BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF025P06

Length=605
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009594230.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    243   1e-75   Nicotiana tomentosiformis
dbj|BAP75927.1|  GDP-mannose pyrophosphorylase                          241   3e-75   Moringa oleifera [maranga]
ref|XP_009759296.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    242   3e-75   Nicotiana sylvestris
ref|XP_002282422.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    242   5e-75   Vitis vinifera
gb|EYU19947.1|  hypothetical protein MIMGU_mgv1a008833mg                242   5e-75   Erythranthe guttata [common monkey flower]
gb|ABI48955.1|  GDP-D-mannose pyrophosphorylase                         241   1e-74   Viola baoshanensis
gb|KDP44883.1|  hypothetical protein JCGZ_01383                         240   2e-74   Jatropha curcas
gb|AFK47417.1|  unknown                                                 238   9e-74   Lotus japonicus
ref|XP_002524227.1|  mannose-1-phosphate guanyltransferase, putative    238   1e-73   Ricinus communis
gb|KJB74050.1|  hypothetical protein B456_011G269100                    238   1e-73   Gossypium raimondii
gb|AIN40499.1|  GDP-D-mannose pyrophosphorylase                         238   1e-73   Ziziphus jujuba [Chinese jujube]
ref|XP_004490906.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    238   1e-73   Cicer arietinum [garbanzo]
ref|XP_009592609.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    238   1e-73   Nicotiana tomentosiformis
ref|XP_009797660.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    238   1e-73   Nicotiana sylvestris
dbj|BAB62108.1|  GDP-D-mannose pyrophosphorylase                        238   2e-73   Nicotiana tabacum [American tobacco]
ref|XP_006338820.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    238   2e-73   Solanum tuberosum [potatoes]
ref|XP_004240924.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    238   2e-73   Solanum lycopersicum
ref|XP_010095035.1|  Mannose-1-phosphate guanylyltransferase 1          237   4e-73   Morus notabilis
gb|ACN38266.1|  GDP-D-mannose pyrophosphorylase                         237   4e-73   Actinidia latifolia
gb|AET14212.1|  GDP-D-mannose pyrophosphorylase                         235   6e-73   Brassica rapa subsp. chinensis [bok-choy]
ref|XP_009133383.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    236   6e-73   Brassica rapa
gb|ACN88684.2|  GDP-D-mannose pyrophosphorylase                         235   6e-73   Malus domestica [apple tree]
ref|XP_010067451.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    236   7e-73   Eucalyptus grandis [rose gum]
gb|ABB53473.1|  GDP-mannose pyrophosphorylase                           236   7e-73   Malpighia glabra [acerola]
ref|XP_008371997.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    236   8e-73   Malus domestica [apple tree]
gb|AGI78460.1|  GDP-D-mannose pyrophosphorylase                         236   1e-72   Camellia sinensis [black tea]
ref|XP_002316262.1|  cytokinesis defective 1 family protein             235   1e-72   Populus trichocarpa [western balsam poplar]
ref|XP_011036070.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    235   2e-72   Populus euphratica
ref|NP_001234025.1|  GDP-mannose pyrophosphorylase                      235   2e-72   Solanum lycopersicum
emb|CDY07636.1|  BnaA03g18750D                                          236   2e-72   Brassica napus [oilseed rape]
ref|NP_001275205.1|  GDP-mannose pyrophosphorylase                      235   2e-72   Solanum tuberosum [potatoes]
ref|XP_007009213.1|  Glucose-1-phosphate adenylyltransferase fami...    235   2e-72   
ref|XP_003616475.1|  Mannose-1-phosphate guanyltransferase              234   3e-72   Medicago truncatula
ref|XP_007009211.1|  Glucose-1-phosphate adenylyltransferase fami...    234   3e-72   Theobroma cacao [chocolate]
ref|NP_001234084.1|  GDP-mannose pyrophosphorylase                      234   3e-72   
ref|XP_007009215.1|  Glucose-1-phosphate adenylyltransferase fami...    234   3e-72   
gb|KDO69186.1|  hypothetical protein CISIN_1g018060mg                   233   3e-72   Citrus sinensis [apfelsine]
ref|XP_011076786.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    234   4e-72   Sesamum indicum [beniseed]
emb|CDP00140.1|  unnamed protein product                                234   4e-72   Coffea canephora [robusta coffee]
ref|XP_006486418.1|  PREDICTED: probable mannose-1-phosphate guan...    234   4e-72   Citrus sinensis [apfelsine]
ref|XP_006435610.1|  hypothetical protein CICLE_v10033733mg             234   4e-72   Citrus clementina [clementine]
ref|XP_004970565.1|  PREDICTED: probable mannose-1-phosphate guan...    234   5e-72   Setaria italica
gb|KDO69184.1|  hypothetical protein CISIN_1g018060mg                   234   5e-72   Citrus sinensis [apfelsine]
ref|XP_004307574.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    234   5e-72   Fragaria vesca subsp. vesca
gb|KDO69185.1|  hypothetical protein CISIN_1g018060mg                   234   5e-72   Citrus sinensis [apfelsine]
ref|XP_010534527.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    234   6e-72   Tarenaya hassleriana [spider flower]
ref|XP_010554624.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    233   7e-72   Tarenaya hassleriana [spider flower]
ref|XP_006294448.1|  hypothetical protein CARUB_v10023461mg             234   9e-72   
ref|XP_009141836.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    233   1e-71   Brassica rapa
ref|XP_010505663.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    233   1e-71   Camelina sativa [gold-of-pleasure]
gb|ACR34770.1|  unknown                                                 231   1e-71   Zea mays [maize]
gb|ACM90325.1|  GDP-D-mannose pyrophosphorylase                         229   2e-71   Ribes nigrum [European black currant]
ref|XP_008441398.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    233   2e-71   Cucumis melo [Oriental melon]
ref|NP_001142302.1|  uncharacterized protein LOC100274471               232   2e-71   Zea mays [maize]
ref|XP_009343927.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    232   2e-71   Pyrus x bretschneideri [bai li]
ref|XP_011085013.1|  PREDICTED: LOW QUALITY PROTEIN: mannose-1-ph...    232   2e-71   Sesamum indicum [beniseed]
emb|CDX93234.1|  BnaC04g46620D                                          232   3e-71   
ref|XP_004138454.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    232   3e-71   Cucumis sativus [cucumbers]
ref|XP_006411211.1|  hypothetical protein EUTSA_v10016850mg             232   3e-71   Eutrema salsugineum [saltwater cress]
ref|XP_008674826.1|  PREDICTED: probable mannose-1-phosphate guan...    232   3e-71   
emb|CDY07033.1|  BnaA04g22820D                                          231   4e-71   
ref|XP_007218178.1|  hypothetical protein PRUPE_ppa007618mg             231   4e-71   Prunus persica
ref|XP_002879816.1|  hypothetical protein ARALYDRAFT_483004             231   5e-71   
gb|ACW84415.1|  GDP-D-mannose pyrophosphorylase                         231   5e-71   Glycine max [soybeans]
ref|NP_181507.1|  GDP-mannose pyrophosphorylase/ mannose-1-pyroph...    231   5e-71   Arabidopsis thaliana [mouse-ear cress]
emb|CAC35355.1|  GDP-mannose pyrophosphorylase                          231   5e-71   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010691388.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    231   5e-71   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006601845.1|  PREDICTED: uncharacterized protein LOC100818...    231   6e-71   
ref|XP_010256792.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    231   8e-71   Nelumbo nucifera [Indian lotus]
gb|KHN17882.1|  Mannose-1-phosphate guanylyltransferase 1               231   8e-71   Glycine soja [wild soybean]
ref|XP_010529799.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    231   9e-71   Tarenaya hassleriana [spider flower]
ref|NP_001240188.1|  mannose-1-phosphate guanylyltransferase 1-like     231   1e-70   Glycine max [soybeans]
ref|XP_004977599.1|  PREDICTED: probable mannose-1-phosphate guan...    230   1e-70   Setaria italica
gb|ADV59923.1|  putative GDP-mannose pyrophosphorylase                  230   1e-70   Citrus unshiu [satsuma mandarin]
gb|ACN66754.1|  GMP                                                     230   1e-70   Carica papaya [mamon]
ref|NP_001276240.1|  mannose-1-phosphate guanylyltransferase 1-like     229   2e-70   Glycine max [soybeans]
ref|XP_009412560.1|  PREDICTED: probable mannose-1-phosphate guan...    229   3e-70   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDM85018.1|  unnamed protein product                                229   3e-70   Triticum aestivum [Canadian hard winter wheat]
ref|XP_011035050.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    229   3e-70   Populus euphratica
ref|XP_002311190.1|  cytokinesis defective 1 family protein             229   4e-70   Populus trichocarpa [western balsam poplar]
gb|EMS68890.1|  Mannose-1-phosphate guanyltransferase beta              231   4e-70   Triticum urartu
gb|AHB17740.1|  GDP-mannose pyrophosphorylase                           229   4e-70   Pogonatherum paniceum
gb|KEH34762.1|  mannose-1-phosphate guanylyltransferase-like protein    227   5e-70   Medicago truncatula
ref|XP_002456631.1|  hypothetical protein SORBIDRAFT_03g039740          229   6e-70   Sorghum bicolor [broomcorn]
gb|EMT31032.1|  Mannose-1-phosphate guanyltransferase beta              229   6e-70   
ref|XP_008777609.1|  PREDICTED: probable mannose-1-phosphate guan...    228   7e-70   Phoenix dactylifera
ref|XP_007141846.1|  hypothetical protein PHAVU_008G230600g             228   7e-70   Phaseolus vulgaris [French bean]
gb|AES92771.2|  mannose-1-phosphate guanyltransferase                   226   7e-70   Medicago truncatula
ref|XP_002308180.1|  hypothetical protein POPTR_0006s09130g             228   9e-70   Populus trichocarpa [western balsam poplar]
ref|XP_003600761.1|  Mannose-1-phosphate guanyltransferase              228   1e-69   
ref|XP_003610574.1|  Mannose-1-phosphate guanyltransferase              228   1e-69   
ref|XP_011019240.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    227   1e-69   Populus euphratica
ref|XP_010931208.1|  PREDICTED: probable mannose-1-phosphate guan...    228   2e-69   Elaeis guineensis
ref|XP_006649823.1|  PREDICTED: probable mannose-1-phosphate guan...    227   2e-69   Oryza brachyantha
ref|NP_001049673.1|  Os03g0268400                                       227   2e-69   
gb|KJB76778.1|  hypothetical protein B456_012G106900                    225   3e-69   Gossypium raimondii
emb|CDP16056.1|  unnamed protein product                                227   3e-69   Coffea canephora [robusta coffee]
gb|KHG01639.1|  hypothetical protein F383_21310                         224   4e-69   Gossypium arboreum [tree cotton]
gb|KJB76777.1|  hypothetical protein B456_012G106900                    226   6e-69   Gossypium raimondii
sp|Q6Z9A3.1|GMPP3_ORYSJ  RecName: Full=Probable mannose-1-phospha...    226   6e-69   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009791580.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    226   8e-69   Nicotiana sylvestris
dbj|BAJ95730.1|  predicted protein                                      226   8e-69   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004984923.1|  PREDICTED: probable mannose-1-phosphate guan...    225   1e-68   Setaria italica
ref|XP_003564604.1|  PREDICTED: probable mannose-1-phosphate guan...    225   1e-68   Brachypodium distachyon [annual false brome]
ref|XP_009601713.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    225   1e-68   Nicotiana tomentosiformis
gb|EAY89395.1|  hypothetical protein OsI_10901                          225   1e-68   Oryza sativa Indica Group [Indian rice]
ref|XP_009407514.1|  PREDICTED: probable mannose-1-phosphate guan...    225   1e-68   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB76118.1|  hypothetical protein B456_012G072800                    224   2e-68   Gossypium raimondii
ref|XP_008803133.1|  PREDICTED: probable mannose-1-phosphate guan...    224   2e-68   Phoenix dactylifera
ref|XP_010262630.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    224   2e-68   Nelumbo nucifera [Indian lotus]
gb|ACK87007.1|  GDP-mannose pyrophosphorylase                           224   4e-68   Carica papaya [mamon]
ref|NP_001044795.1|  Os01g0847200                                       224   4e-68   
ref|XP_003558261.1|  PREDICTED: probable mannose-1-phosphate guan...    224   4e-68   Brachypodium distachyon [annual false brome]
tpg|DAA44592.1|  TPA: hypothetical protein ZEAMMB73_810828              222   5e-68   
ref|XP_003544186.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    224   7e-68   
ref|XP_007026922.1|  Glucose-1-phosphate adenylyltransferase fami...    223   8e-68   
ref|XP_007026924.1|  Glucose-1-phosphate adenylyltransferase fami...    223   8e-68   
gb|ABR17757.1|  unknown                                                 223   8e-68   Picea sitchensis
gb|KHG16049.1|  Mannose-1-phosphate guanyltransferase                   223   1e-67   Gossypium arboreum [tree cotton]
gb|AHX74219.1|  GDP-mannose pyrophosphorylase                           223   1e-67   
ref|XP_006645004.1|  PREDICTED: probable mannose-1-phosphate guan...    223   1e-67   Oryza brachyantha
gb|ABR15468.1|  GDP-mannose pyrophosphorylase                           223   1e-67   Pinus taeda
ref|NP_001142215.1|  hypothetical protein                               222   2e-67   Zea mays [maize]
ref|XP_010937548.1|  PREDICTED: probable mannose-1-phosphate guan...    222   2e-67   Elaeis guineensis
ref|XP_008785513.1|  PREDICTED: probable mannose-1-phosphate guan...    222   2e-67   
gb|AFL69832.1|  mannose-1-phosphate guanyltransferase 3                 222   2e-67   Oryza sativa Indica Group [Indian rice]
gb|AFL69830.1|  mannose-1-phosphate guanyltransferase 1                 222   2e-67   Oryza sativa Indica Group [Indian rice]
ref|XP_006429172.1|  hypothetical protein CICLE_v10012040mg             220   3e-67   Citrus clementina [clementine]
gb|ABR15469.1|  GDP-mannose pyrophosphorylase                           222   3e-67   Pinus taeda
gb|ABK24420.1|  unknown                                                 222   3e-67   Picea sitchensis
ref|XP_009143286.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    221   4e-67   Brassica rapa
ref|XP_010088589.1|  Mannose-1-phosphate guanylyltransferase 1          221   6e-67   Morus notabilis
ref|XP_006493574.1|  PREDICTED: probable mannose-1-phosphate guan...    221   6e-67   Citrus sinensis [apfelsine]
ref|XP_006429173.1|  hypothetical protein CICLE_v10012040mg             221   7e-67   
gb|AFL69833.1|  mannose-1-phosphate guanyltransferase 4                 220   1e-66   Oryza sativa Indica Group [Indian rice]
gb|EPS66224.1|  hypothetical protein M569_08552                         220   2e-66   Genlisea aurea
emb|CDX74832.1|  BnaA05g05780D                                          219   2e-66   
emb|CDY20480.1|  BnaC04g05640D                                          219   3e-66   Brassica napus [oilseed rape]
ref|XP_010923222.1|  PREDICTED: probable mannose-1-phosphate guan...    218   6e-66   Elaeis guineensis
ref|XP_009388596.1|  PREDICTED: probable mannose-1-phosphate guan...    218   6e-66   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008801637.1|  PREDICTED: probable mannose-1-phosphate guan...    218   9e-66   Phoenix dactylifera
ref|XP_008801635.1|  PREDICTED: probable mannose-1-phosphate guan...    218   9e-66   Phoenix dactylifera
ref|XP_004246437.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    218   1e-65   Solanum lycopersicum
ref|XP_006846369.1|  hypothetical protein AMTR_s00012p00262290          216   5e-65   Amborella trichopoda
ref|XP_009387284.1|  PREDICTED: probable mannose-1-phosphate guan...    214   2e-64   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN13115.1|  Mannose-1-phosphate guanylyltransferase 1               214   2e-64   Glycine soja [wild soybean]
ref|XP_006340997.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    214   3e-64   Solanum tuberosum [potatoes]
ref|NP_001276259.1|  mannose-1-phosphate guanylyltransferase 1-like     211   3e-63   
ref|XP_001782193.1|  predicted protein                                  209   3e-62   
ref|XP_002966693.1|  hypothetical protein SELMODRAFT_168373             208   5e-62   Selaginella moellendorffii
ref|XP_011016812.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    207   6e-62   Populus euphratica
ref|NP_191118.1|  probable mannose-1-phosphate guanylyltransferase 2    207   1e-61   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001769404.1|  predicted protein                                  207   1e-61   
ref|XP_002990832.1|  hypothetical protein SELMODRAFT_185648             204   2e-60   Selaginella moellendorffii
ref|XP_002974469.1|  hypothetical protein SELMODRAFT_267755             204   3e-60   Selaginella moellendorffii
ref|NP_001242262.1|  uncharacterized protein LOC100818016               201   3e-59   
ref|XP_010427339.1|  PREDICTED: probable mannose-1-phosphate guan...    198   3e-58   
ref|XP_006846372.1|  hypothetical protein AMTR_s00012p00262630          197   7e-58   Amborella trichopoda
ref|XP_010412788.1|  PREDICTED: probable mannose-1-phosphate guan...    191   2e-55   Camelina sativa [gold-of-pleasure]
gb|EMT15706.1|  Mannose-1-phosphate guanyltransferase beta              188   6e-55   
gb|ABK24789.1|  unknown                                                 187   5e-54   Picea sitchensis
ref|XP_010941227.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    172   3e-48   Elaeis guineensis
ref|XP_008799379.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    171   9e-48   Phoenix dactylifera
ref|XP_010275250.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    166   4e-46   Nelumbo nucifera [Indian lotus]
ref|XP_010456728.1|  PREDICTED: probable mannose-1-phosphate guan...    158   5e-45   
ref|XP_010438160.1|  PREDICTED: probable mannose-1-phosphate guan...    164   6e-45   Camelina sativa [gold-of-pleasure]
ref|XP_004347896.1|  mannose-1-phosphate guanyltransferase beta         159   2e-43   Capsaspora owczarzaki ATCC 30864
gb|KDP38962.1|  hypothetical protein JCGZ_00719                         159   4e-43   Jatropha curcas
ref|XP_010432971.1|  PREDICTED: probable mannose-1-phosphate guan...    159   5e-43   Camelina sativa [gold-of-pleasure]
ref|XP_001695916.1|  GDP-D-mannose pyrophosphorylase                    159   5e-43   Chlamydomonas reinhardtii
gb|AGC69739.1|  mannose-1-phosphate guanylyltransferase                 158   5e-43   Tieghemostelium lacteum
ref|XP_010432972.1|  PREDICTED: probable mannose-1-phosphate guan...    158   6e-43   
dbj|BAN16547.1|  ADB2008858                                             158   6e-43   Acytostelium subglobosum
ref|XP_006408596.1|  hypothetical protein EUTSA_v10002042mg             157   7e-43   
gb|EFA80657.1|  mannose-1-phosphate guanylyltransferase                 158   9e-43   Heterostelium album PN500
ref|XP_002310933.1|  cytokinesis defective 1 family protein             158   1e-42   Populus trichocarpa [western balsam poplar]
ref|XP_002102150.1|  GD19750                                            150   4e-42   
ref|XP_006284084.1|  hypothetical protein CARUB_v10005214mg             154   1e-41   
ref|XP_004353971.1|  mannose-1-phosphate guanylyltransferase            154   4e-41   Cavenderia fasciculata
ref|XP_002952855.1|  hypothetical protein VOLCADRAFT_81984              154   4e-41   Volvox carteri f. nagariensis
ref|XP_004368238.1|  GDPmannose pyrophosphorylase                       153   5e-41   Acanthamoeba castellanii str. Neff
gb|EMS58078.1|  Mannose-1-phosphate guanyltransferase beta              154   6e-41   Triticum urartu
gb|KFK29636.1|  hypothetical protein AALP_AA7G159400                    154   7e-41   Arabis alpina [alpine rockcress]
ref|XP_005536787.1|  mannose-1-phosphate guanylyltransferase            152   1e-40   Cyanidioschyzon merolae strain 10D
ref|XP_002038340.1|  GM10777                                            152   2e-40   Drosophila sechellia
gb|KIY95803.1|  hypothetical protein MNEG_12160                         151   2e-40   Monoraphidium neglectum
ref|XP_001994106.1|  GH23007                                            152   2e-40   Drosophila grimshawi
ref|NP_649498.1|  CG1129, isoform A                                     152   2e-40   Drosophila melanogaster
ref|XP_011033044.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    152   2e-40   Populus euphratica
ref|XP_009484708.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    144   4e-40   Pelecanus crispus
ref|XP_009537794.1|  hypothetical protein PHYSODRAFT_319613             151   4e-40   Phytophthora sojae
ref|XP_007789630.1|  putative mannose-1-phosphate guanyltransfera...    145   4e-40   
ref|XP_002095987.1|  GE25436                                            150   6e-40   Drosophila yakuba
ref|XP_002613614.1|  hypothetical protein BRAFLDRAFT_93657              150   6e-40   Branchiostoma floridae
ref|XP_001978865.1|  GG12578                                            150   6e-40   Drosophila erecta
gb|KIX96214.1|  mannose-1-phosphate guanyltransferase                   150   6e-40   Fonsecaea multimorphosa CBS 102226
ref|XP_006010396.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    150   9e-40   Latimeria chalumnae
gb|EPZ31169.1|  Mannose-1-phosphate guanyltransferase                   150   9e-40   Rozella allomycis CSF55
ref|XP_001359425.1|  GA10892                                            150   1e-39   Drosophila pseudoobscura pseudoobscura
gb|EOA95336.1|  Mannose-1-phosphate guanyltransferase beta              145   1e-39   Anas platyrhynchos [duck]
gb|KFO75973.1|  Mannose-1-phosphate guanyltransferase beta-A            145   1e-39   Cuculus canorus
ref|XP_002000465.1|  GI10243                                            150   1e-39   Drosophila mojavensis
ref|XP_637125.1|  mannose-1-phosphate guanylyltransferase               149   1e-39   Dictyostelium discoideum AX4
gb|ABI26715.1|  GDP-D-mannose pyrophosphorylase                         141   2e-39   Vitis vinifera
ref|XP_009558946.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    144   2e-39   Cuculus canorus
ref|XP_005028112.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    145   2e-39   
ref|XP_009858053.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    149   2e-39   Ciona intestinalis [sea vase]
ref|NP_194786.1|  Glucose-1-phosphate adenylyltransferase family ...    148   2e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008319281.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    149   2e-39   Cynoglossus semilaevis [half-smooth tongue sole]
gb|KFP10017.1|  Mannose-1-phosphate guanyltransferase beta              147   3e-39   Egretta garzetta
emb|CAB79775.1|  GDP-mannose pyrophosphorylase like protein             148   3e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003287195.1|  mannose-1-phosphate guanylyltransferase            148   4e-39   Dictyostelium purpureum
gb|KGL86216.1|  Mannose-1-phosphate guanyltransferase beta              146   4e-39   Charadrius vociferus
gb|KFM01180.1|  Mannose-1-phosphate guanyltransferase beta              146   4e-39   Aptenodytes forsteri
ref|XP_010755204.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    148   4e-39   
gb|KFV73795.1|  Mannose-1-phosphate guanyltransferase beta-A            146   4e-39   Picoides pubescens
ref|XP_006631022.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    148   5e-39   Lepisosteus oculatus
ref|XP_009905934.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    147   5e-39   Picoides pubescens
gb|KFW74715.1|  Mannose-1-phosphate guanyltransferase beta              145   5e-39   Manacus vitellinus
ref|XP_002074034.1|  GK12822                                            148   6e-39   
ref|XP_007888693.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    148   6e-39   Callorhinchus milii [Australian ghost shark]
gb|ACU20879.1|  unknown                                                 145   6e-39   Glycine max [soybeans]
ref|XP_005780850.1|  mannose-1-phosphate guanylyltransferase            148   6e-39   Emiliania huxleyi CCMP1516
ref|XP_005767633.1|  mannose-1-phosphate guanylyltransferase            148   6e-39   Emiliania huxleyi CCMP1516
ref|XP_008903956.1|  hypothetical protein PPTG_09918                    147   6e-39   Phytophthora parasitica INRA-310
ref|XP_005485662.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    145   6e-39   
gb|KFQ90789.1|  Mannose-1-phosphate guanyltransferase beta              146   7e-39   Nipponia nippon
dbj|GAM18590.1|  hypothetical protein SAMD00019534_017650               147   7e-39   Acytostelium subglobosum LB1
ref|XP_009644181.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    146   7e-39   Egretta garzetta
ref|XP_007575815.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    147   8e-39   Poecilia formosa
ref|XP_002739492.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    147   8e-39   Saccoglossus kowalevskii
ref|XP_005814035.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    147   8e-39   Xiphophorus maculatus
gb|KFV84323.1|  Mannose-1-phosphate guanyltransferase beta-A            145   9e-39   Struthio camelus australis
ref|XP_010716657.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    145   1e-38   Meleagris gallopavo [common turkey]
ref|XP_009879625.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    146   1e-38   Charadrius vociferus
gb|KFO57932.1|  Mannose-1-phosphate guanyltransferase beta              145   1e-38   Corvus brachyrhynchos
ref|NP_001087522.1|  mannose-1-phosphate guanyltransferase beta-A       147   1e-38   Xenopus laevis [clawed frog]
gb|KFU89083.1|  Mannose-1-phosphate guanyltransferase beta              145   1e-38   Chaetura pelagica
gb|KGL84089.1|  Mannose-1-phosphate guanyltransferase beta-A            145   1e-38   Tinamus guttatus
ref|XP_005422538.1|  PREDICTED: LOW QUALITY PROTEIN: mannose-1-ph...    145   1e-38   
gb|KFP04832.1|  Mannose-1-phosphate guanyltransferase beta-A            145   1e-38   Calypte anna
ref|XP_009475176.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    146   2e-38   Nipponia nippon
ref|XP_008630498.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    145   2e-38   
gb|KIW22466.1|  mannose-1-phosphate guanyltransferase                   147   2e-38   Cladophialophora immunda
ref|XP_008715026.1|  mannose-1-phosphate guanyltransferase              147   2e-38   Cyphellophora europaea CBS 101466
ref|XP_001955746.1|  GF18913                                            147   2e-38   Drosophila ananassae
emb|CBN80660.1|  Mannose-1-phosphate guanyltransferase beta             146   2e-38   Dicentrarchus labrax [European sea bass]
ref|XP_008301904.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    146   2e-38   Stegastes partitus
ref|XP_011182489.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    147   2e-38   Zeugodacus cucurbitae [melon fruit fly]
ref|XP_005141643.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    145   2e-38   Melopsittacus undulatus
ref|XP_003976606.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    146   2e-38   
ref|XP_002867340.1|  hypothetical protein ARALYDRAFT_913419             145   2e-38   
gb|KDR18890.1|  Mannose-1-phosphate guanyltransferase beta              146   2e-38   Zootermopsis nevadensis
ref|XP_011209172.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    146   2e-38   Bactrocera dorsalis [papaya fruit fly]
ref|NP_001280244.1|  mannose-1-phosphate guanyltransferase beta         146   2e-38   Gallus gallus [bantam]
ref|XP_005508929.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    145   2e-38   Columba livia [carrier pigeon]
ref|XP_009995252.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    144   2e-38   Chaetura pelagica
ref|XP_009279642.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    146   2e-38   Aptenodytes forsteri
ref|XP_010438164.1|  PREDICTED: probable mannose-1-phosphate guan...    146   2e-38   Camelina sativa [gold-of-pleasure]
ref|XP_009679063.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    145   2e-38   Struthio camelus australis
ref|XP_002899327.1|  mannose-1-phosphate guanyltransferase beta, ...    146   2e-38   Phytophthora infestans T30-4
ref|XP_010559913.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    146   2e-38   Haliaeetus leucocephalus
ref|XP_005724499.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    146   3e-38   Pundamilia nyererei
ref|XP_010222885.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    145   3e-38   Tinamus guttatus
ref|XP_007446277.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    146   3e-38   Lipotes vexillifer [baiji]
ref|XP_006783131.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    146   3e-38   Neolamprologus brichardi [lyretail cichlid]
ref|XP_003448400.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    146   3e-38   Oreochromis niloticus
ref|XP_005444503.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    145   3e-38   Falco cherrug
ref|XP_005052977.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    145   3e-38   
ref|XP_005229990.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    145   3e-38   Falco peregrinus [peregrine]
ref|XP_005938954.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    145   3e-38   
ref|XP_009080845.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    140   3e-38   Acanthisitta chloris
ref|XP_009957133.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    142   3e-38   Leptosomus discolor
ref|XP_005547199.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    144   4e-38   Macaca fascicularis [crab eating macaque]
ref|XP_005522264.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    145   4e-38   Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_008497167.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    145   4e-38   Calypte anna
ref|XP_009089239.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    145   4e-38   Serinus canaria [canary]
gb|KIW58407.1|  mannose-1-phosphate guanyltransferase, variant          145   4e-38   Exophiala xenobiotica
gb|KGK39965.1|  hypothetical protein JL09_g896                          145   4e-38   Pichia kudriavzevii
ref|XP_010388613.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    145   4e-38   
gb|ELU15028.1|  hypothetical protein CAPTEDRAFT_154984                  145   4e-38   
ref|XP_003217595.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    145   4e-38   
emb|CDX90771.1|  BnaA03g24510D                                          145   5e-38   
ref|XP_009134205.1|  PREDICTED: probable mannose-1-phosphate guan...    145   5e-38   
ref|XP_006025076.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    143   5e-38   
ref|XP_003894464.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    145   5e-38   
ref|XP_004581526.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    145   5e-38   
ref|NP_001008434.1|  mannose-1-phosphate guanyltransferase beta         145   5e-38   
ref|XP_007428476.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    145   5e-38   
gb|KIW58406.1|  mannose-1-phosphate guanyltransferase                   145   5e-38   
sp|Q9Y5P6.2|GMPPB_HUMAN  RecName: Full=Mannose-1-phosphate guanyl...    145   6e-38   
gb|KIV83904.1|  mannose-1-phosphate guanyltransferase                   145   6e-38   
ref|NP_068806.1|  mannose-1-phosphate guanyltransferase beta isof...    145   6e-38   
gb|EMP33974.1|  Mannose-1-phosphate guanyltransferase beta              144   6e-38   
ref|XP_004760688.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    145   6e-38   
gb|EKC35982.1|  Mannose-1-phosphate guanyltransferase beta              139   6e-38   
ref|XP_002758401.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    145   6e-38   
ref|XP_003936705.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    145   7e-38   
ref|XP_004069373.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    145   7e-38   
gb|KIW41620.1|  mannose-1-phosphate guanyltransferase, variant          145   7e-38   
emb|CDX90770.1|  BnaA03g24500D                                          145   8e-38   
gb|KIW41619.1|  mannose-1-phosphate guanyltransferase                   145   8e-38   
ref|NP_001252910.1|  mannose-1-phosphate guanyltransferase beta         145   8e-38   
gb|KIV97144.1|  mannose-1-phosphate guanyltransferase, variant 5        144   9e-38   
gb|KIW74238.1|  mannose-1-phosphate guanyltransferase                   144   1e-37   
ref|XP_007762213.1|  mannose-1-phosphate guanyltransferase              144   1e-37   
ref|XP_008730765.1|  mannose-1-phosphate guanyltransferase              144   1e-37   
ref|XP_009058578.1|  hypothetical protein LOTGIDRAFT_227532             144   1e-37   
gb|EGW08929.1|  Mannose-1-phosphate guanyltransferase beta              141   1e-37   
dbj|BAN82072.1|  hypothetical protein                                   143   1e-37   
ref|XP_011373733.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    141   1e-37   
gb|KIV97140.1|  mannose-1-phosphate guanyltransferase, variant 1        144   1e-37   
gb|KFP88537.1|  Mannose-1-phosphate guanyltransferase beta              141   1e-37   
ref|XP_007251546.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    144   2e-37   
ref|NP_001091347.1|  mannose-1-phosphate guanyltransferase beta-B       144   2e-37   
ref|XP_006275003.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    144   2e-37   
ref|XP_010866576.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    144   2e-37   
ref|XP_002056635.1|  GJ11048                                            144   2e-37   
ref|XP_004451926.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    144   2e-37   
gb|ETE70877.1|  Mannose-1-phosphate guanyltransferase beta-A            144   2e-37   
gb|EPQ07262.1|  Mannose-1-phosphate guanyltransferase beta              142   2e-37   
gb|EQB77062.1|  inositol hexakisphosphate kinase 1                      148   3e-37   
gb|KIW14322.1|  mannose-1-phosphate guanyltransferase                   144   3e-37   
gb|KIW62314.1|  mannose-1-phosphate guanyltransferase, variant          143   3e-37   
gb|AFK38783.1|  unknown                                                 135   3e-37   
dbj|BAC98266.1|  mKIAA1851 protein                                      147   3e-37   
ref|XP_004284004.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    143   3e-37   
ref|XP_004664300.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    143   4e-37   
ref|XP_001378168.2|  PREDICTED: mannose-1-phosphate guanyltransfe...    143   4e-37   
ref|XP_005851739.1|  hypothetical protein CHLNCDRAFT_133102             143   4e-37   
ref|XP_005279712.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    143   4e-37   
ref|XP_003476723.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    143   4e-37   
ref|XP_006174178.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    141   5e-37   
gb|KIW62313.1|  mannose-1-phosphate guanyltransferase                   143   5e-37   
ref|XP_002713245.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    142   5e-37   
ref|XP_005326986.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    142   5e-37   
emb|CCA19060.1|  mannose1phosphate guanyltransferase beta putative      142   5e-37   
ref|XP_003001766.1|  mannose-1-phosphate guanyltransferase              141   5e-37   
ref|XP_006053329.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    142   5e-37   
gb|ERE75626.1|  amphoterin-induced protein 3                            148   6e-37   
ref|XP_008702343.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    142   6e-37   
ref|XP_006892962.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    142   6e-37   
ref|XP_004368596.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    142   6e-37   
ref|XP_004018504.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    142   6e-37   
ref|XP_005696009.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    142   6e-37   
tpg|DAA16917.1|  TPA: mannose-1-phosphate guanyltransferase beta        142   6e-37   
gb|KFA61058.1|  hypothetical protein S40285_06340                       142   7e-37   
ref|XP_003639816.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    142   7e-37   
ref|XP_008153791.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    142   7e-37   
ref|XP_003982282.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    142   7e-37   
gb|KEY70742.1|  hypothetical protein S7711_03238                        142   7e-37   
ref|XP_004399306.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    142   7e-37   
ref|XP_004615299.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    142   7e-37   
ref|XP_006744594.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    142   7e-37   
ref|XP_002920584.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    142   7e-37   
ref|XP_004676214.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    142   7e-37   
ref|XP_005706305.1|  mannose-1-phosphate guanylyltransferase            142   8e-37   
ref|XP_003500392.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    142   8e-37   
ref|XP_006978396.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    142   8e-37   
ref|NP_808578.1|  mannose-1-phosphate guanyltransferase beta            142   8e-37   
ref|XP_005347941.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    142   8e-37   
gb|ERE75625.1|  amphoterin-induced protein 3                            147   8e-37   
ref|XP_005865488.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    142   8e-37   
ref|XP_006909163.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    142   9e-37   
ref|XP_005006710.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    142   9e-37   
ref|XP_005601090.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    141   1e-36   
ref|NP_001231470.1|  mannose-1-phosphate guanyltransferase beta         142   1e-36   
gb|ENI07108.1|  hypothetical protein COCC4DRAFT_58931                   145   1e-36   
ref|NP_001039633.1|  mannose-1-phosphate guanyltransferase beta         142   1e-36   
sp|Q6DBU5.1|GMPPB_DANRE  RecName: Full=Mannose-1-phosphate guanyl...    142   1e-36   
ref|NP_001003491.2|  mannose-1-phosphate guanyltransferase beta         142   1e-36   
ref|XP_006873657.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    142   1e-36   
ref|XP_005074974.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    142   1e-36   
ref|XP_003305665.1|  hypothetical protein PTT_18576                     145   1e-36   
gb|EUN28032.1|  hypothetical protein COCVIDRAFT_36908                   145   1e-36   
ref|XP_010967477.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    142   1e-36   
ref|XP_008522209.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    141   1e-36   
ref|XP_007714494.1|  hypothetical protein COCCADRAFT_38657              145   1e-36   
ref|XP_005188247.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    142   1e-36   
ref|NP_001102251.1|  mannose-1-phosphate guanyltransferase beta         141   1e-36   
ref|XP_006171011.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    141   1e-36   
ref|XP_001946280.2|  PREDICTED: mannose-1-phosphate guanyltransfe...    142   1e-36   
ref|XP_006196371.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    141   1e-36   
ref|XP_007695805.1|  hypothetical protein COCSADRAFT_167379             145   1e-36   
ref|XP_008851399.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    141   1e-36   
ref|XP_001931822.1|  mannose-1-phosphate guanyltransferase              141   2e-36   
ref|XP_004903552.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    141   2e-36   
ref|XP_011432652.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    141   2e-36   
ref|XP_007693175.1|  hypothetical protein COCMIDRAFT_41347              144   2e-36   
ref|XP_008020912.1|  hypothetical protein SETTUDRAFT_133795             144   2e-36   
ref|XP_007953540.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    141   2e-36   
ref|XP_006243873.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    142   2e-36   
ref|XP_007168787.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    141   2e-36   
ref|XP_009650791.1|  mannose-1-phosphate guanyltransferase              141   2e-36   
ref|XP_004419768.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    141   2e-36   
ref|XP_007818345.1|  hypothetical protein MAA_02156                     141   2e-36   
ref|XP_009261432.1|  hypothetical protein FPSE_10040                    141   2e-36   
gb|ESW95927.1|  Mannose-1-phosphate guanyltransferase                   141   2e-36   
ref|XP_003800644.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    141   2e-36   
ref|XP_001227041.1|  hypothetical protein CHGG_09114                    141   2e-36   
ref|XP_006682149.1|  hypothetical protein BATDEDRAFT_20856              140   2e-36   
ref|XP_002118061.1|  hypothetical protein TRIADDRAFT_33563              140   3e-36   
emb|CCX14363.1|  Similar to Mannose-1-phosphate guanyltransferase...    140   3e-36   
gb|EIF49787.1|  gdp-mannose pyrophosphorylase                           140   3e-36   
emb|CEG72190.1|  Putative Mannose-1-phosphate guanyltransferase         139   3e-36   
sp|Q9P8N0.1|MPG1_PICAN  RecName: Full=Mannose-1-phosphate guanylt...    140   3e-36   
ref|XP_003843812.1|  similar to mannose-1-phosphate guanyltransfe...    140   3e-36   
ref|XP_007129911.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    140   3e-36   
ref|XP_008865908.1|  hypothetical protein H310_03719                    140   3e-36   
ref|XP_009216053.1|  mannose-1-phosphate guanyltransferase              140   4e-36   
emb|CEG80275.1|  Putative Mannose-1-phosphate guanyltransferase         135   4e-36   
dbj|BAO41930.1|  mannose-1-phosphate guanyltransferase                  140   4e-36   
ref|XP_008471831.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    139   4e-36   
ref|XP_010613859.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    140   4e-36   
gb|EPS33496.1|  hypothetical protein PDE_08458                          140   4e-36   
emb|CEG72189.1|  Putative Mannose-1-phosphate guanyltransferase         139   4e-36   
ref|XP_003664129.1|  hypothetical protein MYCTH_2306594                 139   4e-36   
gb|EMD93443.1|  hypothetical protein COCHEDRAFT_1171155                 140   4e-36   
ref|XP_009154013.1|  mannose-1-phosphate guanyltransferase              140   5e-36   
sp|P0C5I2.1|GMPPB_PIG  RecName: Full=Mannose-1-phosphate guanyltr...    140   5e-36   
ref|XP_663190.1|  hypothetical protein AN5586.2                         140   6e-36   
ref|XP_004715224.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    140   6e-36   
ref|XP_008061359.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    140   6e-36   
ref|XP_003691872.1|  PREDICTED: LOW QUALITY PROTEIN: mannose-1-ph...    140   6e-36   
gb|ELR08715.1|  mannose-1-phosphate guanyltransferase                   140   6e-36   
ref|XP_008471832.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    140   7e-36   
ref|XP_003714211.1|  mannose-1-phosphate guanyltransferase              140   7e-36   
sp|Q5B1J4.2|MPG1_EMENI  RecName: Full=Mannose-1-phosphate guanylt...    139   7e-36   
ref|XP_009825082.1|  hypothetical protein H257_02941                    139   7e-36   
ref|XP_003727955.1|  PREDICTED: LOW QUALITY PROTEIN: mannose-1-ph...    139   7e-36   
ref|XP_005969337.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    139   7e-36   
ref|XP_006619482.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    140   8e-36   
ref|XP_007808986.1|  Mannose-1-phosphate guanyltransferase              139   8e-36   
gb|KDO34275.1|  hypothetical protein SPRG_01447                         139   8e-36   
gb|KFY19685.1|  hypothetical protein V491_04283                         139   8e-36   
ref|XP_008569780.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    139   8e-36   
gb|KEQ58368.1|  mannose-1-phosphate guanyltransferase                   139   8e-36   
ref|XP_006694627.1|  hypothetical protein CTHT_0042260                  139   8e-36   
gb|KDD72216.1|  hypothetical protein H632_c3685p0                       138   8e-36   
gb|KFY75477.1|  hypothetical protein V499_04519                         139   9e-36   
gb|KFY85514.1|  hypothetical protein V500_08352                         139   9e-36   
gb|KFY24564.1|  hypothetical protein V493_05165                         139   9e-36   
gb|EKV04708.1|  Mannose-1-phosphate guanyltransferase                   139   9e-36   
gb|KFY61094.1|  hypothetical protein V496_05148                         139   9e-36   
gb|KFX86865.1|  hypothetical protein V490_08766                         139   1e-35   
gb|KIE03647.1|  Mannose-1-phosphate guanyltransferase                   139   1e-35   
gb|KID78012.1|  Mannose-1-phosphate guanyltransferase                   139   1e-35   
gb|KID92963.1|  Mannose-1-phosphate guanyltransferase                   139   1e-35   
ref|XP_002410381.1|  GDP-mannose pyrophosphorylase/mannose-1-phos...    139   1e-35   
gb|KFY30807.1|  hypothetical protein V494_08049                         139   1e-35   
ref|XP_003399056.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    139   1e-35   
ref|XP_003487881.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    139   1e-35   
ref|XP_004931363.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    139   1e-35   
gb|KGO78487.1|  Nucleotidyl transferase                                 139   1e-35   
ref|XP_392845.4|  PREDICTED: mannose-1-phosphate guanyltransferas...    139   1e-35   
emb|CDO94334.1|  unnamed protein product                                139   1e-35   
gb|KIW02373.1|  mannose-1-phosphate guanyltransferase                   139   1e-35   
ref|XP_005410264.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    139   1e-35   
gb|KIM96308.1|  hypothetical protein OIDMADRAFT_44510                   139   1e-35   
gb|EWC45282.1|  mannose-1-phosphate guanyltransferase                   139   1e-35   
ref|XP_010284285.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    133   1e-35   
gb|EHJ63816.1|  hypothetical protein KGM_00281                          138   2e-35   
gb|KGO38018.1|  Nucleotidyl transferase                                 139   2e-35   
gb|KEQ68936.1|  mannose-1-phosphate guanyltransferase                   139   2e-35   
ref|XP_958811.1|  mannose-1-phosphate guanyltransferase                 138   2e-35   
emb|CBY20803.1|  unnamed protein product                                138   2e-35   
gb|KIV97139.1|  mannose-1-phosphate guanyltransferase                   139   2e-35   
ref|XP_003958483.1|  hypothetical protein KAFR_0G03160                  138   2e-35   
ref|XP_454190.1|  hypothetical protein                                  138   2e-35   
gb|ENN79514.1|  hypothetical protein YQE_03977                          138   2e-35   
ref|XP_003700573.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    138   2e-35   
ref|XP_011110042.1|  hypothetical protein H072_4082                     137   3e-35   
ref|XP_007416573.1|  hypothetical protein MELLADRAFT_112114             138   3e-35   
ref|XP_005106670.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    138   3e-35   
ref|XP_007725958.1|  mannose-1-phosphate guanyltransferase              138   3e-35   
ref|XP_007527319.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    138   3e-35   
gb|EPQ66408.1|  GDP-mannose pyrophosphorylase                           137   3e-35   
gb|KIX05331.1|  mannose-1-phosphate guanyltransferase                   138   3e-35   
ref|XP_001689367.1|  AGAP001299-PA                                      138   3e-35   
emb|CCU76871.1|  Mannose-1-phosphate guanyltransferase/PSA1             137   3e-35   
ref|XP_007738522.1|  mannose-1-phosphate guanyltransferase              138   3e-35   
gb|KER00901.1|  hypothetical protein AUEXF2481DRAFT_35153               138   4e-35   
ref|XP_006770662.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    138   4e-35   
ref|XP_007589492.1|  putative mannose-1-phosphate guanyltransfera...    138   4e-35   
gb|EFQ35847.1|  nucleotidyl transferase                                 137   4e-35   
ref|XP_003232421.1|  mannose-1-phosphate guanyltransferase              136   4e-35   
ref|XP_003684339.1|  hypothetical protein TPHA_0B02325                  137   4e-35   
ref|XP_011121615.1|  hypothetical protein AOL_s00078g50                 137   4e-35   
gb|KEQ87376.1|  mannose-1-phosphate guanyltransferase                   137   4e-35   
gb|EFX81986.1|  hypothetical protein DAPPUDRAFT_101964                  137   4e-35   
emb|CDM36708.1|  Mannose-1-phosphate guanyltransferase                  137   4e-35   
ref|XP_003650465.1|  hypothetical protein THITE_2169612                 137   4e-35   
ref|XP_011102864.1|  psa1p                                              137   4e-35   
gb|AAA69677.1|  mannose-1-phosphate guanyltransferase                   137   5e-35   
emb|CCI41880.1|  unnamed protein product                                142   5e-35   
ref|NP_010228.1|  mannose-1-phosphate guanylyltransferase               137   5e-35   
gb|KIL89588.1|  hypothetical protein FAVG1_07168                        137   5e-35   
gb|EMS20847.1|  mannose-1-phosphate guanylyltransferase                 137   5e-35   
gb|KIW93491.1|  mannose-1-phosphate guanyltransferase                   137   5e-35   
gb|KDN60215.1|  putative mannose-1-phosphate guanyltransferase          137   5e-35   



>ref|XP_009594230.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Nicotiana 
tomentosiformis]
 ref|XP_009594231.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Nicotiana 
tomentosiformis]
Length=361

 Score =   243 bits (620),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 117/125 (94%), Positives = 121/125 (97%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            L+KKSSPKLASG+HIVGNVLVDETA I EGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV
Sbjct  237  LKKKSSPKLASGSHIVGNVLVDETATIGEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            R+KKH CISSSIIGWHSTVGQWARVENMTILGEDVH+CDEIYSNGGVVLPHKEIKSSIL 
Sbjct  297  RVKKHACISSSIIGWHSTVGQWARVENMTILGEDVHVCDEIYSNGGVVLPHKEIKSSILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>dbj|BAP75927.1| GDP-mannose pyrophosphorylase, partial [Moringa oleifera]
Length=342

 Score =   241 bits (616),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 116/125 (93%), Positives = 121/125 (97%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKKSSPKLA+G ++VGNVLVDETAKI EGCLIGPDVAIGPGCV+ESGVRLSRCTVMRGV
Sbjct  218  LRKKSSPKLATGPNVVGNVLVDETAKIGEGCLIGPDVAIGPGCVVESGVRLSRCTVMRGV  277

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH CISSSIIGWHSTVGQWARVENMTILGEDVH+CDEIYSNGGVVLPHKEIKSSIL 
Sbjct  278  RIKKHACISSSIIGWHSTVGQWARVENMTILGEDVHVCDEIYSNGGVVLPHKEIKSSILK  337

Query  244  PEIVM  230
            PEIVM
Sbjct  338  PEIVM  342



>ref|XP_009759296.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Nicotiana 
sylvestris]
 ref|XP_009759297.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Nicotiana 
sylvestris]
 ref|XP_009759298.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Nicotiana 
sylvestris]
Length=361

 Score =   242 bits (618),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 116/125 (93%), Positives = 121/125 (97%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            L+K+SSPKLASG+HIVGNVLVDETA I EGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV
Sbjct  237  LKKRSSPKLASGSHIVGNVLVDETATIGEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            R+KKH CISSSIIGWHSTVGQWARVENMTILGEDVH+CDEIYSNGGVVLPHKEIKSSIL 
Sbjct  297  RVKKHACISSSIIGWHSTVGQWARVENMTILGEDVHVCDEIYSNGGVVLPHKEIKSSILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>ref|XP_002282422.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Vitis vinifera]
Length=361

 Score =   242 bits (617),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 117/125 (94%), Positives = 121/125 (97%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKKSS KLASGAHIVGNVLVDE+AKI EGCLIGPDVAIGPGCV+E+GVRLSRCTVMRGV
Sbjct  237  LRKKSSSKLASGAHIVGNVLVDESAKIGEGCLIGPDVAIGPGCVVEAGVRLSRCTVMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH CISSSIIGWHSTVGQWARVENMTILGEDVH+CDEIYSNGGVVLPHKEIKSSIL 
Sbjct  297  RIKKHACISSSIIGWHSTVGQWARVENMTILGEDVHVCDEIYSNGGVVLPHKEIKSSILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>gb|EYU19947.1| hypothetical protein MIMGU_mgv1a008833mg [Erythranthe guttata]
Length=361

 Score =   242 bits (617),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 117/125 (94%), Positives = 121/125 (97%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKKSSPKLASGAHI+GNVLVDE+AKI EGCLIGPDVAIGPGCV+ESGVRLSRCTVMRGV
Sbjct  237  LRKKSSPKLASGAHIIGNVLVDESAKIGEGCLIGPDVAIGPGCVVESGVRLSRCTVMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH CISSSIIGWHSTVGQWARVENMTILGEDVH+ DEIYSNGGVVLPHKEIKSSIL 
Sbjct  297  RIKKHACISSSIIGWHSTVGQWARVENMTILGEDVHVGDEIYSNGGVVLPHKEIKSSILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>gb|ABI48955.1| GDP-D-mannose pyrophosphorylase [Viola baoshanensis]
Length=361

 Score =   241 bits (614),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 115/125 (92%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKKSSPKLA+GA IVGNVLVDETA I EGCLIGPDVAIGPGCV+ESGVRLSRCTVMRGV
Sbjct  237  LRKKSSPKLATGASIVGNVLVDETATIGEGCLIGPDVAIGPGCVVESGVRLSRCTVMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH CISSSI+GWHSTVGQWARVENMTILGEDVH+CDE+YSNGGVVLPHKEIKSSIL 
Sbjct  297  RIKKHACISSSIVGWHSTVGQWARVENMTILGEDVHVCDEVYSNGGVVLPHKEIKSSILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>gb|KDP44883.1| hypothetical protein JCGZ_01383 [Jatropha curcas]
Length=361

 Score =   240 bits (612),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/125 (93%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRK+SS KLA+G HIVGNVLVDETAKI EGCLIGPDVAIGPGCV+ESGVRLSRCTVMRGV
Sbjct  237  LRKRSSSKLATGPHIVGNVLVDETAKIGEGCLIGPDVAIGPGCVVESGVRLSRCTVMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH CISSSIIGWHSTVGQWARVENMTILGEDVH+CDEIYSNGGVVLPHKEIKSSIL 
Sbjct  297  RIKKHACISSSIIGWHSTVGQWARVENMTILGEDVHVCDEIYSNGGVVLPHKEIKSSILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>gb|AFK47417.1| unknown [Lotus japonicus]
Length=353

 Score =   238 bits (607),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 114/125 (91%), Positives = 121/125 (97%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKKSS KLASG++IVGNV+VDETAKI EGCLIGPDVAIGPGC++ESGVRLSRCT+MRGV
Sbjct  229  LRKKSSSKLASGSNIVGNVIVDETAKIGEGCLIGPDVAIGPGCIVESGVRLSRCTIMRGV  288

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH CISSSIIGWHSTVGQWARVENMTILGEDVH+CDEIYSNGGVVLPHKEIKSSIL 
Sbjct  289  RIKKHACISSSIIGWHSTVGQWARVENMTILGEDVHVCDEIYSNGGVVLPHKEIKSSILK  348

Query  244  PEIVM  230
            PEIVM
Sbjct  349  PEIVM  353



>ref|XP_002524227.1| mannose-1-phosphate guanyltransferase, putative [Ricinus communis]
 gb|EEF38151.1| mannose-1-phosphate guanyltransferase, putative [Ricinus communis]
Length=361

 Score =   238 bits (608),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 112/125 (90%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKKSS +LA+GAH+VGNVL+DETAKI EGCLIGPDVAIGPGCV+ESGVRLSRCTVMRGV
Sbjct  237  LRKKSSSRLANGAHVVGNVLIDETAKIGEGCLIGPDVAIGPGCVVESGVRLSRCTVMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH CISSSI+GWHSTVGQW R+ENMTILGEDVH+CDEIYSNGGVVLPHKEIKSSIL 
Sbjct  297  RIKKHACISSSIVGWHSTVGQWTRIENMTILGEDVHVCDEIYSNGGVVLPHKEIKSSILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>gb|KJB74050.1| hypothetical protein B456_011G269100 [Gossypium raimondii]
Length=361

 Score =   238 bits (607),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 114/125 (91%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKK+SPKLASG ++VGNVLV ETAKI EGCLIGPDVAIGPGCV+ESGVRLSRCTVMRGV
Sbjct  237  LRKKASPKLASGPNVVGNVLVHETAKIGEGCLIGPDVAIGPGCVVESGVRLSRCTVMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH CISSSIIGWHST+GQWARVENMTILGEDVH+CDEIYSNGGVVLPHKEIKSSIL 
Sbjct  297  RIKKHACISSSIIGWHSTIGQWARVENMTILGEDVHVCDEIYSNGGVVLPHKEIKSSILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>gb|AIN40499.1| GDP-D-mannose pyrophosphorylase [Ziziphus jujuba]
Length=361

 Score =   238 bits (607),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 116/125 (93%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKKSS  LA+GAHIVGNVLVDETAKI EGCLIGPDVAIGPGCV+ESGVRLSRCTVMRGV
Sbjct  237  LRKKSSSNLATGAHIVGNVLVDETAKIGEGCLIGPDVAIGPGCVVESGVRLSRCTVMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH CISSSIIGWHSTVGQWARVENMTILGEDVH+ DEIYSNGGVVLPHKEIKSSIL 
Sbjct  297  RIKKHACISSSIIGWHSTVGQWARVENMTILGEDVHVSDEIYSNGGVVLPHKEIKSSILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>ref|XP_004490906.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Cicer 
arietinum]
Length=361

 Score =   238 bits (607),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 115/125 (92%), Positives = 121/125 (97%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKKSS KLASG++IVGNV+VDETAKI EGCLIGPDVAIGPGCV+ESGVRLSRCTVMRGV
Sbjct  237  LRKKSSSKLASGSNIVGNVIVDETAKIGEGCLIGPDVAIGPGCVVESGVRLSRCTVMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH CISSSIIGWHSTVGQWARVENMTILGEDVH+CDEIYSNGGVVLPHKEIKS+IL 
Sbjct  297  RIKKHACISSSIIGWHSTVGQWARVENMTILGEDVHVCDEIYSNGGVVLPHKEIKSNILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>ref|XP_009592609.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Nicotiana 
tomentosiformis]
 ref|XP_009592610.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Nicotiana 
tomentosiformis]
Length=361

 Score =   238 bits (607),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 115/125 (92%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            L+K SSPKLASG+HIVGNV+VDE+AKI EGCLIGPDVAIG GCVIESGVRLSRCTVMRGV
Sbjct  237  LKKNSSPKLASGSHIVGNVIVDESAKIGEGCLIGPDVAIGSGCVIESGVRLSRCTVMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH CISSSIIGWHSTVGQWARVENMTILGEDVH+CDEIYSNGGVVLPHKEIKSSIL 
Sbjct  297  RIKKHACISSSIIGWHSTVGQWARVENMTILGEDVHVCDEIYSNGGVVLPHKEIKSSILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>ref|XP_009797660.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Nicotiana 
sylvestris]
 ref|XP_009797661.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Nicotiana 
sylvestris]
 ref|XP_009797662.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Nicotiana 
sylvestris]
Length=361

 Score =   238 bits (607),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 115/125 (92%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            L+K SSPKLASG+HIVGNV+VDE+AKI EGCLIGPDVAIG GCVIESGVRLSRCTVMRGV
Sbjct  237  LKKNSSPKLASGSHIVGNVIVDESAKIGEGCLIGPDVAIGSGCVIESGVRLSRCTVMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH CISSSIIGWHSTVGQWARVENMTILGEDVH+CDEIYSNGGVVLPHKEIKSSIL 
Sbjct  297  RIKKHACISSSIIGWHSTVGQWARVENMTILGEDVHVCDEIYSNGGVVLPHKEIKSSILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>dbj|BAB62108.1| GDP-D-mannose pyrophosphorylase [Nicotiana tabacum]
Length=361

 Score =   238 bits (607),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/125 (92%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            L+K SSPKLASG+HIVGNV+VDE+AKI EGCLIGPDVAIG GCVIESGVRLSRCTVMRGV
Sbjct  237  LKKNSSPKLASGSHIVGNVIVDESAKIGEGCLIGPDVAIGSGCVIESGVRLSRCTVMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH CISSSIIGWHSTVGQWARVENMTILGEDVH+CDEIYSNGGVVLPHKEIKSSIL 
Sbjct  297  RIKKHACISSSIIGWHSTVGQWARVENMTILGEDVHVCDEIYSNGGVVLPHKEIKSSILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>ref|XP_006338820.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006338821.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like isoform 
X2 [Solanum tuberosum]
 ref|XP_006338822.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like isoform 
X3 [Solanum tuberosum]
Length=361

 Score =   238 bits (607),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/125 (90%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            L+K+SSPKLA G+HIVGNV+VDETAKI EGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV
Sbjct  237  LKKRSSPKLALGSHIVGNVIVDETAKIGEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            R+KKH C+S SIIGWHSTVGQWARVENMTILGEDVH+CDEIYSNGGVVLPHKEIKSSIL 
Sbjct  297  RVKKHACVSGSIIGWHSTVGQWARVENMTILGEDVHVCDEIYSNGGVVLPHKEIKSSILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>ref|XP_004240924.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Solanum 
lycopersicum]
 ref|XP_004240926.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Solanum 
lycopersicum]
 ref|XP_004240927.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Solanum 
lycopersicum]
 ref|XP_010322173.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Solanum 
lycopersicum]
 ref|XP_010322174.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Solanum 
lycopersicum]
Length=361

 Score =   238 bits (606),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/125 (90%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            L+K+SSPKLA G+HIVGNV+VDETAKI EGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV
Sbjct  237  LKKRSSPKLALGSHIVGNVIVDETAKIGEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            R+KKH C+S SIIGWHSTVGQWARVENMTILGEDVH+CDEIYSNGGVVLPHKEIKSSIL 
Sbjct  297  RVKKHACVSGSIIGWHSTVGQWARVENMTILGEDVHVCDEIYSNGGVVLPHKEIKSSILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>ref|XP_010095035.1| Mannose-1-phosphate guanylyltransferase 1 [Morus notabilis]
 gb|EXB58141.1| Mannose-1-phosphate guanylyltransferase 1 [Morus notabilis]
Length=361

 Score =   237 bits (604),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 114/125 (91%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKKSS KLA+G+HIVGNV+VDETAKI EGCLIGPDVAIGPGCV+E+GVRLSRCTVMRGV
Sbjct  237  LRKKSSSKLATGSHIVGNVIVDETAKIGEGCLIGPDVAIGPGCVVEAGVRLSRCTVMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH CISSSIIGWHSTVGQWARVENMTILGEDVH+ DEIYSNGGVVLPHKEIKSSIL 
Sbjct  297  RIKKHACISSSIIGWHSTVGQWARVENMTILGEDVHVSDEIYSNGGVVLPHKEIKSSILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>gb|ACN38266.1| GDP-D-mannose pyrophosphorylase [Actinidia latifolia]
Length=361

 Score =   237 bits (604),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 114/125 (91%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKK+S KLA+G HIVGNVLVDETA I EGCLIGPDVAIGPGCV+ESGVRLSRCTVMRGV
Sbjct  237  LRKKTSSKLATGPHIVGNVLVDETATIGEGCLIGPDVAIGPGCVVESGVRLSRCTVMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH CISSSIIGWHSTVGQWARVENMTILGEDVH+CDEIYSNGGV LPHKEIKSSIL 
Sbjct  297  RIKKHACISSSIIGWHSTVGQWARVENMTILGEDVHVCDEIYSNGGVALPHKEIKSSILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>gb|AET14212.1| GDP-D-mannose pyrophosphorylase [Brassica rapa subsp. chinensis]
Length=329

 Score =   235 bits (600),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 112/125 (90%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKKS  KL +GAHIVGNVLVDETAKI EGCLIGPDVAIGPGCV+ESGVRLSRCTVMRG 
Sbjct  205  LRKKSPAKLTTGAHIVGNVLVDETAKIGEGCLIGPDVAIGPGCVVESGVRLSRCTVMRGA  264

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH CISSSIIGWHSTVGQWAR+ENMTILGEDVH+CDEIY+NGGVVLPHKEIKS+IL 
Sbjct  265  RIKKHACISSSIIGWHSTVGQWARIENMTILGEDVHVCDEIYTNGGVVLPHKEIKSNILK  324

Query  244  PEIVM  230
            PEIVM
Sbjct  325  PEIVM  329



>ref|XP_009133383.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Brassica 
rapa]
 emb|CDY61780.1| BnaC03g72590D [Brassica napus]
Length=361

 Score =   236 bits (603),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 112/125 (90%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKKS  KL +GAHIVGNVLVDETAKI EGCLIGPDVAIGPGCV+ESGVRLSRCTVMRG 
Sbjct  237  LRKKSPAKLTTGAHIVGNVLVDETAKIGEGCLIGPDVAIGPGCVVESGVRLSRCTVMRGA  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH CISSSIIGWHSTVGQWAR+ENMTILGEDVH+CDEIY+NGGVVLPHKEIKS+IL 
Sbjct  297  RIKKHACISSSIIGWHSTVGQWARIENMTILGEDVHVCDEIYTNGGVVLPHKEIKSNILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>gb|ACN88684.2| GDP-D-mannose pyrophosphorylase [Malus domestica]
Length=333

 Score =   235 bits (600),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 115/125 (92%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRK SS KLA GAHIVGNVLVDETAKI EGCLIGPDVAIGPGC+IESGVRLSRCTVMRGV
Sbjct  209  LRKNSSSKLARGAHIVGNVLVDETAKIGEGCLIGPDVAIGPGCIIESGVRLSRCTVMRGV  268

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIK H CISSSIIGWHSTVGQWARVENMTILGEDVH+ DEIYSNGGVVLPHKEIKSSIL 
Sbjct  269  RIKNHACISSSIIGWHSTVGQWARVENMTILGEDVHVSDEIYSNGGVVLPHKEIKSSILK  328

Query  244  PEIVM  230
            PEIVM
Sbjct  329  PEIVM  333



>ref|XP_010067451.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Eucalyptus 
grandis]
 ref|XP_010067452.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Eucalyptus 
grandis]
 ref|XP_010067453.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Eucalyptus 
grandis]
 ref|XP_010067454.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Eucalyptus 
grandis]
 gb|KCW65590.1| hypothetical protein EUGRSUZ_G02988 [Eucalyptus grandis]
 gb|KCW65591.1| hypothetical protein EUGRSUZ_G02988 [Eucalyptus grandis]
 gb|KCW65592.1| hypothetical protein EUGRSUZ_G02988 [Eucalyptus grandis]
 gb|KCW65593.1| hypothetical protein EUGRSUZ_G02988 [Eucalyptus grandis]
Length=361

 Score =   236 bits (602),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 115/125 (92%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            +RKKSS KLA+G HIVGNVLVDETAKI EGCLIGPDVAIGPGCV+ESGVRLSRCTVMRGV
Sbjct  237  IRKKSSEKLATGPHIVGNVLVDETAKIGEGCLIGPDVAIGPGCVVESGVRLSRCTVMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH CISSSIIGWHSTVGQWARVENMTILGEDVH+ DEIYSNGGVVLPHKEIKSSIL 
Sbjct  297  RIKKHACISSSIIGWHSTVGQWARVENMTILGEDVHVGDEIYSNGGVVLPHKEIKSSILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>gb|ABB53473.1| GDP-mannose pyrophosphorylase [Malpighia glabra]
 gb|ABX80393.1| GDP-mannose pyrophosphorylase [Malpighia glabra]
Length=361

 Score =   236 bits (602),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 112/125 (90%), Positives = 121/125 (97%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKKSS KLA+G+++VGNVLVDETAKI EGCLIGPDVAIGPGCV+ESGVRLSRCTVMRGV
Sbjct  237  LRKKSSTKLATGSNVVGNVLVDETAKIGEGCLIGPDVAIGPGCVVESGVRLSRCTVMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH C+SSSIIGWHSTVGQWARVENMTILGEDVH+CDE+YSNGGVVLPHKEIKSSI+ 
Sbjct  297  RIKKHACVSSSIIGWHSTVGQWARVENMTILGEDVHLCDEVYSNGGVVLPHKEIKSSIIK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>ref|XP_008371997.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Malus domestica]
 ref|XP_009351402.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Pyrus x 
bretschneideri]
Length=361

 Score =   236 bits (602),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 115/125 (92%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRK SS KLA GAHIVGNVLVDETAKI EGCLIGPDVAIGPGC+IESGVRLSRCTVMRGV
Sbjct  237  LRKNSSSKLARGAHIVGNVLVDETAKIGEGCLIGPDVAIGPGCIIESGVRLSRCTVMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIK H CISSSIIGWHSTVGQWARVENMTILGEDVH+ DEIYSNGGVVLPHKEIKSSIL 
Sbjct  297  RIKNHACISSSIIGWHSTVGQWARVENMTILGEDVHVSDEIYSNGGVVLPHKEIKSSILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>gb|AGI78460.1| GDP-D-mannose pyrophosphorylase [Camellia sinensis]
Length=361

 Score =   236 bits (601),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/125 (90%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKKS  KL++G HIVGNVLVDET+KI EGCLIGPDVAIGPGCV+E+GVRLSRCTVMRGV
Sbjct  237  LRKKSPSKLSTGPHIVGNVLVDETSKIGEGCLIGPDVAIGPGCVVEAGVRLSRCTVMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH CISSSIIGWHSTVGQWARVENMTILGEDVH+CDEIYSNGGVVLPHKEIKSSIL 
Sbjct  297  RIKKHACISSSIIGWHSTVGQWARVENMTILGEDVHVCDEIYSNGGVVLPHKEIKSSILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>ref|XP_002316262.1| cytokinesis defective 1 family protein [Populus trichocarpa]
 gb|EEF02433.1| cytokinesis defective 1 family protein [Populus trichocarpa]
Length=361

 Score =   235 bits (600),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/125 (90%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRK SS KLA+G HIVGNVLVDETAKI EGCLIGPDVAIGPGC++ESGVRLSRC+VMRGV
Sbjct  237  LRKNSSSKLANGPHIVGNVLVDETAKIGEGCLIGPDVAIGPGCIVESGVRLSRCSVMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH CISSSIIGWHSTVGQWARVEN+TILGEDVH+CDEIYSNGGVVLPHKEIKSSIL 
Sbjct  297  RIKKHACISSSIIGWHSTVGQWARVENLTILGEDVHVCDEIYSNGGVVLPHKEIKSSILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>ref|XP_011036070.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Populus 
euphratica]
 ref|XP_011036071.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Populus 
euphratica]
Length=361

 Score =   235 bits (600),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/125 (90%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRK SS KLA+G HIVGNVLVDETAKI EGCLIGPDVAIGPGC++ESGVRLSRC+VMRGV
Sbjct  237  LRKNSSSKLANGPHIVGNVLVDETAKIGEGCLIGPDVAIGPGCIVESGVRLSRCSVMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH CISSSIIGWHSTVGQWARVEN+TILGEDVH+CDEIYSNGGVVLPHKEIKSSIL 
Sbjct  297  RIKKHACISSSIIGWHSTVGQWARVENLTILGEDVHVCDEIYSNGGVVLPHKEIKSSILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>ref|NP_001234025.1| GDP-mannose pyrophosphorylase [Solanum lycopersicum]
 gb|AAT37498.2| GDP-mannose pyrophosphorylase [Solanum lycopersicum]
Length=361

 Score =   235 bits (599),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 114/125 (91%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            L+K SSPKLASG HIVGNV+VDE+AKI EGCLIGPDVAIG GCVIESGVRLSRCTVMRGV
Sbjct  237  LKKHSSPKLASGPHIVGNVIVDESAKIGEGCLIGPDVAIGSGCVIESGVRLSRCTVMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH CIS SIIGWHSTVGQWARVENMTILGEDVH+CDEIYSNGGVVLPHKEIKSSIL 
Sbjct  297  RIKKHACISGSIIGWHSTVGQWARVENMTILGEDVHVCDEIYSNGGVVLPHKEIKSSILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>emb|CDY07636.1| BnaA03g18750D [Brassica napus]
Length=401

 Score =   236 bits (602),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/125 (90%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKKS  KL +GAHIVGNVLVDETAKI EGCLIGPDVAIGPGCV+ESGVRLSRCTVMRG 
Sbjct  277  LRKKSPAKLTTGAHIVGNVLVDETAKIGEGCLIGPDVAIGPGCVVESGVRLSRCTVMRGA  336

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH CISSSIIGWHSTVGQWAR+ENMTILGEDVH+CDEIY+NGGVVLPHKEIKS+IL 
Sbjct  337  RIKKHACISSSIIGWHSTVGQWARIENMTILGEDVHVCDEIYTNGGVVLPHKEIKSNILK  396

Query  244  PEIVM  230
            PEIVM
Sbjct  397  PEIVM  401



>ref|NP_001275205.1| GDP-mannose pyrophosphorylase [Solanum tuberosum]
 gb|AAD01737.1| GDP-mannose pyrophosphorylase [Solanum tuberosum]
Length=361

 Score =   235 bits (599),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 114/125 (91%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            L+K SSPKLASG HIVGNV+VDE+AKI EGCLIGPDVAIG GCVIESGVRLSRCTVMRGV
Sbjct  237  LKKHSSPKLASGPHIVGNVIVDESAKIGEGCLIGPDVAIGSGCVIESGVRLSRCTVMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH CIS SIIGWHSTVGQWARVENMTILGEDVH+CDEIYSNGGVVLPHKEIKSSIL 
Sbjct  297  RIKKHACISGSIIGWHSTVGQWARVENMTILGEDVHVCDEIYSNGGVVLPHKEIKSSILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>ref|XP_007009213.1| Glucose-1-phosphate adenylyltransferase family protein isoform 
3 [Theobroma cacao]
 gb|EOY18023.1| Glucose-1-phosphate adenylyltransferase family protein isoform 
3 [Theobroma cacao]
Length=362

 Score =   235 bits (599),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/125 (90%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKK+S KLA+G HIVGNVLV E+AKI EGCLIGPDVAIGPGCV+ESGVRLSRCTVMRGV
Sbjct  238  LRKKASTKLATGPHIVGNVLVHESAKIGEGCLIGPDVAIGPGCVVESGVRLSRCTVMRGV  297

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            R+KKH CISSSIIGWHST+GQWARVENMTILGEDVH+CDEIYSNGGVVLPHKEIKSSIL 
Sbjct  298  RVKKHACISSSIIGWHSTIGQWARVENMTILGEDVHVCDEIYSNGGVVLPHKEIKSSILK  357

Query  244  PEIVM  230
            PEIVM
Sbjct  358  PEIVM  362



>ref|XP_003616475.1| Mannose-1-phosphate guanyltransferase [Medicago truncatula]
 gb|AAT58365.1| GMPase [Medicago sativa]
 gb|AES99433.1| mannose-1-phosphate guanylyltransferase-like protein [Medicago 
truncatula]
Length=361

 Score =   234 bits (598),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 112/125 (90%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKKSS KLA G++IVGNV+VDETAKI EGCLIGPDVAIGPGC++ESGVRLSRCTVMRGV
Sbjct  237  LRKKSSSKLAGGSNIVGNVIVDETAKIGEGCLIGPDVAIGPGCIVESGVRLSRCTVMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH CISSSIIGWHSTVGQWARVENMTILGEDVH+CDEIYSNGGVVLPHKEIK++IL 
Sbjct  297  RIKKHACISSSIIGWHSTVGQWARVENMTILGEDVHVCDEIYSNGGVVLPHKEIKTNILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>ref|XP_007009211.1| Glucose-1-phosphate adenylyltransferase family protein isoform 
1 [Theobroma cacao]
 ref|XP_007009212.1| Glucose-1-phosphate adenylyltransferase family protein isoform 
1 [Theobroma cacao]
 ref|XP_007009214.1| Glucose-1-phosphate adenylyltransferase family protein isoform 
1 [Theobroma cacao]
 gb|EOY18021.1| Glucose-1-phosphate adenylyltransferase family protein isoform 
1 [Theobroma cacao]
 gb|EOY18022.1| Glucose-1-phosphate adenylyltransferase family protein isoform 
1 [Theobroma cacao]
 gb|EOY18024.1| Glucose-1-phosphate adenylyltransferase family protein isoform 
1 [Theobroma cacao]
Length=361

 Score =   234 bits (598),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 112/125 (90%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKK+S KLA+G HIVGNVLV E+AKI EGCLIGPDVAIGPGCV+ESGVRLSRCTVMRGV
Sbjct  237  LRKKASTKLATGPHIVGNVLVHESAKIGEGCLIGPDVAIGPGCVVESGVRLSRCTVMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            R+KKH CISSSIIGWHST+GQWARVENMTILGEDVH+CDEIYSNGGVVLPHKEIKSSIL 
Sbjct  297  RVKKHACISSSIIGWHSTIGQWARVENMTILGEDVHVCDEIYSNGGVVLPHKEIKSSILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>ref|NP_001234084.1| GDP-mannose pyrophosphorylase [Solanum lycopersicum]
 gb|ABE03745.2| GDP-mannose pyrophosphorylase [Solanum lycopersicum]
Length=361

 Score =   234 bits (598),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 114/125 (91%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            L+K SSPKLASG HIVGNV+VDE+AKI EGCLIGPDVAIG GCVIESGVRLSRCTVMRGV
Sbjct  237  LKKHSSPKLASGPHIVGNVIVDESAKIGEGCLIGPDVAIGSGCVIESGVRLSRCTVMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH CIS SIIGWHSTVGQWARVENMTILGEDVH+CDEIYSNGGVVLPHKEIKSSIL 
Sbjct  297  RIKKHACISGSIIGWHSTVGQWARVENMTILGEDVHVCDEIYSNGGVVLPHKEIKSSILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>ref|XP_007009215.1| Glucose-1-phosphate adenylyltransferase family protein isoform 
5 [Theobroma cacao]
 gb|EOY18025.1| Glucose-1-phosphate adenylyltransferase family protein isoform 
5 [Theobroma cacao]
Length=362

 Score =   234 bits (598),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 112/125 (90%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKK+S KLA+G HIVGNVLV E+AKI EGCLIGPDVAIGPGCV+ESGVRLSRCTVMRGV
Sbjct  238  LRKKASTKLATGPHIVGNVLVHESAKIGEGCLIGPDVAIGPGCVVESGVRLSRCTVMRGV  297

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            R+KKH CISSSIIGWHST+GQWARVENMTILGEDVH+CDEIYSNGGVVLPHKEIKSSIL 
Sbjct  298  RVKKHACISSSIIGWHSTIGQWARVENMTILGEDVHVCDEIYSNGGVVLPHKEIKSSILK  357

Query  244  PEIVM  230
            PEIVM
Sbjct  358  PEIVM  362



>gb|KDO69186.1| hypothetical protein CISIN_1g018060mg [Citrus sinensis]
Length=302

 Score =   233 bits (593),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 113/125 (90%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKKSS KLA+GA+IVGNVLV E+A+I EGCLIGPDVA+GPGCV+ESGVRLSRCTVMRGV
Sbjct  178  LRKKSSLKLATGANIVGNVLVHESAQIGEGCLIGPDVAVGPGCVVESGVRLSRCTVMRGV  237

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH CISSSIIGWHSTVGQWARVENMTILGEDVH+CDEIYSNGGVVLPHKEIKSSIL 
Sbjct  238  RIKKHACISSSIIGWHSTVGQWARVENMTILGEDVHVCDEIYSNGGVVLPHKEIKSSILK  297

Query  244  PEIVM  230
            PEIVM
Sbjct  298  PEIVM  302



>ref|XP_011076786.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Sesamum 
indicum]
 ref|XP_011076787.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Sesamum 
indicum]
Length=361

 Score =   234 bits (597),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 114/125 (91%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKKSS KLA G HI+GNVLVDE+AKI EGCLIGPDVAIGPGCV+ESGVRLSRCTVMRGV
Sbjct  237  LRKKSSSKLALGTHIIGNVLVDESAKIGEGCLIGPDVAIGPGCVVESGVRLSRCTVMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH CISSSIIGWHSTVGQWARVENMTILGEDVH+ DEIYSNGGVVLPHKEIKSSIL 
Sbjct  297  RIKKHACISSSIIGWHSTVGQWARVENMTILGEDVHVGDEIYSNGGVVLPHKEIKSSILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>emb|CDP00140.1| unnamed protein product [Coffea canephora]
Length=361

 Score =   234 bits (597),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 113/125 (90%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKK + KLASG HIVGNVLV E+AKI EGCLIGPDVAIGPGCV+E+GVRLSRCTVMRGV
Sbjct  237  LRKKDASKLASGTHIVGNVLVHESAKIGEGCLIGPDVAIGPGCVVEAGVRLSRCTVMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH CISSSIIGWHSTVGQWARVENMTILGEDVH+CDEIYSNGGVVLPHKEIKSSIL 
Sbjct  297  RIKKHACISSSIIGWHSTVGQWARVENMTILGEDVHVCDEIYSNGGVVLPHKEIKSSILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>ref|XP_006486418.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1-like 
[Citrus sinensis]
Length=361

 Score =   234 bits (597),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 113/125 (90%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKKSS KLA+GA+IVGNVLV E+A+I EGCLIGPDVA+GPGCV+ESGVRLSRCTVMRGV
Sbjct  237  LRKKSSFKLATGANIVGNVLVHESAQIGEGCLIGPDVAVGPGCVVESGVRLSRCTVMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH CISSSIIGWHSTVGQWARVENMTILGEDVH+CDEIYSNGGVVLPHKEIKSSIL 
Sbjct  297  RIKKHACISSSIIGWHSTVGQWARVENMTILGEDVHVCDEIYSNGGVVLPHKEIKSSILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>ref|XP_006435610.1| hypothetical protein CICLE_v10033733mg [Citrus clementina]
 gb|ESR48850.1| hypothetical protein CICLE_v10033733mg [Citrus clementina]
Length=361

 Score =   234 bits (597),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 113/125 (90%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKKSS KLA+GA+IVGNVLV E+A+I EGCLIGPDVA+GPGCV+ESGVRLSRCTVMRGV
Sbjct  237  LRKKSSFKLATGANIVGNVLVHESAQIGEGCLIGPDVAVGPGCVVESGVRLSRCTVMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH CISSSIIGWHSTVGQWARVENMTILGEDVH+CDEIYSNGGVVLPHKEIKSSIL 
Sbjct  297  RIKKHACISSSIIGWHSTVGQWARVENMTILGEDVHVCDEIYSNGGVVLPHKEIKSSILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>ref|XP_004970565.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 3-like 
[Setaria italica]
Length=361

 Score =   234 bits (597),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKKS+ KLASGAH+VGNVLV E+AKI EGCLIGPDVAIGPGCV+E GVRLSRCTVMRGV
Sbjct  237  LRKKSAAKLASGAHVVGNVLVHESAKIGEGCLIGPDVAIGPGCVVEDGVRLSRCTVMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH CIS+SIIGWHSTVGQWAR+ENMTILGEDVH+CDE+YSNGGVVLPHKEIKSSIL 
Sbjct  297  RIKKHACISNSIIGWHSTVGQWARIENMTILGEDVHVCDEVYSNGGVVLPHKEIKSSILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>gb|KDO69184.1| hypothetical protein CISIN_1g018060mg [Citrus sinensis]
Length=361

 Score =   234 bits (596),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 113/125 (90%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKKSS KLA+GA+IVGNVLV E+A+I EGCLIGPDVA+GPGCV+ESGVRLSRCTVMRGV
Sbjct  237  LRKKSSLKLATGANIVGNVLVHESAQIGEGCLIGPDVAVGPGCVVESGVRLSRCTVMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH CISSSIIGWHSTVGQWARVENMTILGEDVH+CDEIYSNGGVVLPHKEIKSSIL 
Sbjct  297  RIKKHACISSSIIGWHSTVGQWARVENMTILGEDVHVCDEIYSNGGVVLPHKEIKSSILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>ref|XP_004307574.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Fragaria 
vesca subsp. vesca]
 ref|XP_004307575.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Fragaria 
vesca subsp. vesca]
Length=361

 Score =   234 bits (596),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 114/125 (91%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKKSS KLA G HIVGNVLVDETA I EGCLIGPDVAIGPGCV+ESGVRLSRCTVMRGV
Sbjct  237  LRKKSSSKLAKGTHIVGNVLVDETATIGEGCLIGPDVAIGPGCVVESGVRLSRCTVMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH CIS SIIGWHSTVGQWARVENMTILGEDVH+ DEIYSNGGVVLPHKEIKSSIL 
Sbjct  297  RIKKHACISGSIIGWHSTVGQWARVENMTILGEDVHVSDEIYSNGGVVLPHKEIKSSILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>gb|KDO69185.1| hypothetical protein CISIN_1g018060mg [Citrus sinensis]
Length=358

 Score =   234 bits (596),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 113/125 (90%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKKSS KLA+GA+IVGNVLV E+A+I EGCLIGPDVA+GPGCV+ESGVRLSRCTVMRGV
Sbjct  234  LRKKSSLKLATGANIVGNVLVHESAQIGEGCLIGPDVAVGPGCVVESGVRLSRCTVMRGV  293

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH CISSSIIGWHSTVGQWARVENMTILGEDVH+CDEIYSNGGVVLPHKEIKSSIL 
Sbjct  294  RIKKHACISSSIIGWHSTVGQWARVENMTILGEDVHVCDEIYSNGGVVLPHKEIKSSILK  353

Query  244  PEIVM  230
            PEIVM
Sbjct  354  PEIVM  358



>ref|XP_010534527.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Tarenaya 
hassleriana]
 ref|XP_010534528.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Tarenaya 
hassleriana]
Length=361

 Score =   234 bits (596),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKKSS KLA G HIVGNV+VDETAKI EGCLIGPDVAIGPGC++ESGVRLSRCT+MRG 
Sbjct  237  LRKKSSSKLARGEHIVGNVIVDETAKIGEGCLIGPDVAIGPGCIVESGVRLSRCTIMRGA  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH CISSSIIGWHSTVG+WARVENMTILGEDVH+CDEIYSNGGVVLPHKEIKSSI+ 
Sbjct  297  RIKKHACISSSIIGWHSTVGKWARVENMTILGEDVHVCDEIYSNGGVVLPHKEIKSSIMK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>ref|XP_010554624.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Tarenaya 
hassleriana]
 ref|XP_010554625.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Tarenaya 
hassleriana]
Length=361

 Score =   233 bits (595),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 112/125 (90%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKKSS KLA+G+HIVGNV+V E+AKI EGCLIGPDVAIGPGCV+E GVRLSRCTVMRGV
Sbjct  237  LRKKSSSKLATGSHIVGNVIVHESAKIGEGCLIGPDVAIGPGCVVEPGVRLSRCTVMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH CISSSIIGWHSTVGQWARVENMTILGEDVH+CDEIYSNGGVVLPHKEIKSSI+ 
Sbjct  297  RIKKHACISSSIIGWHSTVGQWARVENMTILGEDVHVCDEIYSNGGVVLPHKEIKSSIMK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>ref|XP_006294448.1| hypothetical protein CARUB_v10023461mg, partial [Capsella rubella]
 gb|EOA27346.1| hypothetical protein CARUB_v10023461mg, partial [Capsella rubella]
Length=371

 Score =   234 bits (596),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKKS  KL SG+HIVGNVLVDETAKI EGCLIGPDVAIGPGC++ESGVRLSRCTVMRGV
Sbjct  247  LRKKSPAKLTSGSHIVGNVLVDETAKIGEGCLIGPDVAIGPGCIVESGVRLSRCTVMRGV  306

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH CISSSIIGWHSTVGQWAR+ENMTILGEDVH+ DEIYSNGGVVLPHKEIK++IL 
Sbjct  307  RIKKHACISSSIIGWHSTVGQWARIENMTILGEDVHVSDEIYSNGGVVLPHKEIKTNILK  366

Query  244  PEIVM  230
            PEIVM
Sbjct  367  PEIVM  371



>ref|XP_009141836.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Brassica 
rapa]
Length=361

 Score =   233 bits (594),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKKS  KL +GAHIVGNVLVDETAKI EGCLIGPDVAIGPGCV+ESGVRLSRCTVMRGV
Sbjct  237  LRKKSPAKLTTGAHIVGNVLVDETAKIGEGCLIGPDVAIGPGCVVESGVRLSRCTVMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH C+SSSIIGWHSTVGQWAR+ENMTILGEDVH+ DEIY+NGGVVLPHKEIKS+IL 
Sbjct  297  RIKKHACVSSSIIGWHSTVGQWARIENMTILGEDVHVGDEIYTNGGVVLPHKEIKSNILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>ref|XP_010505663.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Camelina 
sativa]
 ref|XP_010505664.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Camelina 
sativa]
 ref|XP_010508973.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Camelina 
sativa]
 ref|XP_010517339.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Camelina 
sativa]
Length=361

 Score =   233 bits (593),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKKS  KL SG HIVGNVLVDETAKI EGCLIGPDVAIGPGC++ESGVRLSRCTVMRGV
Sbjct  237  LRKKSPAKLTSGPHIVGNVLVDETAKIGEGCLIGPDVAIGPGCIVESGVRLSRCTVMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH CISSSIIGWHSTVGQWAR+ENMTILGEDVH+ DEIYSNGGVVLPHKEIK++IL 
Sbjct  297  RIKKHACISSSIIGWHSTVGQWARIENMTILGEDVHVSDEIYSNGGVVLPHKEIKTNILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>gb|ACR34770.1| unknown [Zea mays]
 tpg|DAA56850.1| TPA: hypothetical protein ZEAMMB73_139428 [Zea mays]
Length=302

 Score =   231 bits (588),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            +RKKS+ KLA+GAH+VGNVLV E+AKI EGCLIGPDVAIGPGCV+E GVRLSRCTVMRGV
Sbjct  178  IRKKSAAKLATGAHVVGNVLVHESAKIGEGCLIGPDVAIGPGCVVEDGVRLSRCTVMRGV  237

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH CIS+SIIGWHSTVGQWAR+ENMTILGEDVH+CDE+YSNGGVVLPHKEIKSSIL 
Sbjct  238  RIKKHACISNSIIGWHSTVGQWARIENMTILGEDVHVCDEVYSNGGVVLPHKEIKSSILK  297

Query  244  PEIVM  230
            PEIVM
Sbjct  298  PEIVM  302



>gb|ACM90325.1| GDP-D-mannose pyrophosphorylase [Ribes nigrum]
Length=261

 Score =   229 bits (584),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKKSS KLA+G+HIVGNVLVDETAKI EGCLIGPDVAIGPGCV+ESGVRLSRCTVMR  
Sbjct  137  LRKKSSSKLATGSHIVGNVLVDETAKIGEGCLIGPDVAIGPGCVVESGVRLSRCTVMRNA  196

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            R+KKH CIS SIIGWHSTVGQWARVENMTILGEDVH+CDEIYSNGGVVLP KEIK+SIL 
Sbjct  197  RVKKHACISGSIIGWHSTVGQWARVENMTILGEDVHVCDEIYSNGGVVLPXKEIKTSILK  256

Query  244  PEIVM  230
            PEIVM
Sbjct  257  PEIVM  261



>ref|XP_008441398.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Cucumis 
melo]
Length=361

 Score =   233 bits (593),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 114/125 (91%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRK SS  LA G+HIVGNVLVDETAKI EGCLIGPDVAIGPGCV+ESGVRLSRCTVMRGV
Sbjct  237  LRKNSSSMLAVGSHIVGNVLVDETAKIGEGCLIGPDVAIGPGCVVESGVRLSRCTVMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH CISSSIIGWHSTVGQWARVENMTILGEDVH+ DEIYSNGGVVLPHKEIKSSIL 
Sbjct  297  RIKKHACISSSIIGWHSTVGQWARVENMTILGEDVHVGDEIYSNGGVVLPHKEIKSSILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>ref|NP_001142302.1| uncharacterized protein LOC100274471 [Zea mays]
 ref|XP_008654645.1| PREDICTED: uncharacterized protein LOC100274471 isoform X1 [Zea 
mays]
 ref|XP_008654646.1| PREDICTED: uncharacterized protein LOC100274471 isoform X1 [Zea 
mays]
 ref|XP_008654647.1| PREDICTED: uncharacterized protein LOC100274471 isoform X1 [Zea 
mays]
 gb|ACF80591.1| unknown [Zea mays]
 gb|ACF88136.1| unknown [Zea mays]
 gb|AFW84601.1| hypothetical protein ZEAMMB73_169513 [Zea mays]
 gb|AFW84602.1| hypothetical protein ZEAMMB73_169513 [Zea mays]
 gb|AFW84603.1| hypothetical protein ZEAMMB73_169513 [Zea mays]
 gb|AFW84604.1| hypothetical protein ZEAMMB73_169513 [Zea mays]
 gb|AFW84605.1| hypothetical protein ZEAMMB73_169513 [Zea mays]
Length=361

 Score =   232 bits (592),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKKS+ +LA+GAH+VGNVLV E+AKI EGCLIGPDVAIGPGCV+E GVRLSRCTVMRGV
Sbjct  237  LRKKSAARLAAGAHVVGNVLVHESAKIGEGCLIGPDVAIGPGCVVEDGVRLSRCTVMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH CIS+SIIGWHSTVGQWAR+ENMTILGEDVH+CDE+YSNGGVVLPHKEIKSSIL 
Sbjct  297  RIKKHACISNSIIGWHSTVGQWARIENMTILGEDVHVCDEVYSNGGVVLPHKEIKSSILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>ref|XP_009343927.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Pyrus 
x bretschneideri]
Length=361

 Score =   232 bits (592),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 114/125 (91%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRK  S KLA GAHIVGNVLVDETAK+ EGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV
Sbjct  237  LRKNCSSKLAVGAHIVGNVLVDETAKLGEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIK H CISSSIIGWHSTVGQWARVENMTILGEDVH+ DEIYSNGGVVLPHKEIKSSIL 
Sbjct  297  RIKNHACISSSIIGWHSTVGQWARVENMTILGEDVHVSDEIYSNGGVVLPHKEIKSSILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>ref|XP_011085013.1| PREDICTED: LOW QUALITY PROTEIN: mannose-1-phosphate guanylyltransferase 
1-like [Sesamum indicum]
Length=358

 Score =   232 bits (592),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKKS  KLASG+HI+GNVLVDE+AKI +GCLIGPDVAIGPGCV+ESGVRLSRCTVMRGV
Sbjct  234  LRKKSPLKLASGSHIIGNVLVDESAKIGDGCLIGPDVAIGPGCVVESGVRLSRCTVMRGV  293

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH CISSSIIGWHST+GQWARVENMTILGEDVH+ DE+YSNGGVVLPHKEIKSSIL 
Sbjct  294  RIKKHACISSSIIGWHSTIGQWARVENMTILGEDVHVGDEVYSNGGVVLPHKEIKSSILK  353

Query  244  PEIVM  230
            PEIVM
Sbjct  354  PEIVM  358



>emb|CDX93234.1| BnaC04g46620D [Brassica napus]
Length=361

 Score =   232 bits (592),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKKS  KL +GAHIVGNVLVDETAKI EGCLIGPDVAIGPGCV+ESGVRLSRCTVMRGV
Sbjct  237  LRKKSPGKLTTGAHIVGNVLVDETAKIGEGCLIGPDVAIGPGCVVESGVRLSRCTVMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH C+SSSIIGWHSTVGQWAR+ENMTILGEDVH+ DEIY+NGGVVLPHKEIKS+IL 
Sbjct  297  RIKKHACVSSSIIGWHSTVGQWARIENMTILGEDVHVGDEIYTNGGVVLPHKEIKSNILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>ref|XP_004138454.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Cucumis 
sativus]
 ref|XP_004154737.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Cucumis 
sativus]
 gb|KGN45744.1| hypothetical protein Csa_6G008750 [Cucumis sativus]
Length=361

 Score =   232 bits (591),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 114/125 (91%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRK SS  LA G+HIVGNVLVDETAKI EGCLIGPDVAIGPGCV+ESGVRLSRCTVMRGV
Sbjct  237  LRKNSSSVLAVGSHIVGNVLVDETAKIGEGCLIGPDVAIGPGCVVESGVRLSRCTVMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH CISSSIIGWHSTVGQWARVENMTILGEDVH+ DEIYSNGGVVLPHKEIKSSIL 
Sbjct  297  RIKKHACISSSIIGWHSTVGQWARVENMTILGEDVHVGDEIYSNGGVVLPHKEIKSSILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>ref|XP_006411211.1| hypothetical protein EUTSA_v10016850mg [Eutrema salsugineum]
 dbj|BAJ34137.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ52664.1| hypothetical protein EUTSA_v10016850mg [Eutrema salsugineum]
Length=361

 Score =   232 bits (591),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKKS  KL +G HIVGNVLVDETAKI EGCLIGPDVAIGPGCV+ESGVRLSRCTVMRG 
Sbjct  237  LRKKSPAKLTTGPHIVGNVLVDETAKIGEGCLIGPDVAIGPGCVVESGVRLSRCTVMRGA  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH CISSSIIGWHSTVGQWAR+ENMTILGEDVH+ DEIYSNGGVVLPHKEIKS+IL 
Sbjct  297  RIKKHACISSSIIGWHSTVGQWARIENMTILGEDVHVSDEIYSNGGVVLPHKEIKSNILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>ref|XP_008674826.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 3 
[Zea mays]
 ref|XP_008674827.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 3 
[Zea mays]
 ref|XP_008674828.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 3 
[Zea mays]
 gb|ACR38121.1| unknown [Zea mays]
 tpg|DAA56851.1| TPA: hypothetical protein ZEAMMB73_139428 [Zea mays]
 tpg|DAA56852.1| TPA: hypothetical protein ZEAMMB73_139428 [Zea mays]
Length=361

 Score =   232 bits (591),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            +RKKS+ KLA+GAH+VGNVLV E+AKI EGCLIGPDVAIGPGCV+E GVRLSRCTVMRGV
Sbjct  237  IRKKSAAKLATGAHVVGNVLVHESAKIGEGCLIGPDVAIGPGCVVEDGVRLSRCTVMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH CIS+SIIGWHSTVGQWAR+ENMTILGEDVH+CDE+YSNGGVVLPHKEIKSSIL 
Sbjct  297  RIKKHACISNSIIGWHSTVGQWARIENMTILGEDVHVCDEVYSNGGVVLPHKEIKSSILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>emb|CDY07033.1| BnaA04g22820D [Brassica napus]
Length=361

 Score =   231 bits (590),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKKS  KL +GAHIVGNVLVDETAKI EGCLIGPDVAIGPGCV+ESGVRLSRCTVMRG 
Sbjct  237  LRKKSPAKLTTGAHIVGNVLVDETAKIGEGCLIGPDVAIGPGCVVESGVRLSRCTVMRGA  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH C+SSSIIGWHSTVGQWAR+ENMTILGEDVH+ DEIY+NGGVVLPHKEIKS+IL 
Sbjct  297  RIKKHACVSSSIIGWHSTVGQWARIENMTILGEDVHVGDEIYTNGGVVLPHKEIKSNILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>ref|XP_007218178.1| hypothetical protein PRUPE_ppa007618mg [Prunus persica]
 ref|XP_008233488.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Prunus 
mume]
 ref|XP_008233489.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Prunus 
mume]
 dbj|BAH03298.1| GDP-D-mannose pyrophosphorylase [Prunus persica]
 gb|EMJ19377.1| hypothetical protein PRUPE_ppa007618mg [Prunus persica]
Length=361

 Score =   231 bits (590),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 112/125 (90%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRK SS KLA G+++VGNVLVDETAKI EGCLIGPDVAIGPGCV+ESGVRLSRCTVMRGV
Sbjct  237  LRKNSSSKLARGSNVVGNVLVDETAKIGEGCLIGPDVAIGPGCVVESGVRLSRCTVMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH CIS SIIGWHSTVGQWARVENMTILGEDVH+ DEIYSNGGVVLPHKEIKSSIL 
Sbjct  297  RIKKHACISGSIIGWHSTVGQWARVENMTILGEDVHVSDEIYSNGGVVLPHKEIKSSILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>ref|XP_002879816.1| hypothetical protein ARALYDRAFT_483004 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56075.1| hypothetical protein ARALYDRAFT_483004 [Arabidopsis lyrata subsp. 
lyrata]
Length=361

 Score =   231 bits (590),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKKS  KL SG HIVGNVLVDETA I EGCLIGPDVAIGPGC++ESGVRLSRCTVMRGV
Sbjct  237  LRKKSPAKLTSGPHIVGNVLVDETATIGEGCLIGPDVAIGPGCIVESGVRLSRCTVMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH CISSSIIGWHSTVGQWAR+ENMTILGEDVH+ DEIYSNGGVVLPHKEIKS+IL 
Sbjct  297  RIKKHACISSSIIGWHSTVGQWARIENMTILGEDVHVSDEIYSNGGVVLPHKEIKSNILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>gb|ACW84415.1| GDP-D-mannose pyrophosphorylase [Glycine max]
Length=361

 Score =   231 bits (590),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKKS  KLASG H VGNV+V ETA I EGCL+GPDVAIGPGCV+ESGVRLSRCTVMRGV
Sbjct  237  LRKKSPSKLASGPHFVGNVIVHETATIGEGCLVGPDVAIGPGCVVESGVRLSRCTVMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKHTCIS+SIIGWHSTVGQWARVENMTILGEDVH+CDE+YSNGGVVLPHKEIKS+IL 
Sbjct  297  RIKKHTCISNSIIGWHSTVGQWARVENMTILGEDVHVCDEVYSNGGVVLPHKEIKSNILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>ref|NP_181507.1| GDP-mannose pyrophosphorylase/ mannose-1-pyrophosphatase [Arabidopsis 
thaliana]
 ref|NP_001189713.1| GDP-mannose pyrophosphorylase/ mannose-1-pyrophosphatase [Arabidopsis 
thaliana]
 sp|O22287.1|GMPP1_ARATH RecName: Full=Mannose-1-phosphate guanylyltransferase 1; AltName: 
Full=GDP-mannose pyrophosphorylase 1; AltName: Full=Protein 
CYTOKINESIS DEFECTIVE 1; AltName: Full=Protein EMBRYO DEFECTIVE 
101; AltName: Full=Protein HYPERSENSITIVE TO AMMONIUM 
ION 1; AltName: Full=Protein SENSITIVE TO OZONE 1; AltName: 
Full=Protein VITAMIN C DEFECTIVE 1 [Arabidopsis thaliana]
 gb|AAK32825.1|AF361812_1 At2g39770/T5I7.7 [Arabidopsis thaliana]
 gb|AAL16129.1|AF428297_1 At2g39770/T5I7.7 [Arabidopsis thaliana]
 gb|AAB87126.1| GDP-mannose pyrophosphorylase [Arabidopsis thaliana]
 gb|AAC78474.1| GDP-mannose pyrophosphorylase [Arabidopsis thaliana]
 gb|AAD04627.1| CYT1 protein [Arabidopsis thaliana]
 gb|AAL09781.1| At2g39770/T5I7.7 [Arabidopsis thaliana]
 gb|AAM65235.1| GDP-mannose pyrophosphorylase [Arabidopsis thaliana]
 gb|AAM91473.1| At2g39770/T5I7.7 [Arabidopsis thaliana]
 gb|AAN31841.1| putative GDP-mannose pyrophosphorylase [Arabidopsis thaliana]
 gb|AAP21173.1| At2g39770/T5I7.7 [Arabidopsis thaliana]
 gb|AEC09721.1| GDP-mannose pyrophosphorylase/ mannose-1-pyrophosphatase [Arabidopsis 
thaliana]
 gb|AEC09722.1| GDP-mannose pyrophosphorylase/ mannose-1-pyrophosphatase [Arabidopsis 
thaliana]
Length=361

 Score =   231 bits (590),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKKS  KL SG HIVGNVLVDETA I EGCLIGPDVAIGPGC++ESGVRLSRCTVMRGV
Sbjct  237  LRKKSPAKLTSGPHIVGNVLVDETATIGEGCLIGPDVAIGPGCIVESGVRLSRCTVMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH CISSSIIGWHSTVGQWAR+ENMTILGEDVH+ DEIYSNGGVVLPHKEIKS+IL 
Sbjct  297  RIKKHACISSSIIGWHSTVGQWARIENMTILGEDVHVSDEIYSNGGVVLPHKEIKSNILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>emb|CAC35355.1| GDP-mannose pyrophosphorylase [Arabidopsis thaliana]
Length=361

 Score =   231 bits (590),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKKS  KL SG HIVGNVLVDETA I EGCLIGPDVAIGPGC++ESGVRLSRCTVMRGV
Sbjct  237  LRKKSPAKLTSGPHIVGNVLVDETATIGEGCLIGPDVAIGPGCIVESGVRLSRCTVMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH CISSSIIGWHSTVGQWAR+ENMTILGEDVH+ DEIYSNGGVVLPHKEIKS+IL 
Sbjct  297  RIKKHACISSSIIGWHSTVGQWARIENMTILGEDVHVSDEIYSNGGVVLPHKEIKSNILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>ref|XP_010691388.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Beta vulgaris 
subsp. vulgaris]
Length=361

 Score =   231 bits (589),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRK S  +LASG+HI+GNVLVDE+A I EGCLIGPDVAIGPGCVIE+GVRLSRCT+MRGV
Sbjct  237  LRKNSPSQLASGSHIIGNVLVDESATIGEGCLIGPDVAIGPGCVIEAGVRLSRCTIMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            R+KKH CISSSIIGWHSTVGQWARVENMT+LGEDVH+CDEIYSNGGVVLPHKEIK+SIL 
Sbjct  297  RVKKHACISSSIIGWHSTVGQWARVENMTVLGEDVHVCDEIYSNGGVVLPHKEIKTSILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>ref|XP_006601845.1| PREDICTED: uncharacterized protein LOC100818016 isoform X1 [Glycine 
max]
 ref|XP_006601846.1| PREDICTED: uncharacterized protein LOC100818016 isoform X2 [Glycine 
max]
 ref|XP_006601847.1| PREDICTED: uncharacterized protein LOC100818016 isoform X3 [Glycine 
max]
 ref|XP_006601848.1| PREDICTED: uncharacterized protein LOC100818016 isoform X4 [Glycine 
max]
 ref|XP_006601849.1| PREDICTED: uncharacterized protein LOC100818016 isoform X5 [Glycine 
max]
 gb|KHN07601.1| Mannose-1-phosphate guanylyltransferase 1 [Glycine soja]
Length=361

 Score =   231 bits (589),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKKS  KLASG H VGNV+V ETA I EGCL+GPDVAIGPGCV+ESGVRLSRCTVMRGV
Sbjct  237  LRKKSPSKLASGPHFVGNVIVHETATIGEGCLVGPDVAIGPGCVVESGVRLSRCTVMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKHTCIS+SIIGWHSTVGQWARVENMTILGEDVH+CDE+YSNGGVVLPHKEIKS+IL 
Sbjct  297  RIKKHTCISNSIIGWHSTVGQWARVENMTILGEDVHVCDEVYSNGGVVLPHKEIKSNILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>ref|XP_010256792.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Nelumbo 
nucifera]
Length=361

 Score =   231 bits (588),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKKSS  LA+G+HIVGNVLV ETA I EGCLIGPDVAIGPGCVIE GVRLSRCT+MRGV
Sbjct  237  LRKKSSSNLANGSHIVGNVLVHETAVIGEGCLIGPDVAIGPGCVIEPGVRLSRCTIMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            R+KKH CISSSIIGWHSTVGQWAR+ENMTILGEDVH+CDEIYSNGGVVLPHKEIKSSIL 
Sbjct  297  RVKKHACISSSIIGWHSTVGQWARIENMTILGEDVHVCDEIYSNGGVVLPHKEIKSSILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>gb|KHN17882.1| Mannose-1-phosphate guanylyltransferase 1 [Glycine soja]
Length=361

 Score =   231 bits (588),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKKS  KLASG H VGNV+V ETA I EGCLIGPDVAIGPGCV++SGVRLSRCTVMRGV
Sbjct  237  LRKKSPSKLASGPHFVGNVIVHETATIGEGCLIGPDVAIGPGCVVDSGVRLSRCTVMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKHTCIS+SIIGWHSTVGQWARVENMTILGEDVH+CDE+YSNGGVVLPHKEIKS+IL 
Sbjct  297  RIKKHTCISNSIIGWHSTVGQWARVENMTILGEDVHVCDEVYSNGGVVLPHKEIKSNILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>ref|XP_010529799.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Tarenaya 
hassleriana]
 ref|XP_010529800.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Tarenaya 
hassleriana]
 ref|XP_010529801.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Tarenaya 
hassleriana]
Length=361

 Score =   231 bits (588),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKK+SP+LA+G +I+GNVLVDE+A I EGCLIGPDVAIGPGCVIESGVRLSRCT+MRGV
Sbjct  237  LRKKASPRLATGENIIGNVLVDESAVIGEGCLIGPDVAIGPGCVIESGVRLSRCTIMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH CISSSI+GWHSTVG+WARVENMTILGEDVH+ DE+YSNGGVVLPHKEIKSSILN
Sbjct  297  RIKKHACISSSIVGWHSTVGRWARVENMTILGEDVHVGDEVYSNGGVVLPHKEIKSSILN  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>ref|NP_001240188.1| mannose-1-phosphate guanylyltransferase 1-like [Glycine max]
 ref|XP_006590281.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like isoform 
X1 [Glycine max]
 gb|ACU21527.1| unknown [Glycine max]
Length=361

 Score =   231 bits (588),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKKS  KLASG H VGNV+V ETA I EGCLIGPDVAIGPGCV++SGVRLSRCTVMRGV
Sbjct  237  LRKKSPSKLASGPHFVGNVIVHETATIGEGCLIGPDVAIGPGCVVDSGVRLSRCTVMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKHTCIS+SIIGWHSTVGQWARVENMTILGEDVH+CDE+YSNGGVVLPHKEIKS+IL 
Sbjct  297  RIKKHTCISNSIIGWHSTVGQWARVENMTILGEDVHVCDEVYSNGGVVLPHKEIKSNILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>ref|XP_004977599.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 3-like 
[Setaria italica]
Length=361

 Score =   230 bits (587),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKKS+ KLASGAH+VGNVLV E+AKI E CLIGPDVAIGPGCV+E GVRLSRCTVMRGV
Sbjct  237  LRKKSAAKLASGAHVVGNVLVHESAKIGECCLIGPDVAIGPGCVVEDGVRLSRCTVMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH CIS+SIIGWHSTVGQWAR+ENMTILGEDVH+CDE+YSNGGVVLPHKEIKSSIL 
Sbjct  297  RIKKHACISNSIIGWHSTVGQWARIENMTILGEDVHVCDEVYSNGGVVLPHKEIKSSILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>gb|ADV59923.1| putative GDP-mannose pyrophosphorylase [Citrus unshiu]
Length=361

 Score =   230 bits (587),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 112/125 (90%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKKSS KLA+GA+IVGNVLV E+A+I E CLIGPDVAIGPGCV+ESGVRLSRCTVMRGV
Sbjct  237  LRKKSSFKLATGANIVGNVLVHESAQIGEECLIGPDVAIGPGCVVESGVRLSRCTVMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH CISSSIIGWHSTVGQWARVENMTILGEDVH+CDEIYSNGGV LPHKEIKSSIL 
Sbjct  297  RIKKHACISSSIIGWHSTVGQWARVENMTILGEDVHVCDEIYSNGGVALPHKEIKSSILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>gb|ACN66754.1| GMP [Carica papaya]
Length=361

 Score =   230 bits (587),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRK SS KLA+G+HIVGNVLVDE+A IE+GCLIGPDVAIGPGC IESGVRLSRCTVMRGV
Sbjct  237  LRKTSSSKLATGSHIVGNVLVDESAVIEDGCLIGPDVAIGPGCTIESGVRLSRCTVMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH CISSSIIGWHSTVG+WARVENMTILGEDVH+ DE+YSNGGVVLPHKEIKSSIL 
Sbjct  297  RIKKHACISSSIIGWHSTVGRWARVENMTILGEDVHVGDEVYSNGGVVLPHKEIKSSILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>ref|NP_001276240.1| mannose-1-phosphate guanylyltransferase 1-like [Glycine max]
 gb|ACX37458.1| GDP-D-mannose pyrophosphorylase [Glycine max]
 gb|KHN20905.1| Mannose-1-phosphate guanylyltransferase 1 [Glycine soja]
Length=361

 Score =   229 bits (585),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKKSS KLASG+ IVGNV+VDETAKI EGCLIGPDVAIGPGCVIE GVRL  CT+MRGV
Sbjct  237  LRKKSSSKLASGSQIVGNVIVDETAKIGEGCLIGPDVAIGPGCVIEQGVRLKSCTIMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            R+KKH C+SSSI+GWHSTVGQWARV+NMTILGEDVH+CDEIYSNGGVVLPHKEIKS+IL 
Sbjct  297  RVKKHACVSSSIVGWHSTVGQWARVDNMTILGEDVHVCDEIYSNGGVVLPHKEIKSNILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>ref|XP_009412560.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 3 
[Musa acuminata subsp. malaccensis]
Length=360

 Score =   229 bits (585),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 112/125 (90%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKK+S KLA+G+HIVGNVLV E A I EGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV
Sbjct  236  LRKKASSKLATGSHIVGNVLVHENAVIGEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  295

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH CISSSIIGWHSTVGQWAR+ENMTILGEDVH+ DEIYSNGGVVLPHKEIKSSIL 
Sbjct  296  RIKKHACISSSIIGWHSTVGQWARIENMTILGEDVHVSDEIYSNGGVVLPHKEIKSSILK  355

Query  244  PEIVM  230
            PEIVM
Sbjct  356  PEIVM  360



>emb|CDM85018.1| unnamed protein product [Triticum aestivum]
Length=361

 Score =   229 bits (585),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKKS+ KLA+GAH+VGNVLV E+AKI EGCLIGPDVAIGPGCV+E GVRLSRCTVMRGV
Sbjct  237  LRKKSAAKLAAGAHVVGNVLVHESAKIGEGCLIGPDVAIGPGCVVEDGVRLSRCTVMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH CIS+SIIGWHSTVGQWAR+ENMTILGEDVH+ DE+YSNGGVVLPHKEIKSSIL 
Sbjct  297  RIKKHACISNSIIGWHSTVGQWARIENMTILGEDVHVGDEVYSNGGVVLPHKEIKSSILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>ref|XP_011035050.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Populus 
euphratica]
 ref|XP_011035125.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Populus 
euphratica]
Length=361

 Score =   229 bits (584),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            L+K SS KLA+G HIVGNVLVDETAKI EGCLIGPDVAIGPGC++ESGVRLSRC+VMRGV
Sbjct  237  LKKNSSSKLATGPHIVGNVLVDETAKIGEGCLIGPDVAIGPGCIVESGVRLSRCSVMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
             IKKH CISSSIIGWHSTVG+WARVENMTILGEDV +CDEIYSNGGVVLPHKEIKSSIL 
Sbjct  297  YIKKHACISSSIIGWHSTVGRWARVENMTILGEDVQVCDEIYSNGGVVLPHKEIKSSILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>ref|XP_002311190.1| cytokinesis defective 1 family protein [Populus trichocarpa]
 gb|EEE88557.1| cytokinesis defective 1 family protein [Populus trichocarpa]
Length=361

 Score =   229 bits (584),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            L+K SS KLA+G HIVGNVLVDETAKI EGCLIGPDVAIGPGC++ESGVRLSRC+VMRGV
Sbjct  237  LKKNSSSKLATGPHIVGNVLVDETAKIGEGCLIGPDVAIGPGCIVESGVRLSRCSVMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
             IKKH CISSSIIGWHSTVG+WARVENMTILGEDV +CDEIYSNGGVVLPHKEIKSSIL 
Sbjct  297  YIKKHACISSSIIGWHSTVGRWARVENMTILGEDVQVCDEIYSNGGVVLPHKEIKSSILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>gb|EMS68890.1| Mannose-1-phosphate guanyltransferase beta [Triticum urartu]
Length=412

 Score =   231 bits (588),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKKS+ KLA+GAH+VGNVLV E+AKI EGCLIGPDVAIGPGCV+E GVRLSRCTVMRGV
Sbjct  288  LRKKSAAKLAAGAHVVGNVLVHESAKIGEGCLIGPDVAIGPGCVVEDGVRLSRCTVMRGV  347

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH CIS+SIIGWHSTVGQWAR+ENMTILGEDVH+ DE+YSNGGVVLPHKEIKSSIL 
Sbjct  348  RIKKHACISNSIIGWHSTVGQWARIENMTILGEDVHVGDEVYSNGGVVLPHKEIKSSILK  407

Query  244  PEIVM  230
            PEIVM
Sbjct  408  PEIVM  412



>gb|AHB17740.1| GDP-mannose pyrophosphorylase [Pogonatherum paniceum]
Length=361

 Score =   229 bits (584),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKK++ +LA+GAH++GNVLV E+AKI EGCLIGPDVAIGPGCV++ GVRLSRCTVMRGV
Sbjct  237  LRKKTADRLATGAHVIGNVLVHESAKIGEGCLIGPDVAIGPGCVVDDGVRLSRCTVMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH CIS+SIIGWHSTVGQWAR+ENMTILGEDVH+CDE+YSNGGVVLPHKEIKSSIL 
Sbjct  297  RIKKHACISNSIIGWHSTVGQWARIENMTILGEDVHVCDEVYSNGGVVLPHKEIKSSILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>gb|KEH34762.1| mannose-1-phosphate guanylyltransferase-like protein [Medicago 
truncatula]
Length=302

 Score =   227 bits (578),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKK+S KLASG HI+GNV+V ETAKI EGCLIGPDVAIGPGC IESGVRLS CTVMRGV
Sbjct  178  LRKKTSSKLASGPHILGNVIVHETAKIGEGCLIGPDVAIGPGCTIESGVRLSCCTVMRGV  237

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH CISSSIIGWHSTVGQWARVENMTILGEDVH+ DE+YSNGGVVLPHKEIK+SILN
Sbjct  238  RIKKHACISSSIIGWHSTVGQWARVENMTILGEDVHVSDEVYSNGGVVLPHKEIKTSILN  297

Query  244  PEIVM  230
            PEIVM
Sbjct  298  PEIVM  302



>ref|XP_002456631.1| hypothetical protein SORBIDRAFT_03g039740 [Sorghum bicolor]
 gb|EES01751.1| hypothetical protein SORBIDRAFT_03g039740 [Sorghum bicolor]
Length=361

 Score =   229 bits (583),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKKS+ +LA+G H+VGNVLV E+AKI EGCLIGPDVAIGPGCV+E GVRLSRCTVMRGV
Sbjct  237  LRKKSAARLATGTHVVGNVLVHESAKIGEGCLIGPDVAIGPGCVVEDGVRLSRCTVMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH CIS+SIIGWHSTVG+WAR+ENMTILGEDVH+CDE+YSNGGVVLPHKEIKSSIL 
Sbjct  297  RIKKHACISNSIIGWHSTVGKWARIENMTILGEDVHVCDEVYSNGGVVLPHKEIKSSILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>gb|EMT31032.1| Mannose-1-phosphate guanyltransferase beta [Aegilops tauschii]
Length=361

 Score =   229 bits (583),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKKS+ KLA+GAHIVGNVLV ++AKI EGCLIGPDVAIGPGCV+E GVRLSRCTVMRGV
Sbjct  237  LRKKSAAKLAAGAHIVGNVLVHDSAKIGEGCLIGPDVAIGPGCVVEDGVRLSRCTVMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH CIS+SIIGWHSTVGQWAR+ENMTILGEDVH+ DE+YSNGGVVLPHKEIKSSIL 
Sbjct  297  RIKKHACISNSIIGWHSTVGQWARIENMTILGEDVHVGDEVYSNGGVVLPHKEIKSSILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>ref|XP_008777609.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Phoenix dactylifera]
Length=361

 Score =   228 bits (582),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKKS  KLA+G HIVGNVLV E+A I EGCLIGPDVAIGPGC++ESGVRLSRCTVMRGV
Sbjct  237  LRKKSPYKLAAGRHIVGNVLVHESAVIGEGCLIGPDVAIGPGCIVESGVRLSRCTVMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH CIS SIIGWHSTVGQWARVENMTILGEDVH+CDEIYSNGGVVLPHKEIKSSIL 
Sbjct  297  RIKKHACISGSIIGWHSTVGQWARVENMTILGEDVHVCDEIYSNGGVVLPHKEIKSSILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>ref|XP_007141846.1| hypothetical protein PHAVU_008G230600g [Phaseolus vulgaris]
 ref|XP_007141847.1| hypothetical protein PHAVU_008G230600g [Phaseolus vulgaris]
 gb|ESW13840.1| hypothetical protein PHAVU_008G230600g [Phaseolus vulgaris]
 gb|ESW13841.1| hypothetical protein PHAVU_008G230600g [Phaseolus vulgaris]
Length=361

 Score =   228 bits (582),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKKSS KLASG+ IVGNV+VDETAKI EGCLIGPDVAIGPGC+IE GVRL  CT+MRGV
Sbjct  237  LRKKSSSKLASGSQIVGNVIVDETAKIGEGCLIGPDVAIGPGCIIEQGVRLKSCTIMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            R+KKH C+SSSIIGWHSTVGQW+RV+NMTILGEDVH+CDEIYSNGGVVLPHKEIKS+IL 
Sbjct  297  RVKKHACVSSSIIGWHSTVGQWSRVDNMTILGEDVHVCDEIYSNGGVVLPHKEIKSNILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>gb|AES92771.2| mannose-1-phosphate guanyltransferase [Medicago truncatula]
Length=304

 Score =   226 bits (577),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LR +SS KLASG++IVGNV+VDETAKI EGCLIGPDVAIGP C++E GVRLSRCTVMRGV
Sbjct  180  LRNRSSSKLASGSNIVGNVIVDETAKISEGCLIGPDVAIGPDCIVEPGVRLSRCTVMRGV  239

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH CIS SIIGWHS+VGQWARVENMTILGEDVH+CDEIYSNGGVVLPHKEIKS+IL 
Sbjct  240  RIKKHACISHSIIGWHSSVGQWARVENMTILGEDVHVCDEIYSNGGVVLPHKEIKSNILK  299

Query  244  PEIVM  230
            PEIVM
Sbjct  300  PEIVM  304



>ref|XP_002308180.1| hypothetical protein POPTR_0006s09130g [Populus trichocarpa]
 gb|EEE91703.1| hypothetical protein POPTR_0006s09130g [Populus trichocarpa]
Length=361

 Score =   228 bits (581),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRK SSPKLA+G +IVGNVLVDE+A I EGCLIGPDVAIGPGC+I+SGVRLSRCTVMRGV
Sbjct  237  LRKMSSPKLATGPNIVGNVLVDESAVIGEGCLIGPDVAIGPGCIIDSGVRLSRCTVMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH CISSSIIGWHSTVG+WAR+ENMTILGEDVH+ DE+YSNGGVVLPHKEIKSSIL 
Sbjct  297  RIKKHACISSSIIGWHSTVGRWARIENMTILGEDVHVSDEVYSNGGVVLPHKEIKSSILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>ref|XP_003600761.1| Mannose-1-phosphate guanyltransferase [Medicago truncatula]
 gb|AES71012.1| mannose-1-phosphate guanylyltransferase-like protein [Medicago 
truncatula]
Length=361

 Score =   228 bits (581),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKK+S KLASG HI+GNV+V ETAKI EGCLIGPDVAIGPGC IESGVRLS CTVMRGV
Sbjct  237  LRKKTSSKLASGPHILGNVIVHETAKIGEGCLIGPDVAIGPGCTIESGVRLSCCTVMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH CISSSIIGWHSTVGQWARVENMTILGEDVH+ DE+YSNGGVVLPHKEIK+SILN
Sbjct  297  RIKKHACISSSIIGWHSTVGQWARVENMTILGEDVHVSDEVYSNGGVVLPHKEIKTSILN  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>ref|XP_003610574.1| Mannose-1-phosphate guanyltransferase [Medicago truncatula]
Length=350

 Score =   228 bits (580),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LR +SS KLASG++IVGNV+VDETAKI EGCLIGPDVAIGP C++E GVRLSRCTVMRGV
Sbjct  226  LRNRSSSKLASGSNIVGNVIVDETAKISEGCLIGPDVAIGPDCIVEPGVRLSRCTVMRGV  285

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH CIS SIIGWHS+VGQWARVENMTILGEDVH+CDEIYSNGGVVLPHKEIKS+IL 
Sbjct  286  RIKKHACISHSIIGWHSSVGQWARVENMTILGEDVHVCDEIYSNGGVVLPHKEIKSNILK  345

Query  244  PEIVM  230
            PEIVM
Sbjct  346  PEIVM  350



>ref|XP_011019240.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like, partial 
[Populus euphratica]
 ref|XP_011006397.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like, partial 
[Populus euphratica]
Length=329

 Score =   227 bits (578),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRK SSPKLA+G +IVGNVLVDE+A I EGCLIGPDVAIGPGC+I+SGVRLSRCTVMRGV
Sbjct  205  LRKMSSPKLANGPNIVGNVLVDESAVIGEGCLIGPDVAIGPGCIIDSGVRLSRCTVMRGV  264

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH CISSSIIGWHSTVG+WAR+ENMTILGEDVHI DE+YSNGGVVLPHKEIKSSIL 
Sbjct  265  RIKKHACISSSIIGWHSTVGRWARMENMTILGEDVHIGDEVYSNGGVVLPHKEIKSSILK  324

Query  244  PEIVM  230
            PEIVM
Sbjct  325  PEIVM  329



>ref|XP_010931208.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Elaeis guineensis]
Length=361

 Score =   228 bits (580),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKKS  KLA+G HIVGNVLV E A I EGCLIGPDVAIGPGCV+ESGVRLSRCTVMRGV
Sbjct  237  LRKKSPYKLAAGPHIVGNVLVHEGAVIGEGCLIGPDVAIGPGCVVESGVRLSRCTVMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH CISSSIIGWHST+GQWARVENMTILGEDVH+CDE+YSNGGVVLPHKEIKS+IL 
Sbjct  297  RIKKHACISSSIIGWHSTIGQWARVENMTILGEDVHVCDEVYSNGGVVLPHKEIKSNILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>ref|XP_006649823.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1-like 
[Oryza brachyantha]
Length=361

 Score =   227 bits (579),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKK+  KLASGAH++GNVLV ETA I EGCLIGPDVA+GPGCV+E+GVRLSRCTVMRG 
Sbjct  237  LRKKAPAKLASGAHVLGNVLVHETAVIGEGCLIGPDVAVGPGCVVEAGVRLSRCTVMRGA  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            R+KKH CISSSIIGWHSTVG WARVENMTILGEDVH+CDE+YSNGGVVLPHKEIKSSIL 
Sbjct  297  RVKKHACISSSIIGWHSTVGMWARVENMTILGEDVHVCDEVYSNGGVVLPHKEIKSSILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>ref|NP_001049673.1| Os03g0268400 [Oryza sativa Japonica Group]
 sp|Q84JH5.1|GMPP1_ORYSJ RecName: Full=Probable mannose-1-phosphate guanylyltransferase 
1 [Oryza sativa Japonica Group]
 gb|AAP06900.1| COG1208, GCD1, Nucleoside-diphosphate-sugar pyrophosphorylase 
involved in lipopolysaccharide biosynthesis/translation initiation 
factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) 
[Cell envelope biogenesis, outer membrane / Translation, 
ribosomal structure and biogenesis] [Oryza sativa Japonica 
Group]
 gb|AAP06910.1| putative GDP-mannose pyrophosphorylase [Oryza sativa Japonica 
Group]
 gb|ABF95179.1| mannose-1-phosphate guanyltransferase, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF11587.1| Os03g0268400 [Oryza sativa Japonica Group]
 gb|EAZ26390.1| hypothetical protein OsJ_10274 [Oryza sativa Japonica Group]
 dbj|BAH00737.1| unnamed protein product [Oryza sativa Japonica Group]
Length=361

 Score =   227 bits (579),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKK+  KLASGAH++GNVLV ETA I EGCLIGPDVA+GPGCV+E+GVRLSRCTVMRG 
Sbjct  237  LRKKAPAKLASGAHVLGNVLVHETAVIGEGCLIGPDVAVGPGCVVEAGVRLSRCTVMRGA  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            R+KKH CISSSIIGWHSTVG WARVENMTILGEDVH+CDE+YSNGGVVLPHKEIKSSIL 
Sbjct  297  RVKKHACISSSIIGWHSTVGMWARVENMTILGEDVHVCDEVYSNGGVVLPHKEIKSSILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>gb|KJB76778.1| hypothetical protein B456_012G106900 [Gossypium raimondii]
Length=302

 Score =   225 bits (573),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKKSS KL++G+H VGNVLVDE+A I +GCLIGPDVAIGPGC+IESGVRLSRCT+MRGV
Sbjct  178  LRKKSSAKLSTGSHFVGNVLVDESAVIGDGCLIGPDVAIGPGCIIESGVRLSRCTIMRGV  237

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKHTC+S+SIIGWHSTVG+WAR+ENMTILGEDVH+ DE+YSNGGVVLPHKEIKSSIL 
Sbjct  238  RIKKHTCVSNSIIGWHSTVGKWARLENMTILGEDVHLGDEVYSNGGVVLPHKEIKSSILK  297

Query  244  PEIVM  230
            PEIVM
Sbjct  298  PEIVM  302



>emb|CDP16056.1| unnamed protein product [Coffea canephora]
Length=361

 Score =   227 bits (578),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LR+K + KLASG HIVGNVLV E+AKI EGCLIGPDVAIGPGCV+E+GVRLSRCTVMRGV
Sbjct  237  LRRKDASKLASGTHIVGNVLVHESAKIGEGCLIGPDVAIGPGCVVEAGVRLSRCTVMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH CISSSIIGWHS+VG+WARVENMTILGEDVH+CDEIYSNGGVVLPHKEIKSSIL 
Sbjct  297  RIKKHACISSSIIGWHSSVGEWARVENMTILGEDVHVCDEIYSNGGVVLPHKEIKSSILK  356

Query  244  PEIVM  230
             EIVM
Sbjct  357  SEIVM  361



>gb|KHG01639.1| hypothetical protein F383_21310 [Gossypium arboreum]
Length=302

 Score =   224 bits (572),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKKSS KLA+G HIVGNVLV E+AKI EGCLIGPDV +GPGCV+E+GVRLS CTVMRGV
Sbjct  178  LRKKSSTKLATGHHIVGNVLVHESAKIGEGCLIGPDVVVGPGCVVEAGVRLSCCTVMRGV  237

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH CISSSIIGWHSTVGQWARVENMTILGEDVH+CDEIY NGGV+LPHKEIKSSIL 
Sbjct  238  RIKKHACISSSIIGWHSTVGQWARVENMTILGEDVHVCDEIYGNGGVILPHKEIKSSILK  297

Query  244  PEIVM  230
            PEIVM
Sbjct  298  PEIVM  302



>gb|KJB76777.1| hypothetical protein B456_012G106900 [Gossypium raimondii]
Length=361

 Score =   226 bits (576),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKKSS KL++G+H VGNVLVDE+A I +GCLIGPDVAIGPGC+IESGVRLSRCT+MRGV
Sbjct  237  LRKKSSAKLSTGSHFVGNVLVDESAVIGDGCLIGPDVAIGPGCIIESGVRLSRCTIMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKHTC+S+SIIGWHSTVG+WAR+ENMTILGEDVH+ DE+YSNGGVVLPHKEIKSSIL 
Sbjct  297  RIKKHTCVSNSIIGWHSTVGKWARLENMTILGEDVHLGDEVYSNGGVVLPHKEIKSSILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>sp|Q6Z9A3.1|GMPP3_ORYSJ RecName: Full=Probable mannose-1-phosphate guanylyltransferase 
3 [Oryza sativa Japonica Group]
 dbj|BAD05471.1| putative GDP-mannose pyrophosphorylase [Oryza sativa Japonica 
Group]
 gb|EAZ06115.1| hypothetical protein OsI_28352 [Oryza sativa Indica Group]
 gb|EAZ14142.1| hypothetical protein OsJ_04069 [Oryza sativa Japonica Group]
 dbj|BAH01407.1| unnamed protein product [Oryza sativa Japonica Group]
Length=361

 Score =   226 bits (576),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRK+S+ +LA+GAHIVGNVLV E+AKI EGCLIGPDVAIGPGCV+E GVRLSRCTVMRGV
Sbjct  237  LRKRSANRLATGAHIVGNVLVHESAKIGEGCLIGPDVAIGPGCVVEDGVRLSRCTVMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH CIS+SIIGWHSTVGQWAR+ENMTILGEDVH+ DE+Y+NGGV+LPHKEIKSSIL 
Sbjct  297  RIKKHACISNSIIGWHSTVGQWARIENMTILGEDVHVGDEVYTNGGVILPHKEIKSSILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>ref|XP_009791580.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Nicotiana 
sylvestris]
 ref|XP_009791581.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Nicotiana 
sylvestris]
Length=360

 Score =   226 bits (575),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRK+SSP LA G HI+GNVL+DE+A I +GCLIGPDVAIGPGCVIESGVRLSRCT+MRGV
Sbjct  236  LRKRSSPDLAVGPHILGNVLIDESAVIGDGCLIGPDVAIGPGCVIESGVRLSRCTIMRGV  295

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH CISSSI+GWHSTVG+WARVENMTILGEDVH+ DE+YSNGGVVLPHKEIKSSIL 
Sbjct  296  RIKKHACISSSIVGWHSTVGRWARVENMTILGEDVHVGDEVYSNGGVVLPHKEIKSSILK  355

Query  244  PEIVM  230
            PEIVM
Sbjct  356  PEIVM  360



>dbj|BAJ95730.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91553.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=361

 Score =   226 bits (575),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKKS+ KLA G H VGNVLV E+AKI EGCLIGPDVAIGPGCV+E GVRLSRCTVMRGV
Sbjct  237  LRKKSAAKLAVGEHFVGNVLVHESAKIGEGCLIGPDVAIGPGCVVEDGVRLSRCTVMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH CIS+SIIGWHSTVGQWAR+ENMTILGEDVH+ DE+YSNGGVVLPHKEIKSSIL 
Sbjct  297  RIKKHACISNSIIGWHSTVGQWARIENMTILGEDVHVGDEVYSNGGVVLPHKEIKSSILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>ref|XP_004984923.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1-like 
isoform X1 [Setaria italica]
 ref|XP_004984924.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1-like 
isoform X2 [Setaria italica]
Length=361

 Score =   225 bits (574),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKK+  +LASGAH++GNVLV ETA I EGCLIGPDVA+GPGCV+E+GVRLSRCTVMRG 
Sbjct  237  LRKKAPARLASGAHVLGNVLVHETAVIGEGCLIGPDVAVGPGCVVEAGVRLSRCTVMRGA  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            R+K+H C+SSSIIGWHSTVG+WARVENMTILGEDVH+CDEIYSNGGVVLPHKEIKSSIL 
Sbjct  297  RVKQHACVSSSIIGWHSTVGKWARVENMTILGEDVHVCDEIYSNGGVVLPHKEIKSSILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>ref|XP_003564604.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 3 
[Brachypodium distachyon]
Length=361

 Score =   225 bits (574),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKKS+ +LA+GAH++GNVLV E+A I EGCLIGPDVAIGPGC++E GVRLSRCTVMRGV
Sbjct  237  LRKKSAARLATGAHVIGNVLVHESANIGEGCLIGPDVAIGPGCIVEDGVRLSRCTVMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH+C+S+SIIGWHSTVGQWAR+ENMTILGEDVH+ DE+YSNGGVVLPHKEIKSSIL 
Sbjct  297  RIKKHSCVSNSIIGWHSTVGQWARIENMTILGEDVHVGDEVYSNGGVVLPHKEIKSSILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>ref|XP_009601713.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Nicotiana 
tomentosiformis]
 ref|XP_009601714.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Nicotiana 
tomentosiformis]
Length=361

 Score =   225 bits (574),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKKSSP LA G HI+GNVL+DE+A I +GCLIGPDVAIGPGCVIESGVRLSRCT+MRGV
Sbjct  237  LRKKSSPDLAVGPHILGNVLMDESAVIGDGCLIGPDVAIGPGCVIESGVRLSRCTIMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH C+SSSI+GWHSTVG+WARVENMTILGEDVH+ DE+YSNGGVVLPHKEIKSSIL 
Sbjct  297  RIKKHACVSSSIVGWHSTVGRWARVENMTILGEDVHVGDEVYSNGGVVLPHKEIKSSILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>gb|EAY89395.1| hypothetical protein OsI_10901 [Oryza sativa Indica Group]
Length=361

 Score =   225 bits (574),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKK+   LASGAH++GNVLV ETA I EGCLIGPDVA+GPGCV+E+GVRLSRCTVMRG 
Sbjct  237  LRKKAPANLASGAHVLGNVLVHETAVIGEGCLIGPDVAVGPGCVVEAGVRLSRCTVMRGA  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            R+KKH CISSSIIGWHSTVG WARVENMTILGEDVH+CDE+YSNGGVVLPHKEIKSSIL 
Sbjct  297  RVKKHACISSSIIGWHSTVGMWARVENMTILGEDVHVCDEVYSNGGVVLPHKEIKSSILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>ref|XP_009407514.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 3 
[Musa acuminata subsp. malaccensis]
Length=361

 Score =   225 bits (573),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKK+  +LA+G HIVGNVLV E A I EGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV
Sbjct  237  LRKKAPSRLAAGPHIVGNVLVHENAVIGEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH+C+SSSIIGWHSTVGQWAR+ENMTILGEDVH+ DE+YSNGGVVLPHKEIKSSIL 
Sbjct  297  RIKKHSCVSSSIIGWHSTVGQWARIENMTILGEDVHVSDEVYSNGGVVLPHKEIKSSILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>gb|KJB76118.1| hypothetical protein B456_012G072800 [Gossypium raimondii]
Length=333

 Score =   224 bits (571),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/124 (87%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = -2

Query  601  RKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGVR  422
            RKKSS KLASG HIVGNVLV E+AKI EGCLIGPDV +GPGCV+E+GVRLSRCTVMRGVR
Sbjct  210  RKKSSTKLASGHHIVGNVLVHESAKIGEGCLIGPDVVVGPGCVVEAGVRLSRCTVMRGVR  269

Query  421  IKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILNP  242
            IKKH CISSSIIGWHSTVGQWARVENMT+LGEDVH+ DEIYS+GGV+LPHKEIKSSIL P
Sbjct  270  IKKHACISSSIIGWHSTVGQWARVENMTVLGEDVHVWDEIYSSGGVILPHKEIKSSILKP  329

Query  241  EIVM  230
            EIVM
Sbjct  330  EIVM  333



>ref|XP_008803133.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Phoenix dactylifera]
 ref|XP_008803134.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Phoenix dactylifera]
 ref|XP_008803135.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Phoenix dactylifera]
Length=361

 Score =   224 bits (572),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKKS  KLA GAHIVGNVLV E+A I EGCLIGPDVAIGPGCV+ESGVRL+RCTVMRGV
Sbjct  237  LRKKSPYKLAVGAHIVGNVLVHESAVIGEGCLIGPDVAIGPGCVVESGVRLARCTVMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH CISSSIIGWHSTVGQW+R+ENMTILGEDVH+ DE+YSNGGVVLPHKEIKSSIL 
Sbjct  297  RIKKHACISSSIIGWHSTVGQWSRIENMTILGEDVHVGDEVYSNGGVVLPHKEIKSSILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>ref|XP_010262630.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Nelumbo 
nucifera]
Length=361

 Score =   224 bits (572),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKKSS +LA G+HIVGNVLV ETA I +GCLIGPDVAIGPGCV+ESGVRLSRCTVM+G 
Sbjct  237  LRKKSSSQLARGSHIVGNVLVHETAVIGDGCLIGPDVAIGPGCVVESGVRLSRCTVMQGT  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
             IKKHTCISSSIIGWHSTVGQWAR+ENMTILGEDVH+ DEIYSNGG+VLPHKEIKSSIL 
Sbjct  297  HIKKHTCISSSIIGWHSTVGQWARIENMTILGEDVHVSDEIYSNGGIVLPHKEIKSSILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>gb|ACK87007.1| GDP-mannose pyrophosphorylase [Carica papaya]
Length=361

 Score =   224 bits (571),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRK SS KLA+G+HIVGNVLVDE+A IE+GCLIGPDV IGPGC IESGVRLSRCTVMRGV
Sbjct  237  LRKTSSSKLATGSHIVGNVLVDESAVIEDGCLIGPDVVIGPGCTIESGVRLSRCTVMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH CISSSIIGWHS VG+WARVENMTILGEDVH+ DE+YSNGGVVLPHKEIK SIL 
Sbjct  297  RIKKHACISSSIIGWHSPVGRWARVENMTILGEDVHVGDEVYSNGGVVLPHKEIKFSILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>ref|NP_001044795.1| Os01g0847200 [Oryza sativa Japonica Group]
 sp|Q941T9.1|GMPP2_ORYSJ RecName: Full=Probable mannose-1-phosphate guanylyltransferase 
2 [Oryza sativa Japonica Group]
 dbj|BAB64272.1| putative GMPase [Oryza sativa Japonica Group]
 dbj|BAB89577.1| putative GMPase [Oryza sativa Japonica Group]
 dbj|BAF06709.1| Os01g0847200 [Oryza sativa Japonica Group]
 gb|EAZ41985.1| hypothetical protein OsJ_26535 [Oryza sativa Japonica Group]
 dbj|BAG88187.1| unnamed protein product [Oryza sativa Japonica Group]
Length=361

 Score =   224 bits (571),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRK+S+ +LA+GAHIVGNVLV E+AKI EGCLIGPDVAIGPGCV+E GVRLSRCTVMRGV
Sbjct  237  LRKRSTNRLATGAHIVGNVLVHESAKIGEGCLIGPDVAIGPGCVVEDGVRLSRCTVMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
             IKKH CIS+SIIGWHSTVGQWAR+ENMTILGEDVH+ DE+Y+NGGVVLPHKEIKSSIL 
Sbjct  297  HIKKHACISNSIIGWHSTVGQWARIENMTILGEDVHVGDEVYTNGGVVLPHKEIKSSILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>ref|XP_003558261.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Brachypodium distachyon]
 ref|XP_010228817.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Brachypodium distachyon]
 ref|XP_010228818.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Brachypodium distachyon]
 ref|XP_010228819.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Brachypodium distachyon]
Length=361

 Score =   224 bits (570),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKK+  +LASG H++GNVLV ETA I EGCLIGPDVA+GPGCV+E+GVRLSRCTVMRG 
Sbjct  237  LRKKAPARLASGTHVLGNVLVHETATIGEGCLIGPDVAVGPGCVVEAGVRLSRCTVMRGA  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            R+KKH CIS SI+GWHSTVG+WARVENMTILGEDVH+CDE+YSNGGVVLPHKEIKSSIL 
Sbjct  297  RVKKHACISGSIVGWHSTVGKWARVENMTILGEDVHVCDEVYSNGGVVLPHKEIKSSILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>tpg|DAA44592.1| TPA: hypothetical protein ZEAMMB73_810828 [Zea mays]
Length=311

 Score =   222 bits (565),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKK+  +LASGAH++GNVLV ETA I +GCLIGPDVA+GPGCV+E+GVRLSRCTVMR  
Sbjct  187  LRKKAPARLASGAHVLGNVLVHETAVIGDGCLIGPDVAVGPGCVVEAGVRLSRCTVMRAA  246

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            R+K+H C+SSSIIGWHSTVG+WARVENMTILGEDVH+CDEIYSNGGVVLPHKEIKSSIL 
Sbjct  247  RVKQHACVSSSIIGWHSTVGKWARVENMTILGEDVHVCDEIYSNGGVVLPHKEIKSSILK  306

Query  244  PEIVM  230
            PEIVM
Sbjct  307  PEIVM  311



>ref|XP_003544186.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Glycine 
max]
Length=374

 Score =   224 bits (570),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 105/122 (86%), Positives = 114/122 (93%), Gaps = 0/122 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKKSS KLASG+ IVGNV+VDETAKI EGCLIGPDVAIGPGCVIE GVRL  CT+MRGV
Sbjct  237  LRKKSSSKLASGSQIVGNVIVDETAKIGEGCLIGPDVAIGPGCVIEQGVRLKSCTIMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            R+KKH C+SSSI+GWHSTVGQWARV+NMTILGEDVH+CDEIYSNGGVVLPHKEIKS+IL 
Sbjct  297  RVKKHACVSSSIVGWHSTVGQWARVDNMTILGEDVHVCDEIYSNGGVVLPHKEIKSNILK  356

Query  244  PE  239
            PE
Sbjct  357  PE  358



>ref|XP_007026922.1| Glucose-1-phosphate adenylyltransferase family protein isoform 
1 [Theobroma cacao]
 ref|XP_007026923.1| Glucose-1-phosphate adenylyltransferase family protein isoform 
1 [Theobroma cacao]
 gb|EOY07424.1| Glucose-1-phosphate adenylyltransferase family protein isoform 
1 [Theobroma cacao]
 gb|EOY07425.1| Glucose-1-phosphate adenylyltransferase family protein isoform 
1 [Theobroma cacao]
Length=361

 Score =   223 bits (568),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKKSS +L +G++IVGNVLVDE+A I +GCLIGPDVAIGPGC+IESGVRLSRCT+MRGV
Sbjct  237  LRKKSSAELEAGSNIVGNVLVDESAVIGQGCLIGPDVAIGPGCIIESGVRLSRCTIMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH CISSSIIGWHSTVG+WARVENMTILGEDVH+ DE+YSNGGVVLPHKEIKSSIL 
Sbjct  297  RIKKHACISSSIIGWHSTVGRWARVENMTILGEDVHLGDEVYSNGGVVLPHKEIKSSILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>ref|XP_007026924.1| Glucose-1-phosphate adenylyltransferase family protein isoform 
3 [Theobroma cacao]
 gb|EOY07426.1| Glucose-1-phosphate adenylyltransferase family protein isoform 
3 [Theobroma cacao]
Length=362

 Score =   223 bits (568),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKKSS +L +G++IVGNVLVDE+A I +GCLIGPDVAIGPGC+IESGVRLSRCT+MRGV
Sbjct  238  LRKKSSAELEAGSNIVGNVLVDESAVIGQGCLIGPDVAIGPGCIIESGVRLSRCTIMRGV  297

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH CISSSIIGWHSTVG+WARVENMTILGEDVH+ DE+YSNGGVVLPHKEIKSSIL 
Sbjct  298  RIKKHACISSSIIGWHSTVGRWARVENMTILGEDVHLGDEVYSNGGVVLPHKEIKSSILK  357

Query  244  PEIVM  230
            PEIVM
Sbjct  358  PEIVM  362



>gb|ABR17757.1| unknown [Picea sitchensis]
Length=361

 Score =   223 bits (568),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LR+ +S KLA+G +IVGNV+VD+TA+I EGCLIGPDVAIGPGCV+E+GVRLSRCT+MRGV
Sbjct  237  LRRNTSDKLANGLNIVGNVIVDDTAQIGEGCLIGPDVAIGPGCVVEAGVRLSRCTIMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH C+S SIIGWHSTVGQWARVENMTILGEDVH+ DE+YSNGGVVLPHKEIKSSIL 
Sbjct  297  RIKKHACVSGSIIGWHSTVGQWARVENMTILGEDVHVSDEVYSNGGVVLPHKEIKSSILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>gb|KHG16049.1| Mannose-1-phosphate guanyltransferase [Gossypium arboreum]
Length=361

 Score =   223 bits (568),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            L KKSS KL++G+H VGNVLVDE+A I +GCLIGPDVAIGPGC+IESGVRLSRCT+MRGV
Sbjct  237  LLKKSSTKLSTGSHFVGNVLVDESAVIGDGCLIGPDVAIGPGCIIESGVRLSRCTIMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKHTC+S+SIIGWHSTVG+WAR+ENMTILGEDVH+ DE+YSNGGVVLPHKEIKSSIL 
Sbjct  297  RIKKHTCVSNSIIGWHSTVGKWARLENMTILGEDVHLGDEVYSNGGVVLPHKEIKSSILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>gb|AHX74219.1| GDP-mannose pyrophosphorylase [Pinus taeda]
Length=362

 Score =   223 bits (567),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LR+ +S KLA+G +IVGNV+VD TA+I EGCLIGPDVAIGPGCVIE+GVRLSRCT+MRGV
Sbjct  238  LRRNTSDKLATGVNIVGNVIVDSTAQIGEGCLIGPDVAIGPGCVIEAGVRLSRCTIMRGV  297

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH C+S SIIGWHSTVGQWARVENMTILGEDVH+ DE+Y+NGGVVLPHKEIKSSIL 
Sbjct  298  RIKKHACVSGSIIGWHSTVGQWARVENMTILGEDVHVSDEVYTNGGVVLPHKEIKSSILK  357

Query  244  PEIVM  230
            PEIVM
Sbjct  358  PEIVM  362



>ref|XP_006645004.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 3-like 
[Oryza brachyantha]
Length=361

 Score =   223 bits (567),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            +RK+S+ +LA+GAHIVGNVLV E+AKI EGCLIGPDVAIGPGC++E GVRLSRCTVMR V
Sbjct  237  IRKRSADRLAAGAHIVGNVLVHESAKIGEGCLIGPDVAIGPGCIVEDGVRLSRCTVMRSV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH CIS+SIIGWHSTVGQWAR+ENMTILGEDVH+ DE+Y+NGGVVLPHKEIKSSIL 
Sbjct  297  RIKKHACISNSIIGWHSTVGQWARIENMTILGEDVHVGDEVYTNGGVVLPHKEIKSSILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>gb|ABR15468.1| GDP-mannose pyrophosphorylase [Pinus taeda]
Length=361

 Score =   223 bits (567),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LR+ +S KLA+G +IVGNV+VD TA+I EGCLIGPDVAIGPGCVIE+GVRLSRCT+MRGV
Sbjct  237  LRRNTSDKLATGVNIVGNVIVDSTAQIGEGCLIGPDVAIGPGCVIEAGVRLSRCTIMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH C+S SIIGWHSTVGQWARVENMTILGEDVH+ DE+Y+NGGVVLPHKEIKSSIL 
Sbjct  297  RIKKHACVSGSIIGWHSTVGQWARVENMTILGEDVHVSDEVYTNGGVVLPHKEIKSSILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>ref|NP_001142215.1| hypothetical protein [Zea mays]
 ref|XP_008668541.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 ref|XP_008668543.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 ref|XP_008668544.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACF87905.1| unknown [Zea mays]
 gb|ACR38500.1| unknown [Zea mays]
 tpg|DAA44594.1| TPA: hypothetical protein ZEAMMB73_810828 [Zea mays]
 tpg|DAA44595.1| TPA: hypothetical protein ZEAMMB73_810828 [Zea mays]
 tpg|DAA44596.1| TPA: hypothetical protein ZEAMMB73_810828 [Zea mays]
 tpg|DAA44597.1| TPA: hypothetical protein ZEAMMB73_810828 [Zea mays]
 tpg|DAA44598.1| TPA: hypothetical protein ZEAMMB73_810828 [Zea mays]
Length=361

 Score =   222 bits (566),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKK+  +LASGAH++GNVLV ETA I +GCLIGPDVA+GPGCV+E+GVRLSRCTVMR  
Sbjct  237  LRKKAPARLASGAHVLGNVLVHETAVIGDGCLIGPDVAVGPGCVVEAGVRLSRCTVMRAA  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            R+K+H C+SSSIIGWHSTVG+WARVENMTILGEDVH+CDEIYSNGGVVLPHKEIKSSIL 
Sbjct  297  RVKQHACVSSSIIGWHSTVGKWARVENMTILGEDVHVCDEIYSNGGVVLPHKEIKSSILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>ref|XP_010937548.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Elaeis guineensis]
 ref|XP_010937549.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Elaeis guineensis]
 ref|XP_010937550.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Elaeis guineensis]
Length=361

 Score =   222 bits (566),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKKS  KL+ G HIVGNVLV E+A I EGCLIGPDVAIGPGCV+ESGVRLSRCTVMRGV
Sbjct  237  LRKKSPYKLSVGPHIVGNVLVHESAVIGEGCLIGPDVAIGPGCVVESGVRLSRCTVMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH CISSSIIGWHSTVGQW+R+ENMTILGEDVH+ DE+YSNGGVVLPHKEIKSSIL 
Sbjct  297  RIKKHACISSSIIGWHSTVGQWSRIENMTILGEDVHVGDEVYSNGGVVLPHKEIKSSILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>ref|XP_008785513.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Phoenix dactylifera]
 ref|XP_008785514.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Phoenix dactylifera]
 ref|XP_008785515.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Phoenix dactylifera]
 ref|XP_008785516.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Phoenix dactylifera]
 ref|XP_008785518.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Phoenix dactylifera]
 ref|XP_008785519.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Phoenix dactylifera]
 ref|XP_008785520.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Phoenix dactylifera]
 ref|XP_008785521.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Phoenix dactylifera]
Length=361

 Score =   222 bits (566),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKKS  KLA G HIVGNVLV E+A I EGCLIGPDVAIGPGCV+ESGVRLSR TVMRGV
Sbjct  237  LRKKSPYKLAVGPHIVGNVLVHESAVIGEGCLIGPDVAIGPGCVLESGVRLSRSTVMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH CISSSIIGWH TVG+WARVENMTILGEDVH+CDEIYSNGGVVLPHKEIKSSIL 
Sbjct  297  RIKKHACISSSIIGWHCTVGRWARVENMTILGEDVHVCDEIYSNGGVVLPHKEIKSSILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>gb|AFL69832.1| mannose-1-phosphate guanyltransferase 3 [Oryza sativa Indica 
Group]
Length=361

 Score =   222 bits (565),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRK+S+ +LA+GAHIVGNVLV E+AKI EGCLIGPDVAIGPGCV+E GVRLSRCTVMRGV
Sbjct  237  LRKRSTNRLATGAHIVGNVLVHESAKIGEGCLIGPDVAIGPGCVVEDGVRLSRCTVMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
             IKKH CIS+SIIGWHSTVGQWAR+ENMTILGEDVH+ DE+Y+NGGVVLPHKEIKS IL 
Sbjct  297  HIKKHACISNSIIGWHSTVGQWARIENMTILGEDVHVGDEVYTNGGVVLPHKEIKSGILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>gb|AFL69830.1| mannose-1-phosphate guanyltransferase 1 [Oryza sativa Indica 
Group]
Length=361

 Score =   222 bits (565),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRK+S+ +LA+GAHIVGNVLV E+AKI EGCLIGPDVAIGPGCV+E GVRLSRCTVMRGV
Sbjct  237  LRKRSTNRLATGAHIVGNVLVHESAKIGEGCLIGPDVAIGPGCVVEDGVRLSRCTVMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
             IKKH CIS+SIIGWHSTVGQWAR+ENMTILGEDVH+ DE+Y+NGGVVLPHKEIKS IL 
Sbjct  297  HIKKHACISNSIIGWHSTVGQWARIENMTILGEDVHVGDEVYTNGGVVLPHKEIKSGILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>ref|XP_006429172.1| hypothetical protein CICLE_v10012040mg [Citrus clementina]
 gb|ESR42412.1| hypothetical protein CICLE_v10012040mg [Citrus clementina]
Length=302

 Score =   220 bits (560),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            L+K SS KLA+G++I+GNVLV E AKI +GCLIGPDVAIGPGCVIE GVRLSRCTVMRGV
Sbjct  178  LQKNSSSKLATGSNIIGNVLVHEGAKIGDGCLIGPDVAIGPGCVIEPGVRLSRCTVMRGV  237

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH CISSSIIGWHSTVG+WARVENMTILGEDVH+ DE+YSNG VVLPHKEIKSSI+N
Sbjct  238  RIKKHACISSSIIGWHSTVGRWARVENMTILGEDVHVADEVYSNGAVVLPHKEIKSSIVN  297

Query  244  PEIVM  230
            PEIVM
Sbjct  298  PEIVM  302



>gb|ABR15469.1| GDP-mannose pyrophosphorylase [Pinus taeda]
Length=361

 Score =   222 bits (565),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LR+    KL+ GAHI+GNV+VDETA+I EGCLIGPDVAIGPGCVIE+GVRLSRCTVMRGV
Sbjct  237  LRRNLPKKLSFGAHIIGNVIVDETAQIGEGCLIGPDVAIGPGCVIEAGVRLSRCTVMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH C+S SIIGWH TVGQWARVENMT+LGEDVH+CDE+YSNGGVVLPHKEIKSSI  
Sbjct  297  RIKKHACVSGSIIGWHCTVGQWARVENMTVLGEDVHVCDEVYSNGGVVLPHKEIKSSITK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>gb|ABK24420.1| unknown [Picea sitchensis]
 gb|ACN39840.1| unknown [Picea sitchensis]
Length=361

 Score =   222 bits (565),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            L++    KL+ GAHI+GNV+VDETA+I EGCLIGPDVAIGPGC+IE+GVRLSRCTVMRGV
Sbjct  237  LKRNLPKKLSFGAHIIGNVIVDETAQIGEGCLIGPDVAIGPGCMIEAGVRLSRCTVMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH C+S SIIGWHSTVGQWARVENMT+LGEDVH+CDE+YSNGGVVLPHKEIKSSI  
Sbjct  297  RIKKHACVSGSIIGWHSTVGQWARVENMTVLGEDVHVCDEVYSNGGVVLPHKEIKSSITK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>ref|XP_009143286.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Brassica 
rapa]
Length=361

 Score =   221 bits (564),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKK   KL +G  IVGNVLVDETAKI EGCLIGPDVAIGPGCV+ESGVRLSRCTVMRG 
Sbjct  237  LRKKCPAKLTTGPDIVGNVLVDETAKIGEGCLIGPDVAIGPGCVVESGVRLSRCTVMRGA  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH CISSSIIGWHSTVGQWAR+ENMTILGEDVH+ DEIYSNGGVVLPHKEIKS+IL 
Sbjct  297  RIKKHACISSSIIGWHSTVGQWARIENMTILGEDVHVRDEIYSNGGVVLPHKEIKSNILM  356

Query  244  PEIVM  230
            P IVM
Sbjct  357  PGIVM  361



>ref|XP_010088589.1| Mannose-1-phosphate guanylyltransferase 1 [Morus notabilis]
 gb|EXB36730.1| Mannose-1-phosphate guanylyltransferase 1 [Morus notabilis]
Length=361

 Score =   221 bits (562),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKKSS KLASG+HI+GNVLVDE+A I +GCLIGPDVAIGPGC IE GVRLS CTVMRGV
Sbjct  237  LRKKSSSKLASGSHIIGNVLVDESAVIGDGCLIGPDVAIGPGCEIEQGVRLSHCTVMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH CIS  IIGWHSTVG+WAR+ENMTILGEDVHI DE+YSNGGVVLPHKEIKSSIL 
Sbjct  297  RIKKHACISRGIIGWHSTVGRWARIENMTILGEDVHIGDEVYSNGGVVLPHKEIKSSILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>ref|XP_006493574.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 3-like 
[Citrus sinensis]
Length=361

 Score =   221 bits (562),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            L+K SS KLA+G++I+GNVLV E AKI +GCLIGPDVAIGPGCVIE GVRLSRCTVMRGV
Sbjct  237  LQKNSSSKLATGSNIIGNVLVHEGAKIGDGCLIGPDVAIGPGCVIEPGVRLSRCTVMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH CISSSIIGWHSTVG+WARVENMTILGEDVH+ DE+YSNG VVLPHKEIKSSI+N
Sbjct  297  RIKKHACISSSIIGWHSTVGRWARVENMTILGEDVHVADEVYSNGAVVLPHKEIKSSIVN  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>ref|XP_006429173.1| hypothetical protein CICLE_v10012040mg [Citrus clementina]
 gb|ESR42413.1| hypothetical protein CICLE_v10012040mg [Citrus clementina]
Length=361

 Score =   221 bits (562),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            L+K SS KLA+G++I+GNVLV E AKI +GCLIGPDVAIGPGCVIE GVRLSRCTVMRGV
Sbjct  237  LQKNSSSKLATGSNIIGNVLVHEGAKIGDGCLIGPDVAIGPGCVIEPGVRLSRCTVMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH CISSSIIGWHSTVG+WARVENMTILGEDVH+ DE+YSNG VVLPHKEIKSSI+N
Sbjct  297  RIKKHACISSSIIGWHSTVGRWARVENMTILGEDVHVADEVYSNGAVVLPHKEIKSSIVN  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>gb|AFL69833.1| mannose-1-phosphate guanyltransferase 4 [Oryza sativa Indica 
Group]
Length=361

 Score =   220 bits (560),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRK+S+ +LA+GAHIVGNVLV E+AKI EGCLIGPDVAIGPGCV+E GVRLSRCTVMRGV
Sbjct  237  LRKRSANRLATGAHIVGNVLVHESAKIGEGCLIGPDVAIGPGCVVEDGVRLSRCTVMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH CIS+SIIGWHSTVGQWAR+ENMTILGEDVH+ DE+Y+NGGV+LPHKEIKSSIL 
Sbjct  297  RIKKHACISNSIIGWHSTVGQWARIENMTILGEDVHVGDEVYTNGGVILPHKEIKSSILK  356

Query  244  PEIVM  230
              IVM
Sbjct  357  XXIVM  361



>gb|EPS66224.1| hypothetical protein M569_08552 [Genlisea aurea]
Length=361

 Score =   220 bits (560),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRK++  KL SGAH++GNVLV +TA I EGCLIGPDVA+GPGCV+ESGVRLSRCTVMRG 
Sbjct  237  LRKRTPSKLVSGAHVLGNVLVHDTATIGEGCLIGPDVAVGPGCVVESGVRLSRCTVMRGA  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH C+SSSI+GWHSTVGQWARVENMTILGEDVH+ DEIY+NGGVVLPHKEIKS+I+ 
Sbjct  297  RIKKHACVSSSIVGWHSTVGQWARVENMTILGEDVHVGDEIYTNGGVVLPHKEIKSNIVK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>emb|CDX74832.1| BnaA05g05780D [Brassica napus]
Length=361

 Score =   219 bits (558),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRK    KL +G  IVGNVLVDETAKI EGCLIGPDVAIGPGCV+ESGVRLSRCTVMRG 
Sbjct  237  LRKNCPAKLTTGPDIVGNVLVDETAKIGEGCLIGPDVAIGPGCVVESGVRLSRCTVMRGA  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH CISSSIIGWHSTVGQWAR+ENMTILGEDVH+ DEIYSNGGVVLPHKEIKS+IL 
Sbjct  297  RIKKHACISSSIIGWHSTVGQWARIENMTILGEDVHVRDEIYSNGGVVLPHKEIKSNILM  356

Query  244  PEIVM  230
            P IVM
Sbjct  357  PGIVM  361



>emb|CDY20480.1| BnaC04g05640D [Brassica napus]
Length=360

 Score =   219 bits (558),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 106/123 (86%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKK   KL +GA IVGNVLVDETAKI EGCLIGPDVAIGPGC++ESGVRLSRCTVMRG 
Sbjct  237  LRKKCPAKLTTGADIVGNVLVDETAKIGEGCLIGPDVAIGPGCIVESGVRLSRCTVMRGA  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH CISSSIIGWHSTVGQWAR+ENMTILGEDVH+ DEIYSNGGVVLPHKEIKS+IL 
Sbjct  297  RIKKHACISSSIIGWHSTVGQWARIENMTILGEDVHVRDEIYSNGGVVLPHKEIKSNILM  356

Query  244  PEI  236
            P I
Sbjct  357  PGI  359



>ref|XP_010923222.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Elaeis guineensis]
 ref|XP_010923223.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Elaeis guineensis]
 ref|XP_010923224.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Elaeis guineensis]
Length=361

 Score =   218 bits (556),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKKS  KLA G HIVGNVLV ETA I EGCLIGPDVAIG GCV+ESGVRLSR TVMR V
Sbjct  237  LRKKSPYKLAVGPHIVGNVLVHETAVIGEGCLIGPDVAIGQGCVVESGVRLSRSTVMREV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH CISSSIIGWH TVGQWARVENMTILGEDVH+CDEIYSNGGVVLPHKEIKSSIL 
Sbjct  297  RIKKHACISSSIIGWHCTVGQWARVENMTILGEDVHVCDEIYSNGGVVLPHKEIKSSILK  356

Query  244  PEIVM  230
            P+IVM
Sbjct  357  PQIVM  361



>ref|XP_009388596.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Musa acuminata subsp. malaccensis]
 ref|XP_009388598.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Musa acuminata subsp. malaccensis]
Length=361

 Score =   218 bits (556),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            +R++   KLA G HIVGNVLV E+A I EGCLIGPDVAIGPGCV+E GVRLSRCTVMR  
Sbjct  237  IRRRKPYKLAVGPHIVGNVLVHESAVIGEGCLIGPDVAIGPGCVVEDGVRLSRCTVMRAA  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH+CISSSIIGWHSTVGQWARVENMTILGEDVH+CDE+YSNGGVVLPHKEIKSSIL 
Sbjct  297  RIKKHSCISSSIIGWHSTVGQWARVENMTILGEDVHVCDEVYSNGGVVLPHKEIKSSILK  356

Query  244  PEIVM  230
            P IVM
Sbjct  357  PAIVM  361



>ref|XP_008801637.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
isoform X2 [Phoenix dactylifera]
Length=358

 Score =   218 bits (554),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKKS  KLA G HI GNVLV E+A I EGCLIGPDVAIGPGCV+ESGVRLSRCTVM GV
Sbjct  234  LRKKSPYKLAVGPHIAGNVLVHESAVIGEGCLIGPDVAIGPGCVVESGVRLSRCTVMHGV  293

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH CISSSIIGWHSTVG+W+RVENMTILGEDVH+ DE+YSNGGVVLPHKEIKSSIL 
Sbjct  294  RIKKHACISSSIIGWHSTVGRWSRVENMTILGEDVHVGDEVYSNGGVVLPHKEIKSSILK  353

Query  244  PEIVM  230
            PEIVM
Sbjct  354  PEIVM  358



>ref|XP_008801635.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
isoform X1 [Phoenix dactylifera]
 ref|XP_008801636.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
isoform X1 [Phoenix dactylifera]
Length=361

 Score =   218 bits (554),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKKS  KLA G HI GNVLV E+A I EGCLIGPDVAIGPGCV+ESGVRLSRCTVM GV
Sbjct  237  LRKKSPYKLAVGPHIAGNVLVHESAVIGEGCLIGPDVAIGPGCVVESGVRLSRCTVMHGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH CISSSIIGWHSTVG+W+RVENMTILGEDVH+ DE+YSNGGVVLPHKEIKSSIL 
Sbjct  297  RIKKHACISSSIIGWHSTVGRWSRVENMTILGEDVHVGDEVYSNGGVVLPHKEIKSSILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>ref|XP_004246437.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Solanum 
lycopersicum]
Length=361

 Score =   218 bits (554),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRK SSP LA G HI+GNVL+DE+A I +GCLIGPDVAIGPGCVIESGVRLSRC++MRGV
Sbjct  237  LRKISSPDLAVGHHILGNVLIDESAVIGDGCLIGPDVAIGPGCVIESGVRLSRCSIMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            R+K H CISSSI+GWHSTVG+WARVENM+ILGEDVH+ DE+YSNGGVVLPHKEIKSSIL 
Sbjct  297  RVKNHACISSSIVGWHSTVGRWARVENMSILGEDVHVGDEVYSNGGVVLPHKEIKSSILE  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>ref|XP_006846369.1| hypothetical protein AMTR_s00012p00262290 [Amborella trichopoda]
 gb|ERN08044.1| hypothetical protein AMTR_s00012p00262290 [Amborella trichopoda]
Length=361

 Score =   216 bits (549),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 99/125 (79%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LR   SPKLA G HIVGNVL+DE A+I EGCLIGPDVA+GPGCV+ESGVRLSRCTVMRG 
Sbjct  237  LRNVGSPKLACGVHIVGNVLIDENAQIGEGCLIGPDVAVGPGCVVESGVRLSRCTVMRGA  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            R+K+H C++ SI+GWHSTVGQWARVENMTILGEDVH+ DE+YSNGGVVLPHKEIK++I  
Sbjct  297  RVKRHACVTGSIVGWHSTVGQWARVENMTILGEDVHVGDEVYSNGGVVLPHKEIKTNINK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>ref|XP_009387284.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Musa acuminata subsp. malaccensis]
 ref|XP_009387293.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Musa acuminata subsp. malaccensis]
Length=361

 Score =   214 bits (546),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKKS  KLA+G+H+VGNVLV ETA + EG LIGPDV++GPGCV+E+GVRLSRCTVMRG 
Sbjct  237  LRKKSPSKLAAGSHVVGNVLVHETAVVGEGSLIGPDVSVGPGCVVEAGVRLSRCTVMRGT  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH C+S SIIG HSTVGQWAR+ENMTILGEDVH+ DEIYSNGGVVLPHKEIKSSIL 
Sbjct  297  RIKKHACVSGSIIGTHSTVGQWARIENMTILGEDVHVGDEIYSNGGVVLPHKEIKSSILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>gb|KHN13115.1| Mannose-1-phosphate guanylyltransferase 1 [Glycine soja]
Length=361

 Score =   214 bits (546),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 108/116 (93%), Gaps = 0/116 (0%)
 Frame = -2

Query  577  ASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGVRIKKHTCIS  398
            ASG+  VGNV+VDETAKI EGCLIGPDVAIGPGC+IE GVRL  CT+MRGVR+KKH C+S
Sbjct  246  ASGSQFVGNVIVDETAKIGEGCLIGPDVAIGPGCIIEQGVRLKSCTIMRGVRVKKHACVS  305

Query  397  SSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILNPEIVM  230
            SSI+GWHSTVGQWARV+NMTILGEDVH+CDEIYSNGGVVLPHKEIKS+IL PEIVM
Sbjct  306  SSIVGWHSTVGQWARVDNMTILGEDVHVCDEIYSNGGVVLPHKEIKSNILKPEIVM  361



>ref|XP_006340997.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Solanum 
tuberosum]
Length=361

 Score =   214 bits (545),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 100/125 (80%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRK SSP LA G HI+GNVL+DE+A I +GCLIGPDVAIGPGCVIESGVRLSRC++MRGV
Sbjct  237  LRKISSPDLAVGHHILGNVLIDESAVIGDGCLIGPDVAIGPGCVIESGVRLSRCSIMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            R+K H CISSSI+GWHSTVG+WARVENM+ILGEDVH+ DE+YSNGGVVLPHKEIK SIL 
Sbjct  297  RVKNHACISSSIVGWHSTVGRWARVENMSILGEDVHVGDEVYSNGGVVLPHKEIKFSILE  356

Query  244  PEIVM  230
            P+I+M
Sbjct  357  PQIIM  361



>ref|NP_001276259.1| mannose-1-phosphate guanylyltransferase 1-like [Glycine max]
 gb|ACU21199.1| unknown [Glycine max]
Length=361

 Score =   211 bits (538),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 97/116 (84%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = -2

Query  577  ASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGVRIKKHTCIS  398
            ASG+  VGNV+VDETAKI EGCLIGPDVAIGPGC+IE GVRL  CT+MR VR+KKH C+S
Sbjct  246  ASGSQFVGNVIVDETAKIGEGCLIGPDVAIGPGCIIEQGVRLKSCTIMRRVRVKKHACVS  305

Query  397  SSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILNPEIVM  230
            SSI+GWHSTVGQWARV+NMTILGEDVH+CDEIYSNGGVVLPHKEIKS+IL PEIVM
Sbjct  306  SSIVGWHSTVGQWARVDNMTILGEDVHVCDEIYSNGGVVLPHKEIKSNILKPEIVM  361



>ref|XP_001782193.1| predicted protein [Physcomitrella patens]
 gb|EDQ53016.1| predicted protein [Physcomitrella patens]
Length=361

 Score =   209 bits (531),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 96/125 (77%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKK+  KLASG+  +GNV+VDE+AKI EGCLIGPDV+IG GC IE+GVRLSRCT+MRGV
Sbjct  237  LRKKAPEKLASGSTFLGNVIVDESAKIGEGCLIGPDVSIGQGCTIEAGVRLSRCTIMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            R+KKH CIS SIIGWH T+GQWAR+ENMT+LGEDV + DEI++NGGVVLPHKEIK+SIL 
Sbjct  297  RVKKHACISGSIIGWHCTIGQWARIENMTVLGEDVRVSDEIFTNGGVVLPHKEIKASILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>ref|XP_002966693.1| hypothetical protein SELMODRAFT_168373 [Selaginella moellendorffii]
 ref|XP_002978048.1| hypothetical protein SELMODRAFT_271290 [Selaginella moellendorffii]
 gb|EFJ20705.1| hypothetical protein SELMODRAFT_271290 [Selaginella moellendorffii]
 gb|EFJ32720.1| hypothetical protein SELMODRAFT_168373 [Selaginella moellendorffii]
Length=361

 Score =   208 bits (530),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 97/125 (78%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKKS  KLASG+++V NV++DE+A I +GCL+GPDV+IG GCVIE GVRL  CTVMRGV
Sbjct  237  LRKKSPEKLASGSNVVDNVIIDESASIGQGCLLGPDVSIGQGCVIEDGVRLKHCTVMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKH C+S SIIGWHSTVGQWARVENMT+LGEDVH+ DEIYSNGGVVLPHKEIK++I+ 
Sbjct  297  RIKKHACVSWSIIGWHSTVGQWARVENMTVLGEDVHVSDEIYSNGGVVLPHKEIKANIMK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>ref|XP_011016812.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like, partial 
[Populus euphratica]
Length=349

 Score =   207 bits (528),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 99/113 (88%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRK SSPKLA+G +IVGNVLVDE+A I EGCLIGPDVAIGPGC+I+SGVRLSRCTVMRGV
Sbjct  237  LRKMSSPKLATGPNIVGNVLVDESAVIGEGCLIGPDVAIGPGCIIDSGVRLSRCTVMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKE  266
            RIKKH CISSSIIGWHSTVG+WAR+ENMTILGEDVHI DE+YSNGGVVLPHKE
Sbjct  297  RIKKHACISSSIIGWHSTVGRWARMENMTILGEDVHIGDEVYSNGGVVLPHKE  349



>ref|NP_191118.1| probable mannose-1-phosphate guanylyltransferase 2 [Arabidopsis 
thaliana]
 sp|Q9M2S0.1|GMPP2_ARATH RecName: Full=Probable mannose-1-phosphate guanylyltransferase 
2 [Arabidopsis thaliana]
 emb|CAB75917.1| mannose-1-phosphate guanylyltransferase-like protein [Arabidopsis 
thaliana]
 gb|AAY78774.1| putative GDP-mannose pyrophosphorylase [Arabidopsis thaliana]
 gb|AEE79405.1| probable mannose-1-phosphate guanylyltransferase 2 [Arabidopsis 
thaliana]
Length=364

 Score =   207 bits (528),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 99/125 (79%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKKS  KLA+G HI+GNVLVDETA+I EGCLIGP+VAIGPGCV+ESGVRLS CTVMRGV
Sbjct  240  LRKKSPSKLATGPHILGNVLVDETAEIGEGCLIGPNVAIGPGCVVESGVRLSHCTVMRGV  299

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
             +K++ CISSSIIGWHSTVGQWARVENM+ILG++V++CDEIY NGGVVL +KEIKS IL 
Sbjct  300  HVKRYACISSSIIGWHSTVGQWARVENMSILGKNVYVCDEIYCNGGVVLHNKEIKSDILK  359

Query  244  PEIVM  230
            P+IVM
Sbjct  360  PDIVM  364



>ref|XP_001769404.1| predicted protein [Physcomitrella patens]
 gb|EDQ65773.1| predicted protein [Physcomitrella patens]
Length=361

 Score =   207 bits (527),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 95/125 (76%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKK   +LASG+  +GNV+VDE+AKI +GCLIGPDV+IG GC IE+GVRLSRCT+MRGV
Sbjct  237  LRKKDPERLASGSTFLGNVIVDESAKIGDGCLIGPDVSIGQGCTIEAGVRLSRCTIMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            R+KKH CIS SIIGWH T+GQWAR+ENMT+LGEDV + DEI+SNGGVVLPHKEIK+SIL 
Sbjct  297  RVKKHACISGSIIGWHCTIGQWARIENMTVLGEDVRVSDEIFSNGGVVLPHKEIKTSILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>ref|XP_002990832.1| hypothetical protein SELMODRAFT_185648 [Selaginella moellendorffii]
 gb|EFJ08105.1| hypothetical protein SELMODRAFT_185648 [Selaginella moellendorffii]
Length=361

 Score =   204 bits (518),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            +R+KS  KL+ GAH+VGNV++D +A+I  GCLIGPDVA+GP CVIE GVRLSRCTVMRG 
Sbjct  237  IRRKSPEKLSIGAHVVGNVMIDPSARIGSGCLIGPDVAVGPDCVIEEGVRLSRCTVMRGA  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            +I+KH+C+S SIIGWHS +GQW R+ENMT+LGEDV + DE+YSNGGVVLPHKEIK+SIL 
Sbjct  297  QIRKHSCVSGSIIGWHSKLGQWTRIENMTVLGEDVQVKDELYSNGGVVLPHKEIKTSILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>ref|XP_002974469.1| hypothetical protein SELMODRAFT_267755 [Selaginella moellendorffii]
 gb|EFJ24691.1| hypothetical protein SELMODRAFT_267755 [Selaginella moellendorffii]
Length=361

 Score =   204 bits (518),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            +R+KS  KL+ GAH+VGNV++D +A+I  GCLIGPDVA+GP CVIE GVRLSRCTVMRG 
Sbjct  237  IRRKSPEKLSIGAHVVGNVMIDPSARIGSGCLIGPDVAVGPDCVIEEGVRLSRCTVMRGA  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            +I+KH+C+S SIIGWHS +GQW R+ENMT+LGEDV + DE+YSNGGVVLPHKEIK+SIL 
Sbjct  297  QIRKHSCVSGSIIGWHSKLGQWTRIENMTVLGEDVQVKDELYSNGGVVLPHKEIKTSILK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>ref|NP_001242262.1| uncharacterized protein LOC100818016 [Glycine max]
 gb|ACU23379.1| unknown [Glycine max]
Length=361

 Score =   201 bits (511),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 97/125 (78%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKKS  +LASG H VGNV+V ETA I EGCL+GPDVAIGPGCV+ESGVRLSRCTVMRGV
Sbjct  237  LRKKSPSRLASGPHFVGNVIVHETATIGEGCLVGPDVAIGPGCVVESGVRLSRCTVMRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIKKHTCIS+SIIGWHSTVGQWARVENMTILGEDVH+CDE+YSNGG     +  +     
Sbjct  297  RIKKHTCISNSIIGWHSTVGQWARVENMTILGEDVHVCDEVYSNGGCSFAPQGDQVKHSK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>ref|XP_010427339.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 2 
[Camelina sativa]
 ref|XP_010427340.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 2 
[Camelina sativa]
Length=356

 Score =   198 bits (503),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 95/125 (76%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKK+  KLA+G HIVGNVLVDETA+I +GCLIGPDVAIG  CVIESGVRLSRCTVMRG 
Sbjct  232  LRKKTPSKLANGPHIVGNVLVDETAEIGDGCLIGPDVAIGRDCVIESGVRLSRCTVMRGA  291

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
             +K+++C+SSSIIGWHSTVGQWARVENM+ILG++V++ DEIY NGGVVL +KEIKS I+ 
Sbjct  292  HVKRYSCVSSSIIGWHSTVGQWARVENMSILGKNVNLYDEIYCNGGVVLHNKEIKSDIMK  351

Query  244  PEIVM  230
            P+IVM
Sbjct  352  PDIVM  356



>ref|XP_006846372.1| hypothetical protein AMTR_s00012p00262630 [Amborella trichopoda]
 gb|ERN08047.1| hypothetical protein AMTR_s00012p00262630 [Amborella trichopoda]
Length=361

 Score =   197 bits (502),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LR+ SSP LASG HI+GNV+++ET++I EGCLIGPDVA+GPGCV+ESGVRLSRC+VM+G 
Sbjct  237  LRRISSPLLASGPHIIGNVVMEETSQIGEGCLIGPDVAVGPGCVVESGVRLSRCSVMQGA  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIK+H  +S SI+GWHSTVG+WA +ENM++LGEDVH+ DE+Y NGG+VLPHKEIK++I  
Sbjct  297  RIKEHAVVSGSIVGWHSTVGEWAHIENMSVLGEDVHVRDEVYCNGGLVLPHKEIKTNIDR  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>ref|XP_010412788.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 2 
[Camelina sativa]
Length=358

 Score =   191 bits (485),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 108/125 (86%), Gaps = 6/125 (5%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKKS  KLA+G HIVGNVLVDETA+I EGCLIGPD      CVIESGVRLSRCTVMRG 
Sbjct  240  LRKKSPSKLANGPHIVGNVLVDETAEIGEGCLIGPD------CVIESGVRLSRCTVMRGA  293

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
             +K+++C+SSSIIGWHSTVGQWARVENM+ILG++VH+ DEIY NGGVVL +KEIKS I+ 
Sbjct  294  HVKRYSCVSSSIIGWHSTVGQWARVENMSILGKNVHLYDEIYCNGGVVLHNKEIKSDIMK  353

Query  244  PEIVM  230
            P+IVM
Sbjct  354  PDIVM  358



>gb|EMT15706.1| Mannose-1-phosphate guanyltransferase beta [Aegilops tauschii]
Length=297

 Score =   188 bits (477),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 84/96 (88%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -2

Query  517  GCLIGPDVAIGPGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMT  338
            GCLIGPDVA+GPGCV+E+GVRLSRCTVMRG R+KKH CIS SI+GWHSTVG+WARVENMT
Sbjct  202  GCLIGPDVAVGPGCVVEAGVRLSRCTVMRGARVKKHACISGSIVGWHSTVGKWARVENMT  261

Query  337  ILGEDVHICDEIYSNGGVVLPHKEIKSSILNPEIVM  230
            ILGEDVH+CDE+YSNGGVVLPHKEIKSSIL PEIVM
Sbjct  262  ILGEDVHVCDEVYSNGGVVLPHKEIKSSILKPEIVM  297



>gb|ABK24789.1| unknown [Picea sitchensis]
Length=361

 Score =   187 bits (475),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            L +  S KLA G++IVGNV+++E+A+I E CLIGPDVAIG GCVIE GVRLS+CT+MRG 
Sbjct  237  LSRSCSDKLAKGSNIVGNVIIEESAEIGEDCLIGPDVAIGAGCVIEEGVRLSQCTIMRGA  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RI+KH  +  SIIGW S+VG+W R+EN+TILGEDVH+ DE+YSNGGV+LPHKEIKSSILN
Sbjct  297  RIQKHARVCGSIIGWMSSVGKWGRLENLTILGEDVHVWDEVYSNGGVILPHKEIKSSILN  356

Query  244  PEIVM  230
            P IVM
Sbjct  357  PSIVM  361



>ref|XP_010941227.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Elaeis 
guineensis]
 ref|XP_010941228.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Elaeis 
guineensis]
 ref|XP_010941229.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Elaeis 
guineensis]
 ref|XP_010941231.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Elaeis 
guineensis]
Length=361

 Score =   172 bits (436),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 82/125 (66%), Positives = 103/125 (82%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LR+KSS  LA G +I+GNVL+DE+AKI EGCLIGPDV IGP CVIESGVRLS CT+M+GV
Sbjct  237  LRRKSSLDLAIGHNIIGNVLIDESAKIGEGCLIGPDVVIGPNCVIESGVRLSSCTLMKGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            ++K+   +S SIIGWHSTVG+ A+V +M +LGEDVH+ + ++ NG VVLPHKEI+S  + 
Sbjct  297  QVKRSAHVSGSIIGWHSTVGESAQVSSMAVLGEDVHVGETVFLNGVVVLPHKEIRSHFVK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>ref|XP_008799379.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Phoenix 
dactylifera]
Length=361

 Score =   171 bits (433),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 80/125 (64%), Positives = 103/125 (82%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LR+KS+ +LA G +I+GNVL+DE+AKI EGCLIGPDV IGP CVIE GVRLS CT+M+GV
Sbjct  237  LRRKSALELAVGRNIIGNVLIDESAKIGEGCLIGPDVVIGPNCVIEPGVRLSSCTLMKGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            ++K+   +S SIIGW+STVG+ A+V +M +LGEDVH+ + ++ NG VVLPHKEIKS  + 
Sbjct  297  QVKRSAHVSGSIIGWYSTVGESAQVSSMAVLGEDVHVGETVFLNGAVVLPHKEIKSHFVK  356

Query  244  PEIVM  230
            PEIVM
Sbjct  357  PEIVM  361



>ref|XP_010275250.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Nelumbo 
nucifera]
Length=360

 Score =   166 bits (421),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 78/124 (63%), Positives = 100/124 (81%), Gaps = 1/124 (1%)
 Frame = -2

Query  598  KKSSPKLAS-GAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGVR  422
            K+ SP++ S G +I+GNVL+ ++AKI EGC+IGPDV +GP C+IESGVRLS CT+M+GVR
Sbjct  237  KRVSPEILSVGPYIIGNVLIADSAKIGEGCIIGPDVTVGPDCIIESGVRLSFCTLMKGVR  296

Query  421  IKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILNP  242
            +K    +S SIIGWHSTVGQ A+V NM +LGEDVH+ D ++ NG VVLPHKEIKS  + P
Sbjct  297  VKSSAHVSGSIIGWHSTVGQSAQVSNMAVLGEDVHVSDTMFLNGVVVLPHKEIKSHFVKP  356

Query  241  EIVM  230
            EI+M
Sbjct  357  EIIM  360



>ref|XP_010456728.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 3 
[Camelina sativa]
Length=167

 Score =   158 bits (400),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 81/126 (64%), Positives = 101/126 (80%), Gaps = 6/126 (5%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LR+KSS +LA+G +I+GNVLVDE+A I EGCLIGPDV IG GCVI+SGVRL  CTVMRGV
Sbjct  47   LREKSSQELATGDNIIGNVLVDESAVIGEGCLIGPDVVIGRGCVIDSGVRLLGCTVMRGV  106

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICD-EIYSNGGVVLPHKEIKSSIL  248
             IK+H CIS+SI+GW STVG+WARV N+T+LG+DVH+ D E+Y++G V+     +K    
Sbjct  107  WIKEHACISNSIVGWDSTVGRWARVVNITVLGKDVHVADAEVYNSGAVIEDQASVK----  162

Query  247  NPEIVM  230
             PEIVM
Sbjct  163  -PEIVM  167



>ref|XP_010438160.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 3 
[Camelina sativa]
Length=358

 Score =   164 bits (414),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 102/126 (81%), Gaps = 6/126 (5%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LR+KSS +LA+G +I+GNVLVDE+A I EGCLIGPDV IGPGCVI+SGVRL  CTVMRGV
Sbjct  238  LREKSSQELATGDNIIGNVLVDESAVIGEGCLIGPDVVIGPGCVIDSGVRLLGCTVMRGV  297

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICD-EIYSNGGVVLPHKEIKSSIL  248
             IK+H CIS+SI+GW STVG+WARV N+T+LG+DVH+ D E+Y++G V+     +K    
Sbjct  298  WIKEHACISNSIVGWDSTVGRWARVVNITVLGKDVHVADAEVYNSGAVIEDQASVK----  353

Query  247  NPEIVM  230
             PEIVM
Sbjct  354  -PEIVM  358



>ref|XP_004347896.1| mannose-1-phosphate guanyltransferase beta [Capsaspora owczarzaki 
ATCC 30864]
 gb|KJE93259.1| mannose-1-phosphate guanyltransferase beta [Capsaspora owczarzaki 
ATCC 30864]
Length=359

 Score =   159 bits (403),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 95/125 (76%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            +R K+   LA G + VGNVLVD +AKI  GC IGP+V IGP  +IE GVRL++ T++ G 
Sbjct  235  MRAKNPSMLAKGDNFVGNVLVDPSAKIGTGCKIGPNVVIGPNVIIEDGVRLAKATILNGS  294

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIK H  ++SSIIGW ST+GQW R+EN+++LGEDV + DEIY NGG++LPHKEI +SI  
Sbjct  295  RIKSHAWLTSSIIGWRSTIGQWVRMENISVLGEDVMVKDEIYINGGMILPHKEIGTSIPE  354

Query  244  PEIVM  230
            P IVM
Sbjct  355  PSIVM  359



>gb|KDP38962.1| hypothetical protein JCGZ_00719 [Jatropha curcas]
Length=355

 Score =   159 bits (401),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 96/119 (81%), Gaps = 0/119 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            L++ SS KLA+G  IVGNVL+DE+A IE+G LIGP+V IGP C IESGV LS CT++RGV
Sbjct  237  LQQNSSAKLATGPKIVGNVLIDESAVIEDGSLIGPNVVIGPDCKIESGVSLSFCTLLRGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSIL  248
             IKK   I SSI+GW+S+VG+ AR++NMTILGE   +CDE++SNG V+ PH+E+KSSI 
Sbjct  297  HIKKDAFICSSIMGWNSSVGRGARLQNMTILGEKAKVCDEVFSNGAVLQPHEEMKSSIF  355



>ref|XP_010432971.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 3 
isoform X1 [Camelina sativa]
Length=358

 Score =   159 bits (401),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 100/126 (79%), Gaps = 6/126 (5%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LR+K+S  L +G +I+GNVLVDE+A I EGCLIGPDV IGPGCVI+SGVRL  CTVMRGV
Sbjct  238  LREKASQVLVTGDNIIGNVLVDESAVIGEGCLIGPDVVIGPGCVIDSGVRLLGCTVMRGV  297

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICD-EIYSNGGVVLPHKEIKSSIL  248
             IK+H CIS+SI+GW STVG+WARV N+T+LG+DVH+ D E+Y++G V+     +K    
Sbjct  298  WIKEHACISNSIVGWDSTVGRWARVVNVTVLGKDVHVADAEVYNSGSVIEEQASVK----  353

Query  247  NPEIVM  230
             PEIVM
Sbjct  354  -PEIVM  358



>ref|XP_001695916.1| GDP-D-mannose pyrophosphorylase [Chlamydomonas reinhardtii]
 gb|EDP01253.1| GDP-D-mannose pyrophosphorylase [Chlamydomonas reinhardtii]
Length=360

 Score =   159 bits (401),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 76/122 (62%), Positives = 93/122 (76%), Gaps = 0/122 (0%)
 Frame = -2

Query  595  KSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGVRIK  416
            + SP+LA G  I GNVLVD +AKI EGCLIGPDV+I  GCVI +GVRLS C VMRGVRIK
Sbjct  239  RQSPQLAKGTGINGNVLVDPSAKIGEGCLIGPDVSISAGCVIGNGVRLSHCVVMRGVRIK  298

Query  415  KHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILNPEI  236
             H+ + S I+GW S VG W+R+EN  +LGEDV + DE+Y NG +VLPHKEIK S+  P I
Sbjct  299  DHSKVESCIVGWDSKVGAWSRLENHCVLGEDVTVKDELYLNGAIVLPHKEIKESVSTPAI  358

Query  235  VM  230
            ++
Sbjct  359  IL  360



>gb|AGC69739.1| mannose-1-phosphate guanylyltransferase [Dictyostelium lacteum]
Length=359

 Score =   158 bits (400),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 95/125 (76%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            L+ K+S  LA+GA IVG VL+D T+ I+ GCLIGP+V IGP CVIE G RL   TV+ G 
Sbjct  235  LKNKASETLATGAGIVGPVLIDPTSVIKPGCLIGPNVTIGPNCVIEEGSRLINTTVLEGT  294

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
             I K++ I SSIIGW+ST+G+W R+EN ++LGEDVH+ DEIY NGG +LPHK I SSI  
Sbjct  295  TIGKNSWIKSSIIGWNSTIGKWVRMENTSVLGEDVHVADEIYINGGKILPHKSISSSIPE  354

Query  244  PEIVM  230
            PEI+M
Sbjct  355  PEIIM  359



>ref|XP_010432972.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 3 
isoform X2 [Camelina sativa]
Length=353

 Score =   158 bits (400),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 100/126 (79%), Gaps = 6/126 (5%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LR+K+S  L +G +I+GNVLVDE+A I EGCLIGPDV IGPGCVI+SGVRL  CTVMRGV
Sbjct  233  LREKASQVLVTGDNIIGNVLVDESAVIGEGCLIGPDVVIGPGCVIDSGVRLLGCTVMRGV  292

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICD-EIYSNGGVVLPHKEIKSSIL  248
             IK+H CIS+SI+GW STVG+WARV N+T+LG+DVH+ D E+Y++G V+     +K    
Sbjct  293  WIKEHACISNSIVGWDSTVGRWARVVNVTVLGKDVHVADAEVYNSGSVIEEQASVK----  348

Query  247  NPEIVM  230
             PEIVM
Sbjct  349  -PEIVM  353



>dbj|BAN16547.1| ADB2008858, partial [Acytostelium subglobosum]
 dbj|GAM21573.1| hypothetical protein SAMD00019534_047480, partial [Acytostelium 
subglobosum LB1]
Length=366

 Score =   158 bits (400),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 75/125 (60%), Positives = 97/125 (78%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            L++K+  KLASG  IVG VL+D TA I+ GCLIGP+V IGP CVIE GVRL   TV+ GV
Sbjct  242  LKQKTPEKLASGPGIVGPVLLDATAVIKPGCLIGPNVTIGPNCVIEEGVRLVNTTVLEGV  301

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
             + +++ + SSIIGW ST+G+W R+EN ++LG+DVHI DE+Y NGG +LPHK I SSI +
Sbjct  302  TVGRNSWVKSSIIGWESTIGKWVRMENTSVLGKDVHISDELYINGGKILPHKSITSSIES  361

Query  244  PEIVM  230
            PEI+M
Sbjct  362  PEIIM  366



>ref|XP_006408596.1| hypothetical protein EUTSA_v10002042mg [Eutrema salsugineum]
 gb|ESQ50049.1| hypothetical protein EUTSA_v10002042mg [Eutrema salsugineum]
Length=326

 Score =   157 bits (398),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 78/109 (72%), Positives = 91/109 (83%), Gaps = 1/109 (1%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKKS  +L +G HIVGNVLVDE+  I EGCLIGPDV IGPGCVI SGVRL  CTVMRGV
Sbjct  218  LRKKSLQELVTGDHIVGNVLVDESVVIGEGCLIGPDVVIGPGCVIGSGVRLFGCTVMRGV  277

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICD-EIYSNGGVV  281
            RIK+H CIS+SI+GW STVG+WARV N T+LG+DVH+ D E+YS+G V+
Sbjct  278  RIKEHACISNSIVGWDSTVGRWARVFNRTVLGKDVHVADAEVYSSGTVI  326



>gb|EFA80657.1| mannose-1-phosphate guanylyltransferase [Polysphondylium pallidum 
PN500]
Length=359

 Score =   158 bits (399),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 95/125 (76%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            L++K+  +LA+G  I+G VLVDETA I+ GCLIGP+V IGP CVIE G RL   TV+ G 
Sbjct  235  LKQKAPERLATGPGIIGPVLVDETATIKPGCLIGPNVTIGPNCVIEEGARLVNTTVLEGA  294

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
             + K++ I S+IIGW ST+G+W R+EN ++LG+DVHI DE+Y NGG +LPHK I SSI  
Sbjct  295  TVGKNSWIKSTIIGWESTIGKWVRMENTSVLGKDVHIADELYINGGKILPHKSITSSIPE  354

Query  244  PEIVM  230
            PEI+M
Sbjct  355  PEIIM  359



>ref|XP_002310933.1| cytokinesis defective 1 family protein [Populus trichocarpa]
 gb|EEE88300.1| cytokinesis defective 1 family protein [Populus trichocarpa]
Length=375

 Score =   158 bits (399),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 93/132 (70%), Positives = 105/132 (80%), Gaps = 10/132 (8%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKKS  KLA+G HI+GNVLVDETA+I EGCLIGPDVAIGPGCV+ESGVRLSRC+VM GV
Sbjct  237  LRKKSPSKLATGPHIMGNVLVDETAEIGEGCLIGPDVAIGPGCVVESGVRLSRCSVMSGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENM----------TILGEDVHICDEIYSNGGVVLP  275
             IK+H CISSSIIGW STVGQ A VE            T LGE V++CD++YSNGGVVLP
Sbjct  297  TIKEHACISSSIIGWSSTVGQGACVEKTVLGEAVHVKKTSLGEVVYVCDDVYSNGGVVLP  356

Query  274  HKEIKSSILNPE  239
             +EI+SS L PE
Sbjct  357  GREIESSNLKPE  368



>ref|XP_002102150.1| GD19750 [Drosophila simulans]
 gb|EDX11653.1| GD19750 [Drosophila simulans]
Length=132

 Score =   150 bits (378),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 94/125 (75%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LR+K SPKL +G  +VGNVLVD TAKI EGC IGP+V IGP  VIE GV + R T+++G 
Sbjct  8    LRQKQSPKLYTGPGVVGNVLVDPTAKIGEGCRIGPNVTIGPDVVIEDGVCIKRSTILKGA  67

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
             ++ H+ + S I+GW STVG+W R+E +T+LGEDV + DE+Y NGG VLPHK I +S+  
Sbjct  68   IVRSHSWLDSCIVGWSSTVGRWVRIEGITVLGEDVIVKDELYINGGQVLPHKSIAASVPE  127

Query  244  PEIVM  230
            P+I+M
Sbjct  128  PQIIM  132



>ref|XP_006284084.1| hypothetical protein CARUB_v10005214mg [Capsella rubella]
 gb|EOA16982.1| hypothetical protein CARUB_v10005214mg [Capsella rubella]
Length=332

 Score =   154 bits (389),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 94/110 (85%), Gaps = 2/110 (2%)
 Frame = -2

Query  604  LRKKSSPKLASGA-HIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRG  428
            LR+KSS +L +G  +I+GNV+VDE+A I EGCLIGPDV IGPGCVI+SGVRL  CTVMRG
Sbjct  218  LREKSSQELVTGDDNIIGNVVVDESAAIGEGCLIGPDVVIGPGCVIDSGVRLFGCTVMRG  277

Query  427  VRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICD-EIYSNGGVV  281
            VRIK+H CIS+SI+GW STVG+WARV N+T+LG DVH+ D E+Y++G V+
Sbjct  278  VRIKEHACISNSIVGWDSTVGKWARVVNVTVLGNDVHVADAEVYNSGAVI  327



>ref|XP_004353971.1| mannose-1-phosphate guanylyltransferase [Dictyostelium fasciculatum]
 gb|EGG14534.1| mannose-1-phosphate guanylyltransferase [Dictyostelium fasciculatum]
Length=359

 Score =   154 bits (388),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 92/125 (74%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            L+ K   KLASG  I+G V++D +A I+ GCLIGP+V I P CVIE G RL   TV++G 
Sbjct  235  LKNKEPEKLASGPDIIGPVMIDPSAIIKPGCLIGPNVTIAPNCVIEEGARLVNTTVLQGA  294

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
             I K++ I SSIIGW ST+G+W R+EN ++LG+DVHI DE+Y NGG +LPHK I SSI  
Sbjct  295  TIGKNSWIKSSIIGWESTIGKWVRMENTSVLGKDVHIADELYINGGKILPHKSISSSIPE  354

Query  244  PEIVM  230
            PEI+M
Sbjct  355  PEIIM  359



>ref|XP_002952855.1| hypothetical protein VOLCADRAFT_81984 [Volvox carteri f. nagariensis]
 gb|EFJ46105.1| hypothetical protein VOLCADRAFT_81984 [Volvox carteri f. nagariensis]
Length=360

 Score =   154 bits (388),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 77/122 (63%), Positives = 90/122 (74%), Gaps = 0/122 (0%)
 Frame = -2

Query  595  KSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGVRIK  416
            + S  LA G  I GNVLVD TAKI EGCLIGPDV+I  GCVI +GVRLS C +MRGV+IK
Sbjct  239  RQSSLLAHGPGISGNVLVDPTAKIGEGCLIGPDVSISAGCVIGNGVRLSHCVIMRGVQIK  298

Query  415  KHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILNPEI  236
             HT +  SIIGW S VG W+R+EN  +LGEDV   DE+Y NG VVLPHKEIK S+  P I
Sbjct  299  DHTKVDLSIIGWDSRVGAWSRLENHCVLGEDVQCKDELYLNGAVVLPHKEIKDSVPAPAI  358

Query  235  VM  230
            ++
Sbjct  359  IL  360



>ref|XP_004368238.1| GDPmannose pyrophosphorylase [Acanthamoeba castellanii str. Neff]
 gb|ELR25483.1| GDPmannose pyrophosphorylase [Acanthamoeba castellanii str. Neff]
Length=359

 Score =   153 bits (387),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 93/125 (74%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            L+ +   KL +G   VG V+VDETAKI E CLIGP+V IGPGCVIE GVRL   TV+ G 
Sbjct  235  LKTRDPKKLRTGEGFVGPVMVDETAKIGENCLIGPNVIIGPGCVIEDGVRLRDTTVLEGA  294

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
             I+ +  IS SIIGW S+VG+W R+EN+++LG+DVHI DE+Y NGG +LPHK I +SI  
Sbjct  295  VIRSNAWISLSIIGWQSSVGRWVRMENVSVLGQDVHIGDELYVNGGRILPHKAISTSIPE  354

Query  244  PEIVM  230
            P+I+M
Sbjct  355  PDIIM  359



>gb|EMS58078.1| Mannose-1-phosphate guanyltransferase beta [Triticum urartu]
Length=403

 Score =   154 bits (388),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 69/80 (86%), Positives = 76/80 (95%), Gaps = 0/80 (0%)
 Frame = -2

Query  469  ESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNG  290
            E+GVRLSRCTVMRG R+KKH CIS SI+GWHSTVG+WARVENMTILGEDVH+CDE+YSNG
Sbjct  316  EAGVRLSRCTVMRGARVKKHACISGSIVGWHSTVGKWARVENMTILGEDVHVCDEVYSNG  375

Query  289  GVVLPHKEIKSSILNPEIVM  230
            GVVLPHKEIKSSIL PEIV+
Sbjct  376  GVVLPHKEIKSSILKPEIVI  395



>gb|KFK29636.1| hypothetical protein AALP_AA7G159400 [Arabis alpina]
Length=434

 Score =   154 bits (390),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 98/126 (78%), Gaps = 5/126 (4%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKK+  +L +G H VGNVL DETA I E CLIGPDV IGPGCVI+SGVRL  CT+MRG 
Sbjct  313  LRKKAPQELVTGDHTVGNVLADETAVIGEHCLIGPDVVIGPGCVIDSGVRLFGCTIMRGA  372

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICD-EIYSNGGVVLPHKEIKSSIL  248
            RIK + C+S+SI+GW STVG+WARV N+++LG+DVH+ D E+YSNG  ++   E + S+ 
Sbjct  373  RIKTNACVSNSIVGWDSTVGRWARVVNISVLGKDVHVADAEVYSNGATII---EDQMSV-  428

Query  247  NPEIVM  230
             PEIV+
Sbjct  429  KPEIVI  434



>ref|XP_005536787.1| mannose-1-phosphate guanylyltransferase [Cyanidioschyzon merolae 
strain 10D]
 dbj|BAM80751.1| mannose-1-phosphate guanylyltransferase [Cyanidioschyzon merolae 
strain 10D]
Length=359

 Score =   152 bits (384),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 92/125 (74%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LR + SP+LA+G   +GNVLVD TA+I + C IGPDV IG GC+IE GVR+   T++ G 
Sbjct  235  LRLRGSPELAAGPMFIGNVLVDTTAQIGKDCRIGPDVVIGAGCIIEEGVRIKSSTLLPGS  294

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            R+K HT I++SIIGW ST+G W R+EN ++LGEDV + DE+  NGGV+LPHK +   IL 
Sbjct  295  RVKSHTWIANSIIGWGSTIGSWVRIENTSVLGEDVAVKDEVCVNGGVILPHKSVTEHILE  354

Query  244  PEIVM  230
            P IVM
Sbjct  355  PRIVM  359



>ref|XP_002038340.1| GM10777 [Drosophila sechellia]
 gb|EDW54877.1| GM10777 [Drosophila sechellia]
Length=369

 Score =   152 bits (384),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 94/125 (75%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LR+K SPKL +G  +VGNVLVD TAKI EGC IGP+V IGP  VIE GV + R T+++G 
Sbjct  245  LRQKQSPKLYTGPGVVGNVLVDPTAKIGEGCRIGPNVTIGPDVVIEDGVCIKRSTILKGA  304

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
             ++ H+ + S I+GW STVG+W R+E +T+LGEDV + DE+Y NGG VLPHK I +S+  
Sbjct  305  IVRSHSWLDSCIVGWRSTVGRWVRIEGITVLGEDVIVKDELYINGGQVLPHKSIAASVPE  364

Query  244  PEIVM  230
            P+I+M
Sbjct  365  PQIIM  369



>gb|KIY95803.1| hypothetical protein MNEG_12160 [Monoraphidium neglectum]
Length=328

 Score =   151 bits (381),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 89/125 (71%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LR      LASGA I GNVLV  +AKI  G LIGPDV+IG GCVI  GVRLS C +MRGV
Sbjct  204  LRSSRPADLASGAGISGNVLVAPSAKIGSGSLIGPDVSIGEGCVIGEGVRLSNCVIMRGV  263

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            +IK H  +  SIIGW S +G W+R+E  +ILG+DV I DE++ NG  VLPHKEIK S+L 
Sbjct  264  KIKNHAKVDRSIIGWDSQIGAWSRLEGHSILGKDVQIKDELFLNGATVLPHKEIKESVLQ  323

Query  244  PEIVM  230
            P I++
Sbjct  324  PTIIL  328



>ref|XP_001994106.1| GH23007 [Drosophila grimshawi]
 gb|EDV94842.1| GH23007 [Drosophila grimshawi]
Length=371

 Score =   152 bits (384),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 94/125 (75%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LR+K SPKL +G  +VGNVLVD TAKI EGC IGP+V IGP  +IE GV + R T+++G 
Sbjct  247  LRQKQSPKLYTGPGVVGNVLVDATAKIGEGCRIGPNVTIGPDVIIEDGVCIKRSTILKGA  306

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
             ++ H+ + S I+GW STVG+W R+E +T+LGEDV + DE+Y NGG VLPHK I +S+  
Sbjct  307  IVRSHSWLDSCIVGWRSTVGRWVRIEGITVLGEDVIVKDELYVNGGQVLPHKSIAASVPE  366

Query  244  PEIVM  230
            P+I+M
Sbjct  367  PQIIM  371



>ref|NP_649498.1| CG1129, isoform A [Drosophila melanogaster]
 ref|NP_730877.1| CG1129, isoform B [Drosophila melanogaster]
 ref|NP_001189177.2| CG1129, isoform D [Drosophila melanogaster]
 ref|NP_001287164.1| CG1129, isoform E [Drosophila melanogaster]
 sp|Q7JZB4.1|GMPPB_DROME RecName: Full=Mannose-1-phosphate guanyltransferase beta; AltName: 
Full=GDP-mannose pyrophosphorylase B; AltName: Full=GTP-mannose-1-phosphate 
guanylyltransferase beta [Drosophila melanogaster]
 gb|AAF52089.1| CG1129, isoform B [Drosophila melanogaster]
 gb|AAG22216.1| CG1129, isoform A [Drosophila melanogaster]
 gb|AAL28561.1| HL02883p [Drosophila melanogaster]
 gb|AAL49033.1| RE49494p [Drosophila melanogaster]
 gb|ACL84126.1| CG1129-PA, partial [synthetic construct]
 gb|ACL92693.1| CG1129-PA [synthetic construct]
 gb|ADV37269.2| CG1129, isoform D [Drosophila melanogaster]
 gb|AHN57163.1| CG1129, isoform E [Drosophila melanogaster]
Length=369

 Score =   152 bits (384),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 94/125 (75%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LR+K SPKL +G  +VGNVLVD TAKI EGC IGP+V IGP  VIE GV + R T+++G 
Sbjct  245  LRQKQSPKLYTGPGVVGNVLVDPTAKIGEGCRIGPNVTIGPDVVIEDGVCIKRSTILKGA  304

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
             ++ H+ + S I+GW STVG+W R+E +T+LGEDV + DE+Y NGG VLPHK I +S+  
Sbjct  305  IVRSHSWLDSCIVGWRSTVGRWVRIEGITVLGEDVIVKDELYINGGQVLPHKSIAASVPE  364

Query  244  PEIVM  230
            P+I+M
Sbjct  365  PQIIM  369



>ref|XP_011033044.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Populus 
euphratica]
Length=375

 Score =   152 bits (383),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 103/133 (77%), Gaps = 12/133 (9%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LRKKS  +LA+G HIVGNVLVDETA+I EGCLIGPDVAIGPGCV+ESGVRL RC+VM GV
Sbjct  237  LRKKSPSQLATGPHIVGNVLVDETAEIGEGCLIGPDVAIGPGCVVESGVRLCRCSVMSGV  296

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHI-----------CDEIYSNGGVVL  278
             IK+H CISSSIIGW STVGQ A VE  T+LGE VH+           CD++YSNGGVV 
Sbjct  297  TIKEHACISSSIIGWSSTVGQGACVEK-TVLGEAVHVKKTSLGEVIYLCDDVYSNGGVVY  355

Query  277  PHKEIKSSILNPE  239
            P  EI+SS L PE
Sbjct  356  PGGEIESSNLKPE  368



>ref|XP_009484708.1| PREDICTED: mannose-1-phosphate guanyltransferase beta [Pelecanus 
crispus]
Length=130

 Score =   144 bits (364),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 90/125 (72%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LR +   KL SG  +VGNVLVD +AKI   C+IGP+V IG G V+E GVR+ RCTV++G 
Sbjct  6    LRAQHPEKLHSGPGVVGNVLVDPSAKIGANCVIGPNVTIGAGVVVEDGVRIKRCTVLKGA  65

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RI+ H+ + S I+GW  +VGQW R+EN+T+LGEDV + DE+Y NG  VLPHK I  S+  
Sbjct  66   RIRSHSWLESCIVGWSCSVGQWVRMENVTVLGEDVIVNDELYLNGANVLPHKSIAESVPE  125

Query  244  PEIVM  230
            P I+M
Sbjct  126  PRIIM  130



>ref|XP_009537794.1| hypothetical protein PHYSODRAFT_319613 [Phytophthora sojae]
 gb|EGZ07030.1| hypothetical protein PHYSODRAFT_319613 [Phytophthora sojae]
Length=359

 Score =   151 bits (381),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 68/121 (56%), Positives = 95/121 (79%), Gaps = 0/121 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            L + +S  L++G+  +GNV+VD TA I EGCLIGP+V +GPGCVIE GVRLSR T++RGV
Sbjct  234  LERSNSDSLSTGSKFIGNVMVDPTAVIGEGCLIGPNVVVGPGCVIEDGVRLSRTTLLRGV  293

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
             ++ ++ I SSIIGW ST+G+W R+E +T++GEDV + DE + NGG++LPHK I +SI +
Sbjct  294  TVRANSWIQSSIIGWGSTIGRWCRIEGITVVGEDVQVKDEKFINGGLILPHKAISASIPD  353

Query  244  P  242
            P
Sbjct  354  P  354



>ref|XP_007789630.1| putative mannose-1-phosphate guanyltransferase protein [Eutypa 
lata UCREL1]
 gb|EMR71275.1| putative mannose-1-phosphate guanyltransferase protein [Eutypa 
lata UCREL1]
Length=147

 Score =   145 bits (365),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 94/128 (73%), Gaps = 3/128 (2%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIV---GNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVM  434
            L KK S  LA  +      GNVL+DETAKI + C IGP+V IG GCVI  GVRL RCT++
Sbjct  20   LSKKKSDLLAPTSESYVHGGNVLIDETAKIGKNCRIGPNVVIGKGCVIGDGVRLQRCTLL  79

Query  433  RGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSS  254
             G ++K H  I S+I+GW+S+VG+WAR+EN+T+LG+DV I DEIY NGG VLPHK IK++
Sbjct  80   PGSKVKDHAWIKSTIVGWNSSVGKWARLENVTVLGDDVTIGDEIYVNGGSVLPHKSIKAN  139

Query  253  ILNPEIVM  230
            +  P I+M
Sbjct  140  VDVPAIIM  147



>ref|XP_002095987.1| GE25436 [Drosophila yakuba]
 gb|EDW95699.1| GE25436 [Drosophila yakuba]
Length=369

 Score =   150 bits (380),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 93/125 (74%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LR+K SPKL +G  +VGNVLVD TAKI EGC IGP+V IGP  VIE GV + R T+++G 
Sbjct  245  LRQKQSPKLYTGPGVVGNVLVDPTAKIGEGCRIGPNVTIGPDVVIEDGVCIKRSTILKGA  304

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
             +  H+ + S I+GW STVG+W R+E +T+LGEDV + DE+Y NGG VLPHK I +S+  
Sbjct  305  IVHSHSWLDSCIVGWRSTVGRWVRIEGITVLGEDVIVKDELYINGGQVLPHKSIAASVPE  364

Query  244  PEIVM  230
            P+I+M
Sbjct  365  PQIIM  369



>ref|XP_002613614.1| hypothetical protein BRAFLDRAFT_93657 [Branchiostoma floridae]
 gb|EEN69623.1| hypothetical protein BRAFLDRAFT_93657 [Branchiostoma floridae]
Length=360

 Score =   150 bits (380),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 92/124 (74%), Gaps = 0/124 (0%)
 Frame = -2

Query  601  RKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGVR  422
            R+K   KL  G  I+GNVLVD +AKI + C IGP+V IGP  VIE G R+ RCT++RG  
Sbjct  237  RQKCPEKLHQGDGIIGNVLVDPSAKIGDNCRIGPNVTIGPDAVIEDGARIKRCTILRGSV  296

Query  421  IKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILNP  242
            +K H+ + SSIIGW S VG+W R+EN+++LGEDV I DE+Y NGG +LPHK I +SI +P
Sbjct  297  VKSHSWLDSSIIGWRSQVGRWVRMENVSVLGEDVIIGDELYINGGRILPHKSISASIADP  356

Query  241  EIVM  230
            +IVM
Sbjct  357  QIVM  360



>ref|XP_001978865.1| GG12578 [Drosophila erecta]
 gb|EDV47823.1| GG12578 [Drosophila erecta]
Length=369

 Score =   150 bits (380),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 93/125 (74%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LR+K SPKL +G  +VGNVLVD TAKI EGC IGP+V IGP  VIE GV + R T+++G 
Sbjct  245  LRQKQSPKLYTGPGVVGNVLVDPTAKIGEGCRIGPNVTIGPDVVIEDGVCIKRSTILKGA  304

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
             +  H+ + S I+GW STVG+W R+E +T+LGEDV + DE+Y NGG VLPHK I +S+  
Sbjct  305  IVHSHSWLDSCIVGWRSTVGRWVRIEGITVLGEDVIVKDELYINGGQVLPHKSIAASVPE  364

Query  244  PEIVM  230
            P+I+M
Sbjct  365  PQIIM  369



>gb|KIX96214.1| mannose-1-phosphate guanyltransferase [Fonsecaea multimorphosa 
CBS 102226]
Length=364

 Score =   150 bits (380),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 74/128 (58%), Positives = 95/128 (74%), Gaps = 3/128 (2%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIV---GNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVM  434
            L KK+S KLAS +      GNVLVD TAKI + C IGP+V IGPGCV+  GVRL RC ++
Sbjct  237  LAKKNSKKLASHSEPYVYGGNVLVDPTAKIGKNCRIGPNVVIGPGCVVGDGVRLQRCVLL  296

Query  433  RGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSS  254
               ++K H  + S+IIGW STVG+WAR+EN+T+LG+DV I DEIY NGG VLPHK IK++
Sbjct  297  EDSKVKDHAWVKSTIIGWRSTVGRWARLENVTVLGDDVSIGDEIYVNGGSVLPHKSIKAN  356

Query  253  ILNPEIVM  230
            +  P+I+M
Sbjct  357  VEVPQIIM  364



>ref|XP_006010396.1| PREDICTED: mannose-1-phosphate guanyltransferase beta [Latimeria 
chalumnae]
Length=360

 Score =   150 bits (378),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 91/125 (73%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            +R+K+   L +G    GNVLVD +AKI E C IGP+V IGPG VIE GVR+ RCT+++G 
Sbjct  236  MRQKTPEGLHTGPGFFGNVLVDPSAKIGENCNIGPNVTIGPGVVIEDGVRIKRCTILKGS  295

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RI+ H+ + S +IGW+S VGQW R+EN+T+LGEDV + DE+Y NG  VLPHK I  S+  
Sbjct  296  RIRSHSWLESCVIGWNSAVGQWVRMENVTVLGEDVIVNDELYLNGANVLPHKSISDSVPE  355

Query  244  PEIVM  230
            P I+M
Sbjct  356  PRIIM  360



>gb|EPZ31169.1| Mannose-1-phosphate guanyltransferase [Rozella allomycis CSF55]
Length=360

 Score =   150 bits (378),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 93/125 (74%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            L K S   +A+G ++VGNVL+  +A+I + C IGP+V IGP  V+E GVRLSR  VM G 
Sbjct  236  LSKSSPSDMATGDNVVGNVLIHPSARIGKFCKIGPNVVIGPNVVVEDGVRLSRVAVMEGA  295

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIK H  I+S+I+GW+ TVG+W R+E +TILG+DV +CDE+Y NGG VLPHK I S+I  
Sbjct  296  RIKSHAWINSTIVGWNCTVGRWTRLEGVTILGDDVSVCDEVYVNGGCVLPHKSIASNISE  355

Query  244  PEIVM  230
            P+I+M
Sbjct  356  PQIIM  360



>ref|XP_001359425.1| GA10892 [Drosophila pseudoobscura pseudoobscura]
 ref|XP_002017270.1| GL21618 [Drosophila persimilis]
 sp|Q295Y7.1|GMPPB_DROPS RecName: Full=Mannose-1-phosphate guanyltransferase beta; AltName: 
Full=GDP-mannose pyrophosphorylase B; AltName: Full=GTP-mannose-1-phosphate 
guanylyltransferase beta [Drosophila pseudoobscura 
pseudoobscura]
 gb|EAL28571.1| GA10892 [Drosophila pseudoobscura pseudoobscura]
 gb|EDW34370.1| GL21618 [Drosophila persimilis]
Length=371

 Score =   150 bits (379),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 93/125 (74%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LR+K SPKL +G  +VGNVLVD TA I EGC IGP+V IGP  +IE GV + R T+++G 
Sbjct  247  LRQKQSPKLYTGPGVVGNVLVDPTATIGEGCRIGPNVTIGPDVIIEDGVCIKRATILKGA  306

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
             ++ H+ + S I+GW STVG+W R+E +T+LGEDV + DE+Y NGG VLPHK I +S+  
Sbjct  307  IVRSHSWLDSCIVGWRSTVGRWVRIEGITVLGEDVIVKDELYVNGGQVLPHKSIAASVPE  366

Query  244  PEIVM  230
            P+I+M
Sbjct  367  PQIIM  371



>gb|EOA95336.1| Mannose-1-phosphate guanyltransferase beta, partial [Anas platyrhynchos]
Length=174

 Score =   145 bits (365),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 89/125 (71%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LR +   KL SG  +VGNVLVD +AKI   C+IGP+V IG G V+E GVR+ RCTV+ G 
Sbjct  50   LRAQHPEKLHSGPGVVGNVLVDPSAKIGANCVIGPNVTIGAGVVVEDGVRIKRCTVLEGA  109

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RI+ H+ + S I+GW  +VGQW R+EN+T+LGEDV + DE+Y NG  VLPHK I  S+  
Sbjct  110  RIRSHSWLESCIVGWSCSVGQWVRMENVTVLGEDVIVNDELYLNGANVLPHKSITESVPE  169

Query  244  PEIVM  230
            P I+M
Sbjct  170  PRIIM  174



>gb|KFO75973.1| Mannose-1-phosphate guanyltransferase beta-A, partial [Cuculus 
canorus]
Length=174

 Score =   145 bits (365),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 89/125 (71%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LR +   KL SG  +VGNVLVD +AKI   C+IGP+V IG G V+E GVR+ RCTV+ G 
Sbjct  50   LRTQHPEKLHSGPGVVGNVLVDPSAKIGANCVIGPNVTIGAGVVVEDGVRIKRCTVLEGA  109

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RI+ H+ + S I+GW  +VGQW R+EN+T+LGEDV + DE+Y NG  VLPHK I  S+  
Sbjct  110  RIRSHSWLESCIVGWSCSVGQWVRMENVTVLGEDVIVNDELYLNGANVLPHKSIAESVPE  169

Query  244  PEIVM  230
            P I+M
Sbjct  170  PRIIM  174



>ref|XP_002000465.1| GI10243 [Drosophila mojavensis]
 gb|EDW15926.1| GI10243 [Drosophila mojavensis]
Length=371

 Score =   150 bits (378),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 93/125 (74%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LR+K S KL +G  +VGNVLVD TAKI EGC IGP+V IGP  VIE GV + R T+++G 
Sbjct  247  LRQKQSSKLYTGPGVVGNVLVDPTAKIGEGCRIGPNVTIGPDVVIEDGVCIKRSTILKGA  306

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
             ++ H+ + S I+GW STVG+W R+E +T+LGEDV + DE+Y NGG VLPHK I +S+  
Sbjct  307  NVRSHSWLDSCIVGWRSTVGRWVRIEGITVLGEDVIVKDELYINGGQVLPHKSIAASVPE  366

Query  244  PEIVM  230
            P+I+M
Sbjct  367  PQIIM  371



>ref|XP_637125.1| mannose-1-phosphate guanylyltransferase [Dictyostelium discoideum 
AX4]
 sp|Q54K39.1|GMPPB_DICDI RecName: Full=Mannose-1-phosphate guanyltransferase beta; AltName: 
Full=GDP-mannose pyrophosphorylase B; AltName: Full=GTP-mannose-1-phosphate 
guanylyltransferase beta [Dictyostelium 
discoideum]
 gb|EAL63618.1| mannose-1-phosphate guanylyltransferase [Dictyostelium discoideum 
AX4]
Length=359

 Score =   149 bits (377),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 92/125 (74%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            L+ K    LA+G  I+G VL+D ++ IE GCLIGP+V IGP CVI+ G RL   TV+ G 
Sbjct  235  LKSKQPELLATGNGIIGPVLIDPSSVIEPGCLIGPNVTIGPNCVIQEGTRLVNTTVLEGT  294

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
             I K++ I S+IIGW+S++G+W R+EN ++LGEDVH+ DE+Y NGG +LPHK I SSI  
Sbjct  295  TIGKNSWIKSTIIGWNSSIGKWVRMENTSVLGEDVHVSDELYINGGKILPHKSITSSIPE  354

Query  244  PEIVM  230
            PEI+M
Sbjct  355  PEIIM  359



>gb|ABI26715.1| GDP-D-mannose pyrophosphorylase [Vitis vinifera]
Length=71

 Score =   141 bits (355),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/71 (96%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = -2

Query  442  TVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEI  263
            TVMRGVRIKKH CISSSIIGWHSTVGQWARVENMTILGEDVH+CDEIYSNGGVVLPHKEI
Sbjct  1    TVMRGVRIKKHACISSSIIGWHSTVGQWARVENMTILGEDVHVCDEIYSNGGVVLPHKEI  60

Query  262  KSSILNPEIVM  230
            KSSIL PEIVM
Sbjct  61   KSSILKPEIVM  71



>ref|XP_009558946.1| PREDICTED: mannose-1-phosphate guanyltransferase beta, partial 
[Cuculus canorus]
Length=184

 Score =   144 bits (364),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 89/125 (71%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LR +   KL SG  +VGNVLVD +AKI   C+IGP+V IG G V+E GVR+ RCTV+ G 
Sbjct  60   LRTQHPEKLHSGPGVVGNVLVDPSAKIGANCVIGPNVTIGAGVVVEDGVRIKRCTVLEGA  119

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RI+ H+ + S I+GW  +VGQW R+EN+T+LGEDV + DE+Y NG  VLPHK I  S+  
Sbjct  120  RIRSHSWLESCIVGWSCSVGQWVRMENVTVLGEDVIVNDELYLNGANVLPHKSIAESVPE  179

Query  244  PEIVM  230
            P I+M
Sbjct  180  PRIIM  184



>ref|XP_005028112.1| PREDICTED: mannose-1-phosphate guanyltransferase beta [Anas platyrhynchos]
Length=200

 Score =   145 bits (365),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 89/125 (71%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LR +   KL SG  +VGNVLVD +AKI   C+IGP+V IG G V+E GVR+ RCTV+ G 
Sbjct  76   LRAQHPEKLHSGPGVVGNVLVDPSAKIGANCVIGPNVTIGAGVVVEDGVRIKRCTVLEGA  135

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RI+ H+ + S I+GW  +VGQW R+EN+T+LGEDV + DE+Y NG  VLPHK I  S+  
Sbjct  136  RIRSHSWLESCIVGWSCSVGQWVRMENVTVLGEDVIVNDELYLNGANVLPHKSITESVPE  195

Query  244  PEIVM  230
            P I+M
Sbjct  196  PRIIM  200



>ref|XP_009858053.1| PREDICTED: mannose-1-phosphate guanyltransferase beta-like [Ciona 
intestinalis]
Length=378

 Score =   149 bits (376),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 91/125 (73%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LR+KS  KL  G  IVGNVLVD + KI + C IGP+V +GPG VIE GVR+ RCTVM+  
Sbjct  254  LRQKSPEKLYRGPEIVGNVLVDSSVKIGKNCKIGPNVVLGPGVVIEDGVRIKRCTVMKEA  313

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
             IK H+ + S I+GW S VG+WAR+EN+T+LG+DV++ DEIY NG  +LPHK I  S   
Sbjct  314  VIKSHSWLESCIVGWESKVGKWARLENITVLGQDVNVKDEIYLNGVRILPHKSISMSYPE  373

Query  244  PEIVM  230
            P+I+M
Sbjct  374  PQIIM  378



>ref|NP_194786.1| Glucose-1-phosphate adenylyltransferase family protein [Arabidopsis 
thaliana]
 sp|Q8H1Q7.1|GMPP3_ARATH RecName: Full=Probable mannose-1-phosphate guanylyltransferase 
3 [Arabidopsis thaliana]
 gb|AAN13073.1| putative GDP-mannose pyrophosphorylase [Arabidopsis thaliana]
 gb|AEE85782.1| Glucose-1-phosphate adenylyltransferase family protein [Arabidopsis 
thaliana]
Length=331

 Score =   148 bits (374),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LR+K+  +LA+G +I+GNVLV E+A I EGCLIGPDV IGPGCVI+SGVRL  CTVMRGV
Sbjct  218  LREKTPQELATGDNIIGNVLVHESAVIGEGCLIGPDVVIGPGCVIDSGVRLFGCTVMRGV  277

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHK  269
             IK+H CIS+SI+GW STVG+WARV N+T+LG+DV++ D    N GVV+  +
Sbjct  278  WIKEHACISNSIVGWDSTVGRWARVFNITVLGKDVNVADAEVYNSGVVIEEQ  329



>ref|XP_008319281.1| PREDICTED: mannose-1-phosphate guanyltransferase beta [Cynoglossus 
semilaevis]
 ref|XP_008319282.1| PREDICTED: mannose-1-phosphate guanyltransferase beta [Cynoglossus 
semilaevis]
Length=360

 Score =   149 bits (375),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 67/125 (54%), Positives = 92/125 (74%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LR+++  +L +G   +GNVLVD TA+I E C IGP+V IG   V+E GVR+ RCTV++G 
Sbjct  236  LRQQAPERLHTGPGFLGNVLVDPTAQIGENCTIGPNVTIGADVVVEDGVRIKRCTVLKGS  295

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            R++ H+ + S I+GW STVGQW R+EN+T+LGEDV + DE+Y NG  VLPHK I  S+ +
Sbjct  296  RVRSHSWLESCIVGWRSTVGQWVRMENVTVLGEDVIVNDELYLNGANVLPHKSINESVPD  355

Query  244  PEIVM  230
            P I+M
Sbjct  356  PRIIM  360



>gb|KFP10017.1| Mannose-1-phosphate guanyltransferase beta, partial [Egretta 
garzetta]
Length=285

 Score =   147 bits (370),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 90/125 (72%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LR +   KL SG  +VGNVLVD +AKI   C+IGP+V IG G V+E GVR+ RCTV++G 
Sbjct  161  LRAQHPEKLYSGPGVVGNVLVDPSAKIGANCVIGPNVTIGAGVVVEDGVRIKRCTVLKGA  220

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RI+ H+ + S I+GW  +VGQW R+EN+T+LGEDV + DE+Y NG  VLPHK I  S+  
Sbjct  221  RIRSHSWLESCIVGWSCSVGQWVRMENVTVLGEDVIVNDELYLNGANVLPHKSIAESVPE  280

Query  244  PEIVM  230
            P I+M
Sbjct  281  PRIIM  285



>emb|CAB79775.1| GDP-mannose pyrophosphorylase like protein [Arabidopsis thaliana]
Length=351

 Score =   148 bits (374),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LR+K+  +LA+G +I+GNVLV E+A I EGCLIGPDV IGPGCVI+SGVRL  CTVMRGV
Sbjct  238  LREKTPQELATGDNIIGNVLVHESAVIGEGCLIGPDVVIGPGCVIDSGVRLFGCTVMRGV  297

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHK  269
             IK+H CIS+SI+GW STVG+WARV N+T+LG+DV++ D    N GVV+  +
Sbjct  298  WIKEHACISNSIVGWDSTVGRWARVFNITVLGKDVNVADAEVYNSGVVIEEQ  349



>ref|XP_003287195.1| mannose-1-phosphate guanylyltransferase [Dictyostelium purpureum]
 gb|EGC36249.1| mannose-1-phosphate guanylyltransferase [Dictyostelium purpureum]
Length=359

 Score =   148 bits (374),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 92/125 (74%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            L+ K    L++G  I+G VL+D ++ IE GCLIGP+V IGP CVI+ G RL   TV+ G 
Sbjct  235  LKSKQPELLSTGTGIIGPVLIDPSSVIEPGCLIGPNVTIGPNCVIQEGARLINTTVLEGT  294

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
             I K++ I S+IIGW+S++G+W R+EN ++LGEDVH+ DE+Y NGG +LPHK I SSI  
Sbjct  295  TIGKNSWIKSTIIGWNSSIGKWVRMENTSVLGEDVHVSDELYINGGKILPHKSITSSIPE  354

Query  244  PEIVM  230
            PEI+M
Sbjct  355  PEIIM  359



>gb|KGL86216.1| Mannose-1-phosphate guanyltransferase beta, partial [Charadrius 
vociferus]
Length=274

 Score =   146 bits (369),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 90/125 (72%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LR +   KL SG  +VGNVLVD +AKI   C+IGP+V IG G V+E GVR+ RCTV++G 
Sbjct  150  LRAQHPEKLHSGPGVVGNVLVDPSAKIGSNCVIGPNVTIGAGVVVEDGVRIKRCTVLKGA  209

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RI+ H+ + S I+GW  +VGQW R+EN+T+LGEDV + DE+Y NG  VLPHK I  S+  
Sbjct  210  RIRSHSWLESCIVGWSCSVGQWGRMENVTVLGEDVIVNDELYLNGANVLPHKSIAESVPE  269

Query  244  PEIVM  230
            P I+M
Sbjct  270  PRIIM  274



>gb|KFM01180.1| Mannose-1-phosphate guanyltransferase beta, partial [Aptenodytes 
forsteri]
Length=274

 Score =   146 bits (369),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 90/125 (72%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LR +   KL SG  +VGNVLVD +AKI   C+IGP+V IG G V+E GVR+ RCTV++G 
Sbjct  150  LRAQHPEKLHSGPGVVGNVLVDPSAKIGANCVIGPNVTIGAGVVVEDGVRIKRCTVLKGA  209

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RI+ H+ + S I+GW  +VGQW R+EN+T+LGEDV + DE+Y NG  VLPHK I  S+  
Sbjct  210  RIRSHSWLESCIVGWSCSVGQWVRMENVTVLGEDVIVNDELYLNGANVLPHKSIAESVPE  269

Query  244  PEIVM  230
            P I+M
Sbjct  270  PRIIM  274



>ref|XP_010755204.1| PREDICTED: mannose-1-phosphate guanyltransferase beta [Larimichthys 
crocea]
 ref|XP_010755212.1| PREDICTED: mannose-1-phosphate guanyltransferase beta [Larimichthys 
crocea]
Length=360

 Score =   148 bits (374),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 67/125 (54%), Positives = 91/125 (73%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LR+ +  +L +G   +GNVLVD TA+I E C IGP+V IG G V+E GVR+ RCTV++G 
Sbjct  236  LRQHTPERLRTGPGFLGNVLVDPTAQIGENCTIGPNVTIGAGVVVEDGVRIKRCTVLKGA  295

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            R++ H+ + S I+GW S+VGQW R+EN+T+LGEDV + DE+Y NG  VLPHK I  S+  
Sbjct  296  RVRSHSWLESCIVGWSSSVGQWVRMENVTVLGEDVIVNDELYLNGANVLPHKSINESVPE  355

Query  244  PEIVM  230
            P I+M
Sbjct  356  PRIIM  360



>gb|KFV73795.1| Mannose-1-phosphate guanyltransferase beta-A, partial [Picoides 
pubescens]
Length=291

 Score =   146 bits (369),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 89/125 (71%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LR +   KL SG  +VGNVLVD TAKI   C+IGP+V IG G V+E GVR+ RCTV+ G 
Sbjct  167  LRAQHPEKLHSGPGVVGNVLVDPTAKIGANCVIGPNVTIGAGVVVEDGVRIKRCTVLEGA  226

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RI+ H+ + S I+GW  +VGQW R+EN+T+LGEDV + DE+Y NG  VLPHK I  S+  
Sbjct  227  RIRSHSWLESCIVGWSCSVGQWVRMENVTVLGEDVIVNDELYLNGANVLPHKSIAESVPE  286

Query  244  PEIVM  230
            P I+M
Sbjct  287  PRIIM  291



>ref|XP_006631022.1| PREDICTED: mannose-1-phosphate guanyltransferase beta-like [Lepisosteus 
oculatus]
Length=360

 Score =   148 bits (373),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 91/125 (73%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            +R+ S  KL +G+  VGNVLVD TA+I E C IGP+V +G G V+E GVR+ RCTV++G 
Sbjct  236  VRQHSPEKLRTGSGFVGNVLVDPTAQIGENCTIGPNVTLGAGVVLEDGVRIKRCTVLKGA  295

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            R+  H+ + S IIGW S+VGQW R+EN+T+LGEDV + DE+Y NG  VLPHK I  S+  
Sbjct  296  RVHSHSWLESCIIGWSSSVGQWVRMENVTVLGEDVIVNDELYLNGANVLPHKSIAESVPE  355

Query  244  PEIVM  230
            P I+M
Sbjct  356  PRIIM  360



>ref|XP_009905934.1| PREDICTED: mannose-1-phosphate guanyltransferase beta [Picoides 
pubescens]
Length=305

 Score =   147 bits (370),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 89/125 (71%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LR +   KL SG  +VGNVLVD TAKI   C+IGP+V IG G V+E GVR+ RCTV+ G 
Sbjct  181  LRAQHPEKLHSGPGVVGNVLVDPTAKIGANCVIGPNVTIGAGVVVEDGVRIKRCTVLEGA  240

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RI+ H+ + S I+GW  +VGQW R+EN+T+LGEDV + DE+Y NG  VLPHK I  S+  
Sbjct  241  RIRSHSWLESCIVGWSCSVGQWVRMENVTVLGEDVIVNDELYLNGANVLPHKSIAESVPE  300

Query  244  PEIVM  230
            P I+M
Sbjct  301  PRIIM  305



>gb|KFW74715.1| Mannose-1-phosphate guanyltransferase beta, partial [Manacus 
vitellinus]
Length=232

 Score =   145 bits (365),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 89/125 (71%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LR +   KL SG  +VGNVLVD +AKI   C+IGP+V IG G V+E GVR+ RCTV+ G 
Sbjct  108  LRAQHPEKLHSGPGVVGNVLVDPSAKIGANCVIGPNVTIGAGVVVEDGVRIKRCTVLEGA  167

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RI+ H+ + S I+GW  +VGQW R+EN+T+LGEDV + DE+Y NG  VLPHK I  S+  
Sbjct  168  RIRSHSWLESCIVGWSCSVGQWVRMENVTVLGEDVIVNDELYLNGANVLPHKSIAESVPE  227

Query  244  PEIVM  230
            P I+M
Sbjct  228  PRIIM  232



>ref|XP_002074034.1| GK12822 [Drosophila willistoni]
 gb|EDW85020.1| GK12822 [Drosophila willistoni]
Length=371

 Score =   148 bits (373),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 93/125 (74%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LR+K S KL +GA +VGNVLVD TA I EGC IGP+V IGP  +IE GV + R T+++G 
Sbjct  247  LRQKQSNKLYTGAGVVGNVLVDPTATIGEGCRIGPNVTIGPNVIIEDGVCIKRSTILKGA  306

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
             ++ H+ + S I+GW STVG+W R+E +T+LGEDV + DE+Y NGG VLPHK I +S+  
Sbjct  307  IVRSHSWLDSCIVGWRSTVGRWVRIEGITVLGEDVIVKDELYVNGGQVLPHKSIAASVPE  366

Query  244  PEIVM  230
            P+I+M
Sbjct  367  PQIIM  371



>ref|XP_007888693.1| PREDICTED: mannose-1-phosphate guanyltransferase beta [Callorhinchus 
milii]
Length=360

 Score =   148 bits (373),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 90/125 (72%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LR K+  +L  G  IVGNVLVD +A I E C IGP+V IGPG VIE GVR+ RCTV++G 
Sbjct  236  LRHKAPERLHQGPGIVGNVLVDPSAWIGEKCSIGPNVTIGPGVVIEDGVRIKRCTVLKGS  295

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RI+ H+ + S IIGW S VGQW R+EN+ +LGEDV + DE+Y NG  VLPHK I  S+  
Sbjct  296  RIRSHSWLESCIIGWSSDVGQWVRMENVAVLGEDVIVKDELYLNGANVLPHKSIADSVPE  355

Query  244  PEIVM  230
            P+I+M
Sbjct  356  PKIIM  360



>gb|ACU20879.1| unknown [Glycine max]
Length=262

 Score =   145 bits (367),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LR+KSS KLASG+ IVGNV+VDETAKI EGCLIGPDVAIGPGCVIE GVRL  CT+MRGV
Sbjct  178  LRRKSSSKLASGSQIVGNVIVDETAKIGEGCLIGPDVAIGPGCVIEQGVRLKSCTIMRGV  237

Query  424  RIKKHTCISSSIIGWHSTVGQW  359
            R+KKH C+SSSI GWHSTVGQW
Sbjct  238  RVKKHACVSSSIAGWHSTVGQW  259



>ref|XP_005780850.1| mannose-1-phosphate guanylyltransferase [Emiliania huxleyi CCMP1516]
 gb|EOD28421.1| mannose-1-phosphate guanylyltransferase [Emiliania huxleyi CCMP1516]
Length=389

 Score =   148 bits (374),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 91/118 (77%), Gaps = 0/118 (0%)
 Frame = -2

Query  583  KLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGVRIKKHTC  404
            +L  G  + G+VLVD++A+I   CLIGPDV++GPGCV+E GVRL+RC ++R VR+  H+ 
Sbjct  272  QLHGGTEVQGSVLVDKSAQIGANCLIGPDVSVGPGCVVEEGVRLARCILLRNVRVAAHST  331

Query  403  ISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILNPEIVM  230
            +  SI+GW S+VG W R+E +T+LGEDVH+  EI+ NGG+VLPHK IK SI  P+I++
Sbjct  332  VLDSILGWESSVGCWTRIEGVTVLGEDVHVGGEIFINGGLVLPHKRIKESISEPQIIL  389



>ref|XP_005767633.1| mannose-1-phosphate guanylyltransferase [Emiliania huxleyi CCMP1516]
 gb|EOD15204.1| mannose-1-phosphate guanylyltransferase [Emiliania huxleyi CCMP1516]
Length=389

 Score =   148 bits (374),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 91/118 (77%), Gaps = 0/118 (0%)
 Frame = -2

Query  583  KLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGVRIKKHTC  404
            +L  G  + G+VLVD++A+I   CLIGPDV++GPGCV+E GVRL+RC ++R VR+  H+ 
Sbjct  272  QLHGGTEVQGSVLVDKSAQIGANCLIGPDVSVGPGCVVEEGVRLARCILLRNVRVAAHST  331

Query  403  ISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILNPEIVM  230
            +  SI+GW S+VG W R+E +T+LGEDVH+  EI+ NGG+VLPHK IK SI  P+I++
Sbjct  332  VLDSILGWESSVGCWTRIEGVTVLGEDVHVGGEIFINGGLVLPHKRIKESISEPQIIL  389



>ref|XP_008903956.1| hypothetical protein PPTG_09918 [Phytophthora parasitica INRA-310]
 gb|ETI48632.1| hypothetical protein F443_07367 [Phytophthora parasitica P1569]
 gb|ETI48660.1| hypothetical protein F443_07363 [Phytophthora parasitica P1569]
 gb|ETK88560.1| hypothetical protein L915_07220 [Phytophthora parasitica]
 gb|ETL41954.1| hypothetical protein L916_07172 [Phytophthora parasitica]
 gb|ETL95106.1| hypothetical protein L917_07061 [Phytophthora parasitica]
 gb|ETM48339.1| hypothetical protein L914_07131 [Phytophthora parasitica]
 gb|ETN10852.1| hypothetical protein PPTG_09918 [Phytophthora parasitica INRA-310]
 gb|ETO77385.1| hypothetical protein F444_07427 [Phytophthora parasitica P1976]
 gb|ETP18433.1| hypothetical protein F441_07370 [Phytophthora parasitica CJ01A1]
 gb|ETP46326.1| hypothetical protein F442_07420 [Phytophthora parasitica P10297]
Length=359

 Score =   147 bits (372),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 94/121 (78%), Gaps = 0/121 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            + + ++  L++G   +GNV+VD TA I EGCLIGP+V +GPGCVIE GVRLSR T++RGV
Sbjct  234  VERTNADALSTGPKFIGNVMVDPTAVIGEGCLIGPNVVVGPGCVIEDGVRLSRTTLLRGV  293

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
             ++ ++ I SSIIGW ST+G+W R+E +T++GEDV + DE + NGG++LPHK I +SI +
Sbjct  294  TVRANSWIQSSIIGWGSTIGRWCRIEGITVVGEDVQVKDEKFINGGLILPHKAISASIPD  353

Query  244  P  242
            P
Sbjct  354  P  354



>ref|XP_005485662.1| PREDICTED: mannose-1-phosphate guanyltransferase beta [Zonotrichia 
albicollis]
Length=248

 Score =   145 bits (365),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 89/125 (71%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LR +   KL SG  +VGNVLVD +AKI   C+IGP+V IG G V+E GVR+ RCTV+ G 
Sbjct  124  LRAQHPEKLHSGPGVVGNVLVDPSAKIGANCVIGPNVTIGAGVVVEDGVRIKRCTVLEGA  183

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RI+ H+ + S I+GW  +VGQW R+EN+T+LGEDV + DE+Y NG  VLPHK I  S+  
Sbjct  184  RIRSHSWLESCIVGWSCSVGQWVRMENVTVLGEDVIVNDELYLNGANVLPHKSIAESVPE  243

Query  244  PEIVM  230
            P I+M
Sbjct  244  PRIIM  248



>gb|KFQ90789.1| Mannose-1-phosphate guanyltransferase beta, partial [Nipponia 
nippon]
Length=291

 Score =   146 bits (368),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 90/125 (72%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LR +   KL SG  +VGNVLVD +AKI   C+IGP+V IG G V+E GVR+ RCTV++G 
Sbjct  167  LRAQHPEKLHSGPGVVGNVLVDPSAKIGANCVIGPNVTIGAGVVVEDGVRIKRCTVLKGA  226

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RI+ H+ + S I+GW  +VGQW R+EN+T+LGEDV + DE+Y NG  VLPHK I  S+  
Sbjct  227  RIRSHSWLESCIVGWSCSVGQWVRMENVTVLGEDVIVNDELYLNGANVLPHKSIAESVPE  286

Query  244  PEIVM  230
            P I+M
Sbjct  287  PRIIM  291



>dbj|GAM18590.1| hypothetical protein SAMD00019534_017650 [Acytostelium subglobosum 
LB1]
Length=359

 Score =   147 bits (372),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 90/125 (72%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            L++K+   L+SG  I+  VL+D TA I+ GCLIGP+V IGP C +E G RL   TV+ G 
Sbjct  235  LKQKTPEVLSSGQGIISPVLIDPTATIKPGCLIGPNVTIGPHCTVEEGARLINTTVLAGA  294

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
             I K++ + SSIIGW ST+G W R+EN ++LG+DVHI DE+Y NGG +LPHK I SSI  
Sbjct  295  TIGKNSWVKSSIIGWESTIGSWVRMENNSVLGKDVHIADELYVNGGKILPHKSITSSIET  354

Query  244  PEIVM  230
            PEIVM
Sbjct  355  PEIVM  359



>ref|XP_009644181.1| PREDICTED: mannose-1-phosphate guanyltransferase beta [Egretta 
garzetta]
Length=303

 Score =   146 bits (369),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 90/125 (72%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LR +   KL SG  +VGNVLVD +AKI   C+IGP+V IG G V+E GVR+ RCTV++G 
Sbjct  179  LRAQHPEKLYSGPGVVGNVLVDPSAKIGANCVIGPNVTIGAGVVVEDGVRIKRCTVLKGA  238

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RI+ H+ + S I+GW  +VGQW R+EN+T+LGEDV + DE+Y NG  VLPHK I  S+  
Sbjct  239  RIRSHSWLESCIVGWSCSVGQWVRMENVTVLGEDVIVNDELYLNGANVLPHKSIAESVPE  298

Query  244  PEIVM  230
            P I+M
Sbjct  299  PRIIM  303



>ref|XP_007575815.1| PREDICTED: mannose-1-phosphate guanyltransferase beta [Poecilia 
formosa]
 ref|XP_008406573.1| PREDICTED: mannose-1-phosphate guanyltransferase beta [Poecilia 
reticulata]
Length=360

 Score =   147 bits (372),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 67/125 (54%), Positives = 91/125 (73%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LR+ +  +L +G   +GNVLVD TA+I E C IGP+V IG G V+E GVR+ RCTV++G 
Sbjct  236  LRQHAPERLRTGPGFLGNVLVDPTAQIGENCTIGPNVTIGAGVVVEDGVRIKRCTVLKGS  295

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            R++ H+ + S I+GW S+VGQW R+EN+T+LGEDV + DE+Y NG  VLPHK I  S+  
Sbjct  296  RVRSHSWLESCIVGWSSSVGQWVRMENVTVLGEDVIVNDELYLNGANVLPHKSINESVPE  355

Query  244  PEIVM  230
            P I+M
Sbjct  356  PRIIM  360



>ref|XP_002739492.1| PREDICTED: mannose-1-phosphate guanyltransferase beta-like isoform 
X1 [Saccoglossus kowalevskii]
 ref|XP_006822458.1| PREDICTED: mannose-1-phosphate guanyltransferase beta-like isoform 
X2 [Saccoglossus kowalevskii]
Length=359

 Score =   147 bits (372),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 90/125 (72%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LR  ++ KLA G  IVGNVLVD +AKI   C IGP+V IGPG VIE G  + R TV++  
Sbjct  235  LRNTAAEKLAEGPGIVGNVLVDPSAKIGANCRIGPNVTIGPGVVIEDGTCIKRSTVLKET  294

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RIK H  I SSIIGW   VGQW R+EN+++LGEDV + DE+Y NGG +LPHK I SS+ +
Sbjct  295  RIKSHAWIESSIIGWKCVVGQWVRMENVSVLGEDVIVQDELYVNGGRILPHKSIGSSVAD  354

Query  244  PEIVM  230
            P+I+M
Sbjct  355  PQIIM  359



>ref|XP_005814035.1| PREDICTED: mannose-1-phosphate guanyltransferase beta-like [Xiphophorus 
maculatus]
Length=360

 Score =   147 bits (372),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 67/125 (54%), Positives = 91/125 (73%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LR+ +  +L +G   +GNVLVD TA+I E C IGP+V IG G V+E GVR+ RCTV++G 
Sbjct  236  LRQHAPERLRTGPGFLGNVLVDPTAQIGENCTIGPNVTIGAGVVVEDGVRIKRCTVLKGS  295

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            R++ H+ + S I+GW S+VGQW R+EN+T+LGEDV + DE+Y NG  VLPHK I  S+  
Sbjct  296  RVRSHSWLESCIVGWSSSVGQWVRMENVTVLGEDVIVNDELYLNGANVLPHKSINESVPE  355

Query  244  PEIVM  230
            P I+M
Sbjct  356  PRIIM  360



>gb|KFV84323.1| Mannose-1-phosphate guanyltransferase beta-A, partial [Struthio 
camelus australis]
Length=274

 Score =   145 bits (366),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 90/125 (72%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LR +   +L SG  I+GNVLVD +AKI   C+IGP+V IG G V+E GVR+ RCTV++G 
Sbjct  150  LRAQHPERLHSGPGIIGNVLVDPSAKIGANCIIGPNVTIGAGVVVEDGVRIKRCTVLKGA  209

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RI+ H+ + S I+GW  +VGQW R+EN+T+LGEDV + DE+Y NG  VLPHK I  S+  
Sbjct  210  RIRSHSWLESCIVGWSCSVGQWVRMENVTVLGEDVIVNDELYLNGANVLPHKSIAESVPE  269

Query  244  PEIVM  230
            P I+M
Sbjct  270  PRIIM  274



>ref|XP_010716657.1| PREDICTED: mannose-1-phosphate guanyltransferase beta, partial 
[Meleagris gallopavo]
Length=297

 Score =   145 bits (367),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 90/125 (72%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LR +   KL SG  +VGNVLVD +AKI   C+IGP+V IG G V+E GVR+ RCTV++G 
Sbjct  173  LRAQHPEKLHSGPGVVGNVLVDPSAKIGANCVIGPNVTIGAGVVVEDGVRIKRCTVLQGA  232

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RI+ H+ + S I+GW  +VGQW R+EN+T+LGEDV + DE+Y NG  VLPHK I  S+  
Sbjct  233  RIRSHSWLESCIVGWSCSVGQWVRMENVTVLGEDVIVNDELYLNGANVLPHKSIAESVPE  292

Query  244  PEIVM  230
            P I+M
Sbjct  293  PRIIM  297



>ref|XP_009879625.1| PREDICTED: mannose-1-phosphate guanyltransferase beta [Charadrius 
vociferus]
Length=306

 Score =   146 bits (368),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 90/125 (72%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LR +   KL SG  +VGNVLVD +AKI   C+IGP+V IG G V+E GVR+ RCTV++G 
Sbjct  182  LRAQHPEKLHSGPGVVGNVLVDPSAKIGSNCVIGPNVTIGAGVVVEDGVRIKRCTVLKGA  241

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RI+ H+ + S I+GW  +VGQW R+EN+T+LGEDV + DE+Y NG  VLPHK I  S+  
Sbjct  242  RIRSHSWLESCIVGWSCSVGQWGRMENVTVLGEDVIVNDELYLNGANVLPHKSIAESVPE  301

Query  244  PEIVM  230
            P I+M
Sbjct  302  PRIIM  306



>gb|KFO57932.1| Mannose-1-phosphate guanyltransferase beta, partial [Corvus brachyrhynchos]
Length=274

 Score =   145 bits (365),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 89/125 (71%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LR +   KL SG  +VGNVLVD +AKI   C+IGP+V IG G V+E GVR+ RCTV+ G 
Sbjct  150  LRAQHPEKLHSGPGVVGNVLVDPSAKIGANCVIGPNVTIGAGVVVEDGVRIKRCTVLEGA  209

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RI+ H+ + S I+GW  +VGQW R+EN+T+LGEDV + DE+Y NG  VLPHK I  S+  
Sbjct  210  RIRSHSWLESCIVGWSCSVGQWVRMENVTVLGEDVIVNDELYLNGANVLPHKSIAESVPE  269

Query  244  PEIVM  230
            P I+M
Sbjct  270  PRIIM  274



>ref|NP_001087522.1| mannose-1-phosphate guanyltransferase beta-A [Xenopus laevis]
 sp|Q68EY9.1|GMPBA_XENLA RecName: Full=Mannose-1-phosphate guanyltransferase beta-A; AltName: 
Full=GDP-mannose pyrophosphorylase B-A; AltName: Full=GTP-mannose-1-phosphate 
guanylyltransferase beta-A [Xenopus 
laevis]
 gb|AAH80059.1| MGC84017 protein [Xenopus laevis]
Length=360

 Score =   147 bits (371),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 90/125 (72%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            +R+K    L +G   +GNVLVD TAKI + C IGP+V IGPG  +E GVR+ RCTVM+G 
Sbjct  236  VRQKHPEWLHAGPGFIGNVLVDPTAKIGQNCSIGPNVTIGPGVTVEDGVRIKRCTVMKGS  295

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            R+  H+ + SSI+GW S+VGQW R+EN+T+LGEDV + DE+Y NG  VLPHK I  S+  
Sbjct  296  RLHSHSWLESSIVGWSSSVGQWVRMENVTVLGEDVIVNDELYLNGANVLPHKCISESVPE  355

Query  244  PEIVM  230
            P I+M
Sbjct  356  PRIIM  360



>gb|KFU89083.1| Mannose-1-phosphate guanyltransferase beta, partial [Chaetura 
pelagica]
Length=274

 Score =   145 bits (365),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 89/125 (71%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LR +   KL SG  +VGNVLVD +AKI   C+IGP+V IG G V+E GVR+ RCTV+ G 
Sbjct  150  LRAQHPEKLHSGPGVVGNVLVDPSAKIGANCVIGPNVTIGAGVVVEDGVRIKRCTVLEGA  209

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            R++ H+ + S I+GW  +VGQW R+EN+T+LGEDV + DE+Y NG  VLPHK I  S+  
Sbjct  210  RVRSHSWLESCIVGWSCSVGQWVRMENVTVLGEDVIVNDELYLNGANVLPHKSITESVPE  269

Query  244  PEIVM  230
            P I+M
Sbjct  270  PRIIM  274



>gb|KGL84089.1| Mannose-1-phosphate guanyltransferase beta-A, partial [Tinamus 
guttatus]
Length=274

 Score =   145 bits (365),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 90/125 (72%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LR +   +L SG  IVGNVLVD +AKI   C+IGP+V IG G V+E GVR+ RCTV++G 
Sbjct  150  LRIQHPERLHSGPGIVGNVLVDPSAKIGANCIIGPNVTIGAGVVVEDGVRIKRCTVLKGA  209

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RI+ H+ + S I+GW  +VGQW R+EN+T+LGEDV + DE+Y NG  VLPHK I  S+  
Sbjct  210  RIRSHSWLESCIVGWSCSVGQWVRMENVTVLGEDVIVNDELYLNGANVLPHKSIAESVPE  269

Query  244  PEIVM  230
            P I+M
Sbjct  270  PRIIM  274



>ref|XP_005422538.1| PREDICTED: LOW QUALITY PROTEIN: mannose-1-phosphate guanyltransferase 
beta [Geospiza fortis]
Length=297

 Score =   145 bits (366),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 89/125 (71%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LR +   KL SG  +VGNVLVD +AKI   C+IGP+V IG G V+E GVR+ RCTV+ G 
Sbjct  173  LRAQHPEKLHSGPGVVGNVLVDPSAKIGANCVIGPNVTIGAGVVVEDGVRIKRCTVLEGA  232

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RI+ H+ + S I+GW  +VGQW R+EN+T+LGEDV + DE+Y NG  VLPHK I  S+  
Sbjct  233  RIRSHSWLESCIVGWSCSVGQWVRMENVTVLGEDVIVNDELYLNGANVLPHKSIAESVPE  292

Query  244  PEIVM  230
            P I+M
Sbjct  293  PRIIM  297



>gb|KFP04832.1| Mannose-1-phosphate guanyltransferase beta-A, partial [Calypte 
anna]
Length=291

 Score =   145 bits (366),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 89/125 (71%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LR +   KL SG  +VGNVLVD +AKI   C+IGP+V IG G V+E GVR+ RCTV+ G 
Sbjct  167  LRAQHPDKLHSGPGVVGNVLVDPSAKIGANCVIGPNVTIGAGVVVEDGVRIKRCTVLEGA  226

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RI+ H+ + S I+GW  +VGQW R+EN+T+LGEDV + DE+Y NG  VLPHK I  S+  
Sbjct  227  RIRSHSWLESCIVGWSCSVGQWVRMENVTVLGEDVIVNDELYLNGANVLPHKSIAESVPE  286

Query  244  PEIVM  230
            P I+M
Sbjct  287  PRIIM  291



>ref|XP_009475176.1| PREDICTED: mannose-1-phosphate guanyltransferase beta [Nipponia 
nippon]
Length=331

 Score =   146 bits (368),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 90/125 (72%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LR +   KL SG  +VGNVLVD +AKI   C+IGP+V IG G V+E GVR+ RCTV++G 
Sbjct  207  LRAQHPEKLHSGPGVVGNVLVDPSAKIGANCVIGPNVTIGAGVVVEDGVRIKRCTVLKGA  266

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RI+ H+ + S I+GW  +VGQW R+EN+T+LGEDV + DE+Y NG  VLPHK I  S+  
Sbjct  267  RIRSHSWLESCIVGWSCSVGQWVRMENVTVLGEDVIVNDELYLNGANVLPHKSIAESVPE  326

Query  244  PEIVM  230
            P I+M
Sbjct  327  PRIIM  331



>ref|XP_008630498.1| PREDICTED: mannose-1-phosphate guanyltransferase beta [Corvus 
brachyrhynchos]
Length=299

 Score =   145 bits (366),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 89/125 (71%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LR +   KL SG  +VGNVLVD +AKI   C+IGP+V IG G V+E GVR+ RCTV+ G 
Sbjct  175  LRAQHPEKLHSGPGVVGNVLVDPSAKIGANCVIGPNVTIGAGVVVEDGVRIKRCTVLEGA  234

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RI+ H+ + S I+GW  +VGQW R+EN+T+LGEDV + DE+Y NG  VLPHK I  S+  
Sbjct  235  RIRSHSWLESCIVGWSCSVGQWVRMENVTVLGEDVIVNDELYLNGANVLPHKSIAESVPE  294

Query  244  PEIVM  230
            P I+M
Sbjct  295  PRIIM  299



>gb|KIW22466.1| mannose-1-phosphate guanyltransferase [Cladophialophora immunda]
Length=364

 Score =   147 bits (370),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/128 (56%), Positives = 93/128 (73%), Gaps = 3/128 (2%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIV---GNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVM  434
            L K +S KLA  +      GNVLVD TAKI + C IGP+V IGPGCV+  GVRL RC ++
Sbjct  237  LSKNNSKKLAPHSEPYVYGGNVLVDPTAKIGKNCRIGPNVVIGPGCVVGDGVRLQRCVLL  296

Query  433  RGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSS  254
               ++K H  + S+IIGW STVG+WAR+EN+T+LG+DV I DEIY NGG VLPHK IK++
Sbjct  297  EDSKVKDHAWVKSTIIGWRSTVGRWARLENVTVLGDDVSIGDEIYVNGGSVLPHKSIKAN  356

Query  253  ILNPEIVM  230
            +  P+I+M
Sbjct  357  VEVPQIIM  364



>ref|XP_008715026.1| mannose-1-phosphate guanyltransferase [Cyphellophora europaea 
CBS 101466]
 gb|ETN43290.1| mannose-1-phosphate guanyltransferase [Cyphellophora europaea 
CBS 101466]
Length=364

 Score =   147 bits (370),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/128 (56%), Positives = 91/128 (71%), Gaps = 3/128 (2%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIV---GNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVM  434
            L K+   KL S +      GNV+V ETAKI   C IGP+V IGPGCVI  GVRL RC ++
Sbjct  237  LAKRQPKKLVSNSEPYVYGGNVMVHETAKIGNNCRIGPNVVIGPGCVIGDGVRLQRCVLL  296

Query  433  RGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSS  254
               ++K H  I S+I+GWHSTVG+WAR+EN+T+LG+DV I DEIY NGG VLPHK IK++
Sbjct  297  EDSKVKDHAWIKSTIVGWHSTVGRWARLENVTVLGDDVTIGDEIYVNGGSVLPHKSIKAN  356

Query  253  ILNPEIVM  230
            +  P I+M
Sbjct  357  VEVPSIIM  364



>ref|XP_001955746.1| GF18913 [Drosophila ananassae]
 gb|EDV44307.1| GF18913 [Drosophila ananassae]
Length=371

 Score =   147 bits (370),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 93/125 (74%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LR+K S KL +G  +VGNV+VD TAKI EGC IGP+V IGP  +IE GV + R T+++G 
Sbjct  247  LRQKQSSKLYTGPGVVGNVIVDPTAKIGEGCRIGPNVTIGPDVIIEDGVCIKRSTILKGA  306

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
             ++ H+ + S I+GW STVG+W R+E +T+LGEDV + DE+Y NGG VLPHK I +S+  
Sbjct  307  IVRSHSWLDSCIVGWRSTVGRWVRIEGITVLGEDVIVKDELYINGGQVLPHKSIAASVPE  366

Query  244  PEIVM  230
            P+I+M
Sbjct  367  PQIIM  371



>emb|CBN80660.1| Mannose-1-phosphate guanyltransferase beta [Dicentrarchus labrax]
Length=360

 Score =   146 bits (369),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/125 (53%), Positives = 91/125 (73%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            +R+ +  +L +G   +GNV+VD TA+I E C IGP+V IG G V+E GVR+ RCTVM+G 
Sbjct  236  VRQHAPERLRTGPGFLGNVVVDPTAQIGENCTIGPNVTIGAGVVVEDGVRIKRCTVMKGA  295

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            R++ H+ + S I+GW S+VGQW R+EN+T+LGEDV + DE+Y NG  VLPHK I  S+  
Sbjct  296  RVRSHSWLESCIVGWSSSVGQWVRMENVTVLGEDVIVNDELYLNGANVLPHKSINESVPE  355

Query  244  PEIVM  230
            P I+M
Sbjct  356  PRIIM  360



>ref|XP_008301904.1| PREDICTED: mannose-1-phosphate guanyltransferase beta [Stegastes 
partitus]
Length=360

 Score =   146 bits (369),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/125 (53%), Positives = 91/125 (73%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LR+ +  +L +G   +GNV+VD TA+I E C IGP+V IG G V+E GVR+ RCTV++G 
Sbjct  236  LRQHAPERLRTGPGFLGNVMVDPTAQIGENCTIGPNVTIGAGVVVEDGVRIKRCTVLKGS  295

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            R++ H+ + S I+GW S+VGQW R+EN+T+LGEDV + DE+Y NG  VLPHK I  S+  
Sbjct  296  RVRSHSWLESCIVGWSSSVGQWVRMENVTVLGEDVIVNDELYLNGANVLPHKSINESVPE  355

Query  244  PEIVM  230
            P I+M
Sbjct  356  PRIIM  360



>ref|XP_011182489.1| PREDICTED: mannose-1-phosphate guanyltransferase beta [Bactrocera 
cucurbitae]
Length=370

 Score =   147 bits (370),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 91/125 (73%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LR+K S KL +G  +VGNVLVD TAKI EGC IGP+V IGP  VIE GV + R T++ G 
Sbjct  246  LRQKQSSKLYTGPGVVGNVLVDPTAKIGEGCRIGPNVTIGPDVVIEDGVCIKRSTILTGA  305

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
             +K H+ + S I+GW S VG+W R+E +T+LGEDV + DEIY NGG VLPHK I +S+  
Sbjct  306  IVKSHSWLDSCIVGWRSVVGRWVRLEGITVLGEDVIVKDEIYINGGQVLPHKSIAASVPE  365

Query  244  PEIVM  230
            P+I+M
Sbjct  366  PQIIM  370



>ref|XP_005141643.1| PREDICTED: mannose-1-phosphate guanyltransferase beta [Melopsittacus 
undulatus]
Length=294

 Score =   145 bits (365),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 89/125 (71%), Gaps = 0/125 (0%)
 Frame = -2

Query  604  LRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGV  425
            LR +   KL SG  +VGNVLVD +AKI   C+IGP+V IG G V+E GVR+ RCTV+ G 
Sbjct  170  LRAQHPEKLHSGPGVVGNVLVDPSAKIGANCVIGPNVTIGAGVVVEDGVRIKRCTVLEGA  229

Query  424  RIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILN  245
            RI+ H+ + S I+GW  +VGQW R+EN+T+LGEDV + DE+Y NG  VLPHK I  S+  
Sbjct  230  RIRSHSWLESCIVGWSCSVGQWVRMENVTVLGEDVIVNDELYLNGANVLPHKSISESVPE  289

Query  244  PEIVM  230
            P I+M
Sbjct  290  PRIIM  294



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 802174409370