFGRVANQKGGVLDWVKKLHQEKQLS  538

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            +MVDKDL +N+DRVELEEMVQVALLCTQ+ PSHRP+MSEV+RMLEGDGLAEKWEASQ  D
Sbjct  539  MMVDKDLGSNYDRVELEEMVQVALLCTQYYPSHRPRMSEVIRMLEGDGLAEKWEASQNVD  598

Query  371  TPRFRTHENTPQRYSDF-IEESSLIVEAMELSGPR  270
            TP+  + E  P +Y DF  +ESSL +EAMELSGPR
Sbjct  599  TPKSVSSELLPPKYMDFAADESSLGLEAMELSGPR  633



>emb|CAN63733.1| hypothetical protein VITISV_025883 [Vitis vinifera]
Length=609

 Score =   245 bits (626),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 139/155 (90%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG +LDWVK +HQE KL+
Sbjct  455  IAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAMLDWVKKIHQEKKLD  514

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            ++VDKDLK N+DR+ELEEMVQVALLCTQ+ PSHRPKMSEV+RMLEGDGLAEKWEA+Q  +
Sbjct  515  MLVDKDLKANYDRIELEEMVQVALLCTQYLPSHRPKMSEVVRMLEGDGLAEKWEATQRAE  574

Query  371  TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
              R + +E ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  575  ATRCKANEFSSSERYSDLTDDSSLLVQAMELSGPR  609



>ref|XP_002532890.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor, 
putative [Ricinus communis]
 gb|EEF29495.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor, 
putative [Ricinus communis]
Length=624

 Score =   245 bits (626),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 139/155 (90%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG +LDWVK +HQE KL 
Sbjct  470  IAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAMLDWVKKIHQEKKLE  529

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            ++VDKDLK+N+DR+ELEEMVQVALLCTQF PSHRPKMSEV+RMLEGDGLAE+WEASQ  +
Sbjct  530  MLVDKDLKSNYDRIELEEMVQVALLCTQFLPSHRPKMSEVVRMLEGDGLAERWEASQRAE  589

Query  371  TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
            + + + HE ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  590  STKSKLHEFSSSDRYSDLTDDSSLLVQAMELSGPR  624



>ref|XP_006593318.1| PREDICTED: NSP-interacting kinase isoform X2 [Glycine max]
Length=510

 Score =   243 bits (619),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 135/155 (87%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG +LDWV+ LHQE KL 
Sbjct  356  IAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAMLDWVRKLHQEKKLE  415

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            L+VDKDLK N+DR+ELEE+VQVALLCTQ+ P HRPKMSEV+RMLEGDGLAEKWEASQ  D
Sbjct  416  LLVDKDLKTNYDRIELEEIVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAEKWEASQSAD  475

Query  371  TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
            T   +  E ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  476  TSNCKPQELSSSDRYSDLTDDSSLLVQAMELSGPR  510



>emb|CDP00520.1| unnamed protein product [Coffea canephora]
Length=623

 Score =   245 bits (626),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 138/155 (89%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG +LDWVK +HQE KL 
Sbjct  469  IAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAMLDWVKKIHQEKKLE  528

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            L+VDKDLKN++DR+ELEEM QVALLCTQ+ PSHRPKMSEV+RMLEGDGLAEKWEASQ  +
Sbjct  529  LLVDKDLKNSYDRIELEEMAQVALLCTQYLPSHRPKMSEVVRMLEGDGLAEKWEASQRAE  588

Query  371  TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
              R R +E ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  589  ATRCRANEFSSSERYSDLTDDSSLLVQAMELSGPR  623



>ref|XP_002269902.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Vitis vinifera]
 emb|CBI27432.3| unnamed protein product [Vitis vinifera]
Length=625

 Score =   245 bits (626),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 139/155 (90%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG +LDWVK +HQE KL+
Sbjct  471  IAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAMLDWVKKIHQEKKLD  530

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            ++VDKDLK N+DR+ELEEMVQVALLCTQ+ PSHRPKMSEV+RMLEGDGLAEKWEA+Q  +
Sbjct  531  MLVDKDLKANYDRIELEEMVQVALLCTQYLPSHRPKMSEVVRMLEGDGLAEKWEATQRAE  590

Query  371  TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
              R + +E ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  591  ATRCKANEFSSSERYSDLTDDSSLLVQAMELSGPR  625



>ref|XP_006643812.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like [Oryza brachyantha]
Length=590

 Score =   244 bits (622),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 137/155 (88%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFG+LL+ELITGQKA+DFGR ANQKG +LDWVK LHQE +L+
Sbjct  436  IAPEYLSTGQSSEKTDVFGFGVLLVELITGQKALDFGRIANQKGGVLDWVKKLHQEKQLS  495

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            +MVDKDL +N+DRVELEEMVQVALLCTQ+ PSHRP+MSEV+RMLEGDGLAEKWEASQ  D
Sbjct  496  MMVDKDLGSNYDRVELEEMVQVALLCTQYYPSHRPRMSEVIRMLEGDGLAEKWEASQNVD  555

Query  371  TPRFRTHENTPQRYSDF-IEESSLIVEAMELSGPR  270
            TP+  + E  P ++ DF  +ESSL +EAMELSGPR
Sbjct  556  TPKSVSSELLPPKFMDFAADESSLGLEAMELSGPR  590



>ref|XP_008446509.1| PREDICTED: protein NSP-INTERACTING KINASE 2 isoform X3 [Cucumis 
melo]
Length=510

 Score =   242 bits (617),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/155 (73%), Positives = 137/155 (88%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFG+GILLLELITGQ+A++FG+  NQKG +LDWVK +HQE KL 
Sbjct  356  IAPEYLSTGQSSEKTDVFGYGILLLELITGQRALEFGKAVNQKGAMLDWVKKIHQEKKLE  415

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            L+VDKDL++N+DR+ELEEMVQVALLCTQ+ P+ RPKMSEV+RMLEGDGLAEKWEASQ  D
Sbjct  416  LLVDKDLRSNYDRIELEEMVQVALLCTQYLPTTRPKMSEVVRMLEGDGLAEKWEASQRAD  475

Query  371  TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
              R+R +E ++ +RYSD  ++SSL+ +AMELSGPR
Sbjct  476  ANRYRVNEFSSSERYSDLTDDSSLLAQAMELSGPR  510



>gb|KHN07744.1| Protein NSP-INTERACTING KINASE 2 [Glycine soja]
Length=621

 Score =   244 bits (623),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 140/155 (90%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELI+GQ+A++FG+ ANQKG +LDWVK +HQE K++
Sbjct  467  IAPEYLSTGQSSEKTDVFGFGILLLELISGQRALEFGKAANQKGAMLDWVKKIHQEKKID  526

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            L+VDKDLKNN+DR+EL+E+VQVALLCTQ+ PSHRPKMSEV+RMLEGDGLAEKWEASQ  +
Sbjct  527  LLVDKDLKNNYDRIELDEIVQVALLCTQYLPSHRPKMSEVVRMLEGDGLAEKWEASQSAE  586

Query  371  TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
            + R R +E ++ +RYSD  ++SSL+ +AMELSGPR
Sbjct  587  STRSRGNELSSSERYSDLTDDSSLLAQAMELSGPR  621



>ref|XP_006574993.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like isoform X1 [Glycine 
max]
 ref|XP_006574994.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like isoform X2 [Glycine 
max]
Length=621

 Score =   244 bits (623),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 140/155 (90%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELI+GQ+A++FG+ ANQKG +LDWVK +HQE K++
Sbjct  467  IAPEYLSTGQSSEKTDVFGFGILLLELISGQRALEFGKAANQKGAMLDWVKKIHQEKKID  526

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            L+VDKDLKNN+DR+EL+E+VQVALLCTQ+ PSHRPKMSEV+RMLEGDGLAEKWEASQ  +
Sbjct  527  LLVDKDLKNNYDRIELDEIVQVALLCTQYLPSHRPKMSEVVRMLEGDGLAEKWEASQSAE  586

Query  371  TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
            + R R +E ++ +RYSD  ++SSL+ +AMELSGPR
Sbjct  587  STRSRGNELSSSERYSDLTDDSSLLAQAMELSGPR  621



>dbj|BAD68255.1| putative brassinosteroid insensitive 1-associated receptor kinase 
1 [Oryza sativa Japonica Group]
 dbj|BAE96298.1| SERK like protein kinase [Oryza sativa Japonica Group]
 gb|EAZ10713.1| hypothetical protein OsJ_00547 [Oryza sativa Japonica Group]
 dbj|BAG94399.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC70017.1| hypothetical protein OsI_00578 [Oryza sativa Indica Group]
Length=628

 Score =   244 bits (623),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 137/155 (88%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFG+LL+ELITGQKA+DFGR ANQKG +LDWVK LHQE +L+
Sbjct  474  IAPEYLSTGQSSEKTDVFGFGVLLVELITGQKALDFGRLANQKGGVLDWVKKLHQEKQLS  533

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            +MVDKDL +N+DRVELEEMVQVALLCTQ+ PSHRP+MSEV+RMLEGDGLAEKWEASQ  D
Sbjct  534  MMVDKDLGSNYDRVELEEMVQVALLCTQYYPSHRPRMSEVIRMLEGDGLAEKWEASQNVD  593

Query  371  TPRFRTHENTPQRYSDF-IEESSLIVEAMELSGPR  270
            TP+  + E  P ++ DF  +ESSL +EAMELSGPR
Sbjct  594  TPKSVSSELLPPKFMDFAADESSLGLEAMELSGPR  628



>ref|XP_006482337.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Citrus sinensis]
Length=622

 Score =   244 bits (623),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 138/155 (89%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A+++G+ ANQKG +LDWVK +HQE KL 
Sbjct  468  IAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEYGKAANQKGAMLDWVKKIHQEKKLE  527

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            ++VDKDLKNN+DR+ELEEMVQVALLCTQ+ P+HRPKMSEV+RMLEGDGLAE+WEASQ  +
Sbjct  528  MLVDKDLKNNYDRIELEEMVQVALLCTQYLPAHRPKMSEVVRMLEGDGLAERWEASQRAE  587

Query  371  TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
              + + HE ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  588  ATKSKPHEFSSSDRYSDLTDDSSLLVQAMELSGPR  622



>gb|KDO58880.1| hypothetical protein CISIN_1g036225mg [Citrus sinensis]
Length=622

 Score =   244 bits (622),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 138/155 (89%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A+++G+ ANQKG +LDWVK +HQE KL 
Sbjct  468  IAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEYGKAANQKGAMLDWVKKIHQEKKLE  527

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            ++VDKDLKNN+DR+ELEEMVQVALLCTQ+ P+HRPKMSEV+RMLEGDGLAE+WEASQ  +
Sbjct  528  MLVDKDLKNNYDRIELEEMVQVALLCTQYLPAHRPKMSEVVRMLEGDGLAERWEASQRAE  587

Query  371  TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
              + + HE ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  588  ATKSKPHEFSSSDRYSDLTDDSSLLVQAMELSGPR  622



>ref|XP_004171526.1| PREDICTED: LOW QUALITY PROTEIN: protein NSP-INTERACTING KINASE 
2-like, partial [Cucumis sativus]
Length=287

 Score =   234 bits (598),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 134/155 (86%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG ILDWVK +H E KL 
Sbjct  133  IAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGGILDWVKRIHLEKKLE  192

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            ++VDKDLK N+DRVELEEMVQVALLCTQ+ P HRP MSEV+RMLEG+GLA +WEASQ  D
Sbjct  193  VLVDKDLKANYDRVELEEMVQVALLCTQYLPGHRPXMSEVVRMLEGEGLAVRWEASQRVD  252

Query  371  TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
            + + + H+ ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  253  STKCKPHDFSSSDRYSDLTDDSSLLVQAMELSGPR  287



>ref|NP_001238448.1| NSP-interacting kinase precursor [Glycine max]
 gb|ACM89473.1| NSP-interacting kinase [Glycine max]
Length=600

 Score =   243 bits (619),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 135/155 (87%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG +LDWV+ LHQE KL 
Sbjct  446  IAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAMLDWVRKLHQEKKLE  505

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            L+VDKDLK N+DR+ELEE+VQVALLCTQ+ P HRPKMSEV+RMLEGDGLAEKWEASQ  D
Sbjct  506  LLVDKDLKTNYDRIELEEIVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAEKWEASQSAD  565

Query  371  TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
            T   +  E ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  566  TSNCKPQELSSSDRYSDLTDDSSLLVQAMELSGPR  600



>gb|KHN30771.1| Protein NSP-INTERACTING KINASE 1 [Glycine soja]
Length=619

 Score =   243 bits (620),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 136/155 (88%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG +LDWV+ LHQE KL 
Sbjct  465  IAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAMLDWVRKLHQEKKLE  524

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            L+VDKDLK N+DR+ELEE+VQVALLCTQ+ P HRPKMSEV+RMLEGDGLAEKWEASQ  D
Sbjct  525  LLVDKDLKTNYDRIELEEIVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAEKWEASQSAD  584

Query  371  TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
            T + +  E ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  585  TTKCKPQELSSSDRYSDLTDDSSLLVQAMELSGPR  619



>ref|XP_003555046.1| PREDICTED: protein NSP-INTERACTING KINASE 1 isoformX1 [Glycine 
max]
Length=624

 Score =   243 bits (620),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 136/155 (88%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG +LDWV+ LHQE KL 
Sbjct  470  IAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAMLDWVRKLHQEKKLE  529

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            L+VDKDLK N+DR+ELEE+VQVALLCTQ+ P HRPKMSEV+RMLEGDGLAEKWEASQ  D
Sbjct  530  LLVDKDLKTNYDRIELEEIVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAEKWEASQSAD  589

Query  371  TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
            T + +  E ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  590  TTKCKPQELSSSDRYSDLTDDSSLLVQAMELSGPR  624



>ref|XP_008797566.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Phoenix dactylifera]
Length=624

 Score =   243 bits (620),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 139/155 (90%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITG +A++FG+ ANQKG +LDWVK +HQE KL+
Sbjct  470  IAPEYLSTGQSSEKTDVFGFGILLLELITGLRAMEFGKAANQKGAMLDWVKKIHQEKKLD  529

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            ++VDKDLKN++DR+ELEE VQVALLCTQ+ PSHRPKMSEV+RMLEGDGLAE+WEASQ  +
Sbjct  530  MLVDKDLKNDYDRIELEETVQVALLCTQYLPSHRPKMSEVVRMLEGDGLAERWEASQRAE  589

Query  371  TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
             P+F+  E ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  590  APKFKMPEVSSSERYSDLTDDSSLLVQAMELSGPR  624



>gb|KHN07168.1| Protein NSP-INTERACTING KINASE 1 [Glycine soja]
Length=582

 Score =   242 bits (617),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 113/155 (73%), Positives = 140/155 (90%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELI+GQ+A++FG+ ANQKG +LDWVK +HQE K++
Sbjct  428  IAPEYLSTGQSSEKTDVFGFGILLLELISGQRALEFGKAANQKGAMLDWVKKIHQEKKID  487

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            L+VDKDLKNN+DR+EL+E+VQVALLCTQ+ PS+RPKMSEV+RMLEGDGLAEKWEASQ  +
Sbjct  488  LLVDKDLKNNYDRIELDEIVQVALLCTQYLPSYRPKMSEVVRMLEGDGLAEKWEASQRAE  547

Query  371  TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
            + R R +E ++ +RYSD  ++SSL+ +AMELSGPR
Sbjct  548  STRSRGNELSSSERYSDLTDDSSLLAQAMELSGPR  582



>ref|XP_006593317.1| PREDICTED: NSP-interacting kinase isoform X1 [Glycine max]
 gb|KHN02661.1| Protein NSP-INTERACTING KINASE 1 [Glycine soja]
Length=624

 Score =   243 bits (619),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 135/155 (87%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG +LDWV+ LHQE KL 
Sbjct  470  IAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAMLDWVRKLHQEKKLE  529

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            L+VDKDLK N+DR+ELEE+VQVALLCTQ+ P HRPKMSEV+RMLEGDGLAEKWEASQ  D
Sbjct  530  LLVDKDLKTNYDRIELEEIVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAEKWEASQSAD  589

Query  371  TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
            T   +  E ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  590  TSNCKPQELSSSDRYSDLTDDSSLLVQAMELSGPR  624



>gb|KDP24340.1| hypothetical protein JCGZ_25636 [Jatropha curcas]
Length=624

 Score =   243 bits (619),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 137/155 (88%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG ILDWVK +HQE KL 
Sbjct  470  IAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAILDWVKKIHQEKKLE  529

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            ++VDKDLK N+DR+ELEE+VQVALLCTQF PSHRPKMSEV+RMLEGDGLAE+WEASQ  +
Sbjct  530  MLVDKDLKANYDRIELEEIVQVALLCTQFLPSHRPKMSEVVRMLEGDGLAERWEASQRVE  589

Query  371  TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
              + + HE ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  590  ATKPKPHEFSSSDRYSDLTDDSSLLVQAMELSGPR  624



>gb|KEH17048.1| NSP-interacting kinase-like protein [Medicago truncatula]
Length=558

 Score =   241 bits (615),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 139/155 (90%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELI+GQ+A++FG+ ANQKG +LDWVK +HQE K++
Sbjct  404  IAPEYLSTGQSSEKTDVFGFGILLLELISGQRALEFGKAANQKGAMLDWVKKIHQEKKID  463

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            ++VDKDLKN +DR+EL+E+VQVALLCTQ+ PSHRPKMSEV+RMLEGDGLAEKWEASQ  +
Sbjct  464  VLVDKDLKNKYDRIELDEIVQVALLCTQYLPSHRPKMSEVVRMLEGDGLAEKWEASQRAE  523

Query  371  TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
            + R R +E ++ +RYSD  ++SSL+ +AMELSGPR
Sbjct  524  STRSRGNELSSSERYSDLTDDSSLLAQAMELSGPR  558



>ref|XP_004490300.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Cicer arietinum]
Length=622

 Score =   242 bits (618),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 113/155 (73%), Positives = 140/155 (90%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSS+KTDVFGFGILLLELI+GQ+A++FG+ ANQKG +LDWVK +HQE K++
Sbjct  468  IAPEYLSTGQSSDKTDVFGFGILLLELISGQRALEFGKAANQKGAMLDWVKKIHQEKKID  527

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            L+VDKDLKNN+DR+EL+E+VQVALLCTQ+ PSHRPKMSEV+RMLEGDGLAEKWEASQ  +
Sbjct  528  LLVDKDLKNNYDRIELDEIVQVALLCTQYLPSHRPKMSEVVRMLEGDGLAEKWEASQRAE  587

Query  371  TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
            + R R +E ++ +RYSD  ++SSL+ +AMELSGPR
Sbjct  588  STRSRGNELSSSERYSDLTDDSSLLAQAMELSGPR  622



>ref|XP_006430876.1| hypothetical protein CICLE_v10011302mg [Citrus clementina]
 gb|ESR44116.1| hypothetical protein CICLE_v10011302mg [Citrus clementina]
Length=622

 Score =   242 bits (618),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 113/155 (73%), Positives = 137/155 (88%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A+++G+ ANQKG +LDWVK +H E KL 
Sbjct  468  IAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEYGKAANQKGAMLDWVKKIHHEKKLE  527

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            ++VDKDLKNN+DR+ELEEMVQVALLCTQ+ P+HRPKMSEV+RMLEGDGLAE+WEASQ  +
Sbjct  528  MLVDKDLKNNYDRIELEEMVQVALLCTQYLPAHRPKMSEVVRMLEGDGLAERWEASQRAE  587

Query  371  TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
              + + HE ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  588  ATKSKPHEFSSSDRYSDLTDDSSLLVQAMELSGPR  622



>ref|XP_009625494.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Nicotiana tomentosiformis]
Length=624

 Score =   242 bits (617),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 141/155 (91%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSS+KTDVFGFGILLLELI+GQ+A++FG+ ANQKG +LDWVK + QE KL+
Sbjct  470  IAPEYLSTGQSSDKTDVFGFGILLLELISGQRALEFGKAANQKGAMLDWVKKIQQEKKLD  529

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            L+V+KDLK+N+DR+E+EEMVQVAL+CTQ++PSHRPKMSEV+RMLEGDGLAEKWEASQ  +
Sbjct  530  LLVNKDLKDNYDRIEVEEMVQVALICTQYHPSHRPKMSEVVRMLEGDGLAEKWEASQKAE  589

Query  371  TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
            + R R +E ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  590  STRCRANEFSSSERYSDLTDDSSLLVQAMELSGPR  624



>ref|XP_007153543.1| hypothetical protein PHAVU_003G044400g [Phaseolus vulgaris]
 gb|ESW25537.1| hypothetical protein PHAVU_003G044400g [Phaseolus vulgaris]
Length=621

 Score =   241 bits (616),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 113/155 (73%), Positives = 140/155 (90%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELI+GQ+A++FG+ ANQKG +LDWVK +HQE K++
Sbjct  467  IAPEYLSTGQSSEKTDVFGFGILLLELISGQRALEFGKAANQKGAMLDWVKKIHQEKKID  526

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            L+VDKDLKN++DR+EL+E+VQVALLCTQ+ PSHRPKMSEV+RMLEGDGLAEKWEASQ  +
Sbjct  527  LLVDKDLKNHYDRIELDEIVQVALLCTQYLPSHRPKMSEVVRMLEGDGLAEKWEASQRAE  586

Query  371  TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
            + R R +E ++ +RYSD  ++SSL+ +AMELSGPR
Sbjct  587  STRSRGNELSSSERYSDLTDDSSLLTQAMELSGPR  621



>ref|XP_003517902.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Glycine max]
Length=621

 Score =   241 bits (616),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 113/155 (73%), Positives = 140/155 (90%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELI+GQ+A++FG+ ANQKG +LDWVK +HQE K++
Sbjct  467  IAPEYLSTGQSSEKTDVFGFGILLLELISGQRALEFGKAANQKGAMLDWVKKIHQEKKID  526

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            L+VDKDLKNN+DR+EL+E+VQVALLCTQ+ PS+RPKMSEV+RMLEGDGLAEKWEASQ  +
Sbjct  527  LLVDKDLKNNYDRIELDEIVQVALLCTQYLPSYRPKMSEVVRMLEGDGLAEKWEASQRAE  586

Query  371  TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
            + R R +E ++ +RYSD  ++SSL+ +AMELSGPR
Sbjct  587  STRSRGNELSSSERYSDLTDDSSLLAQAMELSGPR  621



>ref|XP_010681338.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Beta vulgaris 
subsp. vulgaris]
Length=627

 Score =   242 bits (617),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 137/155 (88%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A+DFG+ ANQKG +LDWVK ++QE KL 
Sbjct  473  IAPEYLSTGQSSEKTDVFGFGILLLELITGQRAIDFGKAANQKGAMLDWVKKINQEKKLE  532

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            ++VDKDLKNN+D +ELEE+VQVALLCTQF P+ RP+MSEV+RMLEGDGLAEKWEASQ  D
Sbjct  533  MLVDKDLKNNYDSIELEEIVQVALLCTQFLPNQRPRMSEVVRMLEGDGLAEKWEASQRAD  592

Query  371  TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
            + R R  E ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  593  STRSRVTEFSSSERYSDLTDDSSLLVQAMELSGPR  627



>ref|NP_001140727.1| uncharacterized LOC100272802 [Zea mays]
 gb|ACF84475.1| unknown [Zea mays]
 gb|ACR35282.1| unknown [Zea mays]
 gb|AFW80156.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=251

 Score =   231 bits (589),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 137/158 (87%), Gaps = 4/158 (3%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFG+LL+EL+TGQKA+DFGR ANQKG +LDWVK LHQE +L 
Sbjct  94   IAPEYLSTGQSSEKTDVFGFGVLLVELVTGQKALDFGRVANQKGGVLDWVKKLHQEKQLG  153

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGD-GLAEKWEASQXN  375
            +MVDKDL +++D VELEEMVQ+ALLCTQ++PSHRP+MSEV+RMLEG+ GLAE+WEASQ N
Sbjct  154  VMVDKDLGSSYDGVELEEMVQLALLCTQYHPSHRPRMSEVIRMLEGEPGLAERWEASQSN  213

Query  374  -DTPRFRTHENTPQRYSDF--IEESSLIVEAMELSGPR  270
             DTP+  + E  P +Y DF   +ESSL +EAMELSGPR
Sbjct  214  VDTPKSVSSELLPPKYVDFAAADESSLGLEAMELSGPR  251



>ref|XP_011020829.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Populus euphratica]
Length=622

 Score =   241 bits (616),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 137/155 (88%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELI+G +A++FG+  NQKG +LDWVK +HQE KL 
Sbjct  468  IAPEYLSTGQSSEKTDVFGFGILLLELISGLRALEFGKSTNQKGALLDWVKKIHQEKKLE  527

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            L+VDKDLKNN+DR+ELEE+VQVALLCTQ+ PSHRPKMSEV+RMLEGDGLAEKWEASQ  +
Sbjct  528  LLVDKDLKNNYDRIELEEIVQVALLCTQYLPSHRPKMSEVVRMLEGDGLAEKWEASQRAE  587

Query  371  TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
              R R +E ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  588  ETRSRANEFSSSERYSDLTDDSSLLVQAMELSGPR  622



>ref|XP_004507264.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Cicer arietinum]
Length=626

 Score =   241 bits (616),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 115/157 (73%), Positives = 138/157 (88%), Gaps = 3/157 (2%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITG +A++FG+ ANQKG +LDWVK +HQE KL 
Sbjct  470  IAPEYLSTGQSSEKTDVFGFGILLLELITGLRALEFGKAANQKGAMLDWVKKIHQEKKLE  529

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXN-  375
            L+VDKDLKNN+DR+EL+EMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLA+KWEASQ N 
Sbjct  530  LLVDKDLKNNYDRIELDEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLADKWEASQKNV  589

Query  374  -DTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
             +T + + HE ++  RYSD  ++SSL+++AMELSGPR
Sbjct  590  DNTTKCKQHELSSSDRYSDLTDDSSLLIQAMELSGPR  626



>ref|XP_008446507.1| PREDICTED: protein NSP-INTERACTING KINASE 1 isoform X1 [Cucumis 
melo]
Length=624

 Score =   241 bits (616),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 113/155 (73%), Positives = 137/155 (88%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFG+GILLLELITGQ+A++FG+  NQKG +LDWVK +HQE KL 
Sbjct  470  IAPEYLSTGQSSEKTDVFGYGILLLELITGQRALEFGKAVNQKGAMLDWVKKIHQEKKLE  529

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            L+VDKDL++N+DR+ELEEMVQVALLCTQ+ P+ RPKMSEV+RMLEGDGLAEKWEASQ  D
Sbjct  530  LLVDKDLRSNYDRIELEEMVQVALLCTQYLPTTRPKMSEVVRMLEGDGLAEKWEASQRAD  589

Query  371  TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
              R+R +E ++ +RYSD  ++SSL+ +AMELSGPR
Sbjct  590  ANRYRVNEFSSSERYSDLTDDSSLLAQAMELSGPR  624



>ref|XP_008446508.1| PREDICTED: protein NSP-INTERACTING KINASE 1 isoform X2 [Cucumis 
melo]
Length=622

 Score =   241 bits (616),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 113/155 (73%), Positives = 137/155 (88%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFG+GILLLELITGQ+A++FG+  NQKG +LDWVK +HQE KL 
Sbjct  468  IAPEYLSTGQSSEKTDVFGYGILLLELITGQRALEFGKAVNQKGAMLDWVKKIHQEKKLE  527

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            L+VDKDL++N+DR+ELEEMVQVALLCTQ+ P+ RPKMSEV+RMLEGDGLAEKWEASQ  D
Sbjct  528  LLVDKDLRSNYDRIELEEMVQVALLCTQYLPTTRPKMSEVVRMLEGDGLAEKWEASQRAD  587

Query  371  TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
              R+R +E ++ +RYSD  ++SSL+ +AMELSGPR
Sbjct  588  ANRYRVNEFSSSERYSDLTDDSSLLAQAMELSGPR  622



>tpg|DAA53257.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=428

 Score =   236 bits (603),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 134/155 (86%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFG+LL+ELITGQKA+DFGR ANQKG +LDWVK LHQE +L 
Sbjct  274  IAPEYLSTGQSSEKTDVFGFGVLLVELITGQKALDFGRVANQKGGVLDWVKKLHQEKQLG  333

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
             MVDKDL +++DRVELEEMVQV+LLCTQ++PSHRP+MSEV+RMLEGDGLAE+WEASQ  D
Sbjct  334  TMVDKDLGSSYDRVELEEMVQVSLLCTQYHPSHRPRMSEVIRMLEGDGLAERWEASQNVD  393

Query  371  TPRFRTHENTPQRYSDF-IEESSLIVEAMELSGPR  270
            TP   + E   Q+Y DF  +E SL +EAMELSGPR
Sbjct  394  TPESVSSELLLQKYMDFAADECSLGLEAMELSGPR  428



>ref|XP_003552626.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Glycine 
max]
 ref|XP_006602982.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Glycine 
max]
Length=623

 Score =   241 bits (616),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 136/155 (88%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ AN KG +LDWVK +HQE KL+
Sbjct  469  IAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKSANNKGAMLDWVKKIHQEKKLD  528

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            ++VDKDLKNN+DR+ELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAEKWEASQ  D
Sbjct  529  MLVDKDLKNNYDRIELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAEKWEASQRVD  588

Query  371  TPRFRTHENTPQ-RYSDFIEESSLIVEAMELSGPR  270
            T + +  E++   RYSD  ++S L+V+AMELSGPR
Sbjct  589  TTKCKPQESSSSDRYSDLTDDSLLLVQAMELSGPR  623



>gb|KHN13790.1| Protein NSP-INTERACTING KINASE 1 [Glycine soja]
Length=623

 Score =   241 bits (616),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 136/155 (88%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ AN KG +LDWVK +HQE KL+
Sbjct  469  IAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKSANNKGAMLDWVKKIHQEKKLD  528

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            ++VDKDLKNN+DR+ELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAEKWEASQ  D
Sbjct  529  MLVDKDLKNNYDRIELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAEKWEASQRVD  588

Query  371  TPRFRTHENTPQ-RYSDFIEESSLIVEAMELSGPR  270
            T + +  E++   RYSD  ++S L+V+AMELSGPR
Sbjct  589  TTKCKPQESSSSDRYSDLTDDSLLLVQAMELSGPR  623



>ref|XP_011009019.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Populus euphratica]
Length=622

 Score =   241 bits (616),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 137/155 (88%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELI+G +A++FG+  NQKG +LDWVK +HQE KL 
Sbjct  468  IAPEYLSTGQSSEKTDVFGFGILLLELISGLRALEFGKSTNQKGALLDWVKKIHQEKKLE  527

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            L+VDKDLKNN+DR+ELEE+VQVALLCTQ+ PSHRPKMSEV+RMLEGDGLAEKWEASQ  +
Sbjct  528  LLVDKDLKNNYDRIELEEIVQVALLCTQYLPSHRPKMSEVVRMLEGDGLAEKWEASQRAE  587

Query  371  TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
              R R +E ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  588  ETRSRANEFSSSERYSDLTDDSSLLVQAMELSGPR  622



>ref|XP_004238998.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Solanum lycopersicum]
Length=621

 Score =   241 bits (615),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 113/155 (73%), Positives = 140/155 (90%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSS+KTDVFGFGILLLELI+GQ+A++FG+ ANQKGV+LDWVK +H E KL+
Sbjct  467  IAPEYLSTGQSSDKTDVFGFGILLLELISGQRALEFGKAANQKGVMLDWVKKIHLEKKLD  526

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            L+V KDLK+ +DR+ELEEMVQVAL+CTQ++PSHRPKMSEV+RMLEGDGLAEKWEASQ  +
Sbjct  527  LLVSKDLKDKYDRIELEEMVQVALICTQYHPSHRPKMSEVVRMLEGDGLAEKWEASQRAE  586

Query  371  TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
            + R R +E ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  587  STRCRANEFSSSERYSDLTDDSSLLVQAMELSGPR  621



>ref|XP_006301740.1| hypothetical protein CARUB_v10022201mg [Capsella rubella]
 gb|EOA34638.1| hypothetical protein CARUB_v10022201mg [Capsella rubella]
Length=634

 Score =   241 bits (616),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 118/162 (73%), Positives = 136/162 (84%), Gaps = 8/162 (5%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ++QKGV+LDWVK LHQEGKL 
Sbjct  473  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRSSHQKGVMLDWVKKLHQEGKLK  532

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
             ++DKDL + FDRVELEE+VQVALLCTQFNPSHRPKMSEV++MLEGDGLAE+WEASQ  +
Sbjct  533  QLIDKDLSDKFDRVELEEIVQVALLCTQFNPSHRPKMSEVMKMLEGDGLAERWEASQTGN  592

Query  371  --------TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
                     P   +     + YSD+I+ESSL+VEA+ELSGPR
Sbjct  593  GDSQPPPLPPGMVSSSPRVRYYSDYIQESSLVVEAIELSGPR  634



>ref|XP_002886588.1| nsp-interacting kinase 3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62847.1| nsp-interacting kinase 3 [Arabidopsis lyrata subsp. lyrata]
Length=629

 Score =   241 bits (615),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 118/162 (73%), Positives = 135/162 (83%), Gaps = 8/162 (5%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR A+QKGV+LDWVK LHQEGKL 
Sbjct  468  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRSAHQKGVMLDWVKKLHQEGKLK  527

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
             ++DKDL + FDRVELEE+VQVALLCTQFNPSHRPKMSEV++MLEGDGLAE+WEA+Q   
Sbjct  528  QLIDKDLNDKFDRVELEEIVQVALLCTQFNPSHRPKMSEVMKMLEGDGLAERWEATQNGT  587

Query  371  T--------PRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
                     P   +     + YSD+I+ESSL+VEA+ELSGPR
Sbjct  588  AEHQPPPLPPGMVSSSPRVRYYSDYIQESSLVVEAIELSGPR  629



>gb|KJB43139.1| hypothetical protein B456_007G186300 [Gossypium raimondii]
Length=475

 Score =   237 bits (605),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/156 (72%), Positives = 137/156 (88%), Gaps = 2/156 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSS+KTDVFGFGILLLELITGQ+A++FG+ ANQKG +LDWV+ +H E KL 
Sbjct  320  IAPEYLSTGQSSDKTDVFGFGILLLELITGQRALEFGKAANQKGAMLDWVRKIHHEKKLE  379

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            ++VDKDLKNN+DR+ELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE+WEASQ  +
Sbjct  380  VLVDKDLKNNYDRIELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAERWEASQRAE  439

Query  371  TPRFR-THE-NTPQRYSDFIEESSLIVEAMELSGPR  270
            + + +  HE ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  440  STKCKPPHEFSSSDRYSDLTDDSSLLVQAMELSGPR  475



>gb|KJB80538.1| hypothetical protein B456_013G102600 [Gossypium raimondii]
Length=624

 Score =   241 bits (614),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 138/155 (89%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELI+G +A++FG+ ANQKG ILDWV+ +HQE KL+
Sbjct  470  IAPEYLSTGQSSEKTDVFGFGILLLELISGLRALEFGKTANQKGAILDWVRKVHQEKKLD  529

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            ++VDKDLKNN+DR+ELEEMVQVALLCTQ+ PS RPKMSEV+RMLEGDGLAEKWEASQ  +
Sbjct  530  MLVDKDLKNNYDRIELEEMVQVALLCTQYLPSQRPKMSEVVRMLEGDGLAEKWEASQKAE  589

Query  371  TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
              R R +E ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  590  ATRSRANEFSSSERYSDLTDDSSLLVQAMELSGPR  624



>ref|XP_004135130.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Cucumis sativus]
 ref|XP_004155284.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Cucumis sativus]
 gb|KGN52017.1| hypothetical protein Csa_5G608050 [Cucumis sativus]
Length=623

 Score =   241 bits (614),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 137/155 (88%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFG+GILLLELITGQ+A++FG+  NQKG +LDWVK +HQE KL 
Sbjct  469  IAPEYLSTGQSSEKTDVFGYGILLLELITGQRALEFGKAVNQKGAMLDWVKKIHQEKKLE  528

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            ++VDKDL++N+DR+ELEEMVQVALLCTQ+ P+ RPKMSEV+RMLEGDGLAEKWEASQ  D
Sbjct  529  ILVDKDLRSNYDRIELEEMVQVALLCTQYLPTTRPKMSEVVRMLEGDGLAEKWEASQRAD  588

Query  371  TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
              R+R +E ++ +RYSD  ++SSL+ +AMELSGPR
Sbjct  589  ANRYRVNEFSSSERYSDLTDDSSLLAQAMELSGPR  623



>gb|KHG05227.1| nsp-interacting kinase 2 -like protein [Gossypium arboreum]
Length=624

 Score =   241 bits (614),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 138/155 (89%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELI+G +A++FG+ ANQKG ILDWV+ +HQE KL+
Sbjct  470  IAPEYLSTGQSSEKTDVFGFGILLLELISGLRALEFGKTANQKGAILDWVRKVHQEKKLD  529

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            ++VDKDLKNN+DR+ELEEMVQVALLCTQ+ PS RPKMSEV+RMLEGDGLAEKWEASQ  +
Sbjct  530  MLVDKDLKNNYDRIELEEMVQVALLCTQYLPSQRPKMSEVVRMLEGDGLAEKWEASQKAE  589

Query  371  TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
              R R +E ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  590  ATRSRANEFSSSERYSDLTDDSSLLVQAMELSGPR  624



>gb|AAB71968.1| Putative Serine/Threonine protein kinase [Arabidopsis thaliana]
Length=588

 Score =   240 bits (612),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 118/162 (73%), Positives = 135/162 (83%), Gaps = 8/162 (5%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR A+QKGV+LDWVK LHQEGKL 
Sbjct  427  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRSAHQKGVMLDWVKKLHQEGKLK  486

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
             ++DKDL + FDRVELEE+VQVALLCTQFNPSHRPKMSEV++MLEGDGLAE+WEA+Q   
Sbjct  487  QLIDKDLNDKFDRVELEEIVQVALLCTQFNPSHRPKMSEVMKMLEGDGLAERWEATQNGT  546

Query  371  --------TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
                     P   +     + YSD+I+ESSL+VEA+ELSGPR
Sbjct  547  GEHQPPPLPPGMVSSSPRVRYYSDYIQESSLVVEAIELSGPR  588



>gb|KDO70180.1| hypothetical protein CISIN_1g007025mg [Citrus sinensis]
Length=552

 Score =   239 bits (609),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 136/155 (88%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELI+G +A++FG+ ANQKG +LDWVK +HQE KL 
Sbjct  398  IAPEYLSTGQSSEKTDVFGFGILLLELISGLRALEFGKTANQKGAMLDWVKKIHQEKKLE  457

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            ++VDKDLKNN+DR+ELEEMVQVALLCTQ+ PS RPKMSEV+RMLEGDGLAEKW ASQ  +
Sbjct  458  MLVDKDLKNNYDRIELEEMVQVALLCTQYLPSLRPKMSEVVRMLEGDGLAEKWAASQKAE  517

Query  371  TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
              R R +E ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  518  ATRSRANEFSSSERYSDLTDDSSLLVQAMELSGPR  552



>ref|XP_002311408.2| hypothetical protein POPTR_0008s10970g [Populus trichocarpa]
 gb|EEE88775.2| hypothetical protein POPTR_0008s10970g [Populus trichocarpa]
Length=622

 Score =   240 bits (613),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 137/155 (88%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELI+G +A++FG+  NQKG +LDWVK +HQE KL 
Sbjct  468  IAPEYLSTGQSSEKTDVFGFGILLLELISGLRALEFGKSTNQKGALLDWVKKIHQEKKLE  527

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            L+VDKDLKNN+DR+ELEE+VQVALLCTQ+ PSHRPKMSEV+RMLEGDGLAEKWEASQ  +
Sbjct  528  LLVDKDLKNNYDRIELEEIVQVALLCTQYLPSHRPKMSEVVRMLEGDGLAEKWEASQRAE  587

Query  371  TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
              + R +E ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  588  ETKSRANEFSSSERYSDLTDDSSLLVQAMELSGPR  622



>dbj|BAK02609.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=632

 Score =   240 bits (613),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 118/156 (76%), Positives = 137/156 (88%), Gaps = 2/156 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFG+LL+ELITGQKA+DFGR ANQKG +LD VK LHQE +LN
Sbjct  477  IAPEYLSTGQSSEKTDVFGFGVLLVELITGQKALDFGRLANQKGGVLDLVKKLHQEKQLN  536

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            +MVDKDL +N+DRVELEEMVQVALLCTQ+ PSHRP+MSEV+RMLEGDGLAEKWEASQ  D
Sbjct  537  MMVDKDLGSNYDRVELEEMVQVALLCTQYYPSHRPRMSEVIRMLEGDGLAEKWEASQNVD  596

Query  371  TPRFRTHENTPQRYSDF--IEESSLIVEAMELSGPR  270
            TP+  + E  P +++DF   +ESS+ +EAMELSGPR
Sbjct  597  TPKSVSSELLPLKFTDFAGADESSVGLEAMELSGPR  632



>gb|KEH17047.1| NSP-interacting kinase-like protein [Medicago truncatula]
Length=621

 Score =   240 bits (613),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 139/155 (90%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELI+GQ+A++FG+ ANQKG +LDWVK +HQE K++
Sbjct  467  IAPEYLSTGQSSEKTDVFGFGILLLELISGQRALEFGKAANQKGAMLDWVKKIHQEKKID  526

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            ++VDKDLKN +DR+EL+E+VQVALLCTQ+ PSHRPKMSEV+RMLEGDGLAEKWEASQ  +
Sbjct  527  VLVDKDLKNKYDRIELDEIVQVALLCTQYLPSHRPKMSEVVRMLEGDGLAEKWEASQRAE  586

Query  371  TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
            + R R +E ++ +RYSD  ++SSL+ +AMELSGPR
Sbjct  587  STRSRGNELSSSERYSDLTDDSSLLAQAMELSGPR  621



>ref|NP_176279.1| NSP-interacting kinase 3 [Arabidopsis thaliana]
 sp|Q93ZS4.1|NIK3_ARATH RecName: Full=Protein NSP-INTERACTING KINASE 3; AltName: Full=LRR 
receptor-like serine/threonine-protein kinase NIK3; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAL07143.1| putative receptor kinase [Arabidopsis thaliana]
 gb|AAN12912.1| putative receptor kinase [Arabidopsis thaliana]
 gb|ACN59261.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE33734.1| NSP-interacting kinase 3 [Arabidopsis thaliana]
Length=632

 Score =   240 bits (613),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 118/162 (73%), Positives = 135/162 (83%), Gaps = 8/162 (5%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR A+QKGV+LDWVK LHQEGKL 
Sbjct  471  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRSAHQKGVMLDWVKKLHQEGKLK  530

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
             ++DKDL + FDRVELEE+VQVALLCTQFNPSHRPKMSEV++MLEGDGLAE+WEA+Q   
Sbjct  531  QLIDKDLNDKFDRVELEEIVQVALLCTQFNPSHRPKMSEVMKMLEGDGLAERWEATQNGT  590

Query  371  --------TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
                     P   +     + YSD+I+ESSL+VEA+ELSGPR
Sbjct  591  GEHQPPPLPPGMVSSSPRVRYYSDYIQESSLVVEAIELSGPR  632



>gb|KDO70181.1| hypothetical protein CISIN_1g007025mg [Citrus sinensis]
Length=549

 Score =   238 bits (608),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 136/155 (88%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELI+G +A++FG+ ANQKG +LDWVK +HQE KL 
Sbjct  395  IAPEYLSTGQSSEKTDVFGFGILLLELISGLRALEFGKTANQKGAMLDWVKKIHQEKKLE  454

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            ++VDKDLKNN+DR+ELEEMVQVALLCTQ+ PS RPKMSEV+RMLEGDGLAEKW ASQ  +
Sbjct  455  MLVDKDLKNNYDRIELEEMVQVALLCTQYLPSLRPKMSEVVRMLEGDGLAEKWAASQKAE  514

Query  371  TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
              R R +E ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  515  ATRSRANEFSSSERYSDLTDDSSLLVQAMELSGPR  549



>ref|XP_008465988.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Cucumis melo]
Length=623

 Score =   240 bits (612),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 111/154 (72%), Positives = 135/154 (88%), Gaps = 0/154 (0%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELI+GQ+A++FG+ ANQKG ILDWVK +HQE KL 
Sbjct  470  IAPEYLSTGQSSEKTDVFGFGILLLELISGQRALEFGKAANQKGAILDWVKKIHQEKKLE  529

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            ++VDKDL++N+DR+ELEE+V+VALLC Q+ PSHRPKMSEV+RMLEGDGLAEKWEASQ  +
Sbjct  530  MLVDKDLRSNYDRIELEEIVRVALLCIQYLPSHRPKMSEVVRMLEGDGLAEKWEASQRAE  589

Query  371  TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
              R R +E + +RYSD  ++SSL  +A+ELSGPR
Sbjct  590  ASRSRANEFSSERYSDLTDDSSLFAQAIELSGPR  623



>ref|XP_009765506.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Nicotiana sylvestris]
Length=624

 Score =   240 bits (612),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 141/155 (91%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSS+KTDVFGFGILLLELI+GQ+A++FG+ ANQKG +LDWVK +HQE KL+
Sbjct  470  IAPEYLSTGQSSDKTDVFGFGILLLELISGQRALEFGKAANQKGAMLDWVKKIHQEKKLD  529

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            L+V+KDLK+N+DR+E+EE+VQVAL+CTQ++PS RPKMSEV+RMLEGDGLAEKWEASQ  +
Sbjct  530  LLVNKDLKDNYDRIEVEELVQVALICTQYHPSQRPKMSEVVRMLEGDGLAEKWEASQKAE  589

Query  371  TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
            + R R +E ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  590  STRCRANEFSSSERYSDLTDDSSLLVQAMELSGPR  624



>ref|XP_007139356.1| hypothetical protein PHAVU_008G022700g [Phaseolus vulgaris]
 ref|XP_007139357.1| hypothetical protein PHAVU_008G022700g [Phaseolus vulgaris]
 gb|ESW11350.1| hypothetical protein PHAVU_008G022700g [Phaseolus vulgaris]
 gb|ESW11351.1| hypothetical protein PHAVU_008G022700g [Phaseolus vulgaris]
Length=623

 Score =   239 bits (611),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 113/155 (73%), Positives = 136/155 (88%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ AN KG +LDWVK +HQE KL 
Sbjct  469  IAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKSANNKGAMLDWVKKIHQEKKLE  528

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            ++VDKDLK+N+DR+ELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE+WEASQ  D
Sbjct  529  ILVDKDLKSNYDRIELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAERWEASQRVD  588

Query  371  TPRFRTHENTPQ-RYSDFIEESSLIVEAMELSGPR  270
            T +++  E++   RYSD  ++S L+V+AMELSGPR
Sbjct  589  TTKYKPQESSSSDRYSDLTDDSLLLVQAMELSGPR  623



>ref|XP_007151443.1| hypothetical protein PHAVU_004G046800g [Phaseolus vulgaris]
 gb|ESW23437.1| hypothetical protein PHAVU_004G046800g [Phaseolus vulgaris]
Length=626

 Score =   239 bits (611),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 115/156 (74%), Positives = 137/156 (88%), Gaps = 2/156 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG +LDWV+ +HQE KL 
Sbjct  471  IAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAMLDWVRKIHQEKKLE  530

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            L+VDKDL NN+DR+ELEE+VQVALLCTQ+ P HRP+MSEV+RMLEGDGLAEKWEASQ  D
Sbjct  531  LLVDKDLMNNYDRIELEEIVQVALLCTQYLPGHRPRMSEVVRMLEGDGLAEKWEASQSAD  590

Query  371  TPRF-RTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
            T +  + HE ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  591  TTKCNKPHELSSSDRYSDLTDDSSLLVQAMELSGPR  626



>ref|XP_010032589.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Eucalyptus grandis]
 gb|KCW52001.1| hypothetical protein EUGRSUZ_J01441 [Eucalyptus grandis]
 gb|KCW52002.1| hypothetical protein EUGRSUZ_J01441 [Eucalyptus grandis]
Length=629

 Score =   239 bits (611),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 139/155 (90%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG +LDWVK +HQE KL 
Sbjct  475  IAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAMLDWVKKIHQEKKLE  534

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            ++VDKDL++N+DR+ELEE+VQVALLCTQ+ P+HRPKMSEV+RMLEGDGLAE+WEASQ  +
Sbjct  535  MLVDKDLRSNYDRIELEEIVQVALLCTQYLPAHRPKMSEVVRMLEGDGLAERWEASQRVE  594

Query  371  TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
            + + + HE ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  595  SNKGKPHEFSSSDRYSDLTDDSSLLVQAMELSGPR  629



>ref|XP_007033440.1| NSP-interacting kinase 1 [Theobroma cacao]
 gb|EOY04366.1| NSP-interacting kinase 1 [Theobroma cacao]
Length=649

 Score =   240 bits (612),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 113/155 (73%), Positives = 136/155 (88%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG +LDWV+ +HQE KL 
Sbjct  475  IAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAMLDWVRKIHQEKKLE  534

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
             +VDKDLK+N+DR+ELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE+WEASQ  +
Sbjct  535  GLVDKDLKSNYDRIELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAERWEASQRAE  594

Query  371  TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
              + + HE ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  595  ATKCKPHEFSSSDRYSDLTDDSSLLVQAMELSGPR  629



>ref|XP_010528022.1| PREDICTED: protein NSP-INTERACTING KINASE 2 [Tarenaya hassleriana]
Length=637

 Score =   240 bits (612),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 113/159 (71%), Positives = 138/159 (87%), Gaps = 5/159 (3%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELI+G +A++FG+ ANQKG +LDWVK +HQE KL 
Sbjct  479  IAPEYLSTGQSSEKTDVFGFGILLLELISGLRALEFGKAANQKGAMLDWVKKVHQEKKLE  538

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            L+VDKDLKNN+DR+E+EEMVQVALLCTQ+ PSHRPKMSEV+RMLEGDGLAEKWEASQ  +
Sbjct  539  LIVDKDLKNNYDRIEVEEMVQVALLCTQYLPSHRPKMSEVVRMLEGDGLAEKWEASQQRN  598

Query  371  TPRFRTHE-----NTPQRYSDFIEESSLIVEAMELSGPR  270
            +   R++      ++ +RYSD  ++S+L+V+AMELSGPR
Sbjct  599  SETHRSYSRPNEFSSSERYSDLTDDSTLLVQAMELSGPR  637



>ref|XP_011077619.1| PREDICTED: protein NSP-INTERACTING KINASE 2 [Sesamum indicum]
Length=648

 Score =   240 bits (612),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 136/155 (88%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG +LDWVK +HQE KL+
Sbjct  494  IAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAMLDWVKKIHQEKKLD  553

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            ++VDK+ +NN+D VELEEMVQVALLCTQF P HRPKMSEV+RMLEGDGLAEKWEASQ  +
Sbjct  554  VLVDKNFRNNYDPVELEEMVQVALLCTQFLPIHRPKMSEVVRMLEGDGLAEKWEASQRAE  613

Query  371  TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
              R R +E ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  614  ATRCRANEFSSSGRYSDLTDDSSLLVQAMELSGPR  648



>ref|XP_006348615.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Solanum tuberosum]
Length=621

 Score =   239 bits (611),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 140/155 (90%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSS+KTDVFGFGILLLELI+GQ+A++FG+ ANQKG++LDWVK +H E KL+
Sbjct  467  IAPEYLSTGQSSDKTDVFGFGILLLELISGQRALEFGKAANQKGIMLDWVKKIHLEKKLD  526

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            L+V KDLK+ +DR+ELEEMVQVAL+CTQ++PSHRPK+SEV+RMLEGDGLAEKWEASQ  +
Sbjct  527  LLVSKDLKDKYDRIELEEMVQVALICTQYHPSHRPKISEVVRMLEGDGLAEKWEASQRAE  586

Query  371  TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
            + R R +E ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  587  STRCRANEFSSSERYSDLTDDSSLLVQAMELSGPR  621



>emb|CDY44608.1| BnaCnng11570D [Brassica napus]
Length=507

 Score =   236 bits (603),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 132/154 (86%), Gaps = 5/154 (3%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ++QKGV+LDWVK LHQEGKL 
Sbjct  359  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRSSHQKGVMLDWVKKLHQEGKLK  418

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
             ++DKDL + +D VELEE+VQVALLCTQFNPS+RPKMSEV++MLEGDGLA++WEASQ   
Sbjct  419  QLIDKDLNDKYDTVELEEIVQVALLCTQFNPSNRPKMSEVMKMLEGDGLADRWEASQSGG  478

Query  371  TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
                      P  YSD+I+ESSL+VEA+ELSGPR
Sbjct  479  AKSL-----PPPYYSDYIQESSLVVEAIELSGPR  507



>emb|CDY61508.1| BnaCnng37930D [Brassica napus]
Length=507

 Score =   236 bits (603),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 132/154 (86%), Gaps = 5/154 (3%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ++QKGV+LDWVK LHQEGKL 
Sbjct  359  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRSSHQKGVMLDWVKKLHQEGKLK  418

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
             ++DKDL + +D VELEE+VQVALLCTQFNPS+RPKMSEV++MLEGDGLA++WEASQ   
Sbjct  419  QLIDKDLNDKYDTVELEEIVQVALLCTQFNPSNRPKMSEVMKMLEGDGLADRWEASQSGG  478

Query  371  TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
                      P  YSD+I+ESSL+VEA+ELSGPR
Sbjct  479  AKSL-----PPPYYSDYIQESSLVVEAIELSGPR  507



>ref|XP_010533910.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Tarenaya hassleriana]
Length=640

 Score =   239 bits (611),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 121/168 (72%), Positives = 137/168 (82%), Gaps = 14/168 (8%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ++QKGV+LDWVK LHQEGKLN
Sbjct  473  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRSSHQKGVMLDWVKKLHQEGKLN  532

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
             +VDKDLK  FDRVELEE+VQVALLCTQFNP HRPKMSEVL+MLEGDGLAE+WEASQ   
Sbjct  533  QIVDKDLKGKFDRVELEEIVQVALLCTQFNPLHRPKMSEVLKMLEGDGLAERWEASQSQS  592

Query  371  TP--------RFRTH------ENTPQRYSDFIEESSLIVEAMELSGPR  270
                      R R+        + P  YS++I++SSL+VEA+ELSGPR
Sbjct  593  QNRNAEQMLMRLRSRSWCEPSSSPPVMYSEYIQDSSLVVEAIELSGPR  640



>ref|XP_002305306.2| hypothetical protein POPTR_0004s10790g [Populus trichocarpa]
 gb|EEE85817.2| hypothetical protein POPTR_0004s10790g [Populus trichocarpa]
Length=627

 Score =   239 bits (610),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 113/155 (73%), Positives = 136/155 (88%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG +LDWVK +HQE KL 
Sbjct  473  IAPEYLSTGQSSEKTDVFGFGILLLELITGQRAIEFGKAANQKGAMLDWVKKIHQEKKLE  532

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            ++VDKD+K N+DR+ELEEMVQVALL TQ+ PSHRPKMSEV+RMLEGDGLAE+WEASQ  +
Sbjct  533  MLVDKDIKGNYDRIELEEMVQVALLSTQYLPSHRPKMSEVVRMLEGDGLAERWEASQRAE  592

Query  371  TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
              + + HE ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  593  ATKSKPHEFSSSDRYSDLTDDSSLLVQAMELSGPR  627



>ref|XP_011011496.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Populus euphratica]
Length=622

 Score =   239 bits (610),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 136/155 (88%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELI+G +A++FG+  NQKG +LDWVK +HQE KL 
Sbjct  468  IAPEYLSTGQSSEKTDVFGFGILLLELISGLRALEFGKSTNQKGALLDWVKKIHQEKKLE  527

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            L+VDKDLKNN+DR+ELEE+VQVALLC Q+ PSHRPKMSEV+RMLEGDGLAEKWEASQ  +
Sbjct  528  LLVDKDLKNNYDRIELEEIVQVALLCIQYLPSHRPKMSEVVRMLEGDGLAEKWEASQRAE  587

Query  371  TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
              R R +E ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  588  ETRSRANEFSSSERYSDMTDDSSLLVQAMELSGPR  622



>ref|XP_006384231.1| hypothetical protein POPTR_0004s10790g [Populus trichocarpa]
 gb|ERP62028.1| hypothetical protein POPTR_0004s10790g [Populus trichocarpa]
Length=626

 Score =   239 bits (610),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 113/155 (73%), Positives = 136/155 (88%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG +LDWVK +HQE KL 
Sbjct  472  IAPEYLSTGQSSEKTDVFGFGILLLELITGQRAIEFGKAANQKGAMLDWVKKIHQEKKLE  531

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            ++VDKD+K N+DR+ELEEMVQVALL TQ+ PSHRPKMSEV+RMLEGDGLAE+WEASQ  +
Sbjct  532  MLVDKDIKGNYDRIELEEMVQVALLSTQYLPSHRPKMSEVVRMLEGDGLAERWEASQRAE  591

Query  371  TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
              + + HE ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  592  ATKSKPHEFSSSDRYSDLTDDSSLLVQAMELSGPR  626



>ref|XP_009378313.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Pyrus x bretschneideri]
Length=636

 Score =   239 bits (610),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 113/155 (73%), Positives = 136/155 (88%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ +NQKG ILDWVK +HQE KL 
Sbjct  482  IAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKASNQKGAILDWVKRIHQEKKLE  541

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            ++VDKDLK N+DR+ELEEMVQVALLCTQ+ PSHRPKMSEV+RMLEGDGL E+WEASQ  +
Sbjct  542  MLVDKDLKTNYDRIELEEMVQVALLCTQYLPSHRPKMSEVVRMLEGDGLVERWEASQKAE  601

Query  371  TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
            + + +  E ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  602  STKSKAPEFSSSDRYSDLTDDSSLLVQAMELSGPR  636



>ref|XP_010942232.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Elaeis guineensis]
Length=624

 Score =   239 bits (609),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 138/155 (89%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITG +AV+FG+ ANQKG +LDWVK +HQE KL+
Sbjct  470  IAPEYLSTGQSSEKTDVFGFGILLLELITGLRAVEFGKAANQKGAMLDWVKKIHQEKKLD  529

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            ++VDKDLK+++DR+ELEE V+VALLCTQ+ P HRPKMSEV+RMLEGDGLAE+WEASQ  +
Sbjct  530  MLVDKDLKSDYDRIELEETVRVALLCTQYLPGHRPKMSEVVRMLEGDGLAERWEASQRVE  589

Query  371  TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
             P+F+  E ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  590  APKFKMPEVSSSERYSDLTDDSSLLVQAMELSGPR  624



>ref|XP_008379484.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Malus domestica]
Length=625

 Score =   239 bits (609),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/155 (73%), Positives = 135/155 (87%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG ILDWVK +H E KL 
Sbjct  471  IAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAILDWVKRIHHEKKLE  530

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            ++VDKDLK N+DR+ELEEMVQVALLCTQ+ PSHRPKMSEV+RMLEGDGL E+WEASQ  +
Sbjct  531  MLVDKDLKTNYDRIELEEMVQVALLCTQYLPSHRPKMSEVVRMLEGDGLVERWEASQKAE  590

Query  371  TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
            + + +  E ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  591  SAKSKAPEFSSSDRYSDLTDDSSLLVQAMELSGPR  625



>gb|ABG73621.1| leucine-rich repeat receptor-like kinase [Populus tomentosa]
Length=622

 Score =   238 bits (608),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 136/155 (88%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELI+G +A++FG+  NQKG +LDWVK +H E KL 
Sbjct  468  IAPEYLSTGQSSEKTDVFGFGILLLELISGLRALEFGKSTNQKGALLDWVKKIHLEKKLE  527

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            L+VDKDLKNN+DR+ELEE+VQVALLCTQ+ PSHRPKMSEV+RMLEGDGLAEKWEASQ  +
Sbjct  528  LLVDKDLKNNYDRIELEEIVQVALLCTQYLPSHRPKMSEVVRMLEGDGLAEKWEASQRAE  587

Query  371  TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
              R R +E ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  588  ESRSRANEFSSSERYSDLTDDSSLLVQAMELSGPR  622



>ref|XP_006437790.1| hypothetical protein CICLE_v10030970mg [Citrus clementina]
 gb|ESR51030.1| hypothetical protein CICLE_v10030970mg [Citrus clementina]
Length=621

 Score =   238 bits (607),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 136/155 (88%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELI+G +A++FG+ ANQKG +LDWVK +HQE KL 
Sbjct  467  IAPEYLSTGQSSEKTDVFGFGILLLELISGLRALEFGKTANQKGAMLDWVKKIHQEKKLE  526

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            ++VDKDLKNN+DR+ELEEMVQVALLCTQ+ PS RPKMSEV+RMLEGDGLAEKW ASQ  +
Sbjct  527  MLVDKDLKNNYDRIELEEMVQVALLCTQYLPSLRPKMSEVVRMLEGDGLAEKWAASQKAE  586

Query  371  TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
              R R +E ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  587  ATRSRANEFSSSERYSDLTDDSSLLVQAMELSGPR  621



>ref|XP_010418025.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Camelina 
sativa]
Length=633

 Score =   238 bits (607),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 116/162 (72%), Positives = 135/162 (83%), Gaps = 8/162 (5%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ++QKGV+LDWVK LHQEGKL 
Sbjct  472  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRSSHQKGVMLDWVKKLHQEGKLK  531

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
             ++DK+L + FDRVELEE+VQVALLCTQFNPSHRPKMSEV++MLEGDGLAE+WEA+Q   
Sbjct  532  QLIDKELNDKFDRVELEEIVQVALLCTQFNPSHRPKMSEVMKMLEGDGLAERWEATQNGT  591

Query  371  --------TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
                     P   +     + YSD+I+ESSL+VEA+ELSGPR
Sbjct  592  GESQPPPLPPGMMSSSPRVRYYSDYIQESSLVVEAIELSGPR  633



>ref|XP_006484307.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Citrus sinensis]
 gb|KDO70177.1| hypothetical protein CISIN_1g007025mg [Citrus sinensis]
Length=621

 Score =   238 bits (606),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 136/155 (88%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELI+G +A++FG+ ANQKG +LDWVK +HQE KL 
Sbjct  467  IAPEYLSTGQSSEKTDVFGFGILLLELISGLRALEFGKTANQKGAMLDWVKKIHQEKKLE  526

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            ++VDKDLKNN+DR+ELEEMVQVALLCTQ+ PS RPKMSEV+RMLEGDGLAEKW ASQ  +
Sbjct  527  MLVDKDLKNNYDRIELEEMVQVALLCTQYLPSLRPKMSEVVRMLEGDGLAEKWAASQKAE  586

Query  371  TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
              R R +E ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  587  ATRSRANEFSSSERYSDLTDDSSLLVQAMELSGPR  621



>ref|XP_010418023.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Camelina 
sativa]
Length=636

 Score =   238 bits (607),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 116/162 (72%), Positives = 135/162 (83%), Gaps = 8/162 (5%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ++QKGV+LDWVK LHQEGKL 
Sbjct  475  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRSSHQKGVMLDWVKKLHQEGKLK  534

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
             ++DK+L + FDRVELEE+VQVALLCTQFNPSHRPKMSEV++MLEGDGLAE+WEA+Q   
Sbjct  535  QLIDKELNDKFDRVELEEIVQVALLCTQFNPSHRPKMSEVMKMLEGDGLAERWEATQNGT  594

Query  371  --------TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
                     P   +     + YSD+I+ESSL+VEA+ELSGPR
Sbjct  595  GESQPPPLPPGMMSSSPRVRYYSDYIQESSLVVEAIELSGPR  636



>ref|XP_011012714.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Populus 
euphratica]
Length=627

 Score =   238 bits (606),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 136/155 (88%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG +LDWVK +HQE KL 
Sbjct  473  IAPEYLSTGQSSEKTDVFGFGILLLELITGQRAIEFGKAANQKGAMLDWVKKIHQEKKLE  532

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            ++VDKD+K N+DR+ELEEMVQVALL TQ+ P+HRPKMSEV+RMLEGDGLAE+WEASQ  +
Sbjct  533  MLVDKDIKGNYDRIELEEMVQVALLSTQYLPNHRPKMSEVVRMLEGDGLAERWEASQRAE  592

Query  371  TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
              + + HE ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  593  ATKSKPHEFSSSDRYSDLTDDSSLLVQAMELSGPR  627



>emb|CDP02372.1| unnamed protein product [Coffea canephora]
Length=624

 Score =   238 bits (606),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 110/155 (71%), Positives = 137/155 (88%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++F + ANQKG +LDWVK +HQE KL+
Sbjct  470  IAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFNKAANQKGAMLDWVKRIHQEKKLD  529

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            ++VDKDL+NN+D +E+EEMVQVALLCTQ+ PSHRPKMSEV++MLEGDGLAE+WE SQ  +
Sbjct  530  ILVDKDLRNNYDCIEVEEMVQVALLCTQYLPSHRPKMSEVIQMLEGDGLAERWEVSQRLE  589

Query  371  TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
            + ++RT E +  +RYSD  ++SSL+ +AMELSGPR
Sbjct  590  SSKYRTQELSASERYSDLTDDSSLLAQAMELSGPR  624



>ref|XP_011012715.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Populus 
euphratica]
Length=626

 Score =   238 bits (606),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 136/155 (88%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG +LDWVK +HQE KL 
Sbjct  472  IAPEYLSTGQSSEKTDVFGFGILLLELITGQRAIEFGKAANQKGAMLDWVKKIHQEKKLE  531

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            ++VDKD+K N+DR+ELEEMVQVALL TQ+ P+HRPKMSEV+RMLEGDGLAE+WEASQ  +
Sbjct  532  MLVDKDIKGNYDRIELEEMVQVALLSTQYLPNHRPKMSEVVRMLEGDGLAERWEASQRAE  591

Query  371  TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
              + + HE ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  592  ATKSKPHEFSSSDRYSDLTDDSSLLVQAMELSGPR  626



>gb|KHN14464.1| Protein NSP-INTERACTING KINASE 1 [Glycine soja]
Length=623

 Score =   238 bits (606),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 113/155 (73%), Positives = 135/155 (87%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ AN KG +LDWVK +HQE KL 
Sbjct  469  IAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKSANNKGAMLDWVKKIHQEKKLE  528

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            ++VDKDLK+N+DR+ELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE+WEASQ  D
Sbjct  529  MLVDKDLKSNYDRIELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAERWEASQRVD  588

Query  371  TPRFRTHENTPQ-RYSDFIEESSLIVEAMELSGPR  270
            T + +  E++   RYSD  ++S L+V+AMELSGPR
Sbjct  589  TTKCKPQESSSSDRYSDLTDDSLLLVQAMELSGPR  623



>ref|XP_010510907.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X2 [Camelina 
sativa]
Length=633

 Score =   238 bits (606),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 116/162 (72%), Positives = 135/162 (83%), Gaps = 8/162 (5%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ++QKGV+LDWVK LHQEGKL 
Sbjct  472  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRSSHQKGVMLDWVKKLHQEGKLK  531

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
             ++DK+L + FDRVELEE+VQVALLCTQFNPSHRPKMSEV++MLEGDGLAE+WEA+Q   
Sbjct  532  QLIDKELNDKFDRVELEEIVQVALLCTQFNPSHRPKMSEVMKMLEGDGLAERWEATQNGT  591

Query  371  --------TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
                     P   +     + YSD+I+ESSL+VEA+ELSGPR
Sbjct  592  GESQPPPLPPGMMSSSPRVRYYSDYIQESSLVVEAIELSGPR  633



>emb|CBI16897.3| unnamed protein product [Vitis vinifera]
Length=622

 Score =   237 bits (605),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 137/155 (88%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG +LDWVK +HQE +L 
Sbjct  468  IAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAMLDWVKKIHQEKRLE  527

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            ++VDKDLK+ +DRVELEEMVQVALLCTQ+ P HRPKMSEV++MLEGDGLAE+WEASQ  +
Sbjct  528  ILVDKDLKHFYDRVELEEMVQVALLCTQYLPGHRPKMSEVVQMLEGDGLAERWEASQRGE  587

Query  371  TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
              + + HE ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  588  VTKCKPHELSSSERYSDLTDDSSLLVQAMELSGPR  622



>ref|XP_010510906.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X1 [Camelina 
sativa]
Length=636

 Score =   238 bits (606),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 116/162 (72%), Positives = 135/162 (83%), Gaps = 8/162 (5%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ++QKGV+LDWVK LHQEGKL 
Sbjct  475  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRSSHQKGVMLDWVKKLHQEGKLK  534

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
             ++DK+L + FDRVELEE+VQVALLCTQFNPSHRPKMSEV++MLEGDGLAE+WEA+Q   
Sbjct  535  QLIDKELNDKFDRVELEEIVQVALLCTQFNPSHRPKMSEVMKMLEGDGLAERWEATQNGT  594

Query  371  --------TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
                     P   +     + YSD+I+ESSL+VEA+ELSGPR
Sbjct  595  GESQPPPLPPGMMSSSPRVRYYSDYIQESSLVVEAIELSGPR  636



>ref|XP_002278965.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Vitis vinifera]
Length=624

 Score =   237 bits (605),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 137/155 (88%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG +LDWVK +HQE +L 
Sbjct  470  IAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAMLDWVKKIHQEKRLE  529

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            ++VDKDLK+ +DRVELEEMVQVALLCTQ+ P HRPKMSEV++MLEGDGLAE+WEASQ  +
Sbjct  530  ILVDKDLKHFYDRVELEEMVQVALLCTQYLPGHRPKMSEVVQMLEGDGLAERWEASQRGE  589

Query  371  TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
              + + HE ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  590  VTKCKPHELSSSERYSDLTDDSSLLVQAMELSGPR  624



>ref|XP_004149504.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Cucumis sativus]
 ref|XP_004164846.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Cucumis sativus]
Length=623

 Score =   237 bits (604),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 137/155 (88%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELI+GQ+A++FG+ ANQKG ILDWVK +HQE KL 
Sbjct  469  IAPEYLSTGQSSEKTDVFGFGILLLELISGQRALEFGKAANQKGAILDWVKKIHQEKKLE  528

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            ++VDKDL++N+DR+ELEE+V+VALLC Q+ PSHRPKMSEV+RMLEGDGLAEKWEASQ  +
Sbjct  529  MLVDKDLRSNYDRIELEEIVRVALLCIQYLPSHRPKMSEVVRMLEGDGLAEKWEASQRAE  588

Query  371  TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
              R R +E ++ +RYSD  ++SSL V+A++LSGPR
Sbjct  589  ASRSRANEFSSSERYSDLTDDSSLFVQAIQLSGPR  623



>ref|XP_006392114.1| hypothetical protein EUTSA_v10023342mg [Eutrema salsugineum]
 gb|ESQ29400.1| hypothetical protein EUTSA_v10023342mg [Eutrema salsugineum]
Length=634

 Score =   236 bits (603),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 119/169 (70%), Positives = 136/169 (80%), Gaps = 22/169 (13%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ++QKGV+LDWVK LHQEGKL 
Sbjct  473  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRSSHQKGVMLDWVKKLHQEGKLK  532

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQ---  381
             ++DKDL + FDRVELEE+VQVALLCTQFNPS RPKMSEV++MLEGDGLAE+WEASQ   
Sbjct  533  QLIDKDLNDKFDRVELEEIVQVALLCTQFNPSFRPKMSEVMKMLEGDGLAERWEASQNGA  592

Query  380  ------------XNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
                         + +PR R        YSD+I+ESSL+VEA+ELSGPR
Sbjct  593  AESLPPPLPSGMVSSSPRVR-------YYSDYIQESSLVVEAIELSGPR  634



>ref|XP_003531900.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Glycine max]
Length=623

 Score =   236 bits (602),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 134/155 (86%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ AN KG +LDWVK +HQE KL 
Sbjct  469  IAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKSANNKGAMLDWVKKIHQEKKLE  528

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            ++VDKDLK+N+DR+E EEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE+WEASQ  D
Sbjct  529  MLVDKDLKSNYDRIEFEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAERWEASQRVD  588

Query  371  TPRFRTHENTPQ-RYSDFIEESSLIVEAMELSGPR  270
            T + +  E++   RYSD  ++S L+V+AMELSGPR
Sbjct  589  TTKCKPQESSSSDRYSDLTDDSLLLVQAMELSGPR  623



>ref|XP_011099082.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Sesamum 
indicum]
Length=627

 Score =   236 bits (602),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 113/155 (73%), Positives = 135/155 (87%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A+ FG+ ANQKG +LDWVK LHQE KL 
Sbjct  473  IAPEYLSTGQSSEKTDVFGFGILLLELITGQRALQFGKSANQKGAVLDWVKKLHQEKKLE  532

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
             +VDKDLKNN+DR+ELEEMVQVALLCTQ+ P  RPKMSEV+RMLEGDGLAE+WEASQ  +
Sbjct  533  DLVDKDLKNNYDRIELEEMVQVALLCTQYLPGLRPKMSEVVRMLEGDGLAERWEASQRLE  592

Query  371  TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
            + + +T E ++ +RYSD  ++SSL+ +A+ELSGPR
Sbjct  593  SNKLKTQELSSSERYSDLTDDSSLLAQAIELSGPR  627



>ref|XP_008341829.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Malus domestica]
Length=636

 Score =   236 bits (602),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 134/155 (86%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG ILDWVK +HQE  L 
Sbjct  482  IAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAILDWVKKIHQEKTLE  541

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            ++VDKDLK N+DR+ELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGL E+WEASQ  +
Sbjct  542  MLVDKDLKTNYDRIELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLVERWEASQKVE  601

Query  371  TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
            + + +  E ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  602  STKSKAPEFSSSDRYSDLTDDSSLLVQAMELSGPR  636



>gb|KJB43138.1| hypothetical protein B456_007G186300 [Gossypium raimondii]
Length=625

 Score =   236 bits (602),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 112/156 (72%), Positives = 137/156 (88%), Gaps = 2/156 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSS+KTDVFGFGILLLELITGQ+A++FG+ ANQKG +LDWV+ +H E KL 
Sbjct  470  IAPEYLSTGQSSDKTDVFGFGILLLELITGQRALEFGKAANQKGAMLDWVRKIHHEKKLE  529

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            ++VDKDLKNN+DR+ELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE+WEASQ  +
Sbjct  530  VLVDKDLKNNYDRIELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAERWEASQRAE  589

Query  371  TPRFR-THE-NTPQRYSDFIEESSLIVEAMELSGPR  270
            + + +  HE ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  590  STKCKPPHEFSSSDRYSDLTDDSSLLVQAMELSGPR  625



>ref|XP_010473260.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Camelina 
sativa]
Length=633

 Score =   236 bits (602),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 115/162 (71%), Positives = 134/162 (83%), Gaps = 8/162 (5%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ++QKGV+LDWV  LHQEGKL 
Sbjct  472  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRSSHQKGVMLDWVTKLHQEGKLK  531

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
             ++DK+L + FDRVELEE+VQVALLCTQFNPSHRPKMSEV++MLEGDGLAE+WEA+Q   
Sbjct  532  QLIDKELNDKFDRVELEEIVQVALLCTQFNPSHRPKMSEVMKMLEGDGLAERWEATQNGT  591

Query  371  --------TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
                     P   +     + YSD+I+ESSL+VEA+ELSGPR
Sbjct  592  GESQPPPLPPGMMSSSPRVRYYSDYIQESSLVVEAIELSGPR  633



>ref|XP_010473259.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Camelina 
sativa]
Length=636

 Score =   236 bits (602),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 115/162 (71%), Positives = 134/162 (83%), Gaps = 8/162 (5%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ++QKGV+LDWV  LHQEGKL 
Sbjct  475  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRSSHQKGVMLDWVTKLHQEGKLK  534

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
             ++DK+L + FDRVELEE+VQVALLCTQFNPSHRPKMSEV++MLEGDGLAE+WEA+Q   
Sbjct  535  QLIDKELNDKFDRVELEEIVQVALLCTQFNPSHRPKMSEVMKMLEGDGLAERWEATQNGT  594

Query  371  --------TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
                     P   +     + YSD+I+ESSL+VEA+ELSGPR
Sbjct  595  GESQPPPLPPGMMSSSPRVRYYSDYIQESSLVVEAIELSGPR  636



>ref|XP_011099081.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Sesamum 
indicum]
Length=631

 Score =   236 bits (602),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 113/155 (73%), Positives = 135/155 (87%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A+ FG+ ANQKG +LDWVK LHQE KL 
Sbjct  477  IAPEYLSTGQSSEKTDVFGFGILLLELITGQRALQFGKSANQKGAVLDWVKKLHQEKKLE  536

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
             +VDKDLKNN+DR+ELEEMVQVALLCTQ+ P  RPKMSEV+RMLEGDGLAE+WEASQ  +
Sbjct  537  DLVDKDLKNNYDRIELEEMVQVALLCTQYLPGLRPKMSEVVRMLEGDGLAERWEASQRLE  596

Query  371  TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
            + + +T E ++ +RYSD  ++SSL+ +A+ELSGPR
Sbjct  597  SNKLKTQELSSSERYSDLTDDSSLLAQAIELSGPR  631



>ref|XP_010230510.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X3 [Brachypodium 
distachyon]
Length=603

 Score =   235 bits (600),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 116/156 (74%), Positives = 135/156 (87%), Gaps = 2/156 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFG+LL+ELITGQKA+DFGR ANQKG +LD VK LH E +L+
Sbjct  448  IAPEYLSTGQSSEKTDVFGFGVLLVELITGQKALDFGRLANQKGGVLDMVKKLHHEKQLS  507

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            +MVDKDL +N+DRVELEEMVQVALLCTQ++PSHRP+MSEV+RMLEGDGLAEKWEASQ  D
Sbjct  508  MMVDKDLGSNYDRVELEEMVQVALLCTQYHPSHRPRMSEVIRMLEGDGLAEKWEASQNVD  567

Query  371  TPRFRTHENTPQRYSDF--IEESSLIVEAMELSGPR  270
            TP+  + E  P ++ D    +ESSL +EAMELSGPR
Sbjct  568  TPKSVSSELIPPKFMDLAAADESSLGLEAMELSGPR  603



>ref|XP_010230511.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X4 [Brachypodium 
distachyon]
Length=601

 Score =   235 bits (600),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 116/156 (74%), Positives = 135/156 (87%), Gaps = 2/156 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFG+LL+ELITGQKA+DFGR ANQKG +LD VK LH E +L+
Sbjct  446  IAPEYLSTGQSSEKTDVFGFGVLLVELITGQKALDFGRLANQKGGVLDMVKKLHHEKQLS  505

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            +MVDKDL +N+DRVELEEMVQVALLCTQ++PSHRP+MSEV+RMLEGDGLAEKWEASQ  D
Sbjct  506  MMVDKDLGSNYDRVELEEMVQVALLCTQYHPSHRPRMSEVIRMLEGDGLAEKWEASQNVD  565

Query  371  TPRFRTHENTPQRYSDF--IEESSLIVEAMELSGPR  270
            TP+  + E  P ++ D    +ESSL +EAMELSGPR
Sbjct  566  TPKSVSSELIPPKFMDLAAADESSLGLEAMELSGPR  601



>ref|NP_001169689.1| LOC100383570 precursor [Zea mays]
 gb|ACN34528.1| unknown [Zea mays]
 tpg|DAA53256.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=634

 Score =   236 bits (601),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 134/155 (86%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFG+LL+ELITGQKA+DFGR ANQKG +LDWVK LHQE +L 
Sbjct  480  IAPEYLSTGQSSEKTDVFGFGVLLVELITGQKALDFGRVANQKGGVLDWVKKLHQEKQLG  539

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
             MVDKDL +++DRVELEEMVQV+LLCTQ++PSHRP+MSEV+RMLEGDGLAE+WEASQ  D
Sbjct  540  TMVDKDLGSSYDRVELEEMVQVSLLCTQYHPSHRPRMSEVIRMLEGDGLAERWEASQNVD  599

Query  371  TPRFRTHENTPQRYSDF-IEESSLIVEAMELSGPR  270
            TP   + E   Q+Y DF  +E SL +EAMELSGPR
Sbjct  600  TPESVSSELLLQKYMDFAADECSLGLEAMELSGPR  634



>ref|XP_008459453.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Cucumis melo]
Length=626

 Score =   236 bits (601),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 113/155 (73%), Positives = 135/155 (87%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG ILDWVK +H E KL 
Sbjct  472  IAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGGILDWVKRIHLEKKLE  531

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            ++VDKDLK N+DRVELEEMVQVALLCTQ+ P HRPKMSEV+RMLEG+GLA +WEASQ  D
Sbjct  532  VLVDKDLKANYDRVELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGEGLAVRWEASQRVD  591

Query  371  TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
            + + + H+ ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  592  STKCKPHDFSSSDRYSDLTDDSSLLVQAMELSGPR  626



>ref|XP_008230341.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Prunus mume]
Length=623

 Score =   236 bits (601),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 134/155 (86%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+  NQKG ILDWVK +HQE KL 
Sbjct  469  IAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKATNQKGAILDWVKKIHQEKKLE  528

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            ++VDKDLK N+DR+ELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGL E+WEASQ  +
Sbjct  529  VLVDKDLKTNYDRIELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLVERWEASQRVE  588

Query  371  TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
            + + +  E ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  589  STKSKAPEFSSSDRYSDLTDDSSLLVQAMELSGPR  623



>ref|XP_009803320.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Nicotiana 
sylvestris]
Length=625

 Score =   236 bits (601),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/156 (71%), Positives = 139/156 (89%), Gaps = 2/156 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITG +A++FG+ ANQKG +LDWVK +HQE KL+
Sbjct  470  IAPEYLSTGQSSEKTDVFGFGILLLELITGMRAIEFGKAANQKGAMLDWVKKIHQEKKLD  529

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            ++VDKDLK+N+DR+ELEEMVQVALLCTQ+ P HRPKMSE++RMLEGDGLAE+WEASQ  D
Sbjct  530  ILVDKDLKSNYDRIELEEMVQVALLCTQYLPGHRPKMSEIVRMLEGDGLAERWEASQKFD  589

Query  371  -TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
             + +++T E ++ +R+SD  ++S L+V+AMELSGPR
Sbjct  590  GSNKYKTKELSSSERFSDLTDDSLLLVQAMELSGPR  625



>ref|XP_009104018.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X1 [Brassica 
rapa]
Length=636

 Score =   236 bits (601),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 117/169 (69%), Positives = 137/169 (81%), Gaps = 22/169 (13%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ++QKGV+LDWVK LHQEGKL 
Sbjct  475  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRSSHQKGVMLDWVKKLHQEGKLK  534

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQX--  378
             ++DKDL + +DRVELEE+VQVALLCTQFNPS+RPKMSEV++MLEGDGLA++WEASQ   
Sbjct  535  QLIDKDLNDKYDRVELEEIVQVALLCTQFNPSNRPKMSEVMKMLEGDGLADRWEASQSGG  594

Query  377  -------------NDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
                         + +PR R        YSD+I+ESSL+VEA+ELSGPR
Sbjct  595  AKSLPPPLPSGMVSSSPRVR-------YYSDYIQESSLVVEAIELSGPR  636



>gb|KEH25223.1| NSP-interacting kinase-like protein [Medicago truncatula]
Length=625

 Score =   235 bits (600),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 114/156 (73%), Positives = 139/156 (89%), Gaps = 2/156 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITG +A++FG+ ANQKGV+LDWVK +HQE KL+
Sbjct  470  IAPEYLSTGQSSEKTDVFGFGILLLELITGLRALEFGKAANQKGVMLDWVKKIHQEKKLD  529

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            L+VDKDLKNN+D+ ELEE+VQVALLCTQ+ P+HRPKMSEV+RMLEGDGLAEKWEASQ  D
Sbjct  530  LLVDKDLKNNYDKNELEEIVQVALLCTQYLPAHRPKMSEVVRMLEGDGLAEKWEASQRAD  589

Query  371  -TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
             T + + +E ++  R+SD  ++SSL+++AMELSGPR
Sbjct  590  NTTKGKPYELSSSDRFSDLTDDSSLLIQAMELSGPR  625



>ref|XP_006373507.1| hypothetical protein POPTR_0017s14360g [Populus trichocarpa]
 gb|ERP51304.1| hypothetical protein POPTR_0017s14360g [Populus trichocarpa]
Length=596

 Score =   235 bits (599),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 134/155 (86%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSS+KTDVFGFGILLLELITGQ+A++FG+ ANQKG +LDWVK +HQE KL 
Sbjct  442  IAPEYLSTGQSSDKTDVFGFGILLLELITGQRALEFGKAANQKGAMLDWVKKIHQEKKLE  501

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            ++VDKDLK N+DR+ELEEMVQVALLCTQ+ PS RPKM EV++MLEGDGLAE WEASQ  +
Sbjct  502  MLVDKDLKGNYDRIELEEMVQVALLCTQYLPSQRPKMYEVVKMLEGDGLAESWEASQRAE  561

Query  371  TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
              + + HE ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  562  ATKSKPHEFSSSDRYSDLTDDSSLLVQAMELSGPR  596



>ref|XP_010929457.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Elaeis guineensis]
Length=624

 Score =   235 bits (600),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 137/155 (88%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGIL+LELITG +A++FG+ ANQKG +LDWVK +HQE KL+
Sbjct  470  IAPEYLSTGQSSEKTDVFGFGILILELITGLRAMEFGKAANQKGAMLDWVKKIHQEKKLD  529

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            ++VDKDLKN++DR+ELEEMVQVALLCTQ+ P  RPKMSEV+RMLEGDGLAE+WEASQ  +
Sbjct  530  MLVDKDLKNDYDRIELEEMVQVALLCTQYLPGQRPKMSEVVRMLEGDGLAERWEASQRVE  589

Query  371  TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
              +F+  E ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  590  AHKFKMPEFSSSERYSDLTDDSSLLVQAMELSGPR  624



>ref|XP_009803321.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Nicotiana 
sylvestris]
Length=622

 Score =   235 bits (600),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 111/156 (71%), Positives = 139/156 (89%), Gaps = 2/156 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITG +A++FG+ ANQKG +LDWVK +HQE KL+
Sbjct  467  IAPEYLSTGQSSEKTDVFGFGILLLELITGMRAIEFGKAANQKGAMLDWVKKIHQEKKLD  526

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            ++VDKDLK+N+DR+ELEEMVQVALLCTQ+ P HRPKMSE++RMLEGDGLAE+WEASQ  D
Sbjct  527  ILVDKDLKSNYDRIELEEMVQVALLCTQYLPGHRPKMSEIVRMLEGDGLAERWEASQKFD  586

Query  371  -TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
             + +++T E ++ +R+SD  ++S L+V+AMELSGPR
Sbjct  587  GSNKYKTKELSSSERFSDLTDDSLLLVQAMELSGPR  622



>ref|XP_009803966.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like isoform X2 [Nicotiana 
sylvestris]
Length=602

 Score =   235 bits (599),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 140/158 (89%), Gaps = 4/158 (3%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSS+KTDVFGFGILLLELITGQ+A++FG+ ANQKG +LDWVK +HQE KL+
Sbjct  445  IAPEYLSTGQSSDKTDVFGFGILLLELITGQRALEFGKAANQKGAMLDWVKKIHQEKKLD  504

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXN-  375
            ++VDKD+KNN+DR+ELEEMVQVALLCTQ++PS RPKMSEV+RMLEGDGLAEKWEASQ   
Sbjct  505  MLVDKDMKNNYDRIELEEMVQVALLCTQYHPSQRPKMSEVVRMLEGDGLAEKWEASQRAE  564

Query  374  -DTPRFRTHE-NTPQRYSDFIE-ESSLIVEAMELSGPR  270
             +T   R +E ++ +RYSD  + +SSL+V+AMELSGPR
Sbjct  565  PNTRCSRANEFSSSERYSDLTDNDSSLLVQAMELSGPR  602



>ref|XP_004141483.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Cucumis sativus]
 gb|KGN52542.1| hypothetical protein Csa_5G642730 [Cucumis sativus]
Length=626

 Score =   235 bits (600),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 113/155 (73%), Positives = 135/155 (87%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG ILDWVK +H E KL 
Sbjct  472  IAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGGILDWVKRIHLEKKLE  531

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            ++VDKDLK N+DRVELEEMVQVALLCTQ+ P HRPKMSEV+RMLEG+GLA +WEASQ  D
Sbjct  532  VLVDKDLKANYDRVELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGEGLAVRWEASQRVD  591

Query  371  TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
            + + + H+ ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  592  STKCKPHDFSSSDRYSDLTDDSSLLVQAMELSGPR  626



>ref|XP_003569325.2| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X2 [Brachypodium 
distachyon]
Length=631

 Score =   236 bits (601),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 116/156 (74%), Positives = 135/156 (87%), Gaps = 2/156 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFG+LL+ELITGQKA+DFGR ANQKG +LD VK LH E +L+
Sbjct  476  IAPEYLSTGQSSEKTDVFGFGVLLVELITGQKALDFGRLANQKGGVLDMVKKLHHEKQLS  535

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            +MVDKDL +N+DRVELEEMVQVALLCTQ++PSHRP+MSEV+RMLEGDGLAEKWEASQ  D
Sbjct  536  MMVDKDLGSNYDRVELEEMVQVALLCTQYHPSHRPRMSEVIRMLEGDGLAEKWEASQNVD  595

Query  371  TPRFRTHENTPQRYSDF--IEESSLIVEAMELSGPR  270
            TP+  + E  P ++ D    +ESSL +EAMELSGPR
Sbjct  596  TPKSVSSELIPPKFMDLAAADESSLGLEAMELSGPR  631



>ref|XP_010230509.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X1 [Brachypodium 
distachyon]
Length=633

 Score =   236 bits (601),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 116/156 (74%), Positives = 135/156 (87%), Gaps = 2/156 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFG+LL+ELITGQKA+DFGR ANQKG +LD VK LH E +L+
Sbjct  478  IAPEYLSTGQSSEKTDVFGFGVLLVELITGQKALDFGRLANQKGGVLDMVKKLHHEKQLS  537

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            +MVDKDL +N+DRVELEEMVQVALLCTQ++PSHRP+MSEV+RMLEGDGLAEKWEASQ  D
Sbjct  538  MMVDKDLGSNYDRVELEEMVQVALLCTQYHPSHRPRMSEVIRMLEGDGLAEKWEASQNVD  597

Query  371  TPRFRTHENTPQRYSDF--IEESSLIVEAMELSGPR  270
            TP+  + E  P ++ D    +ESSL +EAMELSGPR
Sbjct  598  TPKSVSSELIPPKFMDLAAADESSLGLEAMELSGPR  633



>emb|CDY46185.1| BnaA01g23070D [Brassica napus]
Length=636

 Score =   236 bits (601),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 117/169 (69%), Positives = 137/169 (81%), Gaps = 22/169 (13%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ++QKGV+LDWVK LHQEGKL 
Sbjct  475  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRSSHQKGVMLDWVKKLHQEGKLK  534

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQX--  378
             ++DKDL + +DRVELEE+VQVALLCTQFNPS+RPKMSEV++MLEGDGLA++WEASQ   
Sbjct  535  QLIDKDLNDKYDRVELEEIVQVALLCTQFNPSNRPKMSEVMKMLEGDGLADRWEASQSGG  594

Query  377  -------------NDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
                         + +PR R        YSD+I+ESSL+VEA+ELSGPR
Sbjct  595  AKSLPPPLPSGMVSSSPRVR-------YYSDYIQESSLVVEAIELSGPR  636



>gb|AFO67891.1| leucine-rich repeat receptor-like kinase (mitochondrion) [Brassica 
rapa subsp. oleifera]
Length=635

 Score =   236 bits (601),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 117/169 (69%), Positives = 137/169 (81%), Gaps = 22/169 (13%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ++QKGV+LDWVK LHQEGKL 
Sbjct  474  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRSSHQKGVMLDWVKKLHQEGKLK  533

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQX--  378
             ++DKDL + +DRVELEE+VQVALLCTQFNPS+RPKMSEV++MLEGDGLA++WEASQ   
Sbjct  534  QLIDKDLNDKYDRVELEEIVQVALLCTQFNPSNRPKMSEVMKMLEGDGLADRWEASQSGG  593

Query  377  -------------NDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
                         + +PR R        YSD+I+ESSL+VEA+ELSGPR
Sbjct  594  AKSLPPPLPSGMVSSSPRVR-------YYSDYIQESSLVVEAIELSGPR  635



>ref|XP_009596697.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like isoform X2 [Nicotiana 
tomentosiformis]
Length=603

 Score =   235 bits (599),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 140/158 (89%), Gaps = 4/158 (3%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSS+KTDVFGFGILLLELITGQ+A++FG+ ANQKG +LDWVK +HQE KL+
Sbjct  446  IAPEYLSTGQSSDKTDVFGFGILLLELITGQRALEFGKAANQKGAMLDWVKKIHQEKKLD  505

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXN-  375
            ++VDKD+KNN+DR+ELEEMVQVALLCTQ++PS RP+MSEV+RMLEGDGLAEKWEASQ   
Sbjct  506  MLVDKDMKNNYDRIELEEMVQVALLCTQYHPSQRPRMSEVVRMLEGDGLAEKWEASQRAE  565

Query  374  -DTPRFRTHE-NTPQRYSDFIE-ESSLIVEAMELSGPR  270
             +T   R +E ++ +RYSD  E +SSL+V+AMELSGPR
Sbjct  566  PNTRCSRANEFSSSERYSDLTENDSSLLVQAMELSGPR  603



>ref|XP_009104025.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X2 [Brassica 
rapa]
Length=635

 Score =   235 bits (600),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 117/169 (69%), Positives = 137/169 (81%), Gaps = 22/169 (13%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ++QKGV+LDWVK LHQEGKL 
Sbjct  474  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRSSHQKGVMLDWVKKLHQEGKLK  533

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQX--  378
             ++DKDL + +DRVELEE+VQVALLCTQFNPS+RPKMSEV++MLEGDGLA++WEASQ   
Sbjct  534  QLIDKDLNDKYDRVELEEIVQVALLCTQFNPSNRPKMSEVMKMLEGDGLADRWEASQSGG  593

Query  377  -------------NDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
                         + +PR R        YSD+I+ESSL+VEA+ELSGPR
Sbjct  594  AKSLPPPLPSGMVSSSPRVR-------YYSDYIQESSLVVEAIELSGPR  635



>ref|XP_009596696.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like isoform X1 [Nicotiana 
tomentosiformis]
Length=621

 Score =   235 bits (600),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 140/158 (89%), Gaps = 4/158 (3%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSS+KTDVFGFGILLLELITGQ+A++FG+ ANQKG +LDWVK +HQE KL+
Sbjct  464  IAPEYLSTGQSSDKTDVFGFGILLLELITGQRALEFGKAANQKGAMLDWVKKIHQEKKLD  523

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXN-  375
            ++VDKD+KNN+DR+ELEEMVQVALLCTQ++PS RP+MSEV+RMLEGDGLAEKWEASQ   
Sbjct  524  MLVDKDMKNNYDRIELEEMVQVALLCTQYHPSQRPRMSEVVRMLEGDGLAEKWEASQRAE  583

Query  374  -DTPRFRTHE-NTPQRYSDFIE-ESSLIVEAMELSGPR  270
             +T   R +E ++ +RYSD  E +SSL+V+AMELSGPR
Sbjct  584  PNTRCSRANEFSSSERYSDLTENDSSLLVQAMELSGPR  621



>ref|XP_009803965.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like isoform X1 [Nicotiana 
sylvestris]
Length=620

 Score =   235 bits (599),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 140/158 (89%), Gaps = 4/158 (3%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSS+KTDVFGFGILLLELITGQ+A++FG+ ANQKG +LDWVK +HQE KL+
Sbjct  463  IAPEYLSTGQSSDKTDVFGFGILLLELITGQRALEFGKAANQKGAMLDWVKKIHQEKKLD  522

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXN-  375
            ++VDKD+KNN+DR+ELEEMVQVALLCTQ++PS RPKMSEV+RMLEGDGLAEKWEASQ   
Sbjct  523  MLVDKDMKNNYDRIELEEMVQVALLCTQYHPSQRPKMSEVVRMLEGDGLAEKWEASQRAE  582

Query  374  -DTPRFRTHE-NTPQRYSDFIE-ESSLIVEAMELSGPR  270
             +T   R +E ++ +RYSD  + +SSL+V+AMELSGPR
Sbjct  583  PNTRCSRANEFSSSERYSDLTDNDSSLLVQAMELSGPR  620



>ref|XP_008807034.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Phoenix 
dactylifera]
Length=604

 Score =   234 bits (598),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 134/155 (86%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQ A++FG+ ANQKG +LDWVK +HQE KL+
Sbjct  450  IAPEYLSTGQSSEKTDVFGFGILLLELITGQTALEFGKAANQKGAMLDWVKKIHQEKKLD  509

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
             +VDKDL++N+DR+ELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE+WEASQ  D
Sbjct  510  TLVDKDLRDNYDRIELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAERWEASQRVD  569

Query  371  TPRFRTHENTPQR-YSDFIEESSLIVEAMELSGPR  270
               F+  E + +R +SD  ++SSL+ +AMELSGPR
Sbjct  570  AHMFKLPEFSSERCFSDLTDDSSLLAQAMELSGPR  604



>ref|XP_006344295.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Solanum tuberosum]
Length=620

 Score =   235 bits (599),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 112/156 (72%), Positives = 138/156 (88%), Gaps = 2/156 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSS+KTDVFGFGILLLELITGQ+A++FG+ ANQKG +LDWV+ + QE KL+
Sbjct  465  IAPEYLSTGQSSDKTDVFGFGILLLELITGQRALEFGKAANQKGAMLDWVRKIQQEKKLD  524

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            ++VDKD+KN +D +ELEEMVQVALLCTQ++PSHRPKMSEV+RMLEGDGLAEKWEASQ  +
Sbjct  525  MLVDKDMKNEYDTIELEEMVQVALLCTQYHPSHRPKMSEVVRMLEGDGLAEKWEASQRAE  584

Query  371  TPRF-RTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
              R  R +E ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  585  PTRCSRANEFSSSERYSDLTDDSSLLVQAMELSGPR  620



>gb|EEC73926.1| hypothetical protein OsI_08784 [Oryza sativa Indica Group]
Length=627

 Score =   235 bits (599),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 136/155 (88%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQ A++FG+ +NQKG +LDWVK +HQE KL+
Sbjct  473  IAPEYLSTGQSSEKTDVFGFGILLLELITGQTALEFGKSSNQKGAMLDWVKKMHQEKKLD  532

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            ++VDK L++N+DRVELEEMVQVALLCTQ+ P HRP+MSEV+RMLEGDGLAE+WEASQ  D
Sbjct  533  VLVDKGLRSNYDRVELEEMVQVALLCTQYLPGHRPRMSEVVRMLEGDGLAERWEASQRAD  592

Query  371  TPRFRTHENTPQR-YSDFIEESSLIVEAMELSGPR  270
            + +F+  E T  R YSD  ++SSL+V+A+ELSGPR
Sbjct  593  SHKFKVPEFTFGRCYSDLTDDSSLLVQAVELSGPR  627



>gb|EEE57731.1| hypothetical protein OsJ_08242 [Oryza sativa Japonica Group]
Length=627

 Score =   235 bits (599),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 136/155 (88%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQ A++FG+ +NQKG +LDWVK +HQE KL+
Sbjct  473  IAPEYLSTGQSSEKTDVFGFGILLLELITGQTALEFGKSSNQKGAMLDWVKKMHQEKKLD  532

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            ++VDK L++N+DRVELEEMVQVALLCTQ+ P HRP+MSEV+RMLEGDGLAE+WEASQ  D
Sbjct  533  VLVDKGLRSNYDRVELEEMVQVALLCTQYLPGHRPRMSEVVRMLEGDGLAERWEASQRAD  592

Query  371  TPRFRTHENTPQR-YSDFIEESSLIVEAMELSGPR  270
            + +F+  E T  R YSD  ++SSL+V+A+ELSGPR
Sbjct  593  SHKFKVPEFTFGRCYSDLTDDSSLLVQAVELSGPR  627



>ref|XP_004236956.1| PREDICTED: protein NSP-INTERACTING KINASE 2 [Solanum lycopersicum]
Length=620

 Score =   234 bits (598),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 110/156 (71%), Positives = 139/156 (89%), Gaps = 2/156 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSS+KTDVFGFGILLLELITG++A++FG+ ANQKG +LDWV+ + QE +L+
Sbjct  465  IAPEYLSTGQSSDKTDVFGFGILLLELITGERALEFGKAANQKGAMLDWVRKIQQEKRLD  524

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            ++VDKD+KN +D +ELEEMVQVALLCTQ++PSHRPKMSEV+RMLEGDGLAEKWEASQ  +
Sbjct  525  MLVDKDMKNEYDTIELEEMVQVALLCTQYHPSHRPKMSEVVRMLEGDGLAEKWEASQTAE  584

Query  371  TPRF-RTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
              R+ R +E ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  585  PTRYSRANEFSSSERYSDLTDDSSLLVQAMELSGPR  620



>ref|XP_011021148.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Populus 
euphratica]
Length=626

 Score =   235 bits (599),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 134/155 (86%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSS+KTDVFGFGILLLELITGQ+A++FG+ ANQKG +LDWVK +HQE KL 
Sbjct  472  IAPEYLSTGQSSDKTDVFGFGILLLELITGQRALEFGKAANQKGAMLDWVKKIHQEKKLE  531

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            ++VDKDLK N+DR+ELEEMVQVALLCTQ+ PS RPKM EV++MLEGDGLAE WEASQ  +
Sbjct  532  MLVDKDLKGNYDRIELEEMVQVALLCTQYLPSQRPKMYEVVKMLEGDGLAESWEASQRAE  591

Query  371  TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
              + + HE ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  592  ATKSKPHEFSSSDRYSDLTDDSSLLVQAMELSGPR  626



>ref|XP_006647834.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Oryza brachyantha]
Length=626

 Score =   235 bits (599),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 136/155 (88%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQ A++FG+ +NQKG +LDWVK +HQE KL+
Sbjct  472  IAPEYLSTGQSSEKTDVFGFGILLLELITGQTALEFGKSSNQKGAMLDWVKKMHQEKKLD  531

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            ++VDK L++N+DRVELEEMVQVALLCTQ+ P HRP+MSEV+RMLEGDGLAE+WEASQ  D
Sbjct  532  VLVDKGLRSNYDRVELEEMVQVALLCTQYLPGHRPRMSEVVRMLEGDGLAERWEASQRAD  591

Query  371  TPRFRTHENTPQR-YSDFIEESSLIVEAMELSGPR  270
            + +F+  E T  R YSD  ++SSL+V+A+ELSGPR
Sbjct  592  SHKFKVPEFTFGRCYSDLTDDSSLLVQAVELSGPR  626



>ref|XP_011021146.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Populus 
euphratica]
Length=627

 Score =   234 bits (598),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 134/155 (86%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSS+KTDVFGFGILLLELITGQ+A++FG+ ANQKG +LDWVK +HQE KL 
Sbjct  473  IAPEYLSTGQSSDKTDVFGFGILLLELITGQRALEFGKAANQKGAMLDWVKKIHQEKKLE  532

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            ++VDKDLK N+DR+ELEEMVQVALLCTQ+ PS RPKM EV++MLEGDGLAE WEASQ  +
Sbjct  533  MLVDKDLKGNYDRIELEEMVQVALLCTQYLPSQRPKMYEVVKMLEGDGLAESWEASQRAE  592

Query  371  TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
              + + HE ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  593  ATKSKPHEFSSSDRYSDLTDDSSLLVQAMELSGPR  627



>ref|XP_002314905.1| hypothetical protein POPTR_0010s14410g [Populus trichocarpa]
 gb|EEF01076.1| hypothetical protein POPTR_0010s14410g [Populus trichocarpa]
Length=627

 Score =   234 bits (598),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 134/155 (86%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELI+G +A++FG+  NQKG +LDWVK +HQE KL 
Sbjct  473  IAPEYLSTGQSSEKTDVFGFGILLLELISGLRALEFGKSTNQKGALLDWVKKIHQEKKLE  532

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            L+VDKDLKNN+D +EL+E VQVALLCTQ  PSHRPKMSEV+RMLEGDGLAEKWEASQ  +
Sbjct  533  LLVDKDLKNNYDPIELDETVQVALLCTQNLPSHRPKMSEVVRMLEGDGLAEKWEASQRAE  592

Query  371  TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
              R RT E ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  593  ATRTRTIEFSSSERYSDLTDDSSLLVQAMELSGPR  627



>ref|XP_002514536.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor, 
putative [Ricinus communis]
 gb|EEF47642.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor, 
putative [Ricinus communis]
Length=576

 Score =   233 bits (595),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 110/155 (71%), Positives = 135/155 (87%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLEL+ G +A++FG+ ANQKG +LDW+K +HQ+ KL 
Sbjct  422  IAPEYLSTGQSSEKTDVFGFGILLLELVHGLRALEFGKSANQKGAMLDWIKKIHQDKKLE  481

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            L+VDK+LKNN+D +ELEE+V+VALLCTQF P HRPKMSEV+RMLEGDGLAEKWEASQ  +
Sbjct  482  LLVDKNLKNNYDPIELEEIVRVALLCTQFIPGHRPKMSEVVRMLEGDGLAEKWEASQRAE  541

Query  371  TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
              R R +E ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  542  ATRSRANEFSSSERYSDLTDDSSLLVQAMELSGPR  576



>ref|XP_008807033.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Phoenix 
dactylifera]
Length=624

 Score =   234 bits (598),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 134/155 (86%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQ A++FG+ ANQKG +LDWVK +HQE KL+
Sbjct  470  IAPEYLSTGQSSEKTDVFGFGILLLELITGQTALEFGKAANQKGAMLDWVKKIHQEKKLD  529

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
             +VDKDL++N+DR+ELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE+WEASQ  D
Sbjct  530  TLVDKDLRDNYDRIELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAERWEASQRVD  589

Query  371  TPRFRTHENTPQR-YSDFIEESSLIVEAMELSGPR  270
               F+  E + +R +SD  ++SSL+ +AMELSGPR
Sbjct  590  AHMFKLPEFSSERCFSDLTDDSSLLAQAMELSGPR  624



>ref|XP_004965216.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Setaria italica]
Length=661

 Score =   235 bits (599),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 135/155 (87%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQ A++FG+ ANQKG +LDWVK +HQE KL+
Sbjct  507  IAPEYLSTGQSSEKTDVFGFGILLLELITGQTALEFGKAANQKGAMLDWVKKMHQEKKLD  566

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            ++VDK LK  +DR+ELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE+WEASQ  D
Sbjct  567  VLVDKGLKGGYDRIELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAERWEASQCAD  626

Query  371  TPRFRTHENTPQR-YSDFIEESSLIVEAMELSGPR  270
            + +F+  E + +R YSD  ++SSL+V+A+ELSGPR
Sbjct  627  SHKFKVPEFSFRRCYSDLTDDSSLLVQAVELSGPR  661



>ref|XP_010236002.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Brachypodium 
distachyon]
Length=627

 Score =   234 bits (597),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 135/155 (87%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQ A++FG+ +NQKG +LDWVK +HQE KL+
Sbjct  473  IAPEYLSTGQSSEKTDVFGFGILLLELITGQTALEFGKSSNQKGAMLDWVKKMHQEKKLD  532

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            ++VDK L+N++D +ELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE+WEASQ  D
Sbjct  533  VLVDKGLRNSYDHIELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAERWEASQRTD  592

Query  371  TPRFRTHENTPQR-YSDFIEESSLIVEAMELSGPR  270
            + +F+  E T  R YSD  ++SSL+V+A+ELSGPR
Sbjct  593  SHKFKVPEFTFGRCYSDLTDDSSLLVQAVELSGPR  627



>ref|XP_003572984.2| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Brachypodium 
distachyon]
Length=628

 Score =   234 bits (597),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 135/155 (87%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQ A++FG+ +NQKG +LDWVK +HQE KL+
Sbjct  474  IAPEYLSTGQSSEKTDVFGFGILLLELITGQTALEFGKSSNQKGAMLDWVKKMHQEKKLD  533

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            ++VDK L+N++D +ELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE+WEASQ  D
Sbjct  534  VLVDKGLRNSYDHIELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAERWEASQRTD  593

Query  371  TPRFRTHENTPQR-YSDFIEESSLIVEAMELSGPR  270
            + +F+  E T  R YSD  ++SSL+V+A+ELSGPR
Sbjct  594  SHKFKVPEFTFGRCYSDLTDDSSLLVQAVELSGPR  628



>ref|XP_009373732.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Pyrus x bretschneideri]
Length=636

 Score =   234 bits (597),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 133/155 (86%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG ILDWVK +HQE  L 
Sbjct  482  IAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAILDWVKKIHQEKTLE  541

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            ++VDKDL  N+DR+ELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGL E+WEASQ  +
Sbjct  542  MLVDKDLTTNYDRIELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLVERWEASQKVE  601

Query  371  TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
            + + +  E ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  602  STKSKAPEFSSSDRYSDLTDDSSLLVQAMELSGPR  636



>ref|XP_007045670.1| LRR receptor-like serine/threonine-protein kinase [Theobroma 
cacao]
 gb|EOY01502.1| LRR receptor-like serine/threonine-protein kinase [Theobroma 
cacao]
Length=926

 Score =   238 bits (607),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 113/155 (73%), Positives = 136/155 (88%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELI+G +A++FG+ ANQKG +LDWV+ +H E KL 
Sbjct  772  IAPEYLSTGQSSEKTDVFGFGILLLELISGLRALEFGKTANQKGAMLDWVRKIHLEKKLE  831

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            ++VDKDLKNN+DR+ELEEM QVALLCTQ+ PSHRPKMSEV+RMLEGDGLAEKWEASQ  +
Sbjct  832  MLVDKDLKNNYDRIELEEMAQVALLCTQYLPSHRPKMSEVVRMLEGDGLAEKWEASQRAE  891

Query  371  TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
              R R +E ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  892  ATRSRANEFSSSERYSDLTDDSSLLVQAMELSGPR  926



>ref|XP_009630581.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Nicotiana tomentosiformis]
Length=625

 Score =   234 bits (596),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 110/156 (71%), Positives = 139/156 (89%), Gaps = 2/156 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITG +A++FG+ ANQKG +LDWVK +HQE KL+
Sbjct  470  IAPEYLSTGQSSEKTDVFGFGILLLELITGMRAIEFGKAANQKGAMLDWVKKIHQEKKLD  529

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            ++VDK+LK+N+DR+ELEEMVQVALLCTQ+ P HRPKMSE++RMLEGDGLAE+WEASQ  D
Sbjct  530  ILVDKELKSNYDRIELEEMVQVALLCTQYLPGHRPKMSEIVRMLEGDGLAERWEASQKFD  589

Query  371  -TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
             + +++T E ++ +R+SD  ++S L+V+AMELSGPR
Sbjct  590  GSNKYKTKELSSSERFSDLTDDSLLLVQAMELSGPR  625



>ref|XP_004232118.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Solanum lycopersicum]
Length=626

 Score =   234 bits (596),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 110/156 (71%), Positives = 139/156 (89%), Gaps = 2/156 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITG +A++FG+ ANQKGV+LDWV+ +HQE KL+
Sbjct  471  IAPEYLSTGQSSEKTDVFGFGILLLELITGMRAIEFGKAANQKGVMLDWVRKIHQEKKLD  530

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            ++VDKDL+ N+DR+ELEEMVQVALLCTQ+ P HRPKMSE++RMLEGDGLAE+WEASQ  D
Sbjct  531  VLVDKDLRINYDRIELEEMVQVALLCTQYLPGHRPKMSEIVRMLEGDGLAERWEASQKFD  590

Query  371  -TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
             + +++T E ++ +R+SD  ++S L+V+AMELSGPR
Sbjct  591  GSNKYKTKELSSSERFSDLTDDSLLLVQAMELSGPR  626



>ref|XP_004953781.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Setaria 
italica]
 ref|XP_004953782.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Setaria 
italica]
 ref|XP_004953783.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X3 [Setaria 
italica]
Length=624

 Score =   233 bits (594),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 134/155 (86%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQ A++FG+ +NQKG +LDWVK +HQE +L+
Sbjct  470  IAPEYLSTGQSSEKTDVFGFGILLLELITGQTALEFGKSSNQKGAMLDWVKKMHQEKQLD  529

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            ++VDK L + +DR+ELEEMVQVALLCTQF P HRPKMSEV+RMLEGDGLAE+WEASQ  D
Sbjct  530  ILVDKGLGSKYDRIELEEMVQVALLCTQFLPGHRPKMSEVVRMLEGDGLAERWEASQHTD  589

Query  371  TPRFRTHENTPQR-YSDFIEESSLIVEAMELSGPR  270
            + +F+  E T  R YSD  ++SSL+V+A+ELSGPR
Sbjct  590  SHKFKVPEFTFSRCYSDLTDDSSLLVQAVELSGPR  624



>ref|XP_007214944.1| hypothetical protein PRUPE_ppa002897mg [Prunus persica]
 gb|EMJ16143.1| hypothetical protein PRUPE_ppa002897mg [Prunus persica]
Length=623

 Score =   233 bits (594),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 133/155 (86%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+  NQKG ILDWVK +HQE KL 
Sbjct  469  IAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKATNQKGAILDWVKKIHQEKKLE  528

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            ++VDKDLK N+DR+ELEEMVQVALLCTQ+ P  RPKMSEV+RMLEGDGL E+WEASQ  +
Sbjct  529  MLVDKDLKTNYDRIELEEMVQVALLCTQYLPGQRPKMSEVVRMLEGDGLVERWEASQRVE  588

Query  371  TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
            + + +  E ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  589  STKSKAPEFSSSDRYSDLTDDSSLLVQAMELSGPR  623



>ref|NP_001042146.2| Os01g0171000 [Oryza sativa Japonica Group]
 dbj|BAF04060.2| Os01g0171000, partial [Oryza sativa Japonica Group]
Length=184

 Score =   221 bits (562),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 107/143 (75%), Positives = 125/143 (87%), Gaps = 1/143 (1%)
 Frame = -3

Query  695  EKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLNLMVDKDLKNNFD  516
            EKTDVFGFG+LL+ELITGQKA+DFGR ANQKG +LDWVK LHQE +L++MVDKDL +N+D
Sbjct  42   EKTDVFGFGVLLVELITGQKALDFGRLANQKGGVLDWVKKLHQEKQLSMMVDKDLGSNYD  101

Query  515  RVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXNDTPRFRTHENTPQ  336
            RVELEEMVQVALLCTQ+ PSHRP+MSEV+RMLEGDGLAEKWEASQ  DTP+  + E  P 
Sbjct  102  RVELEEMVQVALLCTQYYPSHRPRMSEVIRMLEGDGLAEKWEASQNVDTPKSVSSELLPP  161

Query  335  RYSDF-IEESSLIVEAMELSGPR  270
            ++ DF  +ESSL +EAMELSGPR
Sbjct  162  KFMDFAADESSLGLEAMELSGPR  184



>gb|ABD96908.1| hypothetical protein [Cleome spinosa]
Length=630

 Score =   233 bits (595),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 113/162 (70%), Positives = 133/162 (82%), Gaps = 8/162 (5%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG ILDWVK +HQE KL 
Sbjct  469  IAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKSANQKGAILDWVKKIHQEKKLE  528

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            ++VDKDLKNN+D +ELEE VQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE+WEASQ  D
Sbjct  529  VLVDKDLKNNYDHLELEETVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAERWEASQRTD  588

Query  371  TP--------RFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
            +         R     ++  RYSD  ++S+L+V+AMELSGPR
Sbjct  589  STAKCSSSSSRRLNELSSSDRYSDLTDDSTLLVQAMELSGPR  630



>ref|XP_004304172.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Fragaria vesca subsp. 
vesca]
Length=622

 Score =   233 bits (594),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 107/154 (69%), Positives = 131/154 (85%), Gaps = 0/154 (0%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSS+KTDVFGFGILLLELITGQ A++F +  NQKG ILDWVK LHQE KL 
Sbjct  469  IAPEYLSTGQSSDKTDVFGFGILLLELITGQTALEFAKSTNQKGAILDWVKKLHQEKKLE  528

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            ++VDKDL  N+DR+ELEEM+QVALLCTQ+ P HRP+MSEV+RMLEGDGL E+WEASQ  +
Sbjct  529  MLVDKDLNTNYDRIELEEMIQVALLCTQYLPGHRPRMSEVVRMLEGDGLVERWEASQRAE  588

Query  371  TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
            + + + + ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  589  STKSKAYFSSSDRYSDLTDDSSLLVQAMELSGPR  622



>ref|XP_002436855.1| hypothetical protein SORBIDRAFT_10g010010 [Sorghum bicolor]
 gb|EER88222.1| hypothetical protein SORBIDRAFT_10g010010 [Sorghum bicolor]
Length=629

 Score =   233 bits (594),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 134/155 (86%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQ A++FG+ ANQKG +LDWVK +HQE KL+
Sbjct  475  IAPEYLSTGQSSEKTDVFGFGILLLELITGQTALEFGKAANQKGAMLDWVKKMHQEKKLD  534

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            ++VDK L+  +DR+ELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE+WEASQ  D
Sbjct  535  VLVDKGLRGGYDRIELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAERWEASQRAD  594

Query  371  TPRFRTHENTPQR-YSDFIEESSLIVEAMELSGPR  270
            + +F+  + T  R YSD  ++SSL+V+A+ELSGPR
Sbjct  595  SHKFKVPDFTFSRCYSDLTDDSSLLVQAVELSGPR  629



>ref|XP_004491764.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Cicer arietinum]
Length=629

 Score =   233 bits (594),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 113/158 (72%), Positives = 136/158 (86%), Gaps = 4/158 (3%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG +LDWVK +HQE KL 
Sbjct  472  IAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAMLDWVKKIHQEKKLE  531

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQX--  378
            L+VDKDLK+N+D+ ELEEMVQVALLCTQ+ PS+RPKMSEV+RMLEGDGLAE+WEA Q   
Sbjct  532  LLVDKDLKSNYDKNELEEMVQVALLCTQYLPSNRPKMSEVVRMLEGDGLAERWEAYQKTT  591

Query  377  -NDTPRFRTHENT-PQRYSDFIEESSLIVEAMELSGPR  270
             N   +++ HE++   RYSD  ++S L+V+AMELSGPR
Sbjct  592  DNSNAKYKPHESSLSDRYSDLTDDSLLLVQAMELSGPR  629



>ref|XP_010927979.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Elaeis 
guineensis]
Length=591

 Score =   232 bits (591),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 110/155 (71%), Positives = 134/155 (86%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQ A++FG+ ANQKG +LDWVK +HQ+ KL+
Sbjct  437  IAPEYLSTGQSSEKTDVFGFGILLLELITGQTALEFGKAANQKGAMLDWVKKIHQDKKLD  496

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            ++VDKDL++ +DR+ELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE+WEASQ  D
Sbjct  497  MLVDKDLRDKYDRIELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAERWEASQRVD  556

Query  371  TPRFRTHENTPQR-YSDFIEESSLIVEAMELSGPR  270
               F+  E + +R +SD  ++SSL+ +AMELSGPR
Sbjct  557  AHMFKLPEFSSERCFSDLTDDSSLLAQAMELSGPR  591



>ref|XP_010558548.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Tarenaya 
hassleriana]
Length=636

 Score =   233 bits (594),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 113/162 (70%), Positives = 133/162 (82%), Gaps = 8/162 (5%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG ILDWVK +HQE KL 
Sbjct  475  IAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKSANQKGAILDWVKKIHQEKKLE  534

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            ++VDKDLKNN+D +ELEE VQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE+WEASQ  D
Sbjct  535  VLVDKDLKNNYDHLELEETVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAERWEASQRTD  594

Query  371  TP--------RFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
            +         R     ++  RYSD  ++S+L+V+AMELSGPR
Sbjct  595  STAKCSSSSSRRLNELSSSDRYSDLTDDSTLLVQAMELSGPR  636



>ref|XP_010558545.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010558546.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Tarenaya 
hassleriana]
Length=637

 Score =   233 bits (593),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 113/162 (70%), Positives = 133/162 (82%), Gaps = 8/162 (5%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG ILDWVK +HQE KL 
Sbjct  476  IAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKSANQKGAILDWVKKIHQEKKLE  535

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            ++VDKDLKNN+D +ELEE VQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE+WEASQ  D
Sbjct  536  VLVDKDLKNNYDHLELEETVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAERWEASQRTD  595

Query  371  TP--------RFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
            +         R     ++  RYSD  ++S+L+V+AMELSGPR
Sbjct  596  STAKCSSSSSRRLNELSSSDRYSDLTDDSTLLVQAMELSGPR  637



>emb|CDY61461.1| BnaC01g43240D [Brassica napus]
Length=635

 Score =   233 bits (593),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 136/169 (80%), Gaps = 22/169 (13%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ++QKGV+LDWVK LHQEGKL 
Sbjct  474  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRSSHQKGVMLDWVKKLHQEGKLK  533

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQX--  378
             ++DKDL + +D VELEE+VQVALLCTQFNPS+RPKMSEV++MLEGDGLA++WEASQ   
Sbjct  534  QLIDKDLNDKYDTVELEEIVQVALLCTQFNPSNRPKMSEVMKMLEGDGLADRWEASQSGG  593

Query  377  -------------NDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
                         + +PR R        YSD+I+ESSL+VEA+ELSGPR
Sbjct  594  AKSLPPPLPSGMVSSSPRVR-------YYSDYIQESSLVVEAIELSGPR  635



>ref|XP_010927978.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Elaeis 
guineensis]
Length=635

 Score =   232 bits (592),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 110/155 (71%), Positives = 134/155 (86%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQ A++FG+ ANQKG +LDWVK +HQ+ KL+
Sbjct  481  IAPEYLSTGQSSEKTDVFGFGILLLELITGQTALEFGKAANQKGAMLDWVKKIHQDKKLD  540

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            ++VDKDL++ +DR+ELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE+WEASQ  D
Sbjct  541  MLVDKDLRDKYDRIELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAERWEASQRVD  600

Query  371  TPRFRTHENTPQR-YSDFIEESSLIVEAMELSGPR  270
               F+  E + +R +SD  ++SSL+ +AMELSGPR
Sbjct  601  AHMFKLPEFSSERCFSDLTDDSSLLAQAMELSGPR  635



>ref|XP_008783060.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Phoenix dactylifera]
Length=624

 Score =   232 bits (591),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 110/155 (71%), Positives = 135/155 (87%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITG +A++FG+ ANQKG +LDWVK +HQE  L+
Sbjct  470  IAPEYLSTGQSSEKTDVFGFGILLLELITGLRAMEFGKAANQKGAMLDWVKKIHQEKNLD  529

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            ++VDKDLKN++DR+ELEEMVQVALLCT + P  RPKMSEV+RMLEGDGLAE+WEASQ  +
Sbjct  530  MLVDKDLKNDYDRIELEEMVQVALLCTLYLPGQRPKMSEVVRMLEGDGLAERWEASQRVE  589

Query  371  TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
              +F+  E ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  590  AHKFKMPEFSSSERYSDLTDDSSLLVQAMELSGPR  624



>dbj|BAJ89901.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=625

 Score =   231 bits (589),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 109/155 (70%), Positives = 135/155 (87%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQ A++FG+ +NQKG +LDWVK +HQE KL+
Sbjct  471  IAPEYLSTGQSSEKTDVFGFGILLLELITGQTALEFGKASNQKGAMLDWVKKMHQEKKLD  530

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            ++VDK L++++DR+ELEEMVQVALLCTQ+ P HRP+MSEV+RMLEGDGLAE+W+ASQ  D
Sbjct  531  MLVDKGLRSSYDRIELEEMVQVALLCTQYLPGHRPRMSEVVRMLEGDGLAERWQASQRAD  590

Query  371  TPRFRTHENTPQR-YSDFIEESSLIVEAMELSGPR  270
            + +F   E T  R YSD  ++SSL+V+A+ELSGPR
Sbjct  591  SHKFTVPEFTFSRCYSDLTDDSSLLVQAVELSGPR  625



>ref|XP_010905760.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Elaeis guineensis]
Length=635

 Score =   231 bits (590),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 134/155 (86%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQ A++FG+ ANQKG +LDWVK +HQE KL+
Sbjct  481  IAPEYLSTGQSSEKTDVFGFGILLLELITGQTALEFGKAANQKGAMLDWVKRIHQEKKLD  540

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
             +VDK L+N++DR+ELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE+WEASQ  +
Sbjct  541  TIVDKVLRNHYDRIELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAERWEASQRVE  600

Query  371  TPRFRTHENTPQRY-SDFIEESSLIVEAMELSGPR  270
              + + HE + +R  SD  ++SSL+V+AMELSGPR
Sbjct  601  AYKCKLHEFSSERCSSDLTDDSSLLVQAMELSGPR  635



>ref|XP_003563960.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Brachypodium 
distachyon]
Length=629

 Score =   231 bits (588),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 109/155 (70%), Positives = 135/155 (87%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQ A++FG+ +NQKG +LDWVK +HQE KL+
Sbjct  475  IAPEYLSTGQSSEKTDVFGFGILLLELITGQTALEFGKASNQKGAMLDWVKKMHQEKKLD  534

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            ++VDK L++++DR+ELEEMVQVALLCTQ+ P HRP+MSEV+RMLEGDGLAE+W+ASQ  D
Sbjct  535  VLVDKGLRSSYDRIELEEMVQVALLCTQYLPGHRPRMSEVVRMLEGDGLAERWQASQRAD  594

Query  371  TPRFRTHENTPQR-YSDFIEESSLIVEAMELSGPR  270
            + +F   E T  R YSD  ++SSL+V+A+ELSGPR
Sbjct  595  SHKFTVPEFTFSRCYSDLTDDSSLLVQAVELSGPR  629



>ref|XP_008654537.1| PREDICTED: uncharacterized LOC100272802 isoform X1 [Zea mays]
 gb|AFW80157.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=630

 Score =   230 bits (587),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 137/158 (87%), Gaps = 4/158 (3%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFG+LL+EL+TGQKA+DFGR ANQKG +LDWVK LHQE +L 
Sbjct  473  IAPEYLSTGQSSEKTDVFGFGVLLVELVTGQKALDFGRVANQKGGVLDWVKKLHQEKQLG  532

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGD-GLAEKWEASQXN  375
            +MVDKDL +++D VELEEMVQ+ALLCTQ++PSHRP+MSEV+RMLEG+ GLAE+WEASQ N
Sbjct  533  VMVDKDLGSSYDGVELEEMVQLALLCTQYHPSHRPRMSEVIRMLEGEPGLAERWEASQSN  592

Query  374  -DTPRFRTHENTPQRYSDF--IEESSLIVEAMELSGPR  270
             DTP+  + E  P +Y DF   +ESSL +EAMELSGPR
Sbjct  593  VDTPKSVSSELLPPKYVDFAAADESSLGLEAMELSGPR  630



>ref|XP_009396215.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009396224.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Musa acuminata 
subsp. malaccensis]
Length=621

 Score =   229 bits (585),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 110/154 (71%), Positives = 134/154 (87%), Gaps = 2/154 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSS+KTDVFGFGILLLELITG +A+++G+ A QKG +LDWV+ +HQE KL+
Sbjct  470  IAPEYLSTGQSSDKTDVFGFGILLLELITGLRALEYGKAAKQKGAMLDWVRKMHQEKKLD  529

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            ++VDKDLK N+DR+ELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE+WEASQ  +
Sbjct  530  VLVDKDLK-NYDRIELEEMVQVALLCTQYVPGHRPKMSEVVRMLEGDGLAERWEASQRTE  588

Query  371  TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
              +FR  E + +RYSD  ++ SL+VEAMELSGPR
Sbjct  589  VHKFRVPEFSSERYSDLTDD-SLLVEAMELSGPR  621



>ref|XP_008243752.1| PREDICTED: protein NSP-INTERACTING KINASE 2 [Prunus mume]
 ref|XP_008243753.1| PREDICTED: protein NSP-INTERACTING KINASE 2 [Prunus mume]
Length=625

 Score =   229 bits (585),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 109/155 (70%), Positives = 135/155 (87%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGIL+LELI+GQ+A++FG+ ANQKG ILDWVK + QE K +
Sbjct  471  IAPEYLSTGQSSEKTDVFGFGILILELISGQRALEFGKAANQKGAILDWVKKIQQEKKFD  530

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            ++VDK+LKN++D +ELEEM+QVALLCTQ  PS RPKMSEV+RMLEGDGLAEKWEASQ  +
Sbjct  531  VLVDKELKNDYDPIELEEMIQVALLCTQNLPSQRPKMSEVVRMLEGDGLAEKWEASQRAE  590

Query  371  TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
            + R R +E ++ +RYSD  ++SSL+ +AMELSGPR
Sbjct  591  SNRCRANEFSSSERYSDLTDDSSLLAQAMELSGPR  625



>ref|XP_006338306.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Solanum tuberosum]
Length=626

 Score =   229 bits (584),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 109/156 (70%), Positives = 138/156 (88%), Gaps = 2/156 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITG +A++FG+ ANQKGV+LDWV+ +HQE KL+
Sbjct  471  IAPEYLSTGQSSEKTDVFGFGILLLELITGMRAIEFGKAANQKGVMLDWVRKIHQEKKLD  530

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            ++VDKDL+ N+DR+ELEEMVQVALL TQ+ P HRPKMSE++RMLEGDGLAE+WEASQ  D
Sbjct  531  VLVDKDLRINYDRIELEEMVQVALLSTQYLPGHRPKMSEIVRMLEGDGLAERWEASQKFD  590

Query  371  -TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
             + +++T E ++ +R+SD  ++S L+V+AMELSGPR
Sbjct  591  GSNKYKTKELSSSERFSDLTDDSLLLVQAMELSGPR  626



>ref|XP_008389350.1| PREDICTED: LOW QUALITY PROTEIN: protein NSP-INTERACTING KINASE 
2-like [Malus domestica]
Length=621

 Score =   229 bits (583),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 108/155 (70%), Positives = 135/155 (87%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGIL+LELI+GQ+A++FG+ ANQKG ILDWVK + QE K +
Sbjct  467  IAPEYLSTGQSSEKTDVFGFGILILELISGQRALEFGKAANQKGAILDWVKKIQQEKKFD  526

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            ++VDK+LKN++D +ELEEM+QVALLCTQ  P+ RPKMSEV+RMLEGDGLAEKWEASQ  +
Sbjct  527  VLVDKELKNDYDAIELEEMIQVALLCTQNLPNQRPKMSEVVRMLEGDGLAEKWEASQRAE  586

Query  371  TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
            + R R +E ++ +RYSD  ++SSL+ +AMELSGPR
Sbjct  587  SNRCRANEFSSSERYSDLTDDSSLLAQAMELSGPR  621



>ref|XP_009407942.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Musa acuminata 
subsp. malaccensis]
Length=623

 Score =   229 bits (583),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 104/154 (68%), Positives = 133/154 (86%), Gaps = 0/154 (0%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITG +AV+FG+ ANQKG ILDWV+ +HQE  L+
Sbjct  470  IAPEYLSTGQSSEKTDVFGFGILLLELITGLRAVEFGKAANQKGAILDWVRKIHQEKSLD  529

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            ++VD+DLKNN+DRVE+EE++QV +LCTQ+ P HRPKMSEV+RMLEGDGLAE+WEAS+  +
Sbjct  530  MLVDRDLKNNYDRVEVEEIIQVVILCTQYLPGHRPKMSEVVRMLEGDGLAERWEASRRIE  589

Query  371  TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
              + +  E   ++YSD  ++SSL+++A+ELSGPR
Sbjct  590  AHKLKVPEIFSEQYSDITDDSSLLIDAIELSGPR  623



>gb|KDP31451.1| hypothetical protein JCGZ_11827 [Jatropha curcas]
Length=621

 Score =   228 bits (582),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 108/155 (70%), Positives = 134/155 (86%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFG+LL+ELI+G +A++FG+ + QKG +LDWVK ++ E KL 
Sbjct  467  IAPEYLSTGQSSEKTDVFGFGMLLVELISGLRALEFGKSSKQKGAMLDWVKKINHEKKLE  526

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            L+VDKDLKNN+DR+ELEEMV+VALLCTQ+ P+HRPKMSEV+RMLEGDGLAEKWEASQ  +
Sbjct  527  LLVDKDLKNNYDRIELEEMVRVALLCTQYYPTHRPKMSEVVRMLEGDGLAEKWEASQRAE  586

Query  371  TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
                R  E ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  587  ATGSRVAEFSSSERYSDLTDDSSLLVQAMELSGPR  621



>gb|EYU44266.1| hypothetical protein MIMGU_mgv1a002951mg [Erythranthe guttata]
Length=622

 Score =   228 bits (582),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 109/155 (70%), Positives = 134/155 (86%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITG +A+ FG+ ANQKG +LDWVK LHQE KL 
Sbjct  468  IAPEYLSTGQSSEKTDVFGFGILLLELITGLRALQFGKSANQKGAVLDWVKKLHQEKKLE  527

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
             +VDKDL++N+D +ELEE+VQVALLCTQ+ P  RPKMSE++RMLEGDGLAE+WEASQ  +
Sbjct  528  EVVDKDLRSNYDIIELEEIVQVALLCTQYLPGLRPKMSEIVRMLEGDGLAERWEASQRLE  587

Query  371  TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
            + +F+T E ++ +RYSD  ++SSLI +A+ELSGPR
Sbjct  588  SNKFKTQELSSSERYSDLTDDSSLIAQAIELSGPR  622



>ref|XP_010091686.1| Protein NSP-INTERACTING KINASE 2 [Morus notabilis]
 gb|EXB44952.1| Protein NSP-INTERACTING KINASE 2 [Morus notabilis]
Length=619

 Score =   228 bits (580),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 109/155 (70%), Positives = 135/155 (87%), Gaps = 7/155 (5%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELI+GQ+A+DFG+ ANQKG +LDW      E KL+
Sbjct  471  IAPEYLSTGQSSEKTDVFGFGILLLELISGQRALDFGKAANQKGAMLDW------EKKLD  524

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            ++VDKDLKNN+DR+ELEE++QVALLCTQ+ PS+RPKMSEV+RMLEGDGLAEKWEASQ  +
Sbjct  525  MLVDKDLKNNYDRIELEEIIQVALLCTQYLPSYRPKMSEVVRMLEGDGLAEKWEASQRAE  584

Query  371  TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
            + R R ++ ++ +RYSD  ++SSL+ +AMELSGPR
Sbjct  585  STRCRANDFSSSERYSDLTDDSSLLAQAMELSGPR  619



>ref|XP_004297175.1| PREDICTED: protein NSP-INTERACTING KINASE 2 [Fragaria vesca subsp. 
vesca]
Length=624

 Score =   228 bits (580),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 108/156 (69%), Positives = 134/156 (86%), Gaps = 2/156 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGIL+LELI+GQ+A++FG+ ANQKG ILDWVK + QE K +
Sbjct  469  IAPEYLSTGQSSEKTDVFGFGILVLELISGQRALEFGKAANQKGAILDWVKKIQQEKKFD  528

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            ++VDK+LKN++D +ELEEM+QVALLCTQ  P  RPKMSEV+RMLEGDGLAEKWEASQ  +
Sbjct  529  MLVDKELKNDYDPIELEEMIQVALLCTQNLPGQRPKMSEVVRMLEGDGLAEKWEASQRAE  588

Query  371  TPRFRTHEN--TPQRYSDFIEESSLIVEAMELSGPR  270
            + R RT+ +  + +RYSD  ++SSL+ +AMELSGPR
Sbjct  589  SNRCRTNNDFSSSERYSDLTDDSSLLAQAMELSGPR  624



>ref|XP_007221991.1| hypothetical protein PRUPE_ppa002873mg [Prunus persica]
 gb|EMJ23190.1| hypothetical protein PRUPE_ppa002873mg [Prunus persica]
Length=625

 Score =   228 bits (580),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 108/155 (70%), Positives = 134/155 (86%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGIL+LELI+GQ+A++FG+ ANQKG ILDWVK + QE K +
Sbjct  471  IAPEYLSTGQSSEKTDVFGFGILILELISGQRALEFGKAANQKGAILDWVKKIQQEKKFD  530

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            ++VDK+LKN++D +ELEEM+QVALLCTQ  P  RPKMSEV+RMLEGDGLAEKWEASQ  +
Sbjct  531  VLVDKELKNDYDPIELEEMIQVALLCTQNLPRQRPKMSEVVRMLEGDGLAEKWEASQRAE  590

Query  371  TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
            + R R +E ++ +RYSD  ++SSL+ +AMELSGPR
Sbjct  591  SNRCRANEFSSSERYSDLTDDSSLLAQAMELSGPR  625



>gb|AHF18212.1| brassinosteroid insensitive 1-associated receptor kinase 1 [Saccharum 
hybrid cultivar]
Length=626

 Score =   227 bits (579),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 108/155 (70%), Positives = 134/155 (86%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQ A++FG+ +NQKG +LDWVK +HQE +L+
Sbjct  472  IAPEYLSTGQSSEKTDVFGFGILLLELITGQTALEFGKSSNQKGAMLDWVKKMHQEKQLD  531

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            ++VDK L + +DR+ELEEMVQVALLCTQF P HRPKMSEV+RMLEGDGLAE+WEASQ  +
Sbjct  532  ILVDKGLGSKYDRIELEEMVQVALLCTQFLPGHRPKMSEVVRMLEGDGLAERWEASQHTE  591

Query  371  TPRFRTHENTPQR-YSDFIEESSLIVEAMELSGPR  270
            + +F+  E +  R +SD  ++SSL+V+A+ELSGPR
Sbjct  592  SHKFKVPEFSFSRCHSDLTDDSSLLVQAVELSGPR  626



>ref|XP_002452616.1| hypothetical protein SORBIDRAFT_04g029170 [Sorghum bicolor]
 gb|EES05592.1| hypothetical protein SORBIDRAFT_04g029170 [Sorghum bicolor]
Length=626

 Score =   227 bits (579),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 108/155 (70%), Positives = 134/155 (86%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQ A++FG+ +NQKG +LDWVK +HQE +L+
Sbjct  472  IAPEYLSTGQSSEKTDVFGFGILLLELITGQTALEFGKSSNQKGAMLDWVKKMHQEKQLD  531

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            ++VDK L + +DR+ELEEMVQVALLCTQF P HRPKMSEV+RMLEGDGLAE+WEASQ  +
Sbjct  532  ILVDKGLGSKYDRIELEEMVQVALLCTQFLPGHRPKMSEVVRMLEGDGLAERWEASQHTE  591

Query  371  TPRFRTHENTPQR-YSDFIEESSLIVEAMELSGPR  270
            + +F+  E +  R +SD  ++SSL+V+A+ELSGPR
Sbjct  592  SHKFKVPEFSFSRCHSDLTDDSSLLVQAVELSGPR  626



>dbj|BAB01326.1| receptor-like kinase [Arabidopsis thaliana]
Length=630

 Score =   227 bits (579),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 112/158 (71%), Positives = 133/158 (84%), Gaps = 4/158 (3%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITG +A++FG+ ANQ+G ILDWVK L QE KL 
Sbjct  473  IAPEYLSTGQSSEKTDVFGFGILLLELITGLRALEFGKAANQRGAILDWVKKLQQEKKLE  532

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEA-SQXN  375
             +VDKDLK+N+DR+E+EEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGL EKWEA SQ  
Sbjct  533  QIVDKDLKSNYDRIEVEEMVQVALLCTQYLPIHRPKMSEVVRMLEGDGLVEKWEASSQRA  592

Query  374  DTPRFRTHEN---TPQRYSDFIEESSLIVEAMELSGPR  270
            +T R  +  N   + +RYSD  ++SS++V+AMELSGPR
Sbjct  593  ETNRSYSKPNEFSSSERYSDLTDDSSVLVQAMELSGPR  630



>ref|XP_006290715.1| hypothetical protein CARUB_v10016813mg [Capsella rubella]
 gb|EOA23613.1| hypothetical protein CARUB_v10016813mg [Capsella rubella]
Length=651

 Score =   227 bits (579),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 112/158 (71%), Positives = 133/158 (84%), Gaps = 4/158 (3%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITG +A++FG+ ANQ+G ILDWVK L QE KL 
Sbjct  494  IAPEYLSTGQSSEKTDVFGFGILLLELITGLRALEFGKAANQRGAILDWVKKLQQEKKLE  553

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEA-SQXN  375
             +VDKDLK+N+DR+E+EEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGL EKWEA SQ  
Sbjct  554  QIVDKDLKSNYDRIEVEEMVQVALLCTQYLPVHRPKMSEVVRMLEGDGLVEKWEASSQRA  613

Query  374  DTPRFRTHEN---TPQRYSDFIEESSLIVEAMELSGPR  270
            +T R  +  N   + +RYSD  ++SS++V+AMELSGPR
Sbjct  614  ETNRSYSKPNEFSSSERYSDLTDDSSVLVQAMELSGPR  651



>ref|NP_974360.1| NSP-interacting kinase 2 [Arabidopsis thaliana]
 gb|AEE77027.1| NSP-interacting kinase 2 [Arabidopsis thaliana]
Length=636

 Score =   227 bits (578),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 112/158 (71%), Positives = 133/158 (84%), Gaps = 4/158 (3%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITG +A++FG+ ANQ+G ILDWVK L QE KL 
Sbjct  479  IAPEYLSTGQSSEKTDVFGFGILLLELITGLRALEFGKAANQRGAILDWVKKLQQEKKLE  538

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEA-SQXN  375
             +VDKDLK+N+DR+E+EEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGL EKWEA SQ  
Sbjct  539  QIVDKDLKSNYDRIEVEEMVQVALLCTQYLPIHRPKMSEVVRMLEGDGLVEKWEASSQRA  598

Query  374  DTPRFRTHEN---TPQRYSDFIEESSLIVEAMELSGPR  270
            +T R  +  N   + +RYSD  ++SS++V+AMELSGPR
Sbjct  599  ETNRSYSKPNEFSSSERYSDLTDDSSVLVQAMELSGPR  636



>ref|NP_189183.2| NSP-interacting kinase 2 [Arabidopsis thaliana]
 sp|Q8RY65.1|NIK2_ARATH RecName: Full=Protein NSP-INTERACTING KINASE 2; AltName: Full=LRR 
receptor-like serine/threonine-protein kinase NIK2; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAL91629.1| AT3g25560/MWL2_18 [Arabidopsis thaliana]
 gb|AAO11535.1| At3g25560/MWL2_18 [Arabidopsis thaliana]
 gb|ACN59323.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE77026.1| NSP-interacting kinase 2 [Arabidopsis thaliana]
Length=635

 Score =   227 bits (578),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 112/158 (71%), Positives = 133/158 (84%), Gaps = 4/158 (3%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITG +A++FG+ ANQ+G ILDWVK L QE KL 
Sbjct  478  IAPEYLSTGQSSEKTDVFGFGILLLELITGLRALEFGKAANQRGAILDWVKKLQQEKKLE  537

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEA-SQXN  375
             +VDKDLK+N+DR+E+EEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGL EKWEA SQ  
Sbjct  538  QIVDKDLKSNYDRIEVEEMVQVALLCTQYLPIHRPKMSEVVRMLEGDGLVEKWEASSQRA  597

Query  374  DTPRFRTHEN---TPQRYSDFIEESSLIVEAMELSGPR  270
            +T R  +  N   + +RYSD  ++SS++V+AMELSGPR
Sbjct  598  ETNRSYSKPNEFSSSERYSDLTDDSSVLVQAMELSGPR  635



>ref|XP_002876917.1| nsp-interacting kinase 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53176.1| nsp-interacting kinase 2 [Arabidopsis lyrata subsp. lyrata]
Length=636

 Score =   227 bits (578),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 112/158 (71%), Positives = 133/158 (84%), Gaps = 4/158 (3%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITG +A++FG+ ANQ+G ILDWVK L QE KL 
Sbjct  479  IAPEYLSTGQSSEKTDVFGFGILLLELITGLRALEFGKAANQRGAILDWVKKLQQEKKLE  538

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEA-SQXN  375
             +VDKDLK+N+DR+E+EEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGL EKWEA SQ  
Sbjct  539  QIVDKDLKSNYDRIEVEEMVQVALLCTQYLPIHRPKMSEVVRMLEGDGLVEKWEASSQRA  598

Query  374  DTPRFRTHEN---TPQRYSDFIEESSLIVEAMELSGPR  270
            +T R  +  N   + +RYSD  ++SS++V+AMELSGPR
Sbjct  599  ETNRSYSKPNEFSSSERYSDLTDDSSVLVQAMELSGPR  636



>ref|XP_009356495.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Pyrus x bretschneideri]
 ref|XP_009356496.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Pyrus x bretschneideri]
Length=624

 Score =   226 bits (577),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 108/155 (70%), Positives = 134/155 (86%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGIL+LELI+GQ+A++FG+ ANQKG ILDWVK + QE K +
Sbjct  470  IAPEYLSTGQSSEKTDVFGFGILILELISGQRALEFGKAANQKGAILDWVKKIQQEKKFD  529

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            ++VDK+LK ++D +ELEEM+QVALLCTQ  PS RPKMSEV+RMLEGDGLAEKWEASQ  +
Sbjct  530  VLVDKELKYDYDAIELEEMIQVALLCTQNLPSQRPKMSEVVRMLEGDGLAEKWEASQRAE  589

Query  371  TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
            + R R +E ++ +RYSD  ++SSL+ +AMELSGPR
Sbjct  590  SNRCRANEFSSSERYSDLTDDSSLLAQAMELSGPR  624



>ref|XP_008811184.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Phoenix dactylifera]
Length=635

 Score =   226 bits (577),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 111/159 (70%), Positives = 130/159 (82%), Gaps = 9/159 (6%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQ A++FG+ ANQKG +LDWVK +HQE KL 
Sbjct  481  IAPEYLSTGQSSEKTDVFGFGILLLELITGQTALEFGKAANQKGAMLDWVKKIHQEKKLA  540

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQ---  381
             +VDKDL+NN+DR+ELEEM+QVALLCTQ+ P HRPKMSEV+RMLEGDGLAE+WEASQ   
Sbjct  541  TLVDKDLRNNYDRIELEEMIQVALLCTQYLPGHRPKMSEVVRMLEGDGLAERWEASQRVE  600

Query  380  --XNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  270
               N  P F +   +    SD  ++S L+V+AMELSGPR
Sbjct  601  AHKNKLPEFSSEHCS----SDLTDDSLLLVQAMELSGPR  635



>gb|KFK39862.1| hypothetical protein AALP_AA3G298400 [Arabis alpina]
Length=631

 Score =   226 bits (577),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 111/158 (70%), Positives = 133/158 (84%), Gaps = 4/158 (3%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITG +A++FG+ ANQ+G IL+WVK L QE KL 
Sbjct  474  IAPEYLSTGQSSEKTDVFGFGILLLELITGLRALEFGKAANQRGAILEWVKKLQQEKKLE  533

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEA-SQXN  375
             +VDKDLK+N+DR+E+EEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGL E+WEA SQ  
Sbjct  534  QIVDKDLKSNYDRIEIEEMVQVALLCTQYLPIHRPKMSEVVRMLEGDGLVERWEASSQRT  593

Query  374  DTPRFRTHEN---TPQRYSDFIEESSLIVEAMELSGPR  270
            +T R  +  N   T +RYSD  ++SS++V+AMELSGPR
Sbjct  594  ETNRSYSKPNEFSTSERYSDLTDDSSVLVQAMELSGPR  631



>gb|EPS73511.1| hypothetical protein M569_01245, partial [Genlisea aurea]
Length=636

 Score =   226 bits (576),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 117/157 (75%), Positives = 130/157 (83%), Gaps = 4/157 (3%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGILLLELITGQ+AVDFGRG N+KG+ILDWV+ L QEG L+
Sbjct  481  IAPEYLSTGQSSEKTDVFGFGILLLELITGQRAVDFGRGVNEKGLILDWVRRLQQEGDLD  540

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEAS-QXN  375
            L+ DKDLK  +D +EL EM +VALLCT FNP+ RPKMSEVLRMLEGDGLAEKWE S    
Sbjct  541  LIADKDLKKEYDAMELVEMARVALLCTHFNPAIRPKMSEVLRMLEGDGLAEKWEQSLDIE  600

Query  374  DTPRFRTHENTPQ--RYSDFIEESSLIVEAMELSGPR  270
              PR R+    P+  RYSDFIEESSL V+AMELSGPR
Sbjct  601  SPPRQRSFGFPPEIRRYSDFIEESSL-VDAMELSGPR  636



>ref|XP_008339771.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Malus domestica]
Length=625

 Score =   226 bits (575),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 107/155 (69%), Positives = 134/155 (86%), Gaps = 1/155 (1%)
 Frame = -3

Query  731  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTLHQEGKLN  552
            IAPEYLSTGQSSEKTDVFGFGIL+LELI+GQ+A++FG+ ANQKG ILDWVK + QE K +
Sbjct  471  IAPEYLSTGQSSEKTDVFGFGILILELISGQRALEFGKAANQKGAILDWVKKIQQEKKFD  530

Query  551  LMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQXND  372
            ++V K+LKN++D +E+EEM+QVALLCTQ  PS RPKMSEV+RMLEGDGLAEKWEASQ  +
Sbjct  531  VLVGKELKNDYDPIEVEEMIQVALLCTQNLPSQRPKMSEVVRMLEGDGLAEKWEASQRAE  590

Query  371  TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  270
            + R R +E ++ +RYSD  ++SSL+ +AMELSGPR
Sbjct  591  SNRCRANEFSSSERYSDLTDDSSLLAQAMELSGPR  625



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1327220236485