BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF025O18

Length=709
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDO98567.1|  unnamed protein product                                251   8e-78   Coffea canephora [robusta coffee]
ref|XP_011086955.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    248   1e-76   Sesamum indicum [beniseed]
ref|XP_011072066.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    247   2e-76   Sesamum indicum [beniseed]
gb|EYU22293.1|  hypothetical protein MIMGU_mgv1a006235mg                238   3e-72   Erythranthe guttata [common monkey flower]
ref|XP_009792116.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    234   4e-71   Nicotiana sylvestris
ref|XP_009630493.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    233   2e-70   Nicotiana tomentosiformis
ref|XP_006353939.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    231   3e-70   Solanum tuberosum [potatoes]
emb|CAN79596.1|  hypothetical protein VITISV_042386                     226   2e-68   Vitis vinifera
ref|XP_008803049.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    226   2e-68   Phoenix dactylifera
ref|XP_003634328.1|  PREDICTED: E3 ubiquitin-protein ligase RING1       226   3e-68   Vitis vinifera
ref|XP_010088395.1|  E3 ubiquitin-protein ligase RING1                  224   1e-67   Morus notabilis
ref|XP_010935556.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    223   3e-67   Elaeis guineensis
gb|EYU17802.1|  hypothetical protein MIMGU_mgv1a008418mg                223   4e-67   Erythranthe guttata [common monkey flower]
ref|XP_010940373.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    219   7e-66   Elaeis guineensis
ref|XP_008811090.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    218   2e-65   Phoenix dactylifera
ref|XP_008467256.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    217   1e-64   Cucumis melo [Oriental melon]
ref|XP_004137524.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    217   1e-64   Cucumis sativus [cucumbers]
ref|XP_010246216.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    215   3e-64   Nelumbo nucifera [Indian lotus]
ref|XP_004235401.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    216   3e-64   Solanum lycopersicum
gb|ACT21194.1|  zinc finger protein                                     213   1e-63   Carica papaya [mamon]
ref|XP_010249658.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    213   1e-63   Nelumbo nucifera [Indian lotus]
ref|XP_009401096.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    213   3e-63   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006441411.1|  hypothetical protein CICLE_v10020902mg             211   1e-62   Citrus clementina [clementine]
ref|XP_006493415.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    210   3e-62   Citrus sinensis [apfelsine]
gb|KDO48740.1|  hypothetical protein CISIN_1g0186891mg                  210   3e-62   Citrus sinensis [apfelsine]
ref|XP_004299466.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    209   8e-62   Fragaria vesca subsp. vesca
ref|XP_008393509.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    209   2e-61   Malus domestica [apple tree]
ref|XP_010069512.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    208   3e-61   Eucalyptus grandis [rose gum]
ref|XP_008240345.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    207   8e-61   Prunus mume [ume]
ref|XP_006374275.1|  hypothetical protein POPTR_0015s05600g             206   9e-61   Populus trichocarpa [western balsam poplar]
ref|XP_010687250.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    203   2e-59   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011047757.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    202   2e-59   Populus euphratica
ref|NP_001064906.2|  Os10g0487400                                       199   1e-58   
ref|XP_011003690.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    200   2e-58   Populus euphratica
gb|EAZ16486.1|  hypothetical protein OsJ_31957                          199   3e-58   Oryza sativa Japonica Group [Japonica rice]
gb|ACF84253.1|  unknown                                                 194   2e-57   Zea mays [maize]
ref|XP_002317728.2|  hypothetical protein POPTR_0012s03370g             195   2e-57   
gb|AAL59019.1|AC087182_2  putative zinc finger protein                  197   5e-57   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007152550.1|  hypothetical protein PHAVU_004G139600g             196   9e-57   Phaseolus vulgaris [French bean]
ref|XP_008346897.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    196   1e-56   Malus domestica [apple tree]
ref|XP_009383684.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    195   2e-56   Musa acuminata subsp. malaccensis [pisang utan]
gb|EAY78992.1|  hypothetical protein OsI_34100                          195   2e-56   Oryza sativa Indica Group [Indian rice]
ref|XP_009355932.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    196   2e-56   Pyrus x bretschneideri [bai li]
ref|XP_006655672.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    194   2e-56   
ref|NP_001152117.1|  RHC1A                                              195   3e-56   Zea mays [maize]
gb|ACG33105.1|  RHC1A                                                   192   6e-55   Zea mays [maize]
gb|KDP37541.1|  hypothetical protein JCGZ_05980                         189   8e-55   Jatropha curcas
ref|XP_004982780.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    191   2e-54   Setaria italica
ref|NP_001130953.1|  uncharacterized LOC100192058                       190   3e-54   Zea mays [maize]
ref|XP_003534093.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    189   3e-54   Glycine max [soybeans]
ref|XP_007043255.1|  RING/U-box superfamily protein, putative           187   8e-54   Theobroma cacao [chocolate]
ref|XP_006661882.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    188   9e-54   Oryza brachyantha
ref|XP_003549174.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    188   1e-53   Glycine max [soybeans]
gb|KJB77384.1|  hypothetical protein B456_012G134900                    187   1e-53   Gossypium raimondii
ref|XP_002467049.1|  hypothetical protein SORBIDRAFT_01g018800          188   2e-53   Sorghum bicolor [broomcorn]
ref|XP_011022020.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    184   3e-53   Populus euphratica
sp|P0CH30.1|RING1_GOSHI  RecName: Full=E3 ubiquitin-protein ligas...    185   5e-53   Gossypium hirsutum [American cotton]
gb|KHG22497.1|  E3 ubiquitin-protein ligase RING1                       185   6e-53   Gossypium arboreum [tree cotton]
gb|KJB49973.1|  hypothetical protein B456_008G147900                    185   6e-53   Gossypium raimondii
gb|KJB31865.1|  hypothetical protein B456_005G211800                    185   7e-53   Gossypium raimondii
gb|EMS63398.1|  E3 ubiquitin-protein ligase RING1                       181   1e-52   Triticum urartu
ref|XP_003574092.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    185   1e-52   Brachypodium distachyon [annual false brome]
gb|EYU35570.1|  hypothetical protein MIMGU_mgv1a013774mg                180   2e-52   Erythranthe guttata [common monkey flower]
gb|EMT21882.1|  RING finger protein 126                                 183   3e-52   
ref|XP_010533212.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    183   4e-52   Tarenaya hassleriana [spider flower]
gb|KJB79836.1|  hypothetical protein B456_013G068800                    183   6e-52   Gossypium raimondii
gb|KHG01857.1|  E3 ubiquitin-protein ligase RING1                       182   6e-52   Gossypium arboreum [tree cotton]
ref|XP_009357359.1|  PREDICTED: E3 ubiquitin-protein ligase RING1       182   6e-52   Pyrus x bretschneideri [bai li]
ref|XP_003620140.1|  RING finger protein                                178   2e-51   
gb|EPS73974.1|  hypothetical protein M569_00782                         180   3e-51   Genlisea aurea
ref|XP_003557291.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    181   3e-51   Brachypodium distachyon [annual false brome]
ref|XP_010508254.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    180   4e-51   Camelina sativa [gold-of-pleasure]
ref|XP_010466163.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    180   4e-51   Camelina sativa [gold-of-pleasure]
ref|XP_010487953.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    180   4e-51   Camelina sativa [gold-of-pleasure]
emb|CDP18533.1|  unnamed protein product                                180   5e-51   Coffea canephora [robusta coffee]
ref|XP_011070454.1|  PREDICTED: E3 ubiquitin-protein ligase RING1       180   6e-51   Sesamum indicum [beniseed]
ref|XP_009145710.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    179   1e-50   Brassica rapa
ref|XP_010541863.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    179   2e-50   Tarenaya hassleriana [spider flower]
ref|XP_003620252.1|  RING finger protein                                179   2e-50   
ref|XP_002883213.1|  zinc finger family protein                         178   2e-50   
ref|XP_009588217.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    177   3e-50   Nicotiana tomentosiformis
ref|XP_008355430.1|  PREDICTED: uncharacterized protein LOC103419088    182   5e-50   
gb|AES76470.2|  zinc finger, C3HC4 type (RING finger) protein           178   6e-50   Medicago truncatula
emb|CDX82271.1|  BnaA03g35500D                                          174   7e-50   
ref|XP_010557559.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    177   1e-49   Tarenaya hassleriana [spider flower]
ref|XP_004515274.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    177   1e-49   Cicer arietinum [garbanzo]
emb|CDY24592.1|  BnaC05g32760D                                          176   1e-49   Brassica napus [oilseed rape]
ref|XP_002307159.2|  hypothetical protein POPTR_0005s09270g             175   2e-49   
ref|XP_009788594.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    175   2e-49   Nicotiana sylvestris
ref|XP_009401852.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    175   2e-49   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002437660.1|  hypothetical protein SORBIDRAFT_10g000250          174   6e-49   Sorghum bicolor [broomcorn]
emb|CDY36069.1|  BnaC03g41290D                                          171   7e-49   Brassica napus [oilseed rape]
emb|CDY25360.1|  BnaA05g19240D                                          174   9e-49   Brassica napus [oilseed rape]
ref|NP_188629.1|  E3 ubiquitin-protein ligase RING1-like protein        174   1e-48   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001056529.1|  Os06g0101300                                       174   1e-48   
dbj|BAB01310.1|  unnamed protein product                                175   2e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006297993.1|  hypothetical protein CARUB_v10014036mg             174   2e-48   
emb|CDY72364.1|  BnaAnng40830D                                          170   2e-48   Brassica napus [oilseed rape]
ref|XP_006406436.1|  hypothetical protein EUTSA_v10021059mg             173   3e-48   Eutrema salsugineum [saltwater cress]
ref|XP_009135656.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    172   4e-48   Brassica rapa
ref|XP_006847820.1|  hypothetical protein AMTR_s00029p00043520          173   4e-48   
ref|XP_006306505.1|  hypothetical protein CARUB_v10012493mg             172   5e-48   Capsella rubella
ref|XP_006359295.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    172   6e-48   Solanum tuberosum [potatoes]
ref|XP_010034290.1|  PREDICTED: E3 ubiquitin-protein ligase RING1       172   7e-48   Eucalyptus grandis [rose gum]
ref|XP_004964254.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    172   7e-48   Setaria italica
ref|XP_008659413.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    171   9e-48   Zea mays [maize]
ref|XP_009111341.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    171   2e-47   Brassica rapa
gb|EEC79816.1|  hypothetical protein OsI_21260                          167   2e-47   Oryza sativa Indica Group [Indian rice]
ref|XP_004236843.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    170   3e-47   Solanum lycopersicum
gb|ABK96352.1|  unknown                                                 169   3e-47   Populus trichocarpa x Populus deltoides
ref|XP_002310643.2|  hypothetical protein POPTR_0007s07510g             169   3e-47   
ref|XP_010461879.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    169   6e-47   Camelina sativa [gold-of-pleasure]
ref|XP_010500595.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    169   6e-47   Camelina sativa [gold-of-pleasure]
ref|XP_011002257.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...    167   2e-46   Populus euphratica
ref|XP_009382108.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    167   2e-46   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010479486.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    166   8e-46   Camelina sativa [gold-of-pleasure]
emb|CDY33437.1|  BnaC01g32880D                                          166   1e-45   Brassica napus [oilseed rape]
ref|XP_002990229.1|  hypothetical protein SELMODRAFT_18755              159   2e-45   
gb|ABR17677.1|  unknown                                                 168   3e-45   Picea sitchensis
ref|XP_006393160.1|  hypothetical protein EUTSA_v10011690mg             164   5e-45   Eutrema salsugineum [saltwater cress]
ref|XP_008659414.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    161   2e-44   
ref|XP_003592721.1|  RING finger protein                                162   2e-44   Medicago truncatula
ref|XP_004149872.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    160   1e-43   Cucumis sativus [cucumbers]
dbj|BAJ95268.1|  predicted protein                                      157   2e-42   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007142767.1|  hypothetical protein PHAVU_007G015200g             157   3e-42   Phaseolus vulgaris [French bean]
ref|XP_010322969.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    157   5e-42   Solanum lycopersicum
ref|XP_003555841.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    155   1e-41   Glycine max [soybeans]
ref|XP_001777565.1|  predicted protein                                  159   1e-41   
ref|XP_003536735.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    154   2e-41   Glycine max [soybeans]
emb|CDY42507.1|  BnaC06g03510D                                          153   9e-41   Brassica napus [oilseed rape]
emb|CCA20603.1|  conserved hypothetical protein                         147   1e-38   Albugo laibachii Nc14
gb|ABK21010.1|  unknown                                                 146   5e-38   Picea sitchensis
emb|CCI42106.1|  unnamed protein product                                144   6e-38   Albugo candida
gb|ETO72364.1|  hypothetical protein F444_11492                         144   1e-37   Phytophthora parasitica P1976
ref|XP_008907457.1|  hypothetical protein PPTG_13494                    144   1e-37   Phytophthora parasitica INRA-310
gb|EPS72590.1|  hypothetical protein M569_02175                         137   6e-37   Genlisea aurea
ref|XP_002906712.1|  conserved hypothetical protein                     141   8e-37   Phytophthora infestans T30-4
gb|AFG56549.1|  hypothetical protein 2_4925_01                          136   2e-36   Pinus taeda
ref|XP_002988229.1|  hypothetical protein SELMODRAFT_451319             144   3e-36   Selaginella moellendorffii
gb|AEW08272.1|  hypothetical protein 2_4925_01                          135   4e-36   Pinus radiata
ref|XP_002991361.1|  hypothetical protein SELMODRAFT_429694             142   2e-35   Selaginella moellendorffii
gb|AFG56541.1|  hypothetical protein 2_4925_01                          132   1e-34   Pinus taeda
ref|XP_002968394.1|  hypothetical protein SELMODRAFT_451322             139   2e-34   Selaginella moellendorffii
ref|XP_002970557.1|  hypothetical protein SELMODRAFT_451325             139   2e-34   Selaginella moellendorffii
ref|XP_009767589.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    135   5e-34   Nicotiana sylvestris
ref|XP_009515775.1|  hypothetical protein PHYSODRAFT_294053             134   8e-34   Phytophthora sojae
ref|XP_009621828.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    135   8e-34   Nicotiana tomentosiformis
gb|AFG68993.1|  hypothetical protein 0_10618_01                         129   1e-33   Pinus taeda
ref|XP_006445556.1|  hypothetical protein CICLE_v10015642mg             134   3e-33   Citrus clementina [clementine]
ref|XP_008803022.1|  PREDICTED: E3 ubiquitin-protein ligase Praja-2     135   3e-33   Phoenix dactylifera
ref|XP_010276428.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    134   3e-33   Nelumbo nucifera [Indian lotus]
gb|KDO29293.1|  hypothetical protein SPRG_05830                         132   3e-33   Saprolegnia parasitica CBS 223.65
gb|ACN40798.1|  unknown                                                 132   4e-33   Picea sitchensis
ref|XP_006348226.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    133   4e-33   Solanum tuberosum [potatoes]
ref|XP_008878243.1|  hypothetical protein H310_12817                    132   5e-33   Aphanomyces invadans
ref|XP_006305221.1|  hypothetical protein CARUB_v10009589mg             133   6e-33   Capsella rubella
ref|XP_006348225.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    133   6e-33   Solanum tuberosum [potatoes]
ref|XP_009626425.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    132   6e-33   
emb|CDY10554.1|  BnaC03g70600D                                          131   8e-33   Brassica napus [oilseed rape]
ref|XP_002523963.1|  zinc finger protein, putative                      125   1e-32   
ref|XP_006348224.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    132   2e-32   Solanum tuberosum [potatoes]
gb|AFG53307.1|  hypothetical protein 0_8445_01                          126   2e-32   Pinus taeda
gb|KJB83397.1|  hypothetical protein B456_013G245300                    131   2e-32   Gossypium raimondii
gb|AFG53317.1|  hypothetical protein 0_8445_01                          126   2e-32   Pinus taeda
emb|CDY26096.1|  BnaC06g11000D                                          130   2e-32   Brassica napus [oilseed rape]
ref|XP_010462406.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    131   3e-32   Camelina sativa [gold-of-pleasure]
ref|XP_009132309.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    131   3e-32   Brassica rapa
ref|XP_010480093.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    130   3e-32   Camelina sativa [gold-of-pleasure]
ref|XP_008449904.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    131   3e-32   Cucumis melo [Oriental melon]
gb|ADK63410.1|  C3HC4 type zinc finger protein                          130   4e-32   Brassica rapa
ref|XP_009106871.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    130   4e-32   Brassica rapa
ref|XP_004502170.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    130   4e-32   Cicer arietinum [garbanzo]
ref|XP_009831419.1|  hypothetical protein, variant                      129   4e-32   Aphanomyces astaci
ref|XP_002894508.1|  zinc finger family protein                         130   4e-32   Arabidopsis lyrata subsp. lyrata
ref|XP_007205383.1|  hypothetical protein PRUPE_ppa007335mg             130   4e-32   Prunus persica
ref|XP_008220737.1|  PREDICTED: E3 ubiquitin-protein ligase CIP8-...    130   5e-32   Prunus mume [ume]
ref|XP_002303979.2|  zinc finger family protein                         130   5e-32   Populus trichocarpa [western balsam poplar]
ref|XP_009144743.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    130   6e-32   Brassica rapa
ref|XP_009831418.1|  hypothetical protein H257_07553                    129   7e-32   Aphanomyces astaci
ref|XP_008614288.1|  hypothetical protein SDRG_10094                    129   7e-32   Saprolegnia diclina VS20
emb|CDY08249.1|  BnaA05g13700D                                          129   7e-32   Brassica napus [oilseed rape]
ref|XP_006829824.1|  hypothetical protein AMTR_s00119p00089020          129   7e-32   Amborella trichopoda
ref|XP_004141480.1|  PREDICTED: uncharacterized protein LOC101208708    130   8e-32   
ref|XP_010501167.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    130   8e-32   Camelina sativa [gold-of-pleasure]
gb|KGN52539.1|  hypothetical protein Csa_5G642700                       130   8e-32   Cucumis sativus [cucumbers]
ref|XP_004156174.1|  PREDICTED: uncharacterized protein LOC101225971    130   8e-32   
ref|XP_004149638.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    129   1e-31   Cucumis sativus [cucumbers]
emb|CDY56022.1|  BnaA08g29290D                                          129   1e-31   Brassica napus [oilseed rape]
ref|XP_010483111.1|  PREDICTED: E3 ubiquitin-protein ligase RNF12...    130   1e-31   Camelina sativa [gold-of-pleasure]
gb|ADN34278.1|  zinc finger protein                                     130   1e-31   Cucumis melo subsp. melo
gb|ACU20614.1|  unknown                                                 125   1e-31   Glycine max [soybeans]
ref|XP_010257723.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    129   1e-31   Nelumbo nucifera [Indian lotus]
gb|KDP31400.1|  hypothetical protein JCGZ_11776                         130   1e-31   Jatropha curcas
ref|XP_010044920.1|  PREDICTED: E3 ubiquitin-protein ligase CIP8-...    129   1e-31   Eucalyptus grandis [rose gum]
ref|XP_008459416.1|  PREDICTED: uncharacterized protein LOC103498560    130   1e-31   
ref|XP_010922808.1|  PREDICTED: E3 ubiquitin-protein ligase Praja-1     130   1e-31   Elaeis guineensis
ref|XP_010536808.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    129   1e-31   Tarenaya hassleriana [spider flower]
gb|AFG67327.1|  hypothetical protein 2_7298_01                          123   2e-31   Pinus taeda
ref|XP_007014039.1|  RING/U-box superfamily protein, putative iso...    128   2e-31   
ref|XP_009120153.1|  PREDICTED: E3 ubiquitin-protein ligase RNF12...    129   2e-31   Brassica rapa
emb|CDP18575.1|  unnamed protein product                                129   2e-31   Coffea canephora [robusta coffee]
ref|XP_002465271.1|  hypothetical protein SORBIDRAFT_01g035310          127   2e-31   Sorghum bicolor [broomcorn]
ref|XP_003601604.1|  RING finger protein                                128   2e-31   
ref|NP_564693.1|  RING/U-box domain-containing protein                  128   3e-31   Arabidopsis thaliana [mouse-ear cress]
gb|EYU44258.1|  hypothetical protein MIMGU_mgv1a026933mg                129   3e-31   Erythranthe guttata [common monkey flower]
gb|AES71855.2|  zinc finger, C3HC4 type (RING finger) protein           128   3e-31   Medicago truncatula
gb|AEW08366.1|  hypothetical protein 2_7298_01                          122   3e-31   Pinus radiata
ref|XP_009415542.1|  PREDICTED: E3 ubiquitin-protein ligase CIP8-...    129   3e-31   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT01795.1|  RING finger protein 126                                 126   3e-31   
ref|XP_007014035.1|  RING/U-box superfamily protein isoform 1           128   3e-31   
emb|CDM85845.1|  unnamed protein product                                127   4e-31   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002514591.1|  zinc finger protein, putative                      129   4e-31   Ricinus communis
emb|CDY22483.1|  BnaC03g22930D                                          127   4e-31   Brassica napus [oilseed rape]
ref|XP_011089756.1|  PREDICTED: E3 ubiquitin-protein ligase CIP8-...    128   4e-31   Sesamum indicum [beniseed]
emb|CDY22790.1|  BnaA06g02870D                                          126   4e-31   Brassica napus [oilseed rape]
ref|XP_008351262.1|  PREDICTED: E3 ubiquitin-protein ligase CIP8-...    128   5e-31   
emb|CDY36794.1|  BnaA03g10920D                                          131   5e-31   Brassica napus [oilseed rape]
ref|XP_010450985.1|  PREDICTED: E3 ubiquitin-protein ligase RNF11...    128   5e-31   
emb|CDX94901.1|  BnaC05g07700D                                          127   5e-31   
ref|XP_011089755.1|  PREDICTED: E3 ubiquitin-protein ligase CIP8-...    128   6e-31   
ref|XP_010105294.1|  E3 ubiquitin-protein ligase RING1                  128   6e-31   Morus notabilis
emb|CBI24304.3|  unnamed protein product                                123   6e-31   Vitis vinifera
ref|XP_009339205.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    127   6e-31   Pyrus x bretschneideri [bai li]
ref|XP_002864451.1|  zinc finger family protein                         128   6e-31   
ref|XP_006392629.1|  hypothetical protein EUTSA_v10012351mg             128   6e-31   
dbj|BAA77204.1|  ring finger protein                                    122   7e-31   Cicer arietinum [garbanzo]
gb|KDP20275.1|  hypothetical protein JCGZ_06861                         127   7e-31   Jatropha curcas
ref|NP_197086.1|  RING/U-box domain-containing protein                  127   8e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011025108.1|  PREDICTED: E3 ubiquitin-protein ligase RNF11...    127   8e-31   Populus euphratica
ref|XP_010318505.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...    127   8e-31   
ref|NP_001050120.1|  Os03g0351800                                       125   9e-31   
ref|XP_010087330.1|  E3 ubiquitin-protein ligase RING1                  128   9e-31   Morus notabilis
ref|XP_004984362.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    125   9e-31   Setaria italica
ref|XP_002523395.1|  zinc finger protein, putative                      127   1e-30   Ricinus communis
gb|KDP30629.1|  hypothetical protein JCGZ_16194                         127   1e-30   Jatropha curcas
ref|XP_009794149.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    126   1e-30   Nicotiana sylvestris
ref|XP_002317961.2|  hypothetical protein POPTR_0012s06680g             127   1e-30   
ref|XP_006650082.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    125   1e-30   Oryza brachyantha
ref|XP_010261518.1|  PREDICTED: uncharacterized protein LOC104600329    128   1e-30   Nelumbo nucifera [Indian lotus]
ref|XP_010942240.1|  PREDICTED: E3 ubiquitin-protein ligase CIP8-...    127   1e-30   Elaeis guineensis
ref|XP_009133459.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    126   1e-30   Brassica rapa
ref|XP_006279491.1|  hypothetical protein CARUB_v10026533mg             127   1e-30   Capsella rubella
ref|XP_004228482.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    126   1e-30   Solanum lycopersicum
ref|XP_009384344.1|  PREDICTED: E3 ubiquitin-protein ligase Praja...    127   1e-30   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009384343.1|  PREDICTED: E3 ubiquitin-protein ligase Praja...    127   1e-30   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002882822.1|  zinc finger family protein                         125   2e-30   
ref|XP_010443291.1|  PREDICTED: E3 ubiquitin-protein ligase RNF12...    127   2e-30   Camelina sativa [gold-of-pleasure]
ref|XP_010544579.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    126   2e-30   Tarenaya hassleriana [spider flower]
ref|XP_007037687.1|  Zinc finger protein, putative isoform 2            127   2e-30   
ref|XP_011025107.1|  PREDICTED: E3 ubiquitin-protein ligase RNF11...    127   2e-30   Populus euphratica
emb|CDX72127.1|  BnaC08g27470D                                          125   2e-30   
ref|XP_006401344.1|  hypothetical protein EUTSA_v10013831mg             126   2e-30   Eutrema salsugineum [saltwater cress]
ref|XP_007037686.1|  Zinc finger protein, putative isoform 1            127   2e-30   
ref|XP_010257498.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    126   2e-30   Nelumbo nucifera [Indian lotus]
emb|CDY32791.1|  BnaA10g10580D                                          126   2e-30   Brassica napus [oilseed rape]
gb|KJB19466.1|  hypothetical protein B456_003G104200                    127   2e-30   Gossypium raimondii
ref|XP_010534845.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    126   2e-30   Tarenaya hassleriana [spider flower]
ref|XP_001773353.1|  predicted protein                                  119   2e-30   
ref|XP_010538978.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    125   2e-30   Tarenaya hassleriana [spider flower]
ref|XP_009384341.1|  PREDICTED: uncharacterized protein LOC103971...    127   2e-30   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003557912.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    124   2e-30   Brachypodium distachyon [annual false brome]
ref|XP_010544570.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    125   2e-30   Tarenaya hassleriana [spider flower]
gb|KHN24008.1|  E3 ubiquitin-protein ligase RING1                       125   2e-30   Glycine soja [wild soybean]
ref|XP_008797578.1|  PREDICTED: E3 ubiquitin-protein ligase CIP8-...    127   2e-30   
ref|XP_010487098.1|  PREDICTED: E3 ubiquitin-protein ligase CIP8-...    125   2e-30   Camelina sativa [gold-of-pleasure]
ref|XP_010544562.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    126   2e-30   Tarenaya hassleriana [spider flower]
ref|XP_010538977.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    125   2e-30   Tarenaya hassleriana [spider flower]
emb|CDY23878.1|  BnaC04g01590D                                          125   3e-30   Brassica napus [oilseed rape]
gb|EYU32821.1|  hypothetical protein MIMGU_mgv1a008674mg                125   3e-30   Erythranthe guttata [common monkey flower]
ref|XP_010465177.1|  PREDICTED: E3 ubiquitin-protein ligase CIP8-...    125   3e-30   Camelina sativa [gold-of-pleasure]
ref|NP_187951.1|  RING/U-box superfamily protein                        125   3e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008797579.1|  PREDICTED: E3 ubiquitin-protein ligase CIP8-...    126   3e-30   
ref|XP_009146494.1|  PREDICTED: E3 ubiquitin-protein ligase RING1       124   3e-30   Brassica rapa
ref|NP_001147077.1|  RING finger protein 126                            124   3e-30   
gb|AAR20783.1|  At3g13430                                               125   3e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004294935.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    125   3e-30   Fragaria vesca subsp. vesca
gb|AFG67337.1|  hypothetical protein 2_7298_01                          120   3e-30   Pinus taeda
gb|ABK25012.1|  unknown                                                 125   3e-30   Picea sitchensis
ref|XP_008366125.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    125   3e-30   
ref|XP_008358830.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...    125   3e-30   
ref|XP_008797580.1|  PREDICTED: E3 ubiquitin-protein ligase CIP8-...    126   3e-30   
ref|XP_009116354.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    124   4e-30   
emb|CAN73309.1|  hypothetical protein VITISV_018157                     122   4e-30   
ref|XP_007151431.1|  hypothetical protein PHAVU_004G045600g             125   4e-30   
ref|XP_005704022.1|  E3 ubiquitin-protein ligase RNF115/126             125   4e-30   
ref|XP_010453731.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    122   4e-30   
ref|XP_009609325.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    124   4e-30   
ref|XP_002285765.1|  PREDICTED: E3 ubiquitin-protein ligase CIP8        125   4e-30   
ref|XP_008797577.1|  PREDICTED: uncharacterized protein LOC103712...    126   5e-30   
ref|XP_010474409.1|  PREDICTED: E3 ubiquitin-protein ligase Praja...    125   5e-30   
emb|CAN63309.1|  hypothetical protein VITISV_017174                     124   5e-30   
ref|XP_002273441.1|  PREDICTED: uncharacterized protein LOC100268065    125   6e-30   
ref|NP_567039.1|  E3 ubiquitin ligase                                   124   6e-30   
ref|XP_010463639.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    125   6e-30   
ref|XP_002297615.2|  hypothetical protein POPTR_0001s03880g             125   6e-30   
emb|CDY23599.1|  BnaC05g39950D                                          127   6e-30   
emb|CBI16568.3|  unnamed protein product                                124   7e-30   
ref|XP_007146184.1|  hypothetical protein PHAVU_006G019600g             124   7e-30   
ref|XP_010427489.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    124   7e-30   
ref|XP_010516266.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    124   7e-30   
emb|CDY11934.1|  BnaC03g13600D                                          127   7e-30   
ref|XP_006298099.1|  hypothetical protein CARUB_v10014141mg             124   8e-30   
ref|XP_010504561.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    124   8e-30   
ref|XP_011006162.1|  PREDICTED: uncharacterized protein LOC105112236    125   9e-30   
gb|KCW52328.1|  hypothetical protein EUGRSUZ_J01748                     124   1e-29   
gb|KCW52327.1|  hypothetical protein EUGRSUZ_J01748                     124   1e-29   
ref|XP_010032834.1|  PREDICTED: E3 ubiquitin-protein ligase RNF12...    124   1e-29   
ref|NP_200445.1|  protein ATCRT1                                        124   1e-29   
ref|XP_006402974.1|  hypothetical protein EUTSA_v10006102mg             123   1e-29   
emb|CDO98521.1|  unnamed protein product                                125   1e-29   
ref|XP_010653661.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    123   1e-29   
ref|XP_007028207.1|  RING-H2 finger C1A, putative                       123   1e-29   
emb|CDY46577.1|  BnaCnng13990D                                          123   1e-29   
ref|XP_010243363.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    124   1e-29   
gb|KCW52329.1|  hypothetical protein EUGRSUZ_J01748                     124   1e-29   
ref|XP_002525456.1|  zinc finger protein, putative                      124   1e-29   
emb|CDY27204.1|  BnaA09g35980D                                          123   1e-29   
gb|ACU19744.1|  unknown                                                 122   1e-29   
ref|XP_010453730.1|  PREDICTED: E3 ubiquitin-protein ligase Praja...    123   1e-29   
emb|CBI15364.3|  unnamed protein product                                128   1e-29   
ref|XP_006291489.1|  hypothetical protein CARUB_v10017638mg             123   2e-29   
ref|XP_010938677.1|  PREDICTED: E3 ubiquitin-protein ligase RING1       122   2e-29   
ref|XP_002441287.1|  hypothetical protein SORBIDRAFT_09g023840          123   2e-29   
ref|XP_010660538.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    124   2e-29   
ref|XP_006362735.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    123   2e-29   
ref|XP_009383271.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    123   2e-29   
ref|XP_007030174.1|  RING/U-box superfamily protein, putative           123   2e-29   
ref|XP_006853112.1|  hypothetical protein AMTR_s00038p00135070          120   2e-29   
ref|XP_002266870.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    123   2e-29   
ref|XP_004961694.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    122   2e-29   
ref|XP_010931555.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    122   3e-29   
ref|XP_006345087.1|  PREDICTED: uncharacterized protein LOC102578405    124   3e-29   
ref|XP_010545310.1|  PREDICTED: E3 ubiquitin-protein ligase RNF12...    123   3e-29   
ref|XP_010485476.1|  PREDICTED: E3 ubiquitin-protein ligase Praja...    123   3e-29   
ref|XP_006481992.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    122   3e-29   
ref|XP_004507269.1|  PREDICTED: E3 ubiquitin-protein ligase CIP8-...    122   4e-29   
ref|XP_009416356.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    122   4e-29   
ref|XP_010922248.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    122   4e-29   
gb|KDP22949.1|  hypothetical protein JCGZ_01757                         122   4e-29   
ref|XP_008230329.1|  PREDICTED: E3 ubiquitin-protein ligase Praja-1     122   4e-29   
ref|XP_011010366.1|  PREDICTED: E3 ubiquitin-protein ligase CIP8-...    122   4e-29   
ref|XP_007215530.1|  hypothetical protein PRUPE_ppa007129mg             122   5e-29   
ref|XP_002322048.2|  hypothetical protein POPTR_0015s03560g             123   5e-29   
ref|NP_001149786.1|  LOC100283413                                       121   5e-29   
ref|XP_008796177.1|  PREDICTED: E3 ubiquitin-protein ligase RING1       120   5e-29   
ref|XP_010278933.1|  PREDICTED: uncharacterized protein LOC104612961    124   6e-29   
ref|XP_010100889.1|  E3 ubiquitin-protein ligase RING1                  122   6e-29   
ref|XP_008461689.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    122   6e-29   
ref|NP_001140503.1|  uncharacterized LOC100272564                       121   6e-29   
ref|XP_010251900.1|  PREDICTED: E3 ubiquitin-protein ligase RING1       121   6e-29   
ref|NP_001182786.1|  RHC1A                                              121   6e-29   
ref|XP_009399929.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    121   7e-29   
gb|ACG42033.1|  RHC1A                                                   121   7e-29   
ref|XP_011099174.1|  PREDICTED: E3 ubiquitin-protein ligase CIP8-...    122   7e-29   
gb|KJB36692.1|  hypothetical protein B456_006G171100                    121   8e-29   
gb|ABD96901.1|  hypothetical protein                                    121   8e-29   
ref|XP_010654254.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    122   8e-29   
ref|XP_008786879.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    121   8e-29   
ref|XP_004304177.1|  PREDICTED: E3 ubiquitin-protein ligase RING1       118   8e-29   
ref|XP_010558535.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...    122   8e-29   
gb|KHN07574.1|  E3 ubiquitin-protein ligase RING1                       119   8e-29   
ref|NP_565942.1|  RING-H2 finger C1A                                    121   8e-29   
ref|XP_011048150.1|  PREDICTED: E3 ubiquitin-protein ligase RNF12...    122   9e-29   
ref|XP_009411718.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    120   1e-28   
ref|XP_004147682.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    121   1e-28   
ref|XP_010938151.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    120   1e-28   
gb|EPS72886.1|  hypothetical protein M569_01875                         120   1e-28   
ref|XP_003543320.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    120   1e-28   
ref|XP_010922891.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    121   1e-28   
ref|XP_010938150.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    121   1e-28   
ref|XP_010540537.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    121   1e-28   
ref|XP_004161919.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    121   1e-28   
gb|KHN30808.1|  E3 ubiquitin-protein ligase RING1                       120   1e-28   
ref|NP_001144032.1|  uncharacterized protein LOC100276856               120   1e-28   
gb|KHN30758.1|  E3 ubiquitin-protein ligase RING1-like                  121   1e-28   
ref|XP_008793322.1|  PREDICTED: E3 ubiquitin-protein ligase RING1       120   1e-28   
ref|XP_010540160.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...    119   1e-28   
gb|KHN35429.1|  E3 ubiquitin-protein ligase RING1-like                  120   1e-28   
ref|XP_008240686.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    120   2e-28   
ref|XP_002531579.1|  zinc finger protein, putative                      120   2e-28   
gb|KHN02654.1|  E3 ubiquitin-protein ligase RING1-like                  121   2e-28   
ref|XP_004301091.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    121   2e-28   
ref|XP_006288146.1|  hypothetical protein CARUB_v10001383mg             120   2e-28   
ref|XP_002871686.1|  hypothetical protein ARALYDRAFT_909558             120   2e-28   
ref|XP_010549960.1|  PREDICTED: E3 ubiquitin-protein ligase Praja-1     121   2e-28   
ref|XP_009400147.1|  PREDICTED: uncharacterized protein LOC103984394    125   2e-28   
ref|XP_010433513.1|  PREDICTED: E3 ubiquitin-protein ligase RNF12...    120   2e-28   
ref|XP_010256860.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    120   2e-28   
ref|XP_003617179.1|  Thioredoxin-related protein                        119   2e-28   
ref|XP_009346389.1|  PREDICTED: uncharacterized protein LOC103938109    121   2e-28   
gb|EYU19927.1|  hypothetical protein MIMGU_mgv1a007795mg                120   2e-28   
ref|XP_009139092.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    118   2e-28   
emb|CAN82964.1|  hypothetical protein VITISV_000345                     120   2e-28   
gb|KDO57382.1|  hypothetical protein CISIN_1g021656mg                   119   2e-28   
ref|XP_002879893.1|  ring-H2 finger C1A                                 120   2e-28   
ref|XP_006430455.1|  hypothetical protein CICLE_v10012279mg             119   2e-28   
ref|XP_007205441.1|  hypothetical protein PRUPE_ppa007829mg             120   3e-28   
ref|XP_006294585.1|  hypothetical protein CARUB_v10023620mg             120   3e-28   
ref|XP_010505840.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    120   3e-28   
ref|XP_002520538.1|  zinc finger protein, putative                      119   3e-28   
dbj|BAJ85700.1|  predicted protein                                      120   3e-28   
ref|XP_010508797.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    120   3e-28   
ref|XP_006297779.1|  hypothetical protein CARUB_v10013815mg             120   3e-28   
gb|KJB76747.1|  hypothetical protein B456_012G105100                    120   3e-28   
ref|XP_008356868.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    120   3e-28   
ref|XP_010517526.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    119   3e-28   
gb|KFK36186.1|  hypothetical protein AALP_AA4G089500                    119   3e-28   
ref|XP_010420259.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    117   3e-28   
gb|KDP42227.1|  hypothetical protein JCGZ_02957                         120   3e-28   
gb|KDP21834.1|  hypothetical protein JCGZ_00621                         122   3e-28   
ref|XP_010500491.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    119   3e-28   
ref|XP_008807355.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    120   3e-28   
ref|XP_008811773.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    119   3e-28   
ref|XP_002283212.1|  PREDICTED: E3 ubiquitin-protein ligase RING1       120   3e-28   
ref|XP_009364363.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    120   3e-28   
ref|XP_008374682.1|  PREDICTED: uncharacterized protein LOC103437931    120   3e-28   
ref|XP_009338606.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    120   3e-28   
ref|XP_009142711.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    119   3e-28   
ref|XP_008788575.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    119   3e-28   
ref|XP_011090210.1|  PREDICTED: E3 ubiquitin-protein ligase RNF12...    119   3e-28   
ref|XP_006411351.1|  hypothetical protein EUTSA_v10016932mg             119   3e-28   
ref|XP_010678387.1|  PREDICTED: uncharacterized protein LOC104893943    120   4e-28   
ref|XP_010036030.1|  PREDICTED: uncharacterized protein LOC104425...    122   4e-28   
ref|XP_004240370.1|  PREDICTED: E3 ubiquitin-protein ligase RING1       120   4e-28   
gb|ABK23765.1|  unknown                                                 119   4e-28   
emb|CBI16098.3|  unnamed protein product                                121   4e-28   
ref|XP_009387697.1|  PREDICTED: E3 ubiquitin-protein ligase RING1       119   4e-28   
gb|KJB76748.1|  hypothetical protein B456_012G105100                    119   4e-28   
ref|XP_002323210.1|  zinc finger family protein                         119   4e-28   
gb|KDP36906.1|  hypothetical protein JCGZ_08197                         119   4e-28   
ref|XP_008781214.1|  PREDICTED: E3 ubiquitin-protein ligase RING1       119   5e-28   
ref|XP_009787392.1|  PREDICTED: uncharacterized protein LOC104235354    120   5e-28   
ref|XP_010036029.1|  PREDICTED: uncharacterized protein LOC104425...    121   5e-28   
ref|XP_010111250.1|  E3 ubiquitin-protein ligase RING1                  119   5e-28   
ref|XP_002325407.2|  hypothetical protein POPTR_0019s04790g             119   5e-28   
gb|ADE76753.1|  unknown                                                 119   5e-28   
ref|XP_010530272.1|  PREDICTED: E3 ubiquitin-protein ligase CIP8        119   5e-28   
ref|XP_008369925.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    119   5e-28   
ref|XP_004486987.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    119   5e-28   
ref|XP_003623661.1|  E3 ubiquitin-protein ligase CG7694                 120   6e-28   
ref|XP_008807019.1|  PREDICTED: E3 ubiquitin-protein ligase CIP8-...    118   6e-28   
ref|XP_008379474.1|  PREDICTED: E3 ubiquitin-protein ligase Praja...    119   6e-28   
emb|CDX94342.1|  BnaC01g18420D                                          119   6e-28   
ref|XP_009378303.1|  PREDICTED: E3 ubiquitin-protein ligase Praja...    119   6e-28   
ref|XP_010479481.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    119   6e-28   
gb|KJB35824.1|  hypothetical protein B456_006G129700                    118   6e-28   
ref|XP_009142222.1|  PREDICTED: E3 ubiquitin-protein ligase RNF12...    119   7e-28   
ref|XP_010500576.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    119   7e-28   
ref|XP_002452884.1|  hypothetical protein SORBIDRAFT_04g034270          118   7e-28   
gb|KJB12921.1|  hypothetical protein B456_002G045100                    119   7e-28   
emb|CDX75998.1|  BnaA04g02620D                                          115   7e-28   
ref|XP_003617180.1|  Thioredoxin-related protein                        119   8e-28   
ref|XP_011034338.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    119   8e-28   
ref|XP_003617178.1|  Thioredoxin-related protein                        118   8e-28   
ref|XP_004302753.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    119   8e-28   
gb|EPS59848.1|  hypothetical protein M569_14957                         117   8e-28   
ref|XP_007141537.1|  hypothetical protein PHAVU_008G204700g             118   8e-28   
gb|AET00138.2|  zinc finger, C3HC4 type (RING finger) protein           118   8e-28   
ref|XP_010461871.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    118   9e-28   
ref|XP_010093819.1|  E3 ubiquitin-protein ligase RING1-like protein     118   9e-28   
gb|KJB12922.1|  hypothetical protein B456_002G045100                    118   9e-28   
emb|CDM87068.1|  unnamed protein product                                117   9e-28   
ref|XP_003518992.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    118   1e-27   
gb|KEH44419.1|  zinc finger, C3HC4 type (RING finger) protein           118   1e-27   
ref|XP_010939389.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    118   1e-27   
ref|XP_010921861.1|  PREDICTED: E3 ubiquitin-protein ligase RING1       117   1e-27   
ref|XP_004307482.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    119   1e-27   
ref|XP_011085033.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    119   1e-27   
ref|XP_010231240.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    118   1e-27   
ref|NP_001130065.1|  uncharacterized protein LOC100191157               118   1e-27   
ref|XP_009337814.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    119   1e-27   
ref|XP_007215690.1|  hypothetical protein PRUPE_ppa008742mg             117   1e-27   
gb|EAZ24742.1|  hypothetical protein OsJ_08513                          118   1e-27   
emb|CDP00121.1|  unnamed protein product                                119   1e-27   
gb|ACE97593.1|  thioredoxin-related protein                             116   1e-27   
gb|KHN38414.1|  E3 ubiquitin-protein ligase RING1                       118   1e-27   
gb|EPS71485.1|  hypothetical protein M569_03274                         119   1e-27   
ref|XP_002319703.1|  hypothetical protein POPTR_0013s05700g             118   1e-27   
dbj|BAD16922.1|  zinc finger -like                                      118   1e-27   
gb|ACE97613.1|  thioredoxin-related protein                             116   2e-27   
ref|XP_010096594.1|  E3 ubiquitin-protein ligase RING1                  118   2e-27   
ref|XP_008647279.1|  PREDICTED: uncharacterized protein LOC100191...    117   2e-27   
gb|ACE97591.1|  thioredoxin-related protein                             116   2e-27   
gb|ACE97628.1|  thioredoxin-related protein                             116   2e-27   
gb|AFK46565.1|  unknown                                                 117   2e-27   
ref|XP_011041353.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    117   2e-27   
ref|XP_004497245.1|  PREDICTED: E3 ubiquitin-protein ligase CIP8-...    117   2e-27   
emb|CDP02365.1|  unnamed protein product                                118   2e-27   
ref|XP_003547238.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    117   2e-27   
ref|XP_006380961.1|  hypothetical protein POPTR_0006s03070g             116   2e-27   
ref|XP_010438764.1|  PREDICTED: E3 ubiquitin-protein ligase RNF12...    118   2e-27   
ref|XP_001007660.3|  hypothetical protein TTHERM_00059280               116   2e-27   
gb|ABK95425.1|  unknown                                                 116   2e-27   
gb|KJB80844.1|  hypothetical protein B456_013G117700                    117   2e-27   
gb|AIZ68181.1|  E3 ubiquitin-protein ligase RING1-like protein          117   2e-27   
gb|ACE97608.1|  thioredoxin-related protein                             116   2e-27   
ref|XP_009375922.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    117   2e-27   
ref|XP_008463301.1|  PREDICTED: uncharacterized protein LOC103501491    119   2e-27   
emb|CDY03622.1|  BnaC03g68810D                                          118   2e-27   
ref|XP_010543132.1|  PREDICTED: uncharacterized protein LOC104816149    119   2e-27   



>emb|CDO98567.1| unnamed protein product [Coffea canephora]
Length=391

 Score =   251 bits (641),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 128/172 (74%), Positives = 139/172 (81%), Gaps = 14/172 (8%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LEQLIQQL ENDPNRYGTPPA+KSAVEGLP +K+T+E+LA+DSSQCAVCKDSF LDEEAK
Sbjct  181  LEQLIQQLAENDPNRYGTPPASKSAVEGLPTVKMTEELLATDSSQCAVCKDSFLLDEEAK  240

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQP--------------  391
            QMPCKHIYH DCI+PWLELHNSCPVCRYELPTDDPDYE+RRN QQ               
Sbjct  241  QMPCKHIYHSDCILPWLELHNSCPVCRYELPTDDPDYESRRNGQQGGNNSTSNVRSFGIN  300

Query  390  TRnnnnsfglgigglggggNQENPQTPRTVERRFRVSLPWLFGGFGSPAETS  235
             R ++N      G  GG  NQENPQTPRTVERRFR+SLPWLF GFGSPAETS
Sbjct  301  IRTDDNLGTGSGGLSGGAVNQENPQTPRTVERRFRISLPWLFRGFGSPAETS  352



>ref|XP_011086955.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Sesamum indicum]
 ref|XP_011086956.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Sesamum indicum]
 ref|XP_011086957.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Sesamum indicum]
Length=382

 Score =   248 bits (632),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 126/164 (77%), Positives = 134/164 (82%), Gaps = 6/164 (4%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LEQLIQQL ENDPNRYGTPPA+KSAVEGLP+IKIT+EML SDSSQCAVCKDSFEL+EEAK
Sbjct  178  LEQLIQQLAENDPNRYGTPPASKSAVEGLPNIKITEEMLPSDSSQCAVCKDSFELNEEAK  237

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigg  349
            QMPCKHIYHKDCI+PWLELHNSCPVCRYELPTDDPDYENRR  Q    +N  S    IG 
Sbjct  238  QMPCKHIYHKDCILPWLELHNSCPVCRYELPTDDPDYENRRTGQMNDNSNRTSNISNIGL  297

Query  348  lggggNQE------NPQTPRTVERRFRVSLPWLFGGFGSPAETS  235
                G+QE      N  TPR VERRFR+SLPWLF G GSPAETS
Sbjct  298  GVAAGSQENRDDNNNSTTPRMVERRFRISLPWLFRGLGSPAETS  341



>ref|XP_011072066.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Sesamum indicum]
Length=380

 Score =   247 bits (631),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 125/164 (76%), Positives = 137/164 (84%), Gaps = 6/164 (4%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LEQLIQQL ENDPNRYGTPPA+KSAVEGLPDIKIT+EMLASDSSQCAVCKDSFEL+EEAK
Sbjct  176  LEQLIQQLAENDPNRYGTPPASKSAVEGLPDIKITEEMLASDSSQCAVCKDSFELNEEAK  235

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigg  349
            QMPCKHIYHKDCI+PWLELHNSCPVCRYELPTDDPDYENRR  Q    ++ NS    +G 
Sbjct  236  QMPCKHIYHKDCILPWLELHNSCPVCRYELPTDDPDYENRRTGQTNDNSSRNSGNTSLGF  295

Query  348  lggggNQENPQ------TPRTVERRFRVSLPWLFGGFGSPAETS  235
              GGG Q++        TPRT+ERRFR+S+PWL  G GSPAETS
Sbjct  296  GAGGGYQDSGDNNNSSLTPRTMERRFRISVPWLLRGLGSPAETS  339



>gb|EYU22293.1| hypothetical protein MIMGU_mgv1a006235mg [Erythranthe guttata]
Length=451

 Score =   238 bits (608),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 124/158 (78%), Positives = 132/158 (84%), Gaps = 5/158 (3%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LEQLIQQL ENDPNRYGTPPA+KS VEGLPDIKIT EMLASDSSQCAVCKDSFEL+EEAK
Sbjct  253  LEQLIQQLAENDPNRYGTPPASKSVVEGLPDIKITAEMLASDSSQCAVCKDSFELNEEAK  312

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigg  349
            Q+PCKHIYHKDCI+PWLELHNSCPVCRYELPTDD DYENRR     T  NNN+ G    G
Sbjct  313  QIPCKHIYHKDCILPWLELHNSCPVCRYELPTDDADYENRR-----TGQNNNNSGGNQDG  367

Query  348  lggggNQENPQTPRTVERRFRVSLPWLFGGFGSPAETS  235
                 N  NPQTPR +ER FR+SLP +FGGFGSPAETS
Sbjct  368  RNNNINNSNPQTPRAMERMFRISLPSIFGGFGSPAETS  405



>ref|XP_009792116.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Nicotiana 
sylvestris]
 ref|XP_009792117.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Nicotiana 
sylvestris]
Length=398

 Score =   234 bits (597),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 126/171 (74%), Positives = 133/171 (78%), Gaps = 13/171 (8%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LEQLIQQL ENDPNRYG PPAAKSAV GLPDIKIT E+L SDSSQCAVCKD+FEL E+AK
Sbjct  185  LEQLIQQLAENDPNRYGAPPAAKSAVAGLPDIKITVELLDSDSSQCAVCKDTFELGEDAK  244

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglg---  358
            QMPCKHIYHKDCI+PWLELHNSCPVCRYELPTDDPDYENRR SQQ   N+N +       
Sbjct  245  QMPCKHIYHKDCILPWLELHNSCPVCRYELPTDDPDYENRRTSQQQNANSNANNSNNNNT  304

Query  357  ----------igglggggNQENPQTPRTVERRFRVSLPWLFGGFGSPAETS  235
                       G  GGGGNQEN QTPRTVE R R+ L WLF G GSPAETS
Sbjct  305  NNNNNTGWIFGGSEGGGGNQENSQTPRTVEGRLRIPLQWLFRGLGSPAETS  355



>ref|XP_009630493.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Nicotiana 
tomentosiformis]
Length=399

 Score =   233 bits (593),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 124/171 (73%), Positives = 131/171 (77%), Gaps = 13/171 (8%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LEQLIQQL ENDPNRYG PPAAKSAV GLPDIKIT E+L SDSSQCAVCKD+FEL EEAK
Sbjct  186  LEQLIQQLAENDPNRYGAPPAAKSAVAGLPDIKITVELLDSDSSQCAVCKDTFELGEEAK  245

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglg---  358
            Q+PCKHIYHKDCI+PWLELHNSCPVCRYELPTDDPDYENRR SQQ   N+N +       
Sbjct  246  QIPCKHIYHKDCILPWLELHNSCPVCRYELPTDDPDYENRRTSQQQNANSNANNSSNNNT  305

Query  357  ----------igglggggNQENPQTPRTVERRFRVSLPWLFGGFGSPAETS  235
                       G  GGG NQEN  TPRTVE R R+ L WLF G GSPAETS
Sbjct  306  NNNNNTGWVFGGSEGGGENQENSHTPRTVEGRLRIPLQWLFRGLGSPAETS  356



>ref|XP_006353939.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Solanum tuberosum]
Length=387

 Score =   231 bits (590),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 125/171 (73%), Positives = 137/171 (80%), Gaps = 13/171 (8%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LEQLIQQL ENDPNR+GTPPAAKSAV GLPDIKIT+E+L SDSSQCAVCKD+FEL  EAK
Sbjct  177  LEQLIQQLAENDPNRHGTPPAAKSAVAGLPDIKITEELLDSDSSQCAVCKDTFELGMEAK  236

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTRnnn---------  376
            Q+PCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENR+ SQQ T N +         
Sbjct  237  QIPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRKTSQQQTANTSNTHANTSNN  296

Query  375  ----nsfglgigglggggNQENPQTPRTVERRFRVSLPWLFGGFGSPAETS  235
                N+ G+  GGL GGG+Q+N QTP T ERR R+ L WLF G GSPAETS
Sbjct  297  NTNNNNTGVMFGGLEGGGDQDNSQTPSTGERRLRIPLQWLFRGLGSPAETS  347



>emb|CAN79596.1| hypothetical protein VITISV_042386 [Vitis vinifera]
Length=371

 Score =   226 bits (577),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 113/170 (66%), Positives = 125/170 (74%), Gaps = 12/170 (7%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LEQLIQQL ENDPNRYGTPPA+KSA+EGLP I+IT E+L +DSSQCAVCKDSFELDEEAK
Sbjct  174  LEQLIQQLAENDPNRYGTPPASKSAIEGLPTIRITVELLGTDSSQCAVCKDSFELDEEAK  233

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigg  349
            QMPCKHIYH DCI+PWLELHNSCPVCRYELPTDDPDYE+R    Q  +   N+  +   G
Sbjct  234  QMPCKHIYHNDCILPWLELHNSCPVCRYELPTDDPDYEHRTRGGQVNQTGGNAAAVAAAG  293

Query  348  lggggNQE------------NPQTPRTVERRFRVSLPWLFGGFGSPAETS  235
                                NPQTPRT +R FR+S PW F  FGSPAETS
Sbjct  294  AASNSASGAAGGAAVSGENPNPQTPRTADRMFRISFPWPFRTFGSPAETS  343



>ref|XP_008803049.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Phoenix dactylifera]
Length=364

 Score =   226 bits (576),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 114/159 (72%), Positives = 123/159 (77%), Gaps = 2/159 (1%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LEQLIQQL ENDPNRYGTPPAAKSAV  LPDIKIT+E+LA+D +QCAVCKD+FE+ EEAK
Sbjct  170  LEQLIQQLAENDPNRYGTPPAAKSAVGSLPDIKITEELLATDEAQCAVCKDTFEIGEEAK  229

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRN--SQQPTRnnnnsfglgi  355
            QMPCKHIYHKDCI+PWLELHNSCPVCRYELPTDDPDYENRR    Q          G   
Sbjct  230  QMPCKHIYHKDCILPWLELHNSCPVCRYELPTDDPDYENRRGPAVQGAHPVGTEDPGGAG  289

Query  354  gglggggNQENPQTPRTVERRFRVSLPWLFGGFGSPAET  238
            G   G     N Q+PRTVERRFR+SLPW   GFGS AE 
Sbjct  290  GLAAGASGDGNTQSPRTVERRFRISLPWPLRGFGSQAEA  328



>ref|XP_003634328.1| PREDICTED: E3 ubiquitin-protein ligase RING1 [Vitis vinifera]
 ref|XP_010663919.1| PREDICTED: E3 ubiquitin-protein ligase RING1 [Vitis vinifera]
Length=369

 Score =   226 bits (576),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 113/170 (66%), Positives = 125/170 (74%), Gaps = 12/170 (7%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LEQLIQQL ENDPNRYGTPPA+KSA+EGLP I+IT E+L +DSSQCAVCKDSFELDEEAK
Sbjct  172  LEQLIQQLAENDPNRYGTPPASKSAIEGLPTIRITVELLGTDSSQCAVCKDSFELDEEAK  231

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigg  349
            QMPCKHIYH DCI+PWLELHNSCPVCRYELPTDDPDYE+R    Q  +   N+  +   G
Sbjct  232  QMPCKHIYHNDCILPWLELHNSCPVCRYELPTDDPDYEHRTRGGQVNQTGGNAAAVAAAG  291

Query  348  lggggNQE------------NPQTPRTVERRFRVSLPWLFGGFGSPAETS  235
                                NPQTPRT +R FR+S PW F  FGSPAETS
Sbjct  292  AASNSASGAAGGAAVSGENPNPQTPRTADRMFRISFPWPFRTFGSPAETS  341



>ref|XP_010088395.1| E3 ubiquitin-protein ligase RING1 [Morus notabilis]
 gb|EXC35976.1| E3 ubiquitin-protein ligase RING1 [Morus notabilis]
Length=378

 Score =   224 bits (572),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 114/169 (67%), Positives = 128/169 (76%), Gaps = 13/169 (8%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LEQLIQQL ENDPNRYGTPPA+KSA+EGLP +KIT+E+LASDSSQCAVCKD+FEL EEAK
Sbjct  174  LEQLIQQLAENDPNRYGTPPASKSAMEGLPSVKITEELLASDSSQCAVCKDTFELGEEAK  233

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENR-RNSQQPTRnnnnsf-----  367
            QMPCKHIYH +CI+PWLELHNSCPVCRYELPTDDPDYE R R +  P   +  +      
Sbjct  234  QMPCKHIYHSECILPWLELHNSCPVCRYELPTDDPDYEQRNRGTSTPANQSQAAGGFNIS  293

Query  366  -------glgigglggggNQENPQTPRTVERRFRVSLPWLFGGFGSPAE  241
                    +G G   G  + ENPQTPR VERRF +SLP LF  FGS AE
Sbjct  294  VGGGSINAVGDGSGSGATSGENPQTPRMVERRFTISLPQLFRVFGSTAE  342



>ref|XP_010935556.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Elaeis guineensis]
Length=358

 Score =   223 bits (568),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 112/160 (70%), Positives = 123/160 (77%), Gaps = 2/160 (1%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LEQLIQQL ENDPNRYGTPPA+KSAV  L DIKIT E+LASD +QCAVCKD+FE+ EEAK
Sbjct  164  LEQLIQQLAENDPNRYGTPPASKSAVASLSDIKITVELLASDEAQCAVCKDTFEIGEEAK  223

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNS--QQPTRnnnnsfglgi  355
            QMPCKHIYHKDCI+PWLELHNSCPVCRYELPTDDPDYENRR +  Q       +  G   
Sbjct  224  QMPCKHIYHKDCILPWLELHNSCPVCRYELPTDDPDYENRRGAPVQGGLPVGADDPGGAG  283

Query  354  gglggggNQENPQTPRTVERRFRVSLPWLFGGFGSPAETS  235
            G         + Q+PRTVERRFR+SLPW   GFGS AE S
Sbjct  284  GSAARASGDGSTQSPRTVERRFRISLPWPLRGFGSQAEAS  323



>gb|EYU17802.1| hypothetical protein MIMGU_mgv1a008418mg [Erythranthe guttata]
Length=374

 Score =   223 bits (568),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 113/161 (70%), Positives = 125/161 (78%), Gaps = 3/161 (2%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LEQLIQQL ENDPNRYGTPPA+KS VEGLPDI ITQEML SDSSQCAVCKDSFEL+E AK
Sbjct  183  LEQLIQQLAENDPNRYGTPPASKSVVEGLPDITITQEMLTSDSSQCAVCKDSFELNEAAK  242

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigg  349
            Q+PCKH+YHKDCI+PWLELHNSCPVCRYELPTDDP+YENRR  +    + +++       
Sbjct  243  QIPCKHLYHKDCIVPWLELHNSCPVCRYELPTDDPEYENRRTRENENSSQSSNISNSSLE  302

Query  348  lggggNQEN--PQTP-RTVERRFRVSLPWLFGGFGSPAETS  235
               G N  N   QTP    ERRFR+SLPW F GFGS AE S
Sbjct  303  ALDGDNSSNNGEQTPMAAAERRFRISLPWPFRGFGSTAEAS  343



>ref|XP_010940373.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Elaeis guineensis]
 ref|XP_010940374.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Elaeis guineensis]
 ref|XP_010940375.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Elaeis guineensis]
 ref|XP_010940376.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Elaeis guineensis]
Length=363

 Score =   219 bits (559),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 111/159 (70%), Positives = 124/159 (78%), Gaps = 2/159 (1%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LEQLIQQL ENDPNRYGTPPAAKSA+  LPDIKI +E+LASD +QCAVCKD+FE+  EAK
Sbjct  168  LEQLIQQLAENDPNRYGTPPAAKSAITSLPDIKINEELLASDEAQCAVCKDTFEIGVEAK  227

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRN-SQQPTRnnnnsfglgig  352
            QMPCKHIYHKDCI+PWLELHNSCPVCRYELPTDDPDYENR+  + + TR        G G
Sbjct  228  QMPCKHIYHKDCILPWLELHNSCPVCRYELPTDDPDYENRKGPAAEGTRPAGAGDPGGAG  287

Query  351  glggggNQE-NPQTPRTVERRFRVSLPWLFGGFGSPAET  238
            G       + N  +PRTVERRFR+SLPW   GFGS AE 
Sbjct  288  GSAAEALGDGNTLSPRTVERRFRISLPWPLRGFGSQAEA  326



>ref|XP_008811090.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Phoenix dactylifera]
 ref|XP_008811098.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Phoenix dactylifera]
 ref|XP_008811103.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Phoenix dactylifera]
 ref|XP_008811112.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Phoenix dactylifera]
 ref|XP_008811119.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Phoenix dactylifera]
Length=362

 Score =   218 bits (556),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 109/159 (69%), Positives = 121/159 (76%), Gaps = 2/159 (1%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LEQLIQQL ENDPNRYGTPPAAKSA+  LPDIKIT+E+LASD +QCAVCKD+FE+  EAK
Sbjct  167  LEQLIQQLAENDPNRYGTPPAAKSAISSLPDIKITEELLASDEAQCAVCKDTFEIGVEAK  226

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRN--SQQPTRnnnnsfglgi  355
            QMPCKHIYHKDCI+PWLELHNSCPVCRYEL TDDPDYEN+R   ++          G   
Sbjct  227  QMPCKHIYHKDCILPWLELHNSCPVCRYELLTDDPDYENKRGAAAEGARPAGAGDPGGAG  286

Query  354  gglggggNQENPQTPRTVERRFRVSLPWLFGGFGSPAET  238
            G   G     N  +PRTVERRFR+SLPW   GFGS AE 
Sbjct  287  GSAAGASGDGNTLSPRTVERRFRISLPWPLRGFGSQAEA  325



>ref|XP_008467256.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Cucumis melo]
 ref|XP_008467264.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Cucumis melo]
Length=377

 Score =   217 bits (552),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 112/166 (67%), Positives = 126/166 (76%), Gaps = 9/166 (5%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LEQLIQQL ENDPNRYGTPPA+KSA+EGLPDIKIT+E+LA+DSSQCAVCKD+FELDE AK
Sbjct  178  LEQLIQQLAENDPNRYGTPPASKSAIEGLPDIKITEELLATDSSQCAVCKDTFELDEVAK  237

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENR-RNSQQPTRnnn-------n  373
             MPCKHIYH DCI+PWLELHNSCPVCRYELPTDDPDYE R R S  P R+ +       +
Sbjct  238  LMPCKHIYHADCIIPWLELHNSCPVCRYELPTDDPDYEQRTRASSAPNRSQSESQPFGDS  297

Query  372  sfglgigglggggNQENPQTPRTVERRF-RVSLPWLFGGFGSPAET  238
            S G          + EN QT +  ERR  R++ PW F GFGS AET
Sbjct  298  STGGENVVGSDPNSDENSQTQQMGERRVRRIAFPWPFRGFGSAAET  343



>ref|XP_004137524.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform 1 [Cucumis 
sativus]
 ref|XP_004137525.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform 2 [Cucumis 
sativus]
 ref|XP_004137526.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform 3 [Cucumis 
sativus]
 ref|XP_004161827.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform 1 [Cucumis 
sativus]
 ref|XP_004161828.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform 2 [Cucumis 
sativus]
 ref|XP_004161829.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform 3 [Cucumis 
sativus]
 gb|KGN64207.1| hypothetical protein Csa_1G043100 [Cucumis sativus]
Length=378

 Score =   217 bits (552),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 112/166 (67%), Positives = 126/166 (76%), Gaps = 9/166 (5%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LEQLIQQL ENDPNRYGTPPA+KSA+EGLPDIKIT+E+LA+DSSQCAVCKD+FELDE AK
Sbjct  179  LEQLIQQLAENDPNRYGTPPASKSAIEGLPDIKITEELLATDSSQCAVCKDTFELDEVAK  238

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENR-RNSQQPTRnnn-------n  373
             MPCKHIYH DCI+PWLELHNSCPVCRYELPTDDPDYE R R S  P R+ +       +
Sbjct  239  LMPCKHIYHADCIIPWLELHNSCPVCRYELPTDDPDYEQRTRGSSAPNRSQSESQPFGDS  298

Query  372  sfglgigglggggNQENPQTPRTVERRF-RVSLPWLFGGFGSPAET  238
            S G          + EN QT +  ERR  R++ PW F GFGS AET
Sbjct  299  STGGENVVGSDPNSDENSQTQQMGERRVRRIAFPWPFRGFGSAAET  344



>ref|XP_010246216.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Nelumbo nucifera]
Length=361

 Score =   215 bits (548),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 107/157 (68%), Positives = 118/157 (75%), Gaps = 2/157 (1%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LEQLIQQL ENDPNRYGTPPA+ SAVE LP+I IT E+LASD++QCAVCKD+FEL  EAK
Sbjct  171  LEQLIQQLAENDPNRYGTPPASNSAVEALPNIIITDELLASDTAQCAVCKDTFELGSEAK  230

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigg  349
            QMPCKHIYH DCI+PWLELHNSCPVCRYELPTDDPDYE RR +Q    +         G 
Sbjct  231  QMPCKHIYHSDCILPWLELHNSCPVCRYELPTDDPDYEQRRGNQGTANSARAGGSADSGS  290

Query  348  lggggNQENPQTPRTVERRFRVSLPWLFGGFGSPAET  238
               G      Q  RTVERRFR+SLP +F G  SPAET
Sbjct  291  GRAGQVHAPMQ--RTVERRFRISLPSIFRGLISPAET  325



>ref|XP_004235401.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Solanum lycopersicum]
 ref|XP_004235402.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Solanum lycopersicum]
 ref|XP_010318345.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Solanum lycopersicum]
 ref|XP_010318346.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Solanum lycopersicum]
Length=383

 Score =   216 bits (550),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 123/171 (72%), Positives = 136/171 (80%), Gaps = 13/171 (8%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LEQLIQQL ENDPNR+GTPPAAKSAV GLPDIKIT+E+L SDSSQCAVCKD+FEL  EAK
Sbjct  177  LEQLIQQLAENDPNRHGTPPAAKSAVAGLPDIKITEELLDSDSSQCAVCKDTFELGMEAK  236

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTR------------  385
            Q+PCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENR+ SQQ T             
Sbjct  237  QIPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRKTSQQQTANTSNTNTNTSNN  296

Query  384  -nnnnsfglgigglggggNQENPQTPRTVERRFRVSLPWLFGGFGSPAETS  235
              NNN+ G+  GGL GGG+Q++ QT  + ERR R+ L WLF G GSPAETS
Sbjct  297  NTNNNNTGVMFGGLEGGGDQDSSQTSSSGERRLRIPLQWLFRGLGSPAETS  347



>gb|ACT21194.1| zinc finger protein [Carica papaya]
Length=340

 Score =   213 bits (542),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 113/161 (70%), Positives = 128/161 (80%), Gaps = 3/161 (2%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LEQLIQQL ENDPNR+GTPPA+KSA+E LP IKI QEM  SDSSQCAVCKDSF L EEAK
Sbjct  154  LEQLIQQLAENDPNRHGTPPASKSAIEALPTIKIFQEMPDSDSSQCAVCKDSFALAEEAK  213

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENR-RNSQQPTRnnnnsf-glgi  355
            QMPCKHIYH  CI+PWLELHNSCPVCRYELPTDD DYE+R R ++ P +N + S   +  
Sbjct  214  QMPCKHIYHSQCILPWLELHNSCPVCRYELPTDDADYEHRTRANRTPAQNVSGSTDAVNA  273

Query  354  gglggggNQENPQTPRTVERRFRVSLPWLF-GGFGSPAETS  235
               G  GN++NP+TPR+VERRFR+ LPW F   FGS AETS
Sbjct  274  VADGNAGNRDNPETPRSVERRFRIFLPWPFRSSFGSGAETS  314



>ref|XP_010249658.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Nelumbo nucifera]
Length=363

 Score =   213 bits (543),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 106/158 (67%), Positives = 123/158 (78%), Gaps = 4/158 (3%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LEQLIQQL ENDPNRYGTPPA+KSA++GLPD+KI++E+LASD +QCAVCKD+FEL  EAK
Sbjct  175  LEQLIQQLAENDPNRYGTPPASKSAIDGLPDVKISEELLASDLAQCAVCKDTFELGSEAK  234

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigg  349
            QMPCKHIYH DCI+PWL+LHNSCPVCRYELPTDDPDYE RR        ++   G  +  
Sbjct  235  QMPCKHIYHSDCILPWLKLHNSCPVCRYELPTDDPDYEQRRGGL--GTGSSIGDGGPVDS  292

Query  348  lggggNQENPQTPRTVERRFRVSLPWLFGGFGSPAETS  235
             GG   QEN Q   T ER FR++LP +F  F SPAETS
Sbjct  293  GGGRAGQENNQP--TTERSFRITLPSIFRAFASPAETS  328



>ref|XP_009401096.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Musa acuminata 
subsp. malaccensis]
Length=367

 Score =   213 bits (542),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 106/163 (65%), Positives = 125/163 (77%), Gaps = 7/163 (4%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LEQLIQQL ENDPNRYGTPPAAKSA+ GLPDIKI+ E+LASD +QC+VC ++F+L +EAK
Sbjct  171  LEQLIQQLAENDPNRYGTPPAAKSAITGLPDIKISVELLASDEAQCSVCMETFKLGDEAK  230

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRN-----SQQPTRnnnnsfg  364
            QMPCKHI+HKDCI+PWLELHNSCPVCR+ELPTDDPDYE RR      S +PT        
Sbjct  231  QMPCKHIFHKDCILPWLELHNSCPVCRHELPTDDPDYEQRRGAPAALSARPT--AGIRDP  288

Query  363  lgigglggggNQENPQTPRTVERRFRVSLPWLFGGFGSPAETS  235
            + +GG  G   +    +PRTVERRFR+SLPW F  FG+  E S
Sbjct  289  VSVGGSAGAFAEGGAPSPRTVERRFRISLPWPFRIFGAQTEGS  331



>ref|XP_006441411.1| hypothetical protein CICLE_v10020902mg [Citrus clementina]
 gb|ESR54651.1| hypothetical protein CICLE_v10020902mg [Citrus clementina]
Length=350

 Score =   211 bits (536),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 112/167 (67%), Positives = 123/167 (74%), Gaps = 11/167 (7%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LEQLIQQL ENDPNRYGTPPA+KSA+E LP IKI + M++SDSSQCAVCKDSFEL+EEA+
Sbjct  152  LEQLIQQLAENDPNRYGTPPASKSAIEALPSIKINEAMMSSDSSQCAVCKDSFELNEEAR  211

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigg  349
            QMPCKHIYH DCIMPWLELHNSCPVCRYELPTDDPDYE RRN      +NNN+       
Sbjct  212  QMPCKHIYHPDCIMPWLELHNSCPVCRYELPTDDPDYEQRRNGNGDNNSNNNNSMNQSFN  271

Query  348  lggggNQEN-----------PQTPRTVERRFRVSLPWLFGGFGSPAE  241
            LG G                 +TPRTVERR R+SLPW F  F S AE
Sbjct  272  LGFGFGGGGSGGNDGESGGNAETPRTVERRLRISLPWPFNAFASRAE  318



>ref|XP_006493415.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Citrus sinensis]
Length=352

 Score =   210 bits (534),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 110/169 (65%), Positives = 121/169 (72%), Gaps = 13/169 (8%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LEQLIQQL ENDPNRYGTPPA+KSA+E LP IKI + M++SDSSQCAVCKDSFEL+EEA+
Sbjct  152  LEQLIQQLAENDPNRYGTPPASKSAIEALPSIKINEAMMSSDSSQCAVCKDSFELNEEAR  211

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigg  349
            QMPCKHIYH DCIMPWLELHNSCPVCRYELPTDDPDYE RRN      NN+N+       
Sbjct  212  QMPCKHIYHPDCIMPWLELHNSCPVCRYELPTDDPDYEQRRNGNGNGNNNSNNNNSMNQS  271

Query  348  lggggNQEN-------------PQTPRTVERRFRVSLPWLFGGFGSPAE  241
               G                   +TPRTVERR R+SLPW F  F S AE
Sbjct  272  FNLGFGFGGGGSGGNDGESGGNAETPRTVERRLRISLPWPFNAFASRAE  320



>gb|KDO48740.1| hypothetical protein CISIN_1g0186891mg [Citrus sinensis]
Length=352

 Score =   210 bits (534),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 110/169 (65%), Positives = 121/169 (72%), Gaps = 13/169 (8%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LEQLIQQL ENDPNRYGTPPA+KSA+E LP IKI + M++SDSSQCAVCKDSFEL+EEA+
Sbjct  152  LEQLIQQLAENDPNRYGTPPASKSAIEALPSIKINEAMMSSDSSQCAVCKDSFELNEEAR  211

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigg  349
            QMPCKHIYH DCIMPWLELHNSCPVCRYELPTDDPDYE RRN      NN+N+       
Sbjct  212  QMPCKHIYHPDCIMPWLELHNSCPVCRYELPTDDPDYEQRRNGNGNGNNNSNNNNSMNQS  271

Query  348  lggggNQEN-------------PQTPRTVERRFRVSLPWLFGGFGSPAE  241
               G                   +TPRTVERR R+SLPW F  F S AE
Sbjct  272  FNLGFGFGGGGSGGNDGESGGNAETPRTVERRLRISLPWPFNAFASRAE  320



>ref|XP_004299466.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Fragaria vesca 
subsp. vesca]
Length=379

 Score =   209 bits (533),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 109/169 (64%), Positives = 120/169 (71%), Gaps = 11/169 (7%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LEQLIQQL ENDPNRYGTPPA+KSAVE LP +KITQE+L SDSSQCAVCKDSFELDEEAK
Sbjct  175  LEQLIQQLAENDPNRYGTPPASKSAVEALPVVKITQELLDSDSSQCAVCKDSFELDEEAK  234

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYE-----------NRRNSQQPTRn  382
            QMPCKHIYH DCI+PWLELHNSCPVCR+ELPTDD +YE           N  ++Q     
Sbjct  235  QMPCKHIYHSDCILPWLELHNSCPVCRHELPTDDSEYEQRVRGGGGDAANANSTQYAAGV  294

Query  381  nnnsfglgigglggggNQENPQTPRTVERRFRVSLPWLFGGFGSPAETS  235
               +   G+GG  G       Q PRTVERRF +SLP LF  FG   E  
Sbjct  295  GGANNSGGVGGSRGQAVDIQGQAPRTVERRFTISLPRLFRVFGGAPEAG  343



>ref|XP_008393509.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Malus domestica]
 ref|XP_008393510.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Malus domestica]
Length=388

 Score =   209 bits (531),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 109/174 (63%), Positives = 127/174 (73%), Gaps = 16/174 (9%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            +EQLIQQL ENDPNRYGTPPA+KSA+  LP +KI++E+LASDSSQCAVCKDSFEL EEAK
Sbjct  184  IEQLIQQLAENDPNRYGTPPASKSAIVALPVVKISEELLASDSSQCAVCKDSFELGEEAK  243

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENR-----RNSQQPTRnnnnsfg  364
            QMPCKH+YH DCI+PWLELHNSCPVCR+ELPTDDP+YE R      N  Q +++      
Sbjct  244  QMPCKHLYHSDCILPWLELHNSCPVCRHELPTDDPEYEQRIRGDSGNGNQTSQSAAPGGT  303

Query  363  lgigglggggNQ----------ENPQ-TPRTVERRFRVSLPWLFGGFGSPAETS  235
                G GG G+           +NP  +PRTVERRF +SLP  FG  G PAETS
Sbjct  304  NISMGGGGSGSGFGLGIGTPSLDNPSPSPRTVERRFTISLPRFFGALGGPAETS  357



>ref|XP_010069512.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Eucalyptus 
grandis]
 gb|KCW57890.1| hypothetical protein EUGRSUZ_H00641 [Eucalyptus grandis]
Length=394

 Score =   208 bits (530),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 106/161 (66%), Positives = 122/161 (76%), Gaps = 5/161 (3%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LEQLIQQL ENDPNRYGTPPA+K+A+ GLP +KI +E LASD+SQCAVCKD+FEL EEAK
Sbjct  195  LEQLIQQLAENDPNRYGTPPASKTAINGLPVVKIDEESLASDNSQCAVCKDTFELGEEAK  254

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYE--NRRNSQQPTRnnnnsfglgi  355
            QMPCKHIYH DCI+PWLELHNSCPVCR+ELPTDDPDYE  NR    Q          +  
Sbjct  255  QMPCKHIYHSDCILPWLELHNSCPVCRHELPTDDPDYEQRNRGPQAQQVLGGRTQTDVSS  314

Query  354  gglggggNQENPQTPRTVERRFRVS--LPWLFG-GFGSPAE  241
               G   + ++ QTP+T+ERRFR+S  LPW F   FGSPAE
Sbjct  315  DLSGAPASGDSSQTPQTMERRFRISLPLPWPFNRTFGSPAE  355



>ref|XP_008240345.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Prunus mume]
Length=381

 Score =   207 bits (526),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 113/181 (62%), Positives = 124/181 (69%), Gaps = 25/181 (14%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LEQLIQQL ENDPNRYGTPPA+KSAVEGLP +KI++E+L SDSSQCAVCKDSFEL EEAK
Sbjct  172  LEQLIQQLAENDPNRYGTPPASKSAVEGLPVVKISKELLDSDSSQCAVCKDSFELGEEAK  231

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigg  349
            QMPCKHIYH DCI+PWLELHNSCPVCRYELPTDD DYE R  S  P   N  +     GG
Sbjct  232  QMPCKHIYHSDCILPWLELHNSCPVCRYELPTDDTDYEQRL-SGAPANANRANQSAAAGG  290

Query  348  lggggN-----------------------QENPQTPRTVERRFRVSLPWLFGGFGSPAET  238
            +                             ++P TPRTVERRF +SLP LF  FG  AET
Sbjct  291  VNIFAGVGGGSGSGSGSGIGIGIGAPSLDNQSP-TPRTVERRFTISLPRLFRVFGGSAET  349

Query  237  S  235
            S
Sbjct  350  S  350



>ref|XP_006374275.1| hypothetical protein POPTR_0015s05600g [Populus trichocarpa]
 gb|ABK95038.1| unknown [Populus trichocarpa]
 gb|ERP52072.1| hypothetical protein POPTR_0015s05600g [Populus trichocarpa]
Length=345

 Score =   206 bits (523),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 108/161 (67%), Positives = 119/161 (74%), Gaps = 5/161 (3%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LEQLIQQL ENDPNRYGTPPAAKSAVE LPD+K+T+E++ SDSSQCAVCKDSFEL E AK
Sbjct  155  LEQLIQQLAENDPNRYGTPPAAKSAVENLPDVKVTEELMQSDSSQCAVCKDSFELGEVAK  214

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRR--NSQQPTRnnnnsfglgi  355
            Q+PCKHIYHKDCIMPWLELHNSCPVCRYELPTDD DYE R+   S    +N       G 
Sbjct  215  QIPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDQDYEQRKGNGSNGVNQNVGGGINSGG  274

Query  354  gglggggNQENPQTPRTVERRFRVSLPWLF-GGFGSPAETS  235
                G  +  N QTPR  ERRFR+  PW F  G G  A +S
Sbjct  275  SISDGDNSDGNAQTPR--ERRFRIPFPWPFSSGTGRSAGSS  313



>ref|XP_010687250.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Beta vulgaris 
subsp. vulgaris]
Length=374

 Score =   203 bits (517),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 108/167 (65%), Positives = 121/167 (72%), Gaps = 9/167 (5%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LEQLIQQL ENDPNRYGTPPAAKSAVEGLP IK+T+E+L SDSS CAVC + FEL  EAK
Sbjct  181  LEQLIQQLAENDPNRYGTPPAAKSAVEGLPSIKVTEELLNSDSSDCAVCMNEFELGAEAK  240

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENR-RNSQQPTRnnnnsfglgig  352
            QMPCKH++H DCI+PWLELHNSCPVCRYELPTDDP+YE R R  ++ T +  N+ G G G
Sbjct  241  QMPCKHVFHSDCILPWLELHNSCPVCRYELPTDDPEYEERARGRRENTESGGNANGGGAG  300

Query  351  glggggNQEN--------PQTPRTVERRFRVSLPWLFGGFGSPAETS  235
            G                  Q  RTVERRFR+SLPW F   GS AE S
Sbjct  301  GNSNANGDGEGDGGLEEGSQNDRTVERRFRISLPWPFSAAGSAAEGS  347



>ref|XP_011047757.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Populus euphratica]
Length=345

 Score =   202 bits (514),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 103/150 (69%), Positives = 113/150 (75%), Gaps = 4/150 (3%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LEQLIQQL ENDPNRYGTPPAAKSAVE LPD+K+T+E++ SDSSQCAVCKDSFE  E AK
Sbjct  155  LEQLIQQLAENDPNRYGTPPAAKSAVENLPDVKVTEELMQSDSSQCAVCKDSFEPGEVAK  214

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRR--NSQQPTRnnnnsfglgi  355
            Q+PCKHIYHKDCI PWLELHNSCPVCRYELPTDD DYE R+   S    +N       G 
Sbjct  215  QIPCKHIYHKDCITPWLELHNSCPVCRYELPTDDQDYEQRKGDGSNGVNQNVGGGISSGG  274

Query  354  gglggggNQENPQTPRTVERRFRVSLPWLF  265
                G  +  N QTPR  ERRFR+  PWLF
Sbjct  275  SFSDGDNSDGNAQTPR--ERRFRIPFPWLF  302



>ref|NP_001064906.2| Os10g0487400 [Oryza sativa Japonica Group]
 dbj|BAF26820.2| Os10g0487400 [Oryza sativa Japonica Group]
Length=304

 Score =   199 bits (505),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 91/154 (59%), Positives = 110/154 (71%), Gaps = 1/154 (1%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLAS-DSSQCAVCKDSFELDEEA  532
            LEQLI+QL ENDPNRYGTPPAAKSA+  LPD+ +T  M+A+ D ++CAVCK+ F   E A
Sbjct  124  LEQLIEQLTENDPNRYGTPPAAKSALSTLPDVVVTDAMVAAADGAECAVCKEDFSPGEGA  183

Query  531  KQMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgig  352
            KQMPCKHIYH DCIMPWL+LHNSCP+CR+ELPTDDPDYE R+ S        ++      
Sbjct  184  KQMPCKHIYHADCIMPWLDLHNSCPICRFELPTDDPDYEGRKKSNPQPTAGVDAGAASGS  243

Query  351  glggggNQENPQTPRTVERRFRVSLPWLFGGFGS  250
                   +E+ ++ R VERRF VSLPW F G GS
Sbjct  244  STAAEEREESGESARLVERRFNVSLPWPFSGLGS  277



>ref|XP_011003690.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Populus euphratica]
Length=346

 Score =   200 bits (508),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 104/158 (66%), Positives = 117/158 (74%), Gaps = 5/158 (3%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LEQLIQQL ENDPNRYGTPPA+KSAVE LPDIK++ E+L SDSSQCAVCKDSFEL EEAK
Sbjct  156  LEQLIQQLAENDPNRYGTPPASKSAVENLPDIKVSNELLESDSSQCAVCKDSFELGEEAK  215

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPT--Rnnnnsfglgi  355
            Q+PCKHIYHKDCI+PWLELHN CPVCRYELPTDDPDYE R+ +      +N       G 
Sbjct  216  QIPCKHIYHKDCIIPWLELHNWCPVCRYELPTDDPDYEQRKGNGNDGGYQNAGGGNSGGG  275

Query  354  gglggggNQENPQTPRTVERRFRVSLPWLF-GGFGSPA  244
                G  +  N QTPR  +RRFR++  W F  G G P 
Sbjct  276  SFSDGDNSDGNAQTPR--DRRFRIAFQWPFSSGSGRPV  311



>gb|EAZ16486.1| hypothetical protein OsJ_31957 [Oryza sativa Japonica Group]
Length=336

 Score =   199 bits (505),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 91/154 (59%), Positives = 110/154 (71%), Gaps = 1/154 (1%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLAS-DSSQCAVCKDSFELDEEA  532
            LEQLI+QL ENDPNRYGTPPAAKSA+  LPD+ +T  M+A+ D ++CAVCK+ F   E A
Sbjct  156  LEQLIEQLTENDPNRYGTPPAAKSALSTLPDVVVTDAMVAAADGAECAVCKEDFSPGEGA  215

Query  531  KQMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgig  352
            KQMPCKHIYH DCIMPWL+LHNSCP+CR+ELPTDDPDYE R+ S        ++      
Sbjct  216  KQMPCKHIYHADCIMPWLDLHNSCPICRFELPTDDPDYEGRKKSNPQPTAGVDAGAASGS  275

Query  351  glggggNQENPQTPRTVERRFRVSLPWLFGGFGS  250
                   +E+ ++ R VERRF VSLPW F G GS
Sbjct  276  STAAEEREESGESARLVERRFNVSLPWPFSGLGS  309



>gb|ACF84253.1| unknown [Zea mays]
Length=234

 Score =   194 bits (493),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/156 (62%), Positives = 111/156 (71%), Gaps = 6/156 (4%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLAS-DSSQCAVCKDSFELDEEA  532
            LEQLI+QL ENDPNRYGTPPAAKSA+  LPD+ +T  M+A+ + ++CAVCK+ F   E A
Sbjct  51   LEQLIEQLAENDPNRYGTPPAAKSALSSLPDVVVTHTMVAAAEGAECAVCKEDFSPGEVA  110

Query  531  KQMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRR--NSQQPTRnnnnsfglg  358
            KQMPC HIYH DCIMPWLELHNSCP+CR+ELPTDDPDYE R+  NSQQ       + G  
Sbjct  111  KQMPCNHIYHTDCIMPWLELHNSCPICRFELPTDDPDYEVRKGSNSQQAVGIAAAASGSS  170

Query  357  igglggggNQENPQTPRTVERRFRVSLPWLFGGFGS  250
                G    QEN   PR VERRF VSLPW F G G 
Sbjct  171  TAAEGQMERQEN---PRVVERRFNVSLPWPFSGLGG  203



>ref|XP_002317728.2| hypothetical protein POPTR_0012s03370g [Populus trichocarpa]
 gb|EEE95948.2| hypothetical protein POPTR_0012s03370g [Populus trichocarpa]
Length=269

 Score =   195 bits (495),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 89/103 (86%), Positives = 96/103 (93%), Gaps = 0/103 (0%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LEQLIQQL ENDPNRYGTPPA+KSAVE LPDIK+T+E+L SDSSQCAVCKDSFEL EEAK
Sbjct  156  LEQLIQQLAENDPNRYGTPPASKSAVENLPDIKVTKELLESDSSQCAVCKDSFELGEEAK  215

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNS  400
            Q+PCKHIYHKDCI PWLELHNSCPVCRYELPTDDPDYE R+ +
Sbjct  216  QIPCKHIYHKDCITPWLELHNSCPVCRYELPTDDPDYEQRKGN  258



>gb|AAL59019.1|AC087182_2 putative zinc finger protein [Oryza sativa Japonica Group]
 gb|AAP54362.1| Zinc finger, C3HC4 type family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAG95571.1| unnamed protein product [Oryza sativa Japonica Group]
Length=370

 Score =   197 bits (500),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 91/154 (59%), Positives = 110/154 (71%), Gaps = 1/154 (1%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLAS-DSSQCAVCKDSFELDEEA  532
            LEQLI+QL ENDPNRYGTPPAAKSA+  LPD+ +T  M+A+ D ++CAVCK+ F   E A
Sbjct  190  LEQLIEQLTENDPNRYGTPPAAKSALSTLPDVVVTDAMVAAADGAECAVCKEDFSPGEGA  249

Query  531  KQMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgig  352
            KQMPCKHIYH DCIMPWL+LHNSCP+CR+ELPTDDPDYE R+ S        ++      
Sbjct  250  KQMPCKHIYHADCIMPWLDLHNSCPICRFELPTDDPDYEGRKKSNPQPTAGVDAGAASGS  309

Query  351  glggggNQENPQTPRTVERRFRVSLPWLFGGFGS  250
                   +E+ ++ R VERRF VSLPW F G GS
Sbjct  310  STAAEEREESGESARLVERRFNVSLPWPFSGLGS  343



>ref|XP_007152550.1| hypothetical protein PHAVU_004G139600g [Phaseolus vulgaris]
 gb|ESW24544.1| hypothetical protein PHAVU_004G139600g [Phaseolus vulgaris]
Length=359

 Score =   196 bits (498),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 109/150 (73%), Gaps = 2/150 (1%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LE+LIQ L ENDPNRYGTPPA+K+AVEGLPD+ +T+E+LASDSSQCAVCKD+FEL E AK
Sbjct  156  LEELIQHLAENDPNRYGTPPASKTAVEGLPDVSVTEELLASDSSQCAVCKDTFELGETAK  215

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENR--RNSQQPTRnnnnsfglgi  355
            QMPCKHIYH DCI+PWLE+HNSCPVCRYELPTDDPDYE R  R S        +     +
Sbjct  216  QMPCKHIYHADCILPWLEMHNSCPVCRYELPTDDPDYEQRAQRGSGGTGSGVASQVNWNL  275

Query  354  gglggggNQENPQTPRTVERRFRVSLPWLF  265
                GG    +     +  RRFRVS  W F
Sbjct  276  AVGPGGSADSSGGGDNSQRRRFRVSSLWPF  305



>ref|XP_008346897.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Malus domestica]
 ref|XP_008346898.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Malus domestica]
Length=381

 Score =   196 bits (499),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 104/174 (60%), Positives = 120/174 (69%), Gaps = 16/174 (9%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LEQLIQQL ENDPNRYGTPPA+KSA+E L  +KI++E+LASDSSQCAVCKDSFEL EEAK
Sbjct  177  LEQLIQQLAENDPNRYGTPPASKSAIEALLVVKISEELLASDSSQCAVCKDSFELGEEAK  236

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENR-----RNSQQPTRnnnnsfg  364
            QMPCKHIYH DCI+PWLELHN+CPVCR+ELPTDD +YE R      N  Q +++      
Sbjct  237  QMPCKHIYHSDCILPWLELHNTCPVCRHELPTDDSEYEQRIRGESGNGNQTSQSGALGGA  296

Query  363  lgigglggggNQENPQ-----------TPRTVERRFRVSLPWLFGGFGSPAETS  235
                G GG  +                +PRTVERRF +SLP  F   G  AETS
Sbjct  297  NISVGGGGSSSGFGFGIGAPSPDNQSPSPRTVERRFTISLPRFFRQLGGTAETS  350



>ref|XP_009383684.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Musa acuminata 
subsp. malaccensis]
Length=359

 Score =   195 bits (496),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 96/153 (63%), Positives = 111/153 (73%), Gaps = 2/153 (1%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LE+LIQQL ENDPNRYGTPPAAKSAVE LPDI+I+ E LASD +QCAVCKD+FE+ +EAK
Sbjct  166  LERLIQQLAENDPNRYGTPPAAKSAVESLPDIRISAESLASDEAQCAVCKDAFEMGDEAK  225

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigg  349
             MPCKHIYHKDCI+PWL LHNSCPVCRYELPTDD DYE RR +  P     +  G   G 
Sbjct  226  LMPCKHIYHKDCILPWLGLHNSCPVCRYELPTDDTDYEQRRGA--PAARTLSGVGNSGGS  283

Query  348  lggggNQENPQTPRTVERRFRVSLPWLFGGFGS  250
              G   + N      ++R F +SLPW F  F +
Sbjct  284  TAGASVEGNSPGSGMLQRSFSISLPWPFMPFAT  316



>gb|EAY78992.1| hypothetical protein OsI_34100 [Oryza sativa Indica Group]
Length=370

 Score =   195 bits (496),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 110/154 (71%), Gaps = 1/154 (1%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLAS-DSSQCAVCKDSFELDEEA  532
            LEQLI+QL ENDPNRYGTPPAAKSA+  LPD+ +T  M+A+ D ++CAVCK+ F   E A
Sbjct  190  LEQLIEQLAENDPNRYGTPPAAKSALSTLPDVIVTDAMVAAADGAECAVCKEDFSPGEGA  249

Query  531  KQMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgig  352
            KQMPCKH+YH DCIMPWL+LHNSCP+CR+ELPTDDPDYE R+ S        ++      
Sbjct  250  KQMPCKHMYHADCIMPWLDLHNSCPICRFELPTDDPDYEGRKKSNPQPTAGVDAGAASGS  309

Query  351  glggggNQENPQTPRTVERRFRVSLPWLFGGFGS  250
                   +E+ ++ R VERRF VSLPW F G GS
Sbjct  310  STAAEEREESGESARLVERRFNVSLPWPFSGLGS  343



>ref|XP_009355932.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Pyrus x bretschneideri]
 ref|XP_009355933.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Pyrus x bretschneideri]
Length=381

 Score =   196 bits (497),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 102/174 (59%), Positives = 118/174 (68%), Gaps = 16/174 (9%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LEQLIQQL ENDPNRYGTPPA+KSA++ L  +KI++++LASDSSQCAVCKDSFEL EEAK
Sbjct  177  LEQLIQQLAENDPNRYGTPPASKSAIDALLVVKISEDLLASDSSQCAVCKDSFELGEEAK  236

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENR----------------RNSQ  397
            QMPCKHIYH DCI+PWLELHN+CPVCR+ELPTDDP+YE R                R   
Sbjct  237  QMPCKHIYHSDCILPWLELHNTCPVCRHELPTDDPEYEQRIRVDSGNGNQTGQSGARGGA  296

Query  396  QPTRnnnnsfglgigglggggNQENPQTPRTVERRFRVSLPWLFGGFGSPAETS  235
              +     S      G+G         +PRTVERRF +SLP  F   G  AETS
Sbjct  297  NISMGGGGSSSGFGFGIGAPSPDNQSPSPRTVERRFTISLPRFFRPLGGTAETS  350



>ref|XP_006655672.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Oryza brachyantha]
Length=332

 Score =   194 bits (493),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 93/160 (58%), Positives = 114/160 (71%), Gaps = 12/160 (8%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDS-SQCAVCKDSFELDEEA  532
            LEQLIQQL ENDPNRYGTPPAAKSAV  LPD+ ++ +M+A+D  +QCAVC D F L  +A
Sbjct  150  LEQLIQQLAENDPNRYGTPPAAKSAVAALPDVAVSADMMAADGGAQCAVCMDDFHLGADA  209

Query  531  KQMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgig  352
            KQ+PCKH++HKDCI+PWL+LH+SCPVCR+ELPTDDPD+ +RR S QPT     +      
Sbjct  210  KQLPCKHVFHKDCILPWLDLHSSCPVCRFELPTDDPDHGHRRGSDQPTAAAAAAAAAAAA  269

Query  351  glggggNQENPQTPRTVERRFRVSLPW-LFGGFGSPAETS  235
                        +PR  ERRFR+SLPW L   FG  AE+S
Sbjct  270  T----------PSPRVAERRFRISLPWPLRAAFGGQAESS  299



>ref|NP_001152117.1| RHC1A [Zea mays]
 gb|ACG45859.1| RHC1A [Zea mays]
 tpg|DAA49548.1| TPA: putative RING zinc finger domain superfamily protein [Zea 
mays]
Length=375

 Score =   195 bits (495),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 97/156 (62%), Positives = 111/156 (71%), Gaps = 6/156 (4%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLAS-DSSQCAVCKDSFELDEEA  532
            LEQLI+QL ENDPNRYGTPPAAKSA+  LPD+ +T  M+A+ + ++CAVCK+ F   E A
Sbjct  192  LEQLIEQLAENDPNRYGTPPAAKSALSSLPDVVVTHTMVAAAEGAECAVCKEDFSPGEVA  251

Query  531  KQMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRR--NSQQPTRnnnnsfglg  358
            KQMPC HIYH DCIMPWLELHNSCP+CR+ELPTDDPDYE R+  NSQQ       + G  
Sbjct  252  KQMPCNHIYHTDCIMPWLELHNSCPICRFELPTDDPDYEVRKGSNSQQAVGIAAAASGSS  311

Query  357  igglggggNQENPQTPRTVERRFRVSLPWLFGGFGS  250
                G    QEN   PR VERRF VSLPW F G G 
Sbjct  312  TAAEGQMERQEN---PRVVERRFNVSLPWPFSGLGG  344



>gb|ACG33105.1| RHC1A [Zea mays]
Length=385

 Score =   192 bits (487),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 91/154 (59%), Positives = 109/154 (71%), Gaps = 1/154 (1%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLAS-DSSQCAVCKDSFELDEEA  532
            LEQLI+QL ENDPNRYGTPPAAKSA+  LPD+ +T  M+A+ + ++CAVCK+ F   E A
Sbjct  202  LEQLIEQLAENDPNRYGTPPAAKSALSSLPDVLVTHAMVAAAEGAECAVCKEDFSPGEVA  261

Query  531  KQMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgig  352
            KQMPCKHIYH DCI+PWLELHNSCP+CR+ELPTDDPDYE R+ +         +   G  
Sbjct  262  KQMPCKHIYHTDCIVPWLELHNSCPICRFELPTDDPDYEGRKGTNPQPAVGVAAAASGSS  321

Query  351  glggggNQENPQTPRTVERRFRVSLPWLFGGFGS  250
                G  +E  + PR VERRF VSLPW F G G 
Sbjct  322  TAAEGQMEERQENPRVVERRFNVSLPWPFSGLGG  355



>gb|KDP37541.1| hypothetical protein JCGZ_05980 [Jatropha curcas]
Length=311

 Score =   189 bits (481),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 94/149 (63%), Positives = 109/149 (73%), Gaps = 13/149 (9%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LEQLIQQL ENDPNRYGTPPA+KSA++ LP + IT+EML S+ +QCAVCKD FE   EAK
Sbjct  160  LEQLIQQLAENDPNRYGTPPASKSAIDALPTVNITEEMLNSELNQCAVCKDEFEKGAEAK  219

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigg  349
            QMPCKH+YH DCI+PWLELHNSCPVCRYELPTDD DYE R    + ++ +NN+ G     
Sbjct  220  QMPCKHVYHNDCIVPWLELHNSCPVCRYELPTDDSDYETRTRVARESQGSNNTEGSVGDN  279

Query  348  lggggNQENPQTPRTVERRFRVSLPWLFG  262
                         RTVERRF +SLPW FG
Sbjct  280  -------------RTVERRFSISLPWPFG  295



>ref|XP_004982780.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Setaria italica]
Length=393

 Score =   191 bits (484),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 94/158 (59%), Positives = 111/158 (70%), Gaps = 3/158 (2%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLAS-DSSQCAVCKDSFELDEEA  532
            LEQLI+QL ENDPNRYGTPPAAKSA+  LPD+ +T  M+A+ + ++CAVCK+ F   E A
Sbjct  207  LEQLIEQLAENDPNRYGTPPAAKSALSSLPDVVVTDAMVAAAEGAECAVCKEDFSPGEVA  266

Query  531  KQMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRR--NSQQPTRnnnnsfglg  358
            KQMPCKHIYH DCI+PWLELHNSCP+CR+ELPTDDPDYE R+  N Q P      +   G
Sbjct  267  KQMPCKHIYHNDCIVPWLELHNSCPICRFELPTDDPDYEGRKASNPQPPVGIAAAAAPSG  326

Query  357  igglggggNQENPQTPRTVERRFRVSLPWLFGGFGSPA  244
                  G  +E  +  R VERRF VSLPW F G G  A
Sbjct  327  SSTSAEGRMEEREENARVVERRFNVSLPWPFSGLGGQA  364



>ref|NP_001130953.1| uncharacterized LOC100192058 [Zea mays]
 gb|ACF79355.1| unknown [Zea mays]
 gb|AFW68526.1| putative RING zinc finger domain superfamily protein [Zea mays]
Length=385

 Score =   190 bits (483),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 108/154 (70%), Gaps = 1/154 (1%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLAS-DSSQCAVCKDSFELDEEA  532
            LEQLI+QL ENDPNRYGTPPAAKS +  LPD+ +T  M+A+ + ++CAVCK+ F   E A
Sbjct  202  LEQLIEQLAENDPNRYGTPPAAKSVLSSLPDVLVTHAMVAAAEGAECAVCKEDFSPGEVA  261

Query  531  KQMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgig  352
            KQMPCKHIYH DCI+PWLELHNSCP+CR+ELPTDDPDYE R+ +         +   G  
Sbjct  262  KQMPCKHIYHTDCIVPWLELHNSCPICRFELPTDDPDYEGRKGTNPQPAVGVAAAASGSS  321

Query  351  glggggNQENPQTPRTVERRFRVSLPWLFGGFGS  250
                G  +E  + PR VERRF VSLPW F G G 
Sbjct  322  TAAEGQMEERQENPRVVERRFNVSLPWPFSGLGG  355



>ref|XP_003534093.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoformX2 [Glycine 
max]
 ref|XP_006587425.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X3 
[Glycine max]
 ref|XP_006587426.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X4 
[Glycine max]
Length=376

 Score =   189 bits (481),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 102/171 (60%), Positives = 113/171 (66%), Gaps = 16/171 (9%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LE+LIQ L ENDPNRYGTPPA+KSAVEGLPD+ +T+E+LASDSSQCAVCKD+FEL E AK
Sbjct  159  LEELIQHLAENDPNRYGTPPASKSAVEGLPDVSVTEELLASDSSQCAVCKDTFELGETAK  218

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigg  349
            Q+PCKHIYH DCI+PWLELHNSCPVCRYELPTDDPDYE R        +  +  G G   
Sbjct  219  QIPCKHIYHADCILPWLELHNSCPVCRYELPTDDPDYEQRARRGGGGGSGGDGAGSGAAP  278

Query  348  lggggNQENPQTPRTV-------------ERRFRVSLPWLFGGFGSPAETS  235
                     P                    RRFRVSLPW F  F   AETS
Sbjct  279  QVNWNMALGPAGGSADSSGGGGSGGDSSQRRRFRVSLPWPFRQF---AETS  326



>ref|XP_007043255.1| RING/U-box superfamily protein, putative [Theobroma cacao]
 gb|EOX99086.1| RING/U-box superfamily protein, putative [Theobroma cacao]
Length=343

 Score =   187 bits (476),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 98/153 (64%), Positives = 112/153 (73%), Gaps = 4/153 (3%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LEQLIQQL ENDPNRYGTPPA+KSA++ LP +KIT+  L S+ +QCAVC D FE   +AK
Sbjct  179  LEQLIQQLAENDPNRYGTPPASKSAIDSLPSVKITKNHLNSEFNQCAVCMDEFEEGTQAK  238

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigg  349
            QMPCKH+YHKDCI+PWLELHNSCPVCR+ELPTDDPDYE R    Q T   N+  G G G 
Sbjct  239  QMPCKHLYHKDCILPWLELHNSCPVCRHELPTDDPDYERRVRGAQGTGGGNDGEGSGGGD  298

Query  348  lggggNQENPQTPRTVERRFRVSLPWLFGGFGS  250
             G     +N    RTVER FR+SLPW F   GS
Sbjct  299  SGQRSAGDN----RTVERSFRISLPWPFRARGS  327



>ref|XP_006661882.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Oryza brachyantha]
Length=363

 Score =   188 bits (477),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 93/155 (60%), Positives = 113/155 (73%), Gaps = 3/155 (2%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLAS-DSSQCAVCKDSFELDEEA  532
            LEQLI+QL ENDPNRYGTPPAAKSA+  LPD+ +T  M+A+ D ++CAVCK+ F   E A
Sbjct  179  LEQLIEQLAENDPNRYGTPPAAKSALSTLPDVIVTDAMVAATDGAECAVCKEDFSPGEGA  238

Query  531  KQMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQ-QPTRnnnnsfglgi  355
            KQMPCKHIYH +CIMPWLELHNSCP+CR+ELPTDDPDYE+RR S  QP          G 
Sbjct  239  KQMPCKHIYHSNCIMPWLELHNSCPICRFELPTDDPDYEDRRTSNPQPAVGMAAGAASGS  298

Query  354  gglggggNQENPQTPRTVERRFRVSLPWLFGGFGS  250
              +     +E+  + R+VE+RF +SLPW F  FGS
Sbjct  299  SAVAEERGEESGDSARSVEQRF-MSLPWPFNRFGS  332



>ref|XP_003549174.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Glycine max]
Length=369

 Score =   188 bits (477),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 100/166 (60%), Positives = 114/166 (69%), Gaps = 11/166 (7%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LE+LIQ L ENDPNRYGTPPA+KS VEGLPD+ +T+E+LASDSSQCAVCKD+FEL E AK
Sbjct  158  LEELIQHLAENDPNRYGTPPASKSVVEGLPDVSVTEELLASDSSQCAVCKDTFELGETAK  217

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsf------  367
            Q+PCKHIYH DCI+PWLELHNSCPVCRYELPTDDPDYE R                    
Sbjct  218  QIPCKHIYHADCILPWLELHNSCPVCRYELPTDDPDYEQRARRGGSGGGGAAGSGAAPQV  277

Query  366  --glgigglggggNQENPQTPRTVERRFRVSLPWLFGGFGSPAETS  235
               + +G  G   +  +     +  RRFRVSLPW F  F   AETS
Sbjct  278  NWNMALGSGGSADSSGSGGGDNSQRRRFRVSLPWPFRQF---AETS  320



>gb|KJB77384.1| hypothetical protein B456_012G134900 [Gossypium raimondii]
 gb|KJB77385.1| hypothetical protein B456_012G134900 [Gossypium raimondii]
 gb|KJB77386.1| hypothetical protein B456_012G134900 [Gossypium raimondii]
 gb|KJB77387.1| hypothetical protein B456_012G134900 [Gossypium raimondii]
Length=338

 Score =   187 bits (474),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 93/148 (63%), Positives = 105/148 (71%), Gaps = 9/148 (6%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LEQLIQQL ENDPNRYGTPPA+KSA+E LP + IT+  L S+ +QCAVC D FE   EAK
Sbjct  179  LEQLIQQLAENDPNRYGTPPASKSAIEALPSVNITKNNLNSEFNQCAVCMDDFEEGTEAK  238

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigg  349
            QMPCKH+YHKDC++PWLELHNSCPVCR+ELPTDDPDYE R    Q T           G 
Sbjct  239  QMPCKHLYHKDCLLPWLELHNSCPVCRHELPTDDPDYERRVRGAQGT---------SAGN  289

Query  348  lggggNQENPQTPRTVERRFRVSLPWLF  265
             G    Q +    RTVER FR+SLPW F
Sbjct  290  DGDNSGQRSDGDNRTVERSFRISLPWPF  317



>ref|XP_002467049.1| hypothetical protein SORBIDRAFT_01g018800 [Sorghum bicolor]
 gb|EER94047.1| hypothetical protein SORBIDRAFT_01g018800 [Sorghum bicolor]
Length=398

 Score =   188 bits (478),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 92/155 (59%), Positives = 108/155 (70%), Gaps = 4/155 (3%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLAS-DSSQCAVCKDSFELDEEA  532
            LEQLI+QL ENDPNRYGTPPAAKSA+  LPD+ +T  M+A+ + ++CAVCK+ F   E A
Sbjct  211  LEQLIEQLAENDPNRYGTPPAAKSALSSLPDVVVTHTMVAAAEGAECAVCKEDFSPGEVA  270

Query  531  KQMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQP---TRnnnnsfgl  361
            KQMPCKHIYH DCI+PWLELHNSCP+CR+ELPTDDPDYE R+ S  P         +   
Sbjct  271  KQMPCKHIYHTDCIVPWLELHNSCPICRFELPTDDPDYEGRKGSNPPQPAVGIAAAAAAS  330

Query  360  gigglggggNQENPQTPRTVERRFRVSLPWLFGGF  256
            G      G  +E    PR VERRF VSLPW F G 
Sbjct  331  GSSTAADGQMEERQDNPRVVERRFNVSLPWPFSGL  365



>ref|XP_011022020.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Populus euphratica]
 ref|XP_011022021.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Populus euphratica]
Length=291

 Score =   184 bits (468),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 89/153 (58%), Positives = 109/153 (71%), Gaps = 22/153 (14%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASD-SSQCAVCKDSFELDEEA  532
            LEQLIQQL ENDPNRYGTPPA+K+A+E LP +K+T+EM+ S+ ++QCAVCKD FE  EE 
Sbjct  156  LEQLIQQLAENDPNRYGTPPASKTAIEALPTMKVTEEMMKSEMNNQCAVCKDEFESGEEV  215

Query  531  KQMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgig  352
            K MPCKH++H+DCIMPWL++HNSCPVCRYELPTDDPDYENR    Q +            
Sbjct  216  KGMPCKHVFHEDCIMPWLKMHNSCPVCRYELPTDDPDYENRATGGQGSGG----------  265

Query  351  glggggNQENPQTPRTVERRFRVSLPWLFGGFG  253
                        +  +VERRF +S+PW FGG G
Sbjct  266  -----------GSGGSVERRFTISIPWAFGGGG  287



>sp|P0CH30.1|RING1_GOSHI RecName: Full=E3 ubiquitin-protein ligase RING1; AltName: Full=RING 
finger protein 1 [Gossypium hirsutum]
 gb|ADI58769.1| RING-type ubiquitin E3 ligase [Gossypium hirsutum]
Length=338

 Score =   185 bits (470),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 93/148 (63%), Positives = 105/148 (71%), Gaps = 9/148 (6%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LEQLIQQL ENDPNRYGTPPA+KSA+E LP + IT+  L S+ +QCAVC D FE   EAK
Sbjct  179  LEQLIQQLAENDPNRYGTPPASKSAIEALPLVNITKSNLNSEFNQCAVCMDDFEEGTEAK  238

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigg  349
            QMPCKH+YHKDC++PWLELHNSCPVCR+ELPTDDPDYE R    Q T           G 
Sbjct  239  QMPCKHLYHKDCLLPWLELHNSCPVCRHELPTDDPDYERRVRGAQGT---------SGGN  289

Query  348  lggggNQENPQTPRTVERRFRVSLPWLF  265
             G    Q +    RTVER FR+SLPW F
Sbjct  290  DGDNSGQRSDGDNRTVERSFRISLPWPF  317



>gb|KHG22497.1| E3 ubiquitin-protein ligase RING1 [Gossypium arboreum]
Length=338

 Score =   185 bits (470),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 93/148 (63%), Positives = 105/148 (71%), Gaps = 9/148 (6%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LEQLIQQL ENDPNRYGTPPA+KSA+E LP + IT+  L S+ +QCAVC D FE   EAK
Sbjct  179  LEQLIQQLAENDPNRYGTPPASKSAIEALPLVNITKSNLNSEFNQCAVCMDDFEEGTEAK  238

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigg  349
            QMPCKH+YHKDC++PWLELHNSCPVCR+ELPTDDPDYE R    Q T           G 
Sbjct  239  QMPCKHLYHKDCLLPWLELHNSCPVCRHELPTDDPDYERRVRGAQGT---------SGGN  289

Query  348  lggggNQENPQTPRTVERRFRVSLPWLF  265
             G    Q +    RTVER FR+SLPW F
Sbjct  290  DGDNSGQRSDGDNRTVERSFRISLPWPF  317



>gb|KJB49973.1| hypothetical protein B456_008G147900 [Gossypium raimondii]
 gb|KJB49974.1| hypothetical protein B456_008G147900 [Gossypium raimondii]
 gb|KJB49975.1| hypothetical protein B456_008G147900 [Gossypium raimondii]
 gb|KJB49976.1| hypothetical protein B456_008G147900 [Gossypium raimondii]
Length=331

 Score =   185 bits (470),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 94/153 (61%), Positives = 109/153 (71%), Gaps = 4/153 (3%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LEQLIQQL ENDPNRYGTPPA+KSA++ LP + I++  L+S+ +QCAVC D FE   EAK
Sbjct  167  LEQLIQQLAENDPNRYGTPPASKSAMDTLPSVNISKHNLSSEFNQCAVCMDEFEDGTEAK  226

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigg  349
            QMPCKH+YHKDCI PWLELHNSCPVCR+ELPTDDPDYE R    Q T   N+    G+  
Sbjct  227  QMPCKHLYHKDCIFPWLELHNSCPVCRHELPTDDPDYERRVRGAQGTGGGNDGSSSGLAD  286

Query  348  lggggNQENPQTPRTVERRFRVSLPWLFGGFGS  250
                   +N    RTVER FR+SLPW F   GS
Sbjct  287  NAQRSAGDN----RTVERSFRISLPWPFRARGS  315



>gb|KJB31865.1| hypothetical protein B456_005G211800 [Gossypium raimondii]
 gb|KJB31866.1| hypothetical protein B456_005G211800 [Gossypium raimondii]
 gb|KJB31867.1| hypothetical protein B456_005G211800 [Gossypium raimondii]
 gb|KJB31868.1| hypothetical protein B456_005G211800 [Gossypium raimondii]
 gb|KJB31869.1| hypothetical protein B456_005G211800 [Gossypium raimondii]
Length=332

 Score =   185 bits (469),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 109/148 (74%), Gaps = 6/148 (4%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LEQLIQQL ENDPNRYGTPPA+KSA++ LP +KIT++ L+S S+QCAVC D FE   +AK
Sbjct  170  LEQLIQQLAENDPNRYGTPPASKSAIDSLPSVKITKDHLSSKSNQCAVCMDDFEEGIQAK  229

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigg  349
            +MPC+H+YHKDCI+PWLELHNSCPVCR+ELPTDDPDYE R    Q T   N+    G  G
Sbjct  230  RMPCRHLYHKDCILPWLELHNSCPVCRHELPTDDPDYERRVRGAQGTNGGNDGADTGGSG  289

Query  348  lggggNQENPQTPRTVERRFRVSLPWLF  265
                G+ +      T ER FR+SLPW F
Sbjct  290  RRSAGDNQ------TAERSFRISLPWPF  311



>gb|EMS63398.1| E3 ubiquitin-protein ligase RING1 [Triticum urartu]
Length=228

 Score =   181 bits (460),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 91/155 (59%), Positives = 111/155 (72%), Gaps = 5/155 (3%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLAS-DSSQCAVCKDSFELDEEA  532
            LEQLI+QL ENDPNRYGTPPAAKSA+  LPD+ +T  M+A+ + ++CAVCK+ F   + A
Sbjct  40   LEQLIEQLAENDPNRYGTPPAAKSALTTLPDVVVTDAMVAAAEGAECAVCKEDFSPGDGA  99

Query  531  KQMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTRnn----nnsfg  364
            KQMPCKHIYH DCI+PWLELHNSCP+CR+ELPTDDPDYE  + S   +         +  
Sbjct  100  KQMPCKHIYHADCIVPWLELHNSCPICRFELPTDDPDYEGNKASNPQSAVGIAAAAAAAA  159

Query  363  lgigglggggNQENPQTPRTVERRFRVSLPWLFGG  259
             G  G    G +E+ +T R VERRF VSLPW FGG
Sbjct  160  SGSSGAAEEGGEESGETARVVERRFNVSLPWPFGG  194



>ref|XP_003574092.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Brachypodium 
distachyon]
Length=366

 Score =   185 bits (469),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 93/155 (60%), Positives = 111/155 (72%), Gaps = 2/155 (1%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLAS-DSSQCAVCKDSFELDEEA  532
            LEQLI+QL ENDPNRYGTPPAAKSA+  LPD+ +T  M+A+ + ++CAVCK+ F   E A
Sbjct  187  LEQLIEQLAENDPNRYGTPPAAKSALSTLPDVVVTDSMVAAAEGAECAVCKEDFSPGEGA  246

Query  531  KQMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQ-QPTRnnnnsfglgi  355
            KQMPCKHIYH  CI+PWLELHNSCP+CR+ELPTDDPDYE  + S  QP     ++   G 
Sbjct  247  KQMPCKHIYHDYCIVPWLELHNSCPICRFELPTDDPDYEGNKTSNPQPAVGIASAAASGN  306

Query  354  gglggggNQENPQTPRTVERRFRVSLPWLFGGFGS  250
                  G +E  +T R VERRF VSLPW FGG G 
Sbjct  307  SSAAEEGREETGETARVVERRFNVSLPWPFGGLGG  341



>gb|EYU35570.1| hypothetical protein MIMGU_mgv1a013774mg [Erythranthe guttata]
Length=211

 Score =   180 bits (457),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 91/152 (60%), Positives = 107/152 (70%), Gaps = 6/152 (4%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
             +QLI+QL +NDPNRYGTPPAAKSAVE LP I + + ++ SD +QCAVCKD FE+    K
Sbjct  46   FDQLIEQLADNDPNRYGTPPAAKSAVEALPSITVDEALMKSDLAQCAVCKDDFEMGTVVK  105

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigg  349
            QMPCKH+YH++CIMPWLELHNSCPVCRYELPTDDPDYE+  NS     +  N  G   G 
Sbjct  106  QMPCKHVYHEECIMPWLELHNSCPVCRYELPTDDPDYESGGNSGSGGVSRGNGAGGAGGQ  165

Query  348  lggggNQENPQTPRTVERRFRVSLPWLFGGFG  253
              G   +      R VERR  +SLPWLFG F 
Sbjct  166  AEGSDGE------RVVERRLTISLPWLFGEFA  191



>gb|EMT21882.1| RING finger protein 126 [Aegilops tauschii]
Length=336

 Score =   183 bits (465),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 91/153 (59%), Positives = 111/153 (73%), Gaps = 3/153 (2%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLAS-DSSQCAVCKDSFELDEEA  532
            LEQLI+QL ENDPNRYGTPPAA+SA+  LPD+ +T  M+A+ + ++CAVCK+ F   + A
Sbjct  150  LEQLIEQLAENDPNRYGTPPAAESALPTLPDVVVTDAMVAAAEGAECAVCKEDFSPGDGA  209

Query  531  KQMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRR--NSQQPTRnnnnsfglg  358
            KQMPCKHIYH DCI+PWLELHNSCP+CR+ELPTDDPDYE  +  N Q        +   G
Sbjct  210  KQMPCKHIYHADCIVPWLELHNSCPICRFELPTDDPDYEGNKASNPQSAVGIAAAAAASG  269

Query  357  igglggggNQENPQTPRTVERRFRVSLPWLFGG  259
              G    G +E+ +T R VERRF VSLPW FGG
Sbjct  270  SSGAAEEGGEESGETARVVERRFNVSLPWPFGG  302



>ref|XP_010533212.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Tarenaya hassleriana]
Length=322

 Score =   183 bits (464),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 90/148 (61%), Positives = 108/148 (73%), Gaps = 17/148 (11%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LEQLIQQL ENDPNRYGTPPA+KSA++ LP +K+T+EML S+ +QCAVC D FE   +AK
Sbjct  164  LEQLIQQLAENDPNRYGTPPASKSAIDALPTVKVTEEMLDSEMNQCAVCMDEFEKGSDAK  223

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigg  349
            QMPCKH+YH+DC++PWL+LHNSCPVCR+ELPTDDPDYENR +  Q               
Sbjct  224  QMPCKHVYHQDCLLPWLQLHNSCPVCRHELPTDDPDYENRTHGAQ-------------RS  270

Query  348  lggggNQENPQTPRTVERRFRVSLPWLF  265
              G G+ EN  TP    RRF +SLPW F
Sbjct  271  GDGQGSGENQPTP----RRFSISLPWPF  294



>gb|KJB79836.1| hypothetical protein B456_013G068800 [Gossypium raimondii]
Length=339

 Score =   183 bits (464),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 92/148 (62%), Positives = 105/148 (71%), Gaps = 6/148 (4%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LEQLIQQL ENDPNRYGTPPA+KSA++ LP +KI +  L S+ +QCAVC D FE   EAK
Sbjct  175  LEQLIQQLAENDPNRYGTPPASKSAIDALPSVKIAKNNLNSEFNQCAVCMDEFEEGAEAK  234

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigg  349
            QMPCKH+YHKDCI+PWLELHNSCPVCR+ELPTDDPDYE R    Q T   N+    G   
Sbjct  235  QMPCKHLYHKDCILPWLELHNSCPVCRHELPTDDPDYERRVRGAQATGGGNDGDSSGGDN  294

Query  348  lggggNQENPQTPRTVERRFRVSLPWLF  265
                G+       RT ER FR+SLPW F
Sbjct  295  EQRSGDN------RTAERSFRISLPWPF  316



>gb|KHG01857.1| E3 ubiquitin-protein ligase RING1 [Gossypium arboreum]
Length=331

 Score =   182 bits (463),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 108/148 (73%), Gaps = 6/148 (4%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LEQLIQQL ENDPNRYGTPPA+KSA++ LP +KIT++ L+S S+QCAV  D FE   +AK
Sbjct  169  LEQLIQQLAENDPNRYGTPPASKSAIDSLPSVKITKDHLSSKSNQCAVFMDDFEEGIQAK  228

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigg  349
            +MPC+H+YHKDCI+PWLELHNSCPVCR+ELPTDDPDYE R    Q T       G   G 
Sbjct  229  RMPCRHLYHKDCILPWLELHNSCPVCRHELPTDDPDYERRVRGAQGTN------GGNDGA  282

Query  348  lggggNQENPQTPRTVERRFRVSLPWLF  265
              GG  Q +    +T ER FR+SLPW F
Sbjct  283  DTGGSGQRSAGDNQTAERSFRISLPWPF  310



>ref|XP_009357359.1| PREDICTED: E3 ubiquitin-protein ligase RING1, partial [Pyrus 
x bretschneideri]
Length=304

 Score =   182 bits (461),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LEQLIQQL ENDPNRYGTPPA+KSA++ L  +KI++++LASDSSQCAVCKDSFEL EEAK
Sbjct  177  LEQLIQQLAENDPNRYGTPPASKSAIDALLVVKISEDLLASDSSQCAVCKDSFELGEEAK  236

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENR  409
            QMPCKHIYH DCI+PWLELHN+CPVCR+ELPTDDP+YE R
Sbjct  237  QMPCKHIYHSDCILPWLELHNTCPVCRHELPTDDPEYEQR  276



>ref|XP_003620140.1| RING finger protein [Medicago truncatula]
Length=238

 Score =   178 bits (452),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LE LIQQL ENDPNR GTPPA+KSAVE LP I++T E+L SDSSQCAVCKD+F L E+AK
Sbjct  54   LEDLIQQLAENDPNRRGTPPASKSAVEKLPVIEVTGELLESDSSQCAVCKDTFALGEKAK  113

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENR  409
            QMPCKHIYH DCI+PWLELHNSCPVCR+ELPTDDPDYE R
Sbjct  114  QMPCKHIYHDDCILPWLELHNSCPVCRFELPTDDPDYEQR  153



>gb|EPS73974.1| hypothetical protein M569_00782, partial [Genlisea aurea]
Length=296

 Score =   180 bits (456),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 86/153 (56%), Positives = 104/153 (68%), Gaps = 12/153 (8%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
             EQLIQQL ENDPNRYGTPPA+KSAV+ LP++K+ +E+L S+ +QCAVCKD+FELD   K
Sbjct  147  FEQLIQQLAENDPNRYGTPPASKSAVQALPNVKVDEELLKSELAQCAVCKDAFELDTVVK  206

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigg  349
            QMPCKH+YH+DCI PWLELHNSCPVCRYELPTDD   +                      
Sbjct  207  QMPCKHVYHQDCIFPWLELHNSCPVCRYELPTDDAADDRDNRGNS------------SRT  254

Query  348  lggggNQENPQTPRTVERRFRVSLPWLFGGFGS  250
                  ++     R V+RRF ++LPWLFGG GS
Sbjct  255  ETSSQAEDGDDRQRVVQRRFTITLPWLFGGLGS  287



>ref|XP_003557291.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Brachypodium 
distachyon]
Length=338

 Score =   181 bits (459),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 87/160 (54%), Positives = 108/160 (68%), Gaps = 7/160 (4%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDS-SQCAVCKDSFELDEEA  532
            LEQLIQQL ENDPNRYGTPPAAKSAV  LPD+ ++  M+A+D  +QCAVC D FEL   A
Sbjct  158  LEQLIQQLAENDPNRYGTPPAAKSAVAALPDVAVSATMMAADGGAQCAVCMDDFELGASA  217

Query  531  KQMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgig  352
            KQ+PCKH++HKDCI+PWL+LH+SCPVCR+ELPTD+PD++ R+  Q+              
Sbjct  218  KQLPCKHVFHKDCILPWLDLHSSCPVCRHELPTDEPDHDRRQGDQRAAA-----ASAAAA  272

Query  351  glggggNQENPQTPRTVERRFRVSLPW-LFGGFGSPAETS  235
                        +PR  ERRFR+SLPW L    G   E+S
Sbjct  273  AAAAAEASPGTPSPRVAERRFRISLPWPLRAALGGQVESS  312



>ref|XP_010508254.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Camelina sativa]
Length=333

 Score =   180 bits (457),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 87/148 (59%), Positives = 104/148 (70%), Gaps = 17/148 (11%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LEQLIQQL ENDPNRYGTPPA+KSA++ LP +K+T++ML S+ +QCAVC D FE     K
Sbjct  174  LEQLIQQLAENDPNRYGTPPASKSAIDALPTVKVTKDMLKSEMNQCAVCMDEFEDGSGVK  233

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigg  349
            QMPCKH++H+DC++PWLELHNSCPVCRYELPTDDPDYENR    Q + +   S       
Sbjct  234  QMPCKHVFHQDCLLPWLELHNSCPVCRYELPTDDPDYENRAQGVQASGDGQGSV------  287

Query  348  lggggNQENPQTPRTVERRFRVSLPWLF  265
                   E  QTP    RRF + LPW F
Sbjct  288  -------EGQQTP----RRFNIQLPWPF  304



>ref|XP_010466163.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Camelina sativa]
Length=336

 Score =   180 bits (457),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 87/148 (59%), Positives = 104/148 (70%), Gaps = 17/148 (11%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LEQLIQQL ENDPNRYGTPPA+KSA++ LP +K+T++ML S+ +QCAVC D FE     K
Sbjct  174  LEQLIQQLAENDPNRYGTPPASKSAIDALPTVKVTKDMLKSEMNQCAVCMDEFEDGSGVK  233

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigg  349
            QMPCKH++H+DC++PWLELHNSCPVCRYELPTDDPDYENR    Q + +   S       
Sbjct  234  QMPCKHVFHQDCLLPWLELHNSCPVCRYELPTDDPDYENRAQGVQASGDGQGSV------  287

Query  348  lggggNQENPQTPRTVERRFRVSLPWLF  265
                   E  QTP    RRF + LPW F
Sbjct  288  -------EGQQTP----RRFNIQLPWPF  304



>ref|XP_010487953.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Camelina sativa]
Length=332

 Score =   180 bits (457),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 87/148 (59%), Positives = 104/148 (70%), Gaps = 17/148 (11%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LEQLIQQL ENDPNRYGTPPA+KSA++ LP +K+T++ML S+ +QCAVC D FE     K
Sbjct  170  LEQLIQQLAENDPNRYGTPPASKSAIDALPTVKVTKDMLKSEMNQCAVCMDEFEDGSGVK  229

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigg  349
            QMPCKH++H+DC++PWLELHNSCPVCRYELPTDDPDYENR    Q + +   S       
Sbjct  230  QMPCKHVFHQDCLLPWLELHNSCPVCRYELPTDDPDYENRAQGVQGSGDGQGSV------  283

Query  348  lggggNQENPQTPRTVERRFRVSLPWLF  265
                   E  QTP    RRF + LPW F
Sbjct  284  -------EGQQTP----RRFNIQLPWPF  300



>emb|CDP18533.1| unnamed protein product [Coffea canephora]
Length=319

 Score =   180 bits (456),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 95/160 (59%), Positives = 110/160 (69%), Gaps = 12/160 (8%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
             EQLIQQL ENDPNRYGTPPA+K+AV+GLPD+K+ + M+ S+ +QCAVCKD FEL    K
Sbjct  156  FEQLIQQLAENDPNRYGTPPASKTAVKGLPDVKVDEGMMKSELAQCAVCKDDFELGVLVK  215

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigg  349
            QMPCKH+YHKDCI+PWLELHNSCPVCRYELPTDDPDYE+R  S                 
Sbjct  216  QMPCKHVYHKDCILPWLELHNSCPVCRYELPTDDPDYESRERSGSGDS--------NASS  267

Query  348  lggggNQENPQTPRTVERRFRVSLPW--LFGGFGSPAETS  235
             G G +  N Q  R VER   ++LPW  L G FGS   T 
Sbjct  268  SGSGSSGGNSQGQRRVER--VLTLPWSLLLGAFGSTGHTG  305



>ref|XP_011070454.1| PREDICTED: E3 ubiquitin-protein ligase RING1 [Sesamum indicum]
 ref|XP_011070455.1| PREDICTED: E3 ubiquitin-protein ligase RING1 [Sesamum indicum]
 ref|XP_011070456.1| PREDICTED: E3 ubiquitin-protein ligase RING1 [Sesamum indicum]
Length=330

 Score =   180 bits (456),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 87/147 (59%), Positives = 104/147 (71%), Gaps = 4/147 (3%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
             EQLIQQL ENDPNRYGTPPA+KSAV+ LP I + + +L SD +QCAVC D FE+    K
Sbjct  163  FEQLIQQLAENDPNRYGTPPASKSAVDALPGINVDEALLKSDLAQCAVCMDDFEMGTVVK  222

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigg  349
            QMPCKH+YH+DCI+PWLELHNSCPVCRYELPTDDPDYE++ NS +   +  N        
Sbjct  223  QMPCKHVYHQDCILPWLELHNSCPVCRYELPTDDPDYESKGNSGRSGVSQRNDGYNNGND  282

Query  348  lggggNQENPQTPRTVERRFRVSLPWL  268
               G +       RTVERRF ++LP L
Sbjct  283  DLAGSSDGR----RTVERRFTITLPGL  305



>ref|XP_009145710.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Brassica rapa]
Length=327

 Score =   179 bits (454),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/148 (59%), Positives = 106/148 (72%), Gaps = 21/148 (14%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LEQLIQQL ENDPNRYGTPPA+KSA+EGLP +K++++ML S+ +QCAVC D FE   + K
Sbjct  162  LEQLIQQLAENDPNRYGTPPASKSAIEGLPTVKVSKDMLKSEMNQCAVCMDEFEDGGDVK  221

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigg  349
            Q+PCKH++H+DC+MPWLELHNSCPVCRYELPTDDPDYE+R   Q                
Sbjct  222  QVPCKHVFHQDCLMPWLELHNSCPVCRYELPTDDPDYESRSQGQ----------------  265

Query  348  lggggNQENPQTPRTVERRFRVSLPWLF  265
             GG  + +  QTPR+    F V LPW F
Sbjct  266  -GGQTSGDGGQTPRS----FSVQLPWTF  288



>ref|XP_010541863.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X2 
[Tarenaya hassleriana]
 ref|XP_010541864.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X2 
[Tarenaya hassleriana]
 ref|XP_010541865.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X2 
[Tarenaya hassleriana]
 ref|XP_010541866.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X2 
[Tarenaya hassleriana]
 ref|XP_010541867.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X2 
[Tarenaya hassleriana]
 ref|XP_010541868.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X2 
[Tarenaya hassleriana]
 ref|XP_010541869.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X2 
[Tarenaya hassleriana]
 ref|XP_010541870.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X2 
[Tarenaya hassleriana]
 ref|XP_010541871.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X2 
[Tarenaya hassleriana]
Length=326

 Score =   179 bits (453),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 87/148 (59%), Positives = 105/148 (71%), Gaps = 17/148 (11%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LEQLIQQL ENDPNRYGTPPA+KSA++ LP +K+T+++L S+ +QCAVC D FE   +AK
Sbjct  163  LEQLIQQLAENDPNRYGTPPASKSAIDALPTVKVTEDLLNSEMNQCAVCMDEFEKGSDAK  222

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigg  349
            QMPCKH+YH+ C++PWL+LHNSCPVCRYELPTDDPDYEN  +  Q               
Sbjct  223  QMPCKHVYHQHCLLPWLQLHNSCPVCRYELPTDDPDYENMNHGAQ-------------RS  269

Query  348  lggggNQENPQTPRTVERRFRVSLPWLF  265
              G G  EN  TP    RRF +SLPW F
Sbjct  270  GDGQGTGENQTTP----RRFSISLPWPF  293



>ref|XP_003620252.1| RING finger protein [Medicago truncatula]
Length=340

 Score =   179 bits (453),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LE LIQQL ENDPNR GTPPA+KSAVE LP I++T E+L SDSSQCAVCKD+F L E+AK
Sbjct  156  LEDLIQQLAENDPNRRGTPPASKSAVEKLPVIEVTGELLESDSSQCAVCKDTFALGEKAK  215

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENR  409
            QMPCKHIYH DCI+PWLELHNSCPVCR+ELPTDDPDYE R
Sbjct  216  QMPCKHIYHDDCILPWLELHNSCPVCRFELPTDDPDYEQR  255



>ref|XP_002883213.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59472.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=330

 Score =   178 bits (452),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/148 (57%), Positives = 105/148 (71%), Gaps = 18/148 (12%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LEQLIQQL ENDPNRYGTPPA+KSA++GLP +K+T++ML S+ +QCAVC D FE   + K
Sbjct  173  LEQLIQQLAENDPNRYGTPPASKSAIDGLPTVKVTKDMLKSEMNQCAVCMDEFEDGSDVK  232

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigg  349
            QMPCKH++H+DC++PWL+LHNSCPVCR+ELPTDDPDYENR    Q + +   S       
Sbjct  233  QMPCKHVFHQDCLLPWLQLHNSCPVCRFELPTDDPDYENRTQGIQASGDGQGSV------  286

Query  348  lggggNQENPQTPRTVERRFRVSLPWLF  265
                   E  QTP     RF + LPW F
Sbjct  287  -------EGQQTP-----RFSIQLPWPF  302



>ref|XP_009588217.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Nicotiana 
tomentosiformis]
Length=314

 Score =   177 bits (450),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
             E+LIQQL ENDPNRYGTPPA+KSAVEGLP IK+ +E+L S+ +QCAVCKD FEL  + K
Sbjct  155  FEELIQQLAENDPNRYGTPPASKSAVEGLPSIKVNEELLKSELAQCAVCKDDFELGLDVK  214

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENR  409
            Q+PCKH+YH+ CI+PWLELHNSCPVCRYELPTDDPDYENR
Sbjct  215  QLPCKHVYHEGCILPWLELHNSCPVCRYELPTDDPDYENR  254



>ref|XP_008355430.1| PREDICTED: uncharacterized protein LOC103419088 [Malus domestica]
Length=531

 Score =   182 bits (461),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 98/176 (56%), Positives = 114/176 (65%), Gaps = 18/176 (10%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LEQLIQQL ENDPNRYGTPPA+KS +E L  +KI+ E+LASDSSQ AVCKD FEL EEAK
Sbjct  325  LEQLIQQLAENDPNRYGTPPASKSTIEALLVVKISDELLASDSSQYAVCKDLFELGEEAK  384

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENR-----RNSQQPTRnnnnsfg  364
            QMPCKHIYH DCI+PWLELHN+C VCR+ELPTDD +Y+ R      N  Q +++      
Sbjct  385  QMPCKHIYHSDCILPWLELHNTCLVCRHELPTDDSEYKQRIHGDSGNGNQTSQSGAPGEA  444

Query  363  lgigglgggg-------------NQENPQTPRTVERRFRVSLPWLFGGFGSPAETS  235
                G  G               NQ    +PRTVERRF +SLP      G  A+TS
Sbjct  445  NISMGGSGSSSGFGFGIGAPSPYNQSQSPSPRTVERRFTISLPRFVRQLGGTAKTS  500



>gb|AES76470.2| zinc finger, C3HC4 type (RING finger) protein [Medicago truncatula]
Length=374

 Score =   178 bits (452),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LE LIQQL ENDPNR GTPPA+KSAVE LP I++T E+L SDSSQCAVCKD+F L E+AK
Sbjct  190  LEDLIQQLAENDPNRRGTPPASKSAVEKLPVIEVTGELLESDSSQCAVCKDTFALGEKAK  249

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENR  409
            QMPCKHIYH DCI+PWLELHNSCPVCR+ELPTDDPDYE R
Sbjct  250  QMPCKHIYHDDCILPWLELHNSCPVCRFELPTDDPDYEQR  289



>emb|CDX82271.1| BnaA03g35500D [Brassica napus]
Length=213

 Score =   174 bits (440),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 75/104 (72%), Positives = 91/104 (88%), Gaps = 0/104 (0%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LEQLIQQL ENDPNRYGTPPA+KSAV+GLP +K+T++M+ S+ +QCAVC D FE   + K
Sbjct  59   LEQLIQQLAENDPNRYGTPPASKSAVDGLPSVKVTKDMVRSEMNQCAVCMDEFEDGGDVK  118

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQ  397
            QMPCKH++H+DC+MPWLELHNSCPVCRYELPTDDP+YE+R   Q
Sbjct  119  QMPCKHVFHQDCLMPWLELHNSCPVCRYELPTDDPEYESRGQGQ  162



>ref|XP_010557559.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Tarenaya hassleriana]
Length=333

 Score =   177 bits (448),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 88/148 (59%), Positives = 105/148 (71%), Gaps = 17/148 (11%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LEQLIQQL ENDP+RYGTPPA+KSA++ LP +K+T++ML SD +QCAVC D FE    AK
Sbjct  169  LEQLIQQLAENDPHRYGTPPASKSAIDALPTVKVTEDMLNSDMNQCAVCMDEFEKGSAAK  228

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigg  349
            QMPCKH YH+DC++PWL+LHNSCPVCRYELPTDDPDYE R +  Q + +   S G     
Sbjct  229  QMPCKHAYHQDCLLPWLQLHNSCPVCRYELPTDDPDYETRTHGAQESGDGQGSGG-----  283

Query  348  lggggNQENPQTPRTVERRFRVSLPWLF  265
                    N  TP    RRF +SLPW F
Sbjct  284  --------NQPTP----RRFSISLPWPF  299



>ref|XP_004515274.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X1 
[Cicer arietinum]
 ref|XP_004515275.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X2 
[Cicer arietinum]
 ref|XP_004515276.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X3 
[Cicer arietinum]
Length=349

 Score =   177 bits (448),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 90/148 (61%), Positives = 101/148 (68%), Gaps = 17/148 (11%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LE LIQQL ENDP+R GTPPA+KSAVE LP I +T+E+L SDS+QCAVCKD+F L E+AK
Sbjct  167  LEDLIQQLAENDPSRRGTPPASKSAVEKLPVISVTEELLESDSAQCAVCKDTFALGEKAK  226

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigg  349
            QMPCKHIYH DCI+PWLELHNSCPVCRYELPTDD DYE R                    
Sbjct  227  QMPCKHIYHTDCILPWLELHNSCPVCRYELPTDDADYEQRARGDG---------------  271

Query  348  lggggNQENPQTPRTVERRFRVSLPWLF  265
               GG         +  RRFR+SLPW F
Sbjct  272  --VGGGPGGGGVDDSQTRRFRMSLPWPF  297



>emb|CDY24592.1| BnaC05g32760D [Brassica napus]
Length=321

 Score =   176 bits (446),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LEQLIQQL ENDPNRYGTPPA+KSA+EGLP +K++++ML S+ +QCAVC D FE   + K
Sbjct  162  LEQLIQQLAENDPNRYGTPPASKSAIEGLPTVKVSKDMLKSEMNQCAVCMDEFEDGGDVK  221

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENR  409
            QMPCKH++H+DC+MPWLELHNSCPVCRYELPTDDPDYENR
Sbjct  222  QMPCKHVFHQDCLMPWLELHNSCPVCRYELPTDDPDYENR  261



>ref|XP_002307159.2| hypothetical protein POPTR_0005s09270g [Populus trichocarpa]
 gb|EEE94155.2| hypothetical protein POPTR_0005s09270g [Populus trichocarpa]
Length=290

 Score =   175 bits (443),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/147 (57%), Positives = 102/147 (69%), Gaps = 26/147 (18%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASD-SSQCAVCKDSFELDEEA  532
            LEQLIQQL ENDPNRYGTPPA+K+A+E LP +K+T+EM+ S+ ++QCAVCKD FE  EE 
Sbjct  159  LEQLIQQLAENDPNRYGTPPASKTAIEALPTMKVTEEMMKSEMNNQCAVCKDEFESGEEV  218

Query  531  KQMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgig  352
            K MPCKH++H+DCIMPWL++HNSCPVCRYELP DDPDYENR    Q              
Sbjct  219  KGMPCKHVFHEDCIMPWLKMHNSCPVCRYELPADDPDYENRATGGQ--------------  264

Query  351  glggggNQENPQTPRTVERRFRVSLPW  271
                        +   VERRF +S+PW
Sbjct  265  -----------GSGGGVERRFTISIPW  280



>ref|XP_009788594.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X1 
[Nicotiana sylvestris]
 ref|XP_009788595.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X2 
[Nicotiana sylvestris]
 ref|XP_009788596.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X1 
[Nicotiana sylvestris]
Length=311

 Score =   175 bits (444),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
             E+LIQQL ENDPNRYGTPPA+KSAVEGLP IK+ +E+L S+ +QCAVCKD FEL  + K
Sbjct  153  FEELIQQLAENDPNRYGTPPASKSAVEGLPSIKVNEELLKSELAQCAVCKDDFELGLDVK  212

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENR  409
            Q+PCKH+YH+ CI+PWLELHNSCPVCRY+LPTDDPDYENR
Sbjct  213  QLPCKHVYHEGCILPWLELHNSCPVCRYKLPTDDPDYENR  252



>ref|XP_009401852.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Musa acuminata 
subsp. malaccensis]
Length=303

 Score =   175 bits (443),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 76/101 (75%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            L+QLIQ+L ENDPN+YGTPPA+K+AVE LPD+KIT+ +LASD +QC+VC D FE+D  AK
Sbjct  157  LDQLIQRLSENDPNQYGTPPASKAAVESLPDVKITEGLLASDEAQCSVCMDLFEMDAVAK  216

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRR  406
            QMPC H+YHK+CI+PWLELHNSCPVCRYELPTDDPDYE  R
Sbjct  217  QMPCNHVYHKECILPWLELHNSCPVCRYELPTDDPDYERHR  257



>ref|XP_002437660.1| hypothetical protein SORBIDRAFT_10g000250 [Sorghum bicolor]
 gb|EER89027.1| hypothetical protein SORBIDRAFT_10g000250 [Sorghum bicolor]
Length=321

 Score =   174 bits (442),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 88/161 (55%), Positives = 107/161 (66%), Gaps = 15/161 (9%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDS-SQCAVCKDSFELDEEA  532
            LEQLIQQL ENDPNRYGTPPAAKSAV  LPD+ ++ +M+ +D  +QCAVC D F L   A
Sbjct  138  LEQLIQQLAENDPNRYGTPPAAKSAVASLPDVAVSADMMQADGGAQCAVCMDDFHLGAAA  197

Query  531  KQMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgig  352
            KQ+PCKH++HKDCI+PWL+LH+SCPVCR+ELPTDDPDY +    Q               
Sbjct  198  KQLPCKHVFHKDCILPWLDLHSSCPVCRFELPTDDPDYNHTHQQQHAAS-----------  246

Query  351  glggggNQENPQTPRTVERRFRVSLPW-LFGGFGSP-AETS  235
                        +PR  ERRFR+SLPW L   FG+  AE+S
Sbjct  247  -PAPAPAPAASSSPRVAERRFRISLPWPLRAAFGAAQAESS  286



>emb|CDY36069.1| BnaC03g41290D [Brassica napus]
Length=217

 Score =   171 bits (433),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 74/100 (74%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LEQLIQQL ENDPNRYGTPPA+KSAV+GLP +K+T++ML S+ +QCAVC D FE   + K
Sbjct  59   LEQLIQQLAENDPNRYGTPPASKSAVDGLPTVKVTKDMLRSEMNQCAVCMDEFEDGGDVK  118

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENR  409
            QMPCKH++H+DC+MPWLELHNSCPVCR+ELPTDDP+YE+R
Sbjct  119  QMPCKHVFHQDCLMPWLELHNSCPVCRFELPTDDPEYESR  158



>emb|CDY25360.1| BnaA05g19240D [Brassica napus]
Length=323

 Score =   174 bits (441),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 75/100 (75%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LEQLIQQL ENDPNRYGTPPA+KSA+EGLP +K++++ML S+ +QCAVC D FE   + K
Sbjct  161  LEQLIQQLAENDPNRYGTPPASKSAIEGLPTVKVSKDMLKSEMNQCAVCMDEFEDGGDVK  220

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENR  409
            QMPCKH++H+DC+MPWLELHNSCPVCRYELPTDDPDYE+R
Sbjct  221  QMPCKHVFHQDCLMPWLELHNSCPVCRYELPTDDPDYESR  260



>ref|NP_188629.1| E3 ubiquitin-protein ligase RING1-like protein [Arabidopsis thaliana]
 sp|Q8LPN7.1|RNG1L_ARATH RecName: Full=E3 ubiquitin-protein ligase RING1-like; AltName: 
Full=RING finger protein 1 [Arabidopsis thaliana]
 gb|AAM19951.1| AT3g19950/MPN9_19 [Arabidopsis thaliana]
 gb|AAN18152.1| At3g19950/MPN9_19 [Arabidopsis thaliana]
 gb|AEE76311.1| E3 ubiquitin-protein ligase RING1-like protein [Arabidopsis thaliana]
Length=328

 Score =   174 bits (440),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 85/148 (57%), Positives = 104/148 (70%), Gaps = 18/148 (12%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LEQLIQQL ENDPNRYGTPPA+KSA++ LP +K+T++ML S+ +QCAVC D FE   + K
Sbjct  171  LEQLIQQLAENDPNRYGTPPASKSAIDALPTVKVTKDMLKSEMNQCAVCMDEFEDGSDVK  230

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigg  349
            QMPCKH++H+DC++PWLELHNSCPVCR+ELPTDDPDYENR    Q + +   S       
Sbjct  231  QMPCKHVFHQDCLLPWLELHNSCPVCRFELPTDDPDYENRSQGSQGSGDGQGSV------  284

Query  348  lggggNQENPQTPRTVERRFRVSLPWLF  265
                   E  QTP     RF + LPW F
Sbjct  285  -------EGQQTP-----RFSIQLPWPF  300



>ref|NP_001056529.1| Os06g0101300 [Oryza sativa Japonica Group]
 dbj|BAD69377.1| putative ring finger protein 126 isoform 1 [Oryza sativa Japonica 
Group]
 dbj|BAD67937.1| putative ring finger protein 126 isoform 1 [Oryza sativa Japonica 
Group]
 dbj|BAF18443.1| Os06g0101300 [Oryza sativa Japonica Group]
 gb|EAZ35517.1| hypothetical protein OsJ_19796 [Oryza sativa Japonica Group]
 dbj|BAH00711.1| unnamed protein product [Oryza sativa Japonica Group]
Length=338

 Score =   174 bits (440),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 87/160 (54%), Positives = 106/160 (66%), Gaps = 12/160 (8%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDS-SQCAVCKDSFELDEEA  532
            LEQLIQQL ENDPNRYGTPPAAKSAV  LPD+ ++ +M+A+D  +QCAVC D F L   A
Sbjct  156  LEQLIQQLAENDPNRYGTPPAAKSAVAALPDVAVSADMMAADGGAQCAVCMDDFHLGAAA  215

Query  531  KQMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgig  352
            KQ+PCKH++HKDCI+PWL+LH+SCPVCR+ELPTDDP +        PT  ++        
Sbjct  216  KQLPCKHVFHKDCILPWLDLHSSCPVCRFELPTDDPHHA------HPTLGSHRPAAPASA  269

Query  351  glggggNQENPQTPRTVERRFRVSLPW-LFGGFGSPAETS  235
                          R  ERRFR+SLPW L   FG  AE+S
Sbjct  270  SASPSPAPPP----RLAERRFRISLPWPLRAAFGGQAESS  305



>dbj|BAB01310.1| unnamed protein product [Arabidopsis thaliana]
Length=386

 Score =   175 bits (443),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 85/148 (57%), Positives = 104/148 (70%), Gaps = 18/148 (12%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LEQLIQQL ENDPNRYGTPPA+KSA++ LP +K+T++ML S+ +QCAVC D FE   + K
Sbjct  229  LEQLIQQLAENDPNRYGTPPASKSAIDALPTVKVTKDMLKSEMNQCAVCMDEFEDGSDVK  288

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigg  349
            QMPCKH++H+DC++PWLELHNSCPVCR+ELPTDDPDYENR    Q + +   S       
Sbjct  289  QMPCKHVFHQDCLLPWLELHNSCPVCRFELPTDDPDYENRSQGSQGSGDGQGSV------  342

Query  348  lggggNQENPQTPRTVERRFRVSLPWLF  265
                   E  QTP     RF + LPW F
Sbjct  343  -------EGQQTP-----RFSIQLPWPF  358



>ref|XP_006297993.1| hypothetical protein CARUB_v10014036mg, partial [Capsella rubella]
 gb|EOA30891.1| hypothetical protein CARUB_v10014036mg, partial [Capsella rubella]
Length=361

 Score =   174 bits (441),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 84/148 (57%), Positives = 105/148 (71%), Gaps = 17/148 (11%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LEQLIQQL ENDPNRYGTPPA+KSA++ LP +K+T++ML S+ +QCAVC D FE   + K
Sbjct  199  LEQLIQQLAENDPNRYGTPPASKSAIDALPTVKVTKDMLKSEMNQCAVCMDEFEDGSDVK  258

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigg  349
            QMPCKH++H+DC++PWL+LHNSCPVCR+EL TDDPDYE+R    Q +             
Sbjct  259  QMPCKHVFHQDCLLPWLQLHNSCPVCRFELSTDDPDYEHRAQGIQAS-------------  305

Query  348  lggggNQENPQTPRTVERRFRVSLPWLF  265
              G G+ E  QTP    RRF + LPW F
Sbjct  306  GDGQGSSEGQQTP----RRFSIQLPWPF  329



>emb|CDY72364.1| BnaAnng40830D, partial [Brassica napus]
Length=222

 Score =   170 bits (431),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 74/100 (74%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LEQLIQQL ENDPNRYGTPPA+KSA++ LP +K+T +ML S+ +QCAVC D FE   + K
Sbjct  62   LEQLIQQLAENDPNRYGTPPASKSAIDALPTVKVTLDMLNSEMNQCAVCMDEFEDGGDVK  121

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENR  409
            QMPCKH++H+DC+MPWLELHNSCPVCRYELPTDDPDYE+R
Sbjct  122  QMPCKHVFHQDCLMPWLELHNSCPVCRYELPTDDPDYESR  161



>ref|XP_006406436.1| hypothetical protein EUTSA_v10021059mg [Eutrema salsugineum]
 gb|ESQ47889.1| hypothetical protein EUTSA_v10021059mg [Eutrema salsugineum]
Length=345

 Score =   173 bits (439),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 84/148 (57%), Positives = 105/148 (71%), Gaps = 15/148 (10%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LEQLIQQL ENDPNRYGTPPA+KSA++ LP +K+T++ML S+ +QCAVC D FE   + K
Sbjct  176  LEQLIQQLAENDPNRYGTPPASKSAIDALPTVKVTKDMLKSEMNQCAVCMDEFEDGSDVK  235

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigg  349
            QMPCKH++H+DC++PWL+LHNSCPVCRYELPTDDPDYENR   Q    + +    +    
Sbjct  236  QMPCKHVFHQDCLLPWLQLHNSCPVCRYELPTDDPDYENRAQGQGGQSSGDGQGSV----  291

Query  348  lggggNQENPQTPRTVERRFRVSLPWLF  265
                   E  QTPR+    F + LPW F
Sbjct  292  -------EGQQTPRS----FSIQLPWPF  308



>ref|XP_009135656.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Brassica rapa]
Length=302

 Score =   172 bits (435),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 74/100 (74%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LEQLIQQL ENDPNRYGTPPA+KSAV+GLP +K+T++M+ S+ +QCAVC D FE   + K
Sbjct  147  LEQLIQQLAENDPNRYGTPPASKSAVDGLPSVKVTKDMVRSEMNQCAVCMDEFEDGGDVK  206

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENR  409
            QMPCKH++H+DC+MPWLELHNSCPVCRYELPTDDP+YE+R
Sbjct  207  QMPCKHVFHQDCLMPWLELHNSCPVCRYELPTDDPEYESR  246



>ref|XP_006847820.1| hypothetical protein AMTR_s00029p00043520 [Amborella trichopoda]
 gb|ERN09401.1| hypothetical protein AMTR_s00029p00043520 [Amborella trichopoda]
Length=366

 Score =   173 bits (439),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 86/152 (57%), Positives = 104/152 (68%), Gaps = 6/152 (4%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LEQLIQ L ENDPNRYGTPPA++SA++ LP+++++ E+L SD+SQCAVCKD+FE    AK
Sbjct  149  LEQLIQHLAENDPNRYGTPPASESAIDSLPEVRVSSELLNSDTSQCAVCKDAFEEGSFAK  208

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRR------NSQQPTRnnnnsf  367
            Q+PCKHIYH DCI+PWLELHNSCPVCRYELPTDD DYE R       N  +  RN     
Sbjct  209  QLPCKHIYHGDCILPWLELHNSCPVCRYELPTDDQDYERRNQGEGRPNQGEGRRNPAGQP  268

Query  366  glgigglggggNQENPQTPRTVERRFRVSLPW  271
              G     G          +   RRFR+S+PW
Sbjct  269  ESGGDSGEGSAGDGGSGGQQGQGRRFRISIPW  300



>ref|XP_006306505.1| hypothetical protein CARUB_v10012493mg [Capsella rubella]
 gb|EOA39403.1| hypothetical protein CARUB_v10012493mg [Capsella rubella]
Length=307

 Score =   172 bits (435),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 85/148 (57%), Positives = 103/148 (70%), Gaps = 17/148 (11%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LE LIQQL E+D NRYGTPPA+KSA++ LP +K+T+E+L S+ +QCAVC D FE   EAK
Sbjct  154  LEDLIQQLAEDDQNRYGTPPASKSAIDALPTVKVTKEILQSEMNQCAVCMDEFEDGIEAK  213

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigg  349
            QMPCKH+YH DC++PWL+LHNSCPVCR+ELPTDDPDYENR    Q + +   S G     
Sbjct  214  QMPCKHVYHHDCLLPWLQLHNSCPVCRHELPTDDPDYENRTRGGQTSGDGEGSSGEA---  270

Query  348  lggggNQENPQTPRTVERRFRVSLPWLF  265
                      QTP    RRF +S PW F
Sbjct  271  ----------QTP----RRFSISFPWSF  284



>ref|XP_006359295.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Solanum tuberosum]
Length=322

 Score =   172 bits (435),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 74/101 (73%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
             EQLIQ L ENDPNRYGTPPA++SAVEGLP IK+ +E++ S+ +QCAVCKD FE+  + K
Sbjct  167  FEQLIQNLAENDPNRYGTPPASRSAVEGLPTIKVDEELMRSELAQCAVCKDDFEMGLDVK  226

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRR  406
            QMPCKH+YHKDCI+PWLELH+SCPVCRYELPTDDP+ ENR+
Sbjct  227  QMPCKHVYHKDCIVPWLELHSSCPVCRYELPTDDPENENRQ  267



>ref|XP_010034290.1| PREDICTED: E3 ubiquitin-protein ligase RING1 [Eucalyptus grandis]
 gb|KCW51329.1| hypothetical protein EUGRSUZ_J00881 [Eucalyptus grandis]
 gb|KCW51330.1| hypothetical protein EUGRSUZ_J00881 [Eucalyptus grandis]
Length=321

 Score =   172 bits (435),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 90/150 (60%), Positives = 105/150 (70%), Gaps = 12/150 (8%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LEQLIQQL ENDP RYGTPPA+KSAV+ LP IK+T+E+  S+ + CAVC+D FE   E K
Sbjct  173  LEQLIQQLAENDPTRYGTPPASKSAVKNLPTIKVTEEVQNSEMNHCAVCQDDFEKYMEVK  232

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigg  349
            QMPCKHIYH DC++PWLELHNSCPVCR+ELPTDDPDYENRR++ Q              G
Sbjct  233  QMPCKHIYHSDCLLPWLELHNSCPVCRHELPTDDPDYENRRSAAQ--------GSAQGSG  284

Query  348  lggggNQENPQTPRTVERRFRVSLPWLFGG  259
             G     EN    RTV R F + LP+ F G
Sbjct  285  GGTSSGGEN----RTVRRNFSIMLPYPFRG  310



>ref|XP_004964254.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Setaria italica]
Length=323

 Score =   172 bits (435),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 87/161 (54%), Positives = 108/161 (67%), Gaps = 9/161 (6%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDS-SQCAVCKDSFELDEEA  532
            LEQLIQQL ENDPNRYGTPPAAKSAV  LPD+ ++ +M+ +D  +QCAVC D F L   A
Sbjct  140  LEQLIQQLAENDPNRYGTPPAAKSAVAALPDVAVSADMMQADGGAQCAVCMDDFHLGAAA  199

Query  531  KQMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgig  352
            KQ+PC H++HKDCI+PWL+LH+SCPVCRYELPTDDPDY  ++  +  +            
Sbjct  200  KQLPCNHVFHKDCILPWLDLHSSCPVCRYELPTDDPDYHQQQQQRAASA------PAPAP  253

Query  351  glggggNQENPQTPRTVERRFRVSLPW-LFGGFGSP-AETS  235
                        +PR  ERRFR+SLPW L   FG+  AE+S
Sbjct  254  APAPAPAPAAASSPRVAERRFRISLPWPLRAAFGAAQAESS  294



>ref|XP_008659413.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X1 
[Zea mays]
 gb|AFW86264.1| putative RING zinc finger domain superfamily protein isoform 
1 [Zea mays]
 gb|AFW86265.1| putative RING zinc finger domain superfamily protein isoform 
2 [Zea mays]
Length=310

 Score =   171 bits (433),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 88/161 (55%), Positives = 108/161 (67%), Gaps = 14/161 (9%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDS-SQCAVCKDSFELDEEA  532
            LEQLIQQL ENDPNRYGTPPAAK+AV  LPD+ ++ +M+ +D  +QCAVC D F L   A
Sbjct  133  LEQLIQQLAENDPNRYGTPPAAKAAVASLPDVAVSADMMQADGGAQCAVCMDDFHLGAAA  192

Query  531  KQMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgig  352
            KQ+PCKH++HKDCI+PWL+LH+SCPVCR+ELPTDDPDY N  + Q               
Sbjct  193  KQLPCKHVFHKDCIVPWLDLHSSCPVCRFELPTDDPDY-NHTHQQH----------GDSS  241

Query  351  glggggNQENPQTPRTVERRFRVSLPW-LFGGFGSP-AETS  235
                        +PR  ERRFR+SLPW L   FG+  AE+S
Sbjct  242  APAPPSPAPAVSSPRVAERRFRISLPWPLRAAFGAAQAESS  282



>ref|XP_009111341.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Brassica rapa]
 ref|XP_009111349.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Brassica rapa]
Length=325

 Score =   171 bits (432),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 74/100 (74%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LEQLIQQL ENDPNRYGTPPA+KSA++ LP +K+T +ML S+ +QCAVC D FE   + K
Sbjct  159  LEQLIQQLAENDPNRYGTPPASKSAIDALPTVKVTLDMLNSEMNQCAVCMDEFEDGGDVK  218

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENR  409
            QMPCKH++H+DC+MPWLELHNSCPVCRYELPTDDPDYE+R
Sbjct  219  QMPCKHVFHQDCLMPWLELHNSCPVCRYELPTDDPDYESR  258



>gb|EEC79816.1| hypothetical protein OsI_21260 [Oryza sativa Indica Group]
Length=221

 Score =   167 bits (424),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 84/157 (54%), Positives = 104/157 (66%), Gaps = 12/157 (8%)
 Frame = -2

Query  699  LIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDS-SQCAVCKDSFELDEEAKQM  523
            LIQQL ENDPNRYGTPPAAKSAV  LPD+ ++ +M+A+D  +QCAVC D F L   AKQ+
Sbjct  42   LIQQLAENDPNRYGTPPAAKSAVAALPDVAVSADMMAADGGAQCAVCMDDFHLGAAAKQL  101

Query  522  PCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigglg  343
            PCKH++HKDCI+PWL+LH+SCPVCR+ELPTDDP + +      PT  ++           
Sbjct  102  PCKHVFHKDCILPWLDLHSSCPVCRFELPTDDPHHAH------PTLGSHRPAAPASASAS  155

Query  342  gggNQENPQTPRTVERRFRVSLPW-LFGGFGSPAETS  235
                       R  ERRFR+SLPW L   FG  AE+S
Sbjct  156  PSPAPPP----RLAERRFRISLPWPLRAAFGGQAESS  188



>ref|XP_004236843.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Solanum lycopersicum]
Length=309

 Score =   170 bits (430),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 82/154 (53%), Positives = 102/154 (66%), Gaps = 17/154 (11%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
             EQLIQ L ENDPNRYGTPPA+++AVEGLP IK+ +E++ S+ +QCAVCKD FE+  +  
Sbjct  167  FEQLIQNLAENDPNRYGTPPASRAAVEGLPTIKVDEELMRSELAQCAVCKDDFEMGSDVI  226

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigg  349
            QMPCKH+YHKDCI+PWLELH+SCPVCRYELPTD+P+ ENR+                   
Sbjct  227  QMPCKHVYHKDCIIPWLELHSSCPVCRYELPTDEPENENRQRDND---------------  271

Query  348  lggggNQENPQTPRTVERRF-RVSLPWLFGGFGS  250
             G      +        RRF  +SLPW  G FG+
Sbjct  272  -GDSSGDGSASGSGGSGRRFTTISLPWPLGSFGA  304



>gb|ABK96352.1| unknown [Populus trichocarpa x Populus deltoides]
Length=296

 Score =   169 bits (428),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 75/101 (74%), Positives = 89/101 (88%), Gaps = 1/101 (1%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASD-SSQCAVCKDSFELDEEA  532
            LEQLIQQL ENDPNRYGTPPA+K A+E LP +K+T+EM+ S+ ++QCAVCKD FE  EE 
Sbjct  158  LEQLIQQLAENDPNRYGTPPASKKAIEALPTMKVTEEMMKSEMNNQCAVCKDEFEGGEEV  217

Query  531  KQMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENR  409
            K MPCKH++H+DCI+PWL +HNSCPVCRYELPTDDPDYENR
Sbjct  218  KGMPCKHVFHEDCIIPWLNMHNSCPVCRYELPTDDPDYENR  258



>ref|XP_002310643.2| hypothetical protein POPTR_0007s07510g [Populus trichocarpa]
 gb|EEE91093.2| hypothetical protein POPTR_0007s07510g [Populus trichocarpa]
Length=297

 Score =   169 bits (428),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 75/101 (74%), Positives = 89/101 (88%), Gaps = 1/101 (1%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASD-SSQCAVCKDSFELDEEA  532
            LEQLIQQL ENDPNRYGTPPA+K A+E LP +K+T+EM+ S+ ++QCAVCKD FE  EE 
Sbjct  158  LEQLIQQLAENDPNRYGTPPASKKAIEALPTMKVTEEMMKSEMNNQCAVCKDEFEGGEEV  217

Query  531  KQMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENR  409
            K MPCKH++H+DCI+PWL +HNSCPVCRYELPTDDPDYENR
Sbjct  218  KGMPCKHVFHEDCIIPWLNMHNSCPVCRYELPTDDPDYENR  258



>ref|XP_010461879.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Camelina sativa]
Length=311

 Score =   169 bits (428),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 81/148 (55%), Positives = 100/148 (68%), Gaps = 17/148 (11%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LE LIQQL E+D NRYGTPPA+KSA++ LP +K+++E+L S+ +QCAVC D FE   EAK
Sbjct  158  LEDLIQQLAEDDQNRYGTPPASKSAIDALPTVKVSKEILQSEMNQCAVCMDEFEDGIEAK  217

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigg  349
            QMPCKH+YH DC++PWL+LHNSCPVCR+ELPTDDPDYENR    Q +             
Sbjct  218  QMPCKHVYHHDCLLPWLQLHNSCPVCRHELPTDDPDYENRTRGGQTS-------------  264

Query  348  lggggNQENPQTPRTVERRFRVSLPWLF  265
                G+ E         RRF +S PW F
Sbjct  265  ----GDGEGSSGETHTPRRFSISFPWSF  288



>ref|XP_010500595.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Camelina sativa]
Length=313

 Score =   169 bits (428),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 81/148 (55%), Positives = 100/148 (68%), Gaps = 17/148 (11%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LE LIQQL E+D NRYGTPPA+KSA++ LP +K+++E+L S+ +QCAVC D FE   EAK
Sbjct  160  LEDLIQQLAEDDQNRYGTPPASKSAIDALPTVKVSKEILQSEMNQCAVCMDEFEDGIEAK  219

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigg  349
            QMPCKH+YH DC++PWL+LHNSCPVCR+ELPTDDPDYENR    Q +             
Sbjct  220  QMPCKHVYHHDCLLPWLQLHNSCPVCRHELPTDDPDYENRTRGGQTS-------------  266

Query  348  lggggNQENPQTPRTVERRFRVSLPWLF  265
                G+ E         RRF +S PW F
Sbjct  267  ----GDGEGSSGETHTPRRFSISFPWSF  290



>ref|XP_011002257.1| PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin-protein ligase RING1-like 
[Populus euphratica]
Length=292

 Score =   167 bits (422),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 81/149 (54%), Positives = 100/149 (67%), Gaps = 22/149 (15%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASD-SSQCAVCKDSFELDEEA  532
            LEQLIQQL ENDPNRYGTPP +K A+E LP +K+T+EM+ S+ ++QCAVCKD FE  EE 
Sbjct  152  LEQLIQQLAENDPNRYGTPPTSKKAIEALPTMKVTEEMMKSEMNNQCAVCKDEFEGGEEV  211

Query  531  KQMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgig  352
            K MPCKH++H+DCIMPWL +HNSC VCRYELPTDDPDY+NR    Q              
Sbjct  212  KGMPCKHVFHEDCIMPWLNMHNSCLVCRYELPTDDPDYDNRSPRGQ--------------  257

Query  351  glggggNQENPQTPRTVERRFRVSLPWLF  265
                   +    +   +ERRF +S+P  F
Sbjct  258  -------ESGGGSVGGMERRFTISIPRAF  279



>ref|XP_009382108.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Musa acuminata 
subsp. malaccensis]
Length=295

 Score =   167 bits (422),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 73/101 (72%), Positives = 87/101 (86%), Gaps = 0/101 (0%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LEQLIQQL ENDPNRYGTPPA+K+AVE LPD+++ +E+LASD +QC VC D FE+   AK
Sbjct  150  LEQLIQQLAENDPNRYGTPPASKAAVEILPDVEVGEELLASDDAQCLVCMDPFEIGTVAK  209

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRR  406
            QMPC HIYHK CI+ WL+LHNSCPVCRYELPTDDP+YE+ +
Sbjct  210  QMPCSHIYHKQCILRWLDLHNSCPVCRYELPTDDPEYEHYK  250



>ref|XP_010479486.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Camelina sativa]
Length=308

 Score =   166 bits (420),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 79/148 (53%), Positives = 98/148 (66%), Gaps = 17/148 (11%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LE LIQQL E+D NRYGTPPA+KSA++ LP +K+++E+L S+ +QCAVC D FE   EAK
Sbjct  155  LEDLIQQLAEDDQNRYGTPPASKSAIDALPTVKVSKEILQSEMNQCAVCMDEFEDGIEAK  214

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigg  349
            QMPCKH+YH DC++PWL+LHNSCPVCR+ELPTDD DYENR    Q + +           
Sbjct  215  QMPCKHVYHHDCLLPWLQLHNSCPVCRHELPTDDLDYENRTRGGQTSGDG----------  264

Query  348  lggggNQENPQTPRTVERRFRVSLPWLF  265
                   E         RRF +S PW F
Sbjct  265  -------EGSSGETHTPRRFSISFPWSF  285



>emb|CDY33437.1| BnaC01g32880D [Brassica napus]
Length=324

 Score =   166 bits (419),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 72/100 (72%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LEQLIQQL ENDPNR+GTPPA+KSA++ L  +K+T +ML S+ +QCAVC D FE   + K
Sbjct  161  LEQLIQQLAENDPNRHGTPPASKSAIDALLTVKVTLDMLNSEMNQCAVCMDEFEDGRDVK  220

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENR  409
            QMPCKH++H+DC+MPWLELHNSCPVCRYELPTDDPDYE+R
Sbjct  221  QMPCKHVFHQDCLMPWLELHNSCPVCRYELPTDDPDYESR  260



>ref|XP_002990229.1| hypothetical protein SELMODRAFT_18755, partial [Selaginella moellendorffii]
 ref|XP_002992456.1| hypothetical protein SELMODRAFT_7748, partial [Selaginella moellendorffii]
 gb|EFJ06394.1| hypothetical protein SELMODRAFT_7748, partial [Selaginella moellendorffii]
 gb|EFJ08789.1| hypothetical protein SELMODRAFT_18755, partial [Selaginella moellendorffii]
Length=99

 Score =   159 bits (401),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 81/98 (83%), Gaps = 0/98 (0%)
 Frame = -2

Query  705  EQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAKQ  526
            +QLIQQL ENDPNRYGTPPA+K+A+E +P + IT E ++ D  QCAVCKD FEL  E +Q
Sbjct  1    DQLIQQLAENDPNRYGTPPASKTAIEAMPVVSITSEHMSGDGGQCAVCKDEFELGSEVRQ  60

Query  525  MPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYEN  412
            MPCKH+YH DCI+PWL  HNSCPVCR+E+PTDDP+Y N
Sbjct  61   MPCKHLYHGDCILPWLAQHNSCPVCRHEMPTDDPEYNN  98



>gb|ABR17677.1| unknown [Picea sitchensis]
Length=451

 Score =   168 bits (425),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 89/107 (83%), Gaps = 0/107 (0%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            L+QLIQQL ENDPNRYGTPPA+K+++  +P IKITQ++L +DS+QCAVCKD FE+  E +
Sbjct  187  LDQLIQQLAENDPNRYGTPPASKASIGTMPTIKITQDLLVTDSTQCAVCKDEFEVGTEVR  246

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPT  388
            QMPCKH+YH  CI+PWLE HNSCPVCRYE+PTDD +YE  R+  Q +
Sbjct  247  QMPCKHMYHSVCILPWLEQHNSCPVCRYEMPTDDVEYEQVRSRGQSS  293



>ref|XP_006393160.1| hypothetical protein EUTSA_v10011690mg [Eutrema salsugineum]
 gb|ESQ30446.1| hypothetical protein EUTSA_v10011690mg [Eutrema salsugineum]
Length=305

 Score =   164 bits (414),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 79/148 (53%), Positives = 101/148 (68%), Gaps = 17/148 (11%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LE LIQQL E+DPNRYGTPPA+KSA++ LP +K+T+++L S+ +QCAVC D FE   +AK
Sbjct  152  LEDLIQQLAEDDPNRYGTPPASKSAIDALPTVKVTKDILQSEMNQCAVCMDEFEDGVDAK  211

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigg  349
            +MPCKH+YH DC++PWL+LHNSCPVCR+ELPTDDPDYENR    Q + +   S       
Sbjct  212  EMPCKHLYHHDCLLPWLQLHNSCPVCRHELPTDDPDYENRNRGGQTSGDGGGS-------  264

Query  348  lggggNQENPQTPRTVERRFRVSLPWLF  265
                         +   RRF +S PW F
Sbjct  265  ----------GDGQQTPRRFSISFPWPF  282



>ref|XP_008659414.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X2 
[Zea mays]
Length=264

 Score =   161 bits (407),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 69/102 (68%), Positives = 85/102 (83%), Gaps = 1/102 (1%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDS-SQCAVCKDSFELDEEA  532
            LEQLIQQL ENDPNRYGTPPAAK+AV  LPD+ ++ +M+ +D  +QCAVC D F L   A
Sbjct  133  LEQLIQQLAENDPNRYGTPPAAKAAVASLPDVAVSADMMQADGGAQCAVCMDDFHLGAAA  192

Query  531  KQMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRR  406
            KQ+PCKH++HKDCI+PWL+LH+SCPVCR+ELPTDDPDY +  
Sbjct  193  KQLPCKHVFHKDCIVPWLDLHSSCPVCRFELPTDDPDYNHTH  234



>ref|XP_003592721.1| RING finger protein [Medicago truncatula]
 gb|AES62972.1| E3 ubiquitin-protein ligase RING1-like protein [Medicago truncatula]
Length=315

 Score =   162 bits (410),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 88/161 (55%), Positives = 106/161 (66%), Gaps = 10/161 (6%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
             EQLIQQL ENDPNRYGTPPA+K AV+ LP + +   +L+S+ +QCAVC+D FE   + K
Sbjct  149  FEQLIQQLAENDPNRYGTPPASKEAVKNLPTVTVDDALLSSELNQCAVCQDEFEKGMQVK  208

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRR---NSQQPTRnnnnsfglg  358
            QMPCKH+YH DC++PWLELHNSCPVCR+ELPTDD DYENR    NS    R       + 
Sbjct  209  QMPCKHVYHDDCLLPWLELHNSCPVCRHELPTDDADYENRGRDDNSGDGLR------SVV  262

Query  357  igglggggNQENPQTPRTVERRFRVSLPWLFGGFGSPAETS  235
             G   GGG        R V R FR+SL + FG  G  A+ S
Sbjct  263  GGNSTGGGGSGGGGGNRPVHRTFRISLRYPFGS-GDSAQDS  302



>ref|XP_004149872.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Cucumis sativus]
 ref|XP_004168858.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Cucumis sativus]
 gb|KGN50936.1| hypothetical protein Csa_5G350590 [Cucumis sativus]
Length=299

 Score =   160 bits (404),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 80/149 (54%), Positives = 98/149 (66%), Gaps = 8/149 (5%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LEQLIQ L ENDPNRYGTPPA+KSA+E L  I +T+++L S+ +QCAVC D F      K
Sbjct  150  LEQLIQLLAENDPNRYGTPPASKSAIEKLSTITVTEDLLNSEMNQCAVCIDDFGKGIVVK  209

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigg  349
            QMPCKH++H  C++PWLELHNSCP+CR+ELPTDD DYENR    +               
Sbjct  210  QMPCKHVFHDYCLLPWLELHNSCPICRFELPTDDSDYENRTRGNR--------MQGNESS  261

Query  348  lggggNQENPQTPRTVERRFRVSLPWLFG  262
                G+  +  + R VERRFRV L W FG
Sbjct  262  GEESGSGSSGSSMRRVERRFRVPLWWPFG  290



>dbj|BAJ95268.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=330

 Score =   157 bits (398),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 102/147 (69%), Gaps = 9/147 (6%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDS-SQCAVCKDSFELDEEA  532
            LEQLIQQL ENDP+RYGTPPAAK+AV  LPD+ ++ +M+A+D  +QCAVC D F L   A
Sbjct  156  LEQLIQQLAENDPSRYGTPPAAKAAVAALPDVAVSADMMAADGGAQCAVCMDDFLLGAAA  215

Query  531  KQMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgig  352
            KQ+PC H++HKDCI+PWL+LH+SCPVCR+E+PTDDPDY+N +                  
Sbjct  216  KQLPCNHVFHKDCILPWLDLHSSCPVCRHEMPTDDPDYDNHQRQAAAAA--------PAP  267

Query  351  glggggNQENPQTPRTVERRFRVSLPW  271
                  +     +PR +ERRFR+SLPW
Sbjct  268  AAAAPASPGGGPSPRVMERRFRISLPW  294



>ref|XP_007142767.1| hypothetical protein PHAVU_007G015200g [Phaseolus vulgaris]
 gb|ESW14761.1| hypothetical protein PHAVU_007G015200g [Phaseolus vulgaris]
Length=306

 Score =   157 bits (396),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 68/100 (68%), Positives = 81/100 (81%), Gaps = 0/100 (0%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
             EQLIQ L +NDPNRYGTPPAAK A+E LP + +  E+L S+ +QCAVC+D FE D + K
Sbjct  139  FEQLIQLLADNDPNRYGTPPAAKDAIENLPTVTVDDELLNSEMNQCAVCQDEFEKDTQVK  198

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENR  409
            QMPC+H YH DC++PWL LHNSCPVCRYELPTDD +YENR
Sbjct  199  QMPCRHAYHADCLIPWLRLHNSCPVCRYELPTDDSEYENR  238



>ref|XP_010322969.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Solanum lycopersicum]
Length=359

 Score =   157 bits (397),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 92/187 (49%), Positives = 108/187 (58%), Gaps = 31/187 (17%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            L QLI+QL   D N  GTPPAA+SAV GLPD++++ E+L SD SQCAVCKD F+LDE  K
Sbjct  132  LVQLIRQLAVIDLNMNGTPPAARSAVLGLPDVRVSDELLNSDLSQCAVCKDGFKLDEMVK  191

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRR-----NSQQPTRnnnnsfg  364
            QMPCKH+YH DCI+PWLE+ NSCPVCR+ELPTDD  YE RR     N+   +R       
Sbjct  192  QMPCKHMYHNDCILPWLEMRNSCPVCRFELPTDDFAYEIRRRRNANNAGLLSRGLEGGGN  251

Query  363  lgigglgg------ggNQENPQTPR--------------------TVERRFRVSLPWLFG  262
             G     G       GNQ N  T                      TVERR R+S+P L  
Sbjct  252  QGTLDSNGGLLSVDAGNQGNGGTVESYGALFSMGAEVGGSRGNRGTVERRVRISVPGLLR  311

Query  261  GFGSPAE  241
            G  S AE
Sbjct  312  GLQSHAE  318



>ref|XP_003555841.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Glycine max]
Length=298

 Score =   155 bits (391),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LEQ IQQL +NDPNRYGTPPAAK AVE LP I +  E+L S+ +QCAVC+D FE      
Sbjct  134  LEQFIQQLADNDPNRYGTPPAAKDAVENLPTITVDDELLNSELNQCAVCQDEFEKGSLVT  193

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYEN  412
            QMPCKH YH DC++PWL LHNSCPVCRYELPTDD DYEN
Sbjct  194  QMPCKHAYHGDCLIPWLRLHNSCPVCRYELPTDDADYEN  232



>ref|XP_001777565.1| predicted protein [Physcomitrella patens]
 gb|EDQ57608.1| predicted protein [Physcomitrella patens]
Length=560

 Score =   159 bits (403),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            L+QLIQQL ENDP+R+G PPA+KSAVE +P I+I+QE L +D+ QCAVCKD FEL    +
Sbjct  321  LDQLIQQLAENDPSRHGAPPASKSAVEAMPTIQISQEHLGTDAMQCAVCKDEFELGALVR  380

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPT  388
            QMPCKH+YH DCI+PWL  HNSCPVCRYE+PTDD  Y    ++  P 
Sbjct  381  QMPCKHMYHADCILPWLAQHNSCPVCRYEMPTDDHSYNQSHSNSIPA  427



>ref|XP_003536735.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Glycine max]
Length=286

 Score =   154 bits (388),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 79/99 (80%), Gaps = 0/99 (0%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LEQ IQQL +NDPNRYGTPPAAK AVE LP + +  ++L S+ +QCAVC+D FE   +  
Sbjct  135  LEQFIQQLADNDPNRYGTPPAAKDAVENLPTVTVDDDLLNSELNQCAVCQDEFEKGSKVT  194

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYEN  412
            QMPCKH YH DC++PWL LHNSCPVCRYELPTDD DYEN
Sbjct  195  QMPCKHAYHGDCLIPWLRLHNSCPVCRYELPTDDADYEN  233



>emb|CDY42507.1| BnaC06g03510D [Brassica napus]
Length=339

 Score =   153 bits (387),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LE LIQQL E+DPNRYG PPA+KSAVE LP +K+T+EML SD  QCAVC + FE     K
Sbjct  131  LEDLIQQLGEDDPNRYGPPPASKSAVEALPTVKLTEEMLRSDKKQCAVCMEEFEDGVGVK  190

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYEN  412
            +MPC+H+YH DC++PWL LHN+CPVCR+ELPTDD DYEN
Sbjct  191  EMPCRHVYHHDCLLPWLRLHNTCPVCRHELPTDDVDYEN  229



>emb|CCA20603.1| conserved hypothetical protein [Albugo laibachii Nc14]
Length=315

 Score =   147 bits (371),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 66/101 (65%), Positives = 81/101 (80%), Gaps = 1/101 (1%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            L  +I QLM+ND NR+GTPPAAK A+E LP + ITQE + ++S +CAVCKD F L EEA+
Sbjct  205  LSTVINQLMQNDSNRHGTPPAAKEAIEKLPVLSITQEDINTNS-ECAVCKDDFNLAEEAR  263

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRR  406
            +MPC H +H DCI+PWL+ HNSCPVCRYELPTDD DYE +R
Sbjct  264  RMPCTHTFHPDCILPWLKQHNSCPVCRYELPTDDADYERQR  304



>gb|ABK21010.1| unknown [Picea sitchensis]
 gb|ABR17400.1| unknown [Picea sitchensis]
Length=325

 Score =   146 bits (368),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 71/152 (47%), Positives = 99/152 (65%), Gaps = 9/152 (6%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            L+ LIQ+L END N YGTPPA++SAVE +P ++I++  L+SD SQCAVC + FEL  EA+
Sbjct  147  LDWLIQRLAENDANHYGTPPASRSAVEAMPAVEISESHLSSDVSQCAVCLEEFELGSEAR  206

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRR------NSQQPTRnnnnsf  367
            QMPCKH++H DCI PWL+LH+SCPVCR+++P DD D +  +      NS + +R +    
Sbjct  207  QMPCKHMFHSDCIQPWLKLHSSCPVCRFQMPVDDEDDDTEKRQAEESNSAEDSRRDGAES  266

Query  366  glgigglggggNQENPQTPRTVERRFRVSLPW  271
                    GG   E+ Q      R F +++PW
Sbjct  267  EANTSDSEGG---EHGQAGSERRREFSLAIPW  295



>emb|CCI42106.1| unnamed protein product [Albugo candida]
Length=258

 Score =   144 bits (363),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 80/101 (79%), Gaps = 1/101 (1%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            L  +I QLM+ND NR+GTPPAAK A+E LP + ITQE + + + +CAVCKD F L EEA+
Sbjct  148  LSTVINQLMQNDSNRHGTPPAAKEAIEKLPMLAITQEDI-NINPECAVCKDEFNLAEEAR  206

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRR  406
            +MPC H +H DCI+PWL+ HNSCP+CRYELPTDD DYE +R
Sbjct  207  RMPCTHTFHPDCILPWLKQHNSCPICRYELPTDDADYERQR  247



>gb|ETO72364.1| hypothetical protein F444_11492 [Phytophthora parasitica P1976]
Length=284

 Score =   144 bits (362),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 81/107 (76%), Gaps = 1/107 (1%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            +  +I QLM+NDPNR+G PPAAK  VE LP +KITQ +    S++C VCKD F +D+E  
Sbjct  179  MANVINQLMQNDPNRHGAPPAAKEVVEKLPKVKITQ-VEVDGSAECPVCKDFFAVDDEVH  237

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPT  388
            ++PC+H +H DCI+PWL+ HNSCP+CR+ELPTDDPDYE RR S   T
Sbjct  238  RLPCEHSFHPDCILPWLKQHNSCPLCRFELPTDDPDYERRRASSSST  284



>ref|XP_008907457.1| hypothetical protein PPTG_13494 [Phytophthora parasitica INRA-310]
 gb|ETI43684.1| hypothetical protein F443_11427 [Phytophthora parasitica P1569]
 gb|ETK83780.1| hypothetical protein L915_11118 [Phytophthora parasitica]
 gb|ETL37191.1| hypothetical protein L916_11015 [Phytophthora parasitica]
 gb|ETL90350.1| hypothetical protein L917_10924 [Phytophthora parasitica]
 gb|ETM43657.1| hypothetical protein L914_10948 [Phytophthora parasitica]
 gb|ETN07081.1| hypothetical protein PPTG_13494 [Phytophthora parasitica INRA-310]
 gb|ETP13502.1| hypothetical protein F441_11345 [Phytophthora parasitica CJ01A1]
 gb|ETP41604.1| hypothetical protein F442_11316 [Phytophthora parasitica P10297]
Length=284

 Score =   144 bits (362),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 81/107 (76%), Gaps = 1/107 (1%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            +  +I QLM+NDPNR+G PPAAK  VE LP +KITQ +    S++C VCKD F +D+E  
Sbjct  179  MANVINQLMQNDPNRHGAPPAAKEVVEKLPKVKITQ-VEVDGSAECPVCKDFFAVDDEVH  237

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPT  388
            ++PC+H +H DCI+PWL+ HNSCP+CR+ELPTDDPDYE RR S   T
Sbjct  238  RLPCEHSFHPDCILPWLKQHNSCPLCRFELPTDDPDYERRRASSSST  284



>gb|EPS72590.1| hypothetical protein M569_02175, partial [Genlisea aurea]
Length=122

 Score =   137 bits (345),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = -2

Query  675  DPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKD  496
            DP+R GTPPA++SA++GL D+ IT  +L SDS+ CAVCKD+F + ++AKQMPC HIYH D
Sbjct  22   DPDRNGTPPASQSAIDGLTDVIITDRVLDSDSTPCAVCKDAFVIGDKAKQMPCTHIYHTD  81

Query  495  CIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQ  394
            CI+PWL L N+CP CR++LPTDDP YEN R + Q
Sbjct  82   CILPWLNLRNTCPSCRFQLPTDDPVYENARRTLQ  115



>ref|XP_002906712.1| conserved hypothetical protein [Phytophthora infestans T30-4]
 gb|EEY66113.1| conserved hypothetical protein [Phytophthora infestans T30-4]
Length=266

 Score =   141 bits (356),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 81/107 (76%), Gaps = 1/107 (1%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            +  +I QLM+NDPNR+G PPAAK  V+ LP +KITQ  +   S++C VCKD F +D+E  
Sbjct  161  MANVINQLMQNDPNRHGAPPAAKEVVDKLPKVKITQGEV-DGSAECPVCKDFFAVDDEVH  219

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPT  388
            ++PC+H +H DCI+PWL+ HNSCP+CR+ELPTDDPDYE RR +   T
Sbjct  220  RLPCEHSFHPDCILPWLKQHNSCPLCRFELPTDDPDYERRRAASTST  266



>gb|AFG56549.1| hypothetical protein 2_4925_01, partial [Pinus taeda]
Length=135

 Score =   136 bits (343),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            L+ LIQ+L END N YGTPPA++SAVE +  +KI+QE L+SD SQCAVC + FE+  EA+
Sbjct  21   LDWLIQRLAENDANHYGTPPASRSAVEAMAAVKISQEHLSSDLSQCAVCLEEFEVGSEAR  80

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELP  436
            +MPCKH++H DCI PWL+LH+SCPVCRY++P
Sbjct  81   EMPCKHMFHSDCIQPWLKLHSSCPVCRYQMP  111



>ref|XP_002988229.1| hypothetical protein SELMODRAFT_451319 [Selaginella moellendorffii]
 gb|EFJ10648.1| hypothetical protein SELMODRAFT_451319 [Selaginella moellendorffii]
Length=517

 Score =   144 bits (362),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 64/105 (61%), Positives = 79/105 (75%), Gaps = 0/105 (0%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
             EQL+QQL END  R G PPAAKSAV+ L  +KI Q  + S  + CA+CK+   LDE AK
Sbjct  284  FEQLLQQLAENDTTRRGAPPAAKSAVDELEMVKIAQHHIDSGIAVCAICKEQLMLDEPAK  343

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQ  394
            Q+PC H+YH+DCI+PWL   NSCPVCRYELPTDDPDYE ++N ++
Sbjct  344  QLPCLHLYHQDCILPWLGSRNSCPVCRYELPTDDPDYEEQKNGRK  388



>gb|AEW08272.1| hypothetical protein 2_4925_01, partial [Pinus radiata]
Length=135

 Score =   135 bits (340),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 75/90 (83%), Gaps = 0/90 (0%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            L+ LIQ+L END N YGTPPA++SAVE +  +KI+QE L+SD SQCAVC + FEL  EA+
Sbjct  21   LDWLIQRLAENDANHYGTPPASRSAVEAMAAVKISQEHLSSDLSQCAVCLEEFELGSEAR  80

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYEL  439
            +MPCKH++H DCI PWL+LH+SCPVCRY++
Sbjct  81   EMPCKHMFHSDCIQPWLKLHSSCPVCRYQM  110



>ref|XP_002991361.1| hypothetical protein SELMODRAFT_429694 [Selaginella moellendorffii]
 gb|EFJ07473.1| hypothetical protein SELMODRAFT_429694 [Selaginella moellendorffii]
Length=512

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 78/105 (74%), Gaps = 0/105 (0%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
             EQL+QQL END  R G PPAAKSAV+ L  +KI Q  + S  + CA+CK+   LDE AK
Sbjct  279  FEQLLQQLAENDTTRRGAPPAAKSAVDELEMVKIAQHHIDSGIAVCAICKEQLMLDEPAK  338

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQ  394
            Q+PC H+YH+DCI+PWL   NSCPVCRYELPTDDPDYE ++  ++
Sbjct  339  QLPCLHLYHQDCILPWLGSRNSCPVCRYELPTDDPDYEEQKKGRK  383



>gb|AFG56541.1| hypothetical protein 2_4925_01, partial [Pinus taeda]
 gb|AFG56542.1| hypothetical protein 2_4925_01, partial [Pinus taeda]
 gb|AFG56543.1| hypothetical protein 2_4925_01, partial [Pinus taeda]
 gb|AFG56544.1| hypothetical protein 2_4925_01, partial [Pinus taeda]
 gb|AFG56545.1| hypothetical protein 2_4925_01, partial [Pinus taeda]
 gb|AFG56546.1| hypothetical protein 2_4925_01, partial [Pinus taeda]
 gb|AFG56547.1| hypothetical protein 2_4925_01, partial [Pinus taeda]
 gb|AFG56548.1| hypothetical protein 2_4925_01, partial [Pinus taeda]
 gb|AFG56550.1| hypothetical protein 2_4925_01, partial [Pinus taeda]
 gb|AFG56551.1| hypothetical protein 2_4925_01, partial [Pinus taeda]
 gb|AFG56552.1| hypothetical protein 2_4925_01, partial [Pinus taeda]
 gb|AFG56553.1| hypothetical protein 2_4925_01, partial [Pinus taeda]
 gb|AFG56554.1| hypothetical protein 2_4925_01, partial [Pinus taeda]
 gb|AFG56555.1| hypothetical protein 2_4925_01, partial [Pinus taeda]
 gb|AFG56556.1| hypothetical protein 2_4925_01, partial [Pinus taeda]
 gb|AFG56557.1| hypothetical protein 2_4925_01, partial [Pinus taeda]
Length=135

 Score =   132 bits (331),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            L+ LIQ+L END N YGTPPA++SAVE +  +KI++  L SD SQCAVC + FE+  EA+
Sbjct  21   LDWLIQRLAENDANHYGTPPASRSAVEAMAAVKISEGHLRSDLSQCAVCLEEFEVGSEAR  80

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELP  436
            +MPCKH++H DCI PWL+LH+SCPVCRY++P
Sbjct  81   EMPCKHMFHSDCIQPWLKLHSSCPVCRYQMP  111



>ref|XP_002968394.1| hypothetical protein SELMODRAFT_451322 [Selaginella moellendorffii]
 gb|EFJ30648.1| hypothetical protein SELMODRAFT_451322 [Selaginella moellendorffii]
Length=613

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 77/101 (76%), Gaps = 0/101 (0%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
             E L+QQL END +R G PPAAKSAV+ LP I I Q  L   S+ CAVCKD+  + E AK
Sbjct  328  FELLLQQLAENDNSRRGAPPAAKSAVDTLPTILIEQAHLDDGSAVCAVCKDTVCVGEPAK  387

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRR  406
            QMPC H+YH DCI+PWL+  NSCPVCR+ELPTDDPDYE+++
Sbjct  388  QMPCLHLYHADCILPWLDSRNSCPVCRFELPTDDPDYEDQK  428



>ref|XP_002970557.1| hypothetical protein SELMODRAFT_451325 [Selaginella moellendorffii]
 gb|EFJ28687.1| hypothetical protein SELMODRAFT_451325 [Selaginella moellendorffii]
Length=614

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 77/101 (76%), Gaps = 0/101 (0%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
             E L+QQL END +R G PPAAKSAV+ LP I I Q  L   S+ CAVCKD+  + E AK
Sbjct  325  FELLLQQLAENDNSRRGAPPAAKSAVDTLPTILIEQAHLDDGSAVCAVCKDTVCVGEPAK  384

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRR  406
            QMPC H+YH DCI+PWL+  NSCPVCR+ELPTDDPDYE+++
Sbjct  385  QMPCLHLYHADCILPWLDSRNSCPVCRFELPTDDPDYEDQK  425



>ref|XP_009767589.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Nicotiana 
sylvestris]
 ref|XP_009767590.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Nicotiana 
sylvestris]
Length=343

 Score =   135 bits (341),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 67/151 (44%), Positives = 88/151 (58%), Gaps = 26/151 (17%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            L+ L+Q L ENDPNRYGTPPA K AVE LP +KI + +      QC+VC + FE+  EAK
Sbjct  187  LDMLLQHLAENDPNRYGTPPAQKEAVEALPAVKIDETL------QCSVCLEDFEIGTEAK  240

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigg  349
            +MPCKH +H +CI+PWLELH++CPVCR++LP+D+   EN   +                 
Sbjct  241  EMPCKHKFHSECILPWLELHSTCPVCRHQLPSDESKVENVTGNTNAA-------------  287

Query  348  lggggNQENPQTPRTVERRFRVSLPWLFGGF  256
                   ++  T     RRF VSLPW   G 
Sbjct  288  -------QSSDTRNENGRRFPVSLPWPLSGL  311



>ref|XP_009515775.1| hypothetical protein PHYSODRAFT_294053 [Phytophthora sojae]
 gb|EGZ28500.1| hypothetical protein PHYSODRAFT_294053 [Phytophthora sojae]
Length=297

 Score =   134 bits (337),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 81/116 (70%), Gaps = 10/116 (9%)
 Frame = -2

Query  708  LEQLIQQLMENDPNR---------YGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKD  556
            +  +I QLM+NDPNR         +G PPAAK  VE LP +KITQ  +   S++C VCKD
Sbjct  183  MANVINQLMQNDPNRREVVADDLKHGAPPAAKEVVEKLPKVKITQSDV-DGSAECPVCKD  241

Query  555  SFELDEEAKQMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPT  388
             F +D+E  ++PC+H +H DCI+PWL+ HNSCP+CR+ELPTDDPDYE RR +   T
Sbjct  242  FFAVDDEVHRLPCEHSFHPDCILPWLKDHNSCPLCRFELPTDDPDYERRRAASATT  297



>ref|XP_009621828.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Nicotiana 
tomentosiformis]
 ref|XP_009621829.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Nicotiana 
tomentosiformis]
Length=342

 Score =   135 bits (339),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 68/155 (44%), Positives = 88/155 (57%), Gaps = 26/155 (17%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            L+ L+Q L ENDPNRYGTPPA K  VE LP +KI + M      QC+VC + FE+  EAK
Sbjct  186  LDMLLQHLAENDPNRYGTPPAQKEVVEALPAVKIDETM------QCSVCLEDFEIGTEAK  239

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigg  349
            +MPCKH +H  CI+PWLELH++CPVCR++LP+D+   EN  ++                 
Sbjct  240  EMPCKHKFHSGCILPWLELHSTCPVCRHQLPSDESKVENVTDNTNAA-------------  286

Query  348  lggggNQENPQTPRTVERRFRVSLPWLFGGFGSPA  244
                   ++  T     RRF VSLPW   G  S  
Sbjct  287  -------QSSDTRNENGRRFPVSLPWPLSGLFSSG  314



>gb|AFG68993.1| hypothetical protein 0_10618_01, partial [Pinus taeda]
 gb|AFG68994.1| hypothetical protein 0_10618_01, partial [Pinus taeda]
 gb|AFG68995.1| hypothetical protein 0_10618_01, partial [Pinus taeda]
 gb|AFG68996.1| hypothetical protein 0_10618_01, partial [Pinus taeda]
 gb|AFG68997.1| hypothetical protein 0_10618_01, partial [Pinus taeda]
 gb|AFG68998.1| hypothetical protein 0_10618_01, partial [Pinus taeda]
 gb|AFG68999.1| hypothetical protein 0_10618_01, partial [Pinus taeda]
 gb|AFG69000.1| hypothetical protein 0_10618_01, partial [Pinus taeda]
 gb|AFG69001.1| hypothetical protein 0_10618_01, partial [Pinus taeda]
 gb|AFG69002.1| hypothetical protein 0_10618_01, partial [Pinus taeda]
 gb|AFG69003.1| hypothetical protein 0_10618_01, partial [Pinus taeda]
 gb|AFG69004.1| hypothetical protein 0_10618_01, partial [Pinus taeda]
 gb|AFG69005.1| hypothetical protein 0_10618_01, partial [Pinus taeda]
 gb|AFG69006.1| hypothetical protein 0_10618_01, partial [Pinus taeda]
 gb|AFG69007.1| hypothetical protein 0_10618_01, partial [Pinus taeda]
 gb|AFG69008.1| hypothetical protein 0_10618_01, partial [Pinus taeda]
 gb|AFG69009.1| hypothetical protein 0_10618_01, partial [Pinus taeda]
 gb|AFG69010.1| hypothetical protein 0_10618_01, partial [Pinus taeda]
Length=138

 Score =   129 bits (324),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 72/101 (71%), Gaps = 0/101 (0%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
             EQL+Q L E D +R G PPAA+S +E LP I I Q      SS CA+CKDS  L ++AK
Sbjct  33   FEQLLQHLAETDNSRRGAPPAAQSVIEQLPLIIIRQAHEEDGSSVCAICKDSLALGDQAK  92

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRR  406
            Q+PC H+YH +CI+PWL   NSCPVCRYELPTDDP+YE  +
Sbjct  93   QLPCMHLYHPNCILPWLGARNSCPVCRYELPTDDPEYEEEK  133



>ref|XP_006445556.1| hypothetical protein CICLE_v10015642mg [Citrus clementina]
 ref|XP_006488959.1| PREDICTED: E3 ubiquitin-protein ligase CIP8-like [Citrus sinensis]
 gb|ESR58796.1| hypothetical protein CICLE_v10015642mg [Citrus clementina]
 gb|KDO54518.1| hypothetical protein CISIN_1g017208mg [Citrus sinensis]
 gb|KDO54519.1| hypothetical protein CISIN_1g017208mg [Citrus sinensis]
Length=375

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 71/153 (46%), Positives = 89/153 (58%), Gaps = 12/153 (8%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            L+ L+Q L ENDPNRYGTPPA K AVE +P +KI + +      QC+VC D FE+  EAK
Sbjct  205  LDLLLQHLAENDPNRYGTPPAQKEAVEAMPSVKIEETL------QCSVCLDDFEIGTEAK  258

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDD--PDYENRRNSQQPTRnnnnsfglgi  355
            +MPCKH +H  CI+PWLELH+SCPVCR +LP D+  P+ E  RNS    R          
Sbjct  259  EMPCKHKFHSQCILPWLELHSSCPVCRCQLPADEFKPESERSRNSSNHQR---EHEHHSS  315

Query  354  gglggggNQENPQTPRTVERRFRVSLPWLFGGF  256
                   ++E     R  E   R S+PW F G 
Sbjct  316  DHGTHASSEEGDGEGRN-ESGSRFSIPWPFNGL  347



>ref|XP_008803022.1| PREDICTED: E3 ubiquitin-protein ligase Praja-2 [Phoenix dactylifera]
 ref|XP_008803024.1| PREDICTED: E3 ubiquitin-protein ligase Praja-2 [Phoenix dactylifera]
 ref|XP_008803025.1| PREDICTED: E3 ubiquitin-protein ligase Praja-2 [Phoenix dactylifera]
 ref|XP_008803026.1| PREDICTED: E3 ubiquitin-protein ligase Praja-2 [Phoenix dactylifera]
Length=536

 Score =   135 bits (341),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 76/102 (75%), Gaps = 0/102 (0%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
             E+L++QL END +R G PPAA S V  LP + I+++   +DS  CAVCKD   ++ EAK
Sbjct  310  FEELLEQLAENDGSRRGAPPAAASFVASLPSVIISKDHERNDSLICAVCKDPLPINTEAK  369

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRN  403
            Q+PCKH+YH  CI+PWL   NSCPVCRYELPTDDP+YE +RN
Sbjct  370  QLPCKHLYHPSCILPWLAARNSCPVCRYELPTDDPEYEGKRN  411



>ref|XP_010276428.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Nelumbo nucifera]
 ref|XP_010276429.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Nelumbo nucifera]
 ref|XP_010276430.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Nelumbo nucifera]
 ref|XP_010276431.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Nelumbo nucifera]
Length=353

 Score =   134 bits (336),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 69/146 (47%), Positives = 88/146 (60%), Gaps = 6/146 (4%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            L+ L+Q L ENDPNRYGTPPA K AVE +P +KIT+      SSQC+VC D  E+  EAK
Sbjct  178  LDLLLQHLAENDPNRYGTPPAQKEAVEAMPTVKITE------SSQCSVCLDDLEIGAEAK  231

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigg  349
            +MPCKH +H  CI+PWLELH+SCPVCR+++P D+       +     R  N   G+G   
Sbjct  232  EMPCKHKFHSGCILPWLELHSSCPVCRFQIPADESKMAPDGSGTSEYRAENGGIGIGGAL  291

Query  348  lggggNQENPQTPRTVERRFRVSLPW  271
              GG   E+        RR  V +PW
Sbjct  292  GAGGQGSEDSSGGNGNGRRLLVPIPW  317



>gb|KDO29293.1| hypothetical protein SPRG_05830 [Saprolegnia parasitica CBS 223.65]
Length=311

 Score =   132 bits (333),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 78/104 (75%), Gaps = 1/104 (1%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            +  +I  LM+NDPN++G PPA+KS VE LP + IT+E +A +   CAVCKD F L +E +
Sbjct  197  ISTIINHLMQNDPNQHGAPPASKSVVESLPVVHITEEDVAKNQ-DCAVCKDMFALHDEIR  255

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQ  397
            ++PC H +H DCI+PWL  HNSCPVCR+ELPTDD +YEN +++ 
Sbjct  256  RLPCTHDFHPDCILPWLAQHNSCPVCRFELPTDDQEYENHKHAN  299



>gb|ACN40798.1| unknown [Picea sitchensis]
Length=282

 Score =   132 bits (331),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 78/98 (80%), Gaps = 3/98 (3%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LEQL+Q+L E+DP R G PPA++++V+ L ++K++ +  A+   QCAVCKD FE  + AK
Sbjct  106  LEQLLQELAESDPGRRGPPPASRASVDALENVKVSGKDAAA---QCAVCKDEFEPGKYAK  162

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYE  415
            +MPC H+YH DCI+PWL  HNSCPVCRYE+PTDDP+Y+
Sbjct  163  RMPCNHMYHADCILPWLAQHNSCPVCRYEMPTDDPEYD  200



>ref|XP_006348226.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X3 
[Solanum tuberosum]
 ref|XP_006348227.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X4 
[Solanum tuberosum]
 ref|XP_006348228.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X5 
[Solanum tuberosum]
Length=360

 Score =   133 bits (335),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 70/151 (46%), Positives = 91/151 (60%), Gaps = 11/151 (7%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            L+ L+Q L ENDPNRYGTPPA K  VE LP + I + +      QC+VC + FE+  EAK
Sbjct  190  LDVLLQHLAENDPNRYGTPPAQKEVVEALPVVTIDETL------QCSVCLEDFEIGTEAK  243

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigg  349
            +MPCKH +H DCI+PWLELH++CPVCR++LP+D+   E+       T + + S       
Sbjct  244  EMPCKHRFHGDCILPWLELHSTCPVCRHQLPSDESKVES-----AGTNDGSGSNTNAQSS  298

Query  348  lggggNQENPQTPRTVERRFRVSLPWLFGGF  256
             G G   E+  T     RRF VSLPW   G 
Sbjct  299  NGNGRRYEDEDTRNENGRRFPVSLPWPLSGL  329



>ref|XP_008878243.1| hypothetical protein H310_12817 [Aphanomyces invadans]
 gb|ETV93221.1| hypothetical protein H310_12817 [Aphanomyces invadans]
Length=313

 Score =   132 bits (332),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 74/101 (73%), Gaps = 1/101 (1%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            +  +I  LM+ND +++G PPAAK+ +E LP + I+Q  +  D   CAVCKD +EL EEA 
Sbjct  199  ISTIINHLMQNDSSQHGAPPAAKTVLESLPKVHISQGEV-DDKHDCAVCKDVYELKEEAI  257

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRR  406
            ++PC H +H DCIMPWL+ HNSCPVCRYELPTDD +YE  R
Sbjct  258  RLPCSHDFHTDCIMPWLKQHNSCPVCRYELPTDDQEYETAR  298



>ref|XP_006305221.1| hypothetical protein CARUB_v10009589mg [Capsella rubella]
 gb|EOA38119.1| hypothetical protein CARUB_v10009589mg [Capsella rubella]
Length=351

 Score =   133 bits (334),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 71/95 (75%), Gaps = 6/95 (6%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
             E L+Q+L ENDPNRYGTPPA K AVE L  +KI + +      QC+VC D FE+  EAK
Sbjct  186  FEMLLQRLAENDPNRYGTPPAKKEAVEALATVKIEETL------QCSVCLDDFEIGTEAK  239

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDP  424
             MPCKH +H DC++PWLELH+SCPVCRY+LP D+P
Sbjct  240  LMPCKHKFHVDCLLPWLELHSSCPVCRYQLPADEP  274



>ref|XP_006348225.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X2 
[Solanum tuberosum]
Length=378

 Score =   133 bits (335),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 70/151 (46%), Positives = 91/151 (60%), Gaps = 11/151 (7%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            L+ L+Q L ENDPNRYGTPPA K  VE LP + I + +      QC+VC + FE+  EAK
Sbjct  208  LDVLLQHLAENDPNRYGTPPAQKEVVEALPVVTIDETL------QCSVCLEDFEIGTEAK  261

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigg  349
            +MPCKH +H DCI+PWLELH++CPVCR++LP+D+   E+       T + + S       
Sbjct  262  EMPCKHRFHGDCILPWLELHSTCPVCRHQLPSDESKVES-----AGTNDGSGSNTNAQSS  316

Query  348  lggggNQENPQTPRTVERRFRVSLPWLFGGF  256
             G G   E+  T     RRF VSLPW   G 
Sbjct  317  NGNGRRYEDEDTRNENGRRFPVSLPWPLSGL  347



>ref|XP_009626425.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Nicotiana 
tomentosiformis]
Length=331

 Score =   132 bits (332),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 66/146 (45%), Positives = 86/146 (59%), Gaps = 26/146 (18%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            L+ L+Q L ENDPNRYGTPPA K  VE LP +KI + M      QC+VC + FE+  EAK
Sbjct  186  LDMLLQHLAENDPNRYGTPPAQKEVVEALPAVKIDETM------QCSVCLEDFEIGTEAK  239

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigg  349
            +MPCKH +H  CI+PWLELH++CPVCR++LP+D+   EN  ++                 
Sbjct  240  EMPCKHKFHSGCILPWLELHSTCPVCRHQLPSDESKVENVTDNTNAA-------------  286

Query  348  lggggNQENPQTPRTVERRFRVSLPW  271
                   ++  T     RRF VSLPW
Sbjct  287  -------QSSDTRNENGRRFPVSLPW  305



>emb|CDY10554.1| BnaC03g70600D [Brassica napus]
Length=305

 Score =   131 bits (330),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 75/101 (74%), Gaps = 5/101 (5%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
             E L+Q+L +NDPNRYGTPPA K AVE L  +KI +  L     QC+VC D FE+  EAK
Sbjct  142  FEALLQRLTDNDPNRYGTPPAQKEAVEALATVKIQEGAL-----QCSVCLDDFEIGVEAK  196

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRR  406
            +MPC+H +H+DC++PWLELH+SCPVCRYELP+D+   E  R
Sbjct  197  EMPCEHKFHRDCLLPWLELHSSCPVCRYELPSDETKTETER  237



>ref|XP_002523963.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF38331.1| zinc finger protein, putative [Ricinus communis]
Length=116

 Score =   125 bits (315),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 70/106 (66%), Gaps = 12/106 (11%)
 Frame = -2

Query  579  SQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNS  400
            +QCAVCKD FE   EAKQMPCKH+YH DCI+PWLELHNSCPVCRYELPTDD DYE+R   
Sbjct  2    NQCAVCKDEFEKGAEAKQMPCKHVYHNDCIVPWLELHNSCPVCRYELPTDDSDYESR---  58

Query  399  QQPTRnnnnsfglgigglggggNQENPQTPRTVERRFRVSLPWLFG  262
               TR             G  G+       RTVERRF +SLPW FG
Sbjct  59   ---TRGGAEGGQGSNEVAGTTGDN------RTVERRFSISLPWPFG  95



>ref|XP_006348224.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X1 
[Solanum tuberosum]
Length=395

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/151 (46%), Positives = 91/151 (60%), Gaps = 11/151 (7%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            L+ L+Q L ENDPNRYGTPPA K  VE LP + I + +      QC+VC + FE+  EAK
Sbjct  225  LDVLLQHLAENDPNRYGTPPAQKEVVEALPVVTIDETL------QCSVCLEDFEIGTEAK  278

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigg  349
            +MPCKH +H DCI+PWLELH++CPVCR++LP+D+   E+       T + + S       
Sbjct  279  EMPCKHRFHGDCILPWLELHSTCPVCRHQLPSDESKVES-----AGTNDGSGSNTNAQSS  333

Query  348  lggggNQENPQTPRTVERRFRVSLPWLFGGF  256
             G G   E+  T     RRF VSLPW   G 
Sbjct  334  NGNGRRYEDEDTRNENGRRFPVSLPWPLSGL  364



>gb|AFG53307.1| hypothetical protein 0_8445_01, partial [Pinus taeda]
 gb|AFG53308.1| hypothetical protein 0_8445_01, partial [Pinus taeda]
 gb|AFG53309.1| hypothetical protein 0_8445_01, partial [Pinus taeda]
 gb|AFG53310.1| hypothetical protein 0_8445_01, partial [Pinus taeda]
 gb|AFG53311.1| hypothetical protein 0_8445_01, partial [Pinus taeda]
 gb|AFG53312.1| hypothetical protein 0_8445_01, partial [Pinus taeda]
 gb|AFG53313.1| hypothetical protein 0_8445_01, partial [Pinus taeda]
 gb|AFG53314.1| hypothetical protein 0_8445_01, partial [Pinus taeda]
 gb|AFG53315.1| hypothetical protein 0_8445_01, partial [Pinus taeda]
 gb|AFG53316.1| hypothetical protein 0_8445_01, partial [Pinus taeda]
 gb|AFG53319.1| hypothetical protein 0_8445_01, partial [Pinus taeda]
 gb|AFG53320.1| hypothetical protein 0_8445_01, partial [Pinus taeda]
Length=146

 Score =   126 bits (317),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = -2

Query  621  PDIKITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLELHNSCPVCRYE  442
            P IKITQ++L +DS+QCAVCKD FE+  E +QMPCKH+YH  CI+PWLE HNSCPVCRYE
Sbjct  1    PTIKITQDLLVTDSTQCAVCKDEFEVGTEVRQMPCKHMYHSVCILPWLEQHNSCPVCRYE  60

Query  441  LPTDDPDYENRRNSQQPTR  385
            +PTDD +YE  R+S Q + 
Sbjct  61   MPTDDVEYEQARSSGQSSH  79



>gb|KJB83397.1| hypothetical protein B456_013G245300 [Gossypium raimondii]
Length=342

 Score =   131 bits (330),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 72/159 (45%), Positives = 96/159 (60%), Gaps = 15/159 (9%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            L+ L+Q L END NRYGTPP  K A+E LP +KI +EML     QC+VC D  +   EAK
Sbjct  175  LDLLLQHLAENDSNRYGTPPTQKEAIEALPTVKI-EEML-----QCSVCLDDLKTGNEAK  228

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigg  349
            +MPCKH +H +CI+PWLELH+SCPVCRY++PTD+   ++ R      R          G 
Sbjct  229  EMPCKHKFHGECILPWLELHSSCPVCRYQMPTDESKLDSERPRANTNR-------RESGN  281

Query  348  lggggNQENPQTPRTVERRFRVSLPWLFGG-FGSPAETS  235
               G ++E  +  R    R R S+PW F G F S +++S
Sbjct  282  NVRGSSEEGERDGRNGSGR-RFSIPWPFNGLFSSGSQSS  319



>gb|AFG53317.1| hypothetical protein 0_8445_01, partial [Pinus taeda]
 gb|AFG53318.1| hypothetical protein 0_8445_01, partial [Pinus taeda]
Length=146

 Score =   126 bits (317),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = -2

Query  621  PDIKITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLELHNSCPVCRYE  442
            P IKITQ++L +DS+QCAVCKD FE+  E +QMPCKH+YH  CI+PWLE HNSCPVCRYE
Sbjct  1    PTIKITQDLLVTDSTQCAVCKDEFEVGTEVRQMPCKHMYHSVCILPWLEQHNSCPVCRYE  60

Query  441  LPTDDPDYENRRNSQQPTR  385
            +PTDD +YE  R+S Q + 
Sbjct  61   MPTDDVEYEQARSSGQSSH  79



>emb|CDY26096.1| BnaC06g11000D [Brassica napus]
Length=294

 Score =   130 bits (326),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 71/94 (76%), Gaps = 5/94 (5%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
             E L+Q+L ENDPNRYGTPPA K  VE L  +KI +  L     QC+VC D FE+  EAK
Sbjct  132  FEALLQRLAENDPNRYGTPPARKEDVESLATVKIQEPSL-----QCSVCLDDFEVGAEAK  186

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDD  427
            QMPCKH +H DC++PWLELH+SCPVCRY+LPTD+
Sbjct  187  QMPCKHNFHADCLLPWLELHSSCPVCRYQLPTDE  220



>ref|XP_010462406.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Camelina sativa]
Length=350

 Score =   131 bits (329),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 71/95 (75%), Gaps = 6/95 (6%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
             E L+Q+L ENDPNRYGTPPA K AVE L  +KI + +      QC+VC D FE+  EAK
Sbjct  187  FEMLLQRLAENDPNRYGTPPAKKEAVEALSTVKIEETL------QCSVCLDDFEIGTEAK  240

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDP  424
             MPCKH +H DC++PWLELH+SCPVCR++LP D+P
Sbjct  241  LMPCKHKFHADCLLPWLELHSSCPVCRFQLPADEP  275



>ref|XP_009132309.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Brassica rapa]
Length=378

 Score =   131 bits (330),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 81/110 (74%), Gaps = 7/110 (6%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            L+ L+Q L ENDPNR GTPPA K AVE LP +K+T+ +L     QC+VC D FE   EAK
Sbjct  197  LDLLLQHLAENDPNRQGTPPARKEAVEALPTVKVTEPLL-----QCSVCLDEFERGVEAK  251

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPT--DDPDYENRRNSQQPTR  385
            +MPCKH +H  CI+PWLE+H+SCPVCR+ELP+  DD D E++  S++ TR
Sbjct  252  EMPCKHKFHVKCIVPWLEIHSSCPVCRFELPSGNDDGDDESKVVSERGTR  301



>ref|XP_010480093.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Camelina sativa]
Length=350

 Score =   130 bits (328),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 71/95 (75%), Gaps = 6/95 (6%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
             E L+Q+L ENDPNRYGTPPA K AVE L  +KI + +      QC+VC D FE+  EAK
Sbjct  188  FEMLLQRLAENDPNRYGTPPAKKEAVEALSTVKIEETL------QCSVCLDDFEIGTEAK  241

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDP  424
             MPCKH +H DC++PWLELH+SCPVCR++LP D+P
Sbjct  242  LMPCKHKFHVDCLLPWLELHSSCPVCRFQLPADEP  276



>ref|XP_008449904.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Cucumis melo]
 ref|XP_008449905.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Cucumis melo]
Length=366

 Score =   131 bits (329),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 69/151 (46%), Positives = 91/151 (60%), Gaps = 6/151 (4%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            L+ L+Q + ENDPNRYGTPPA K AV+ LP +++  E+      QC+VC D FE+DEEAK
Sbjct  200  LDLLLQHIAENDPNRYGTPPAQKEAVDALPTVRV--ELEEDSRLQCSVCLDEFEVDEEAK  257

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigg  349
            +MPCKH +H  CI+PWLELH+SCPVCR++LP D    E++R+    +     S      G
Sbjct  258  EMPCKHKFHTGCILPWLELHSSCPVCRHQLPGD----ESKRDVDGGSAARFMSDLNNGNG  313

Query  348  lggggNQENPQTPRTVERRFRVSLPWLFGGF  256
             G G      +   + E   R S PW F G 
Sbjct  314  NGNGNGSGEIEERNSSESGRRFSFPWPFNGL  344



>gb|ADK63410.1| C3HC4 type zinc finger protein [Brassica rapa]
Length=312

 Score =   130 bits (326),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 58/102 (57%), Positives = 74/102 (73%), Gaps = 5/102 (5%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
             E L+Q+L +NDPNRYGTPPA K AVE L  +KI +  L     QC+VC D FE+  EAK
Sbjct  144  FEALLQRLTDNDPNRYGTPPAQKEAVEALASVKIQEPTL-----QCSVCLDEFEIGVEAK  198

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRN  403
            +MPC+H +H +C++PWLELH+SCPVCRYELP+D+   E  R 
Sbjct  199  EMPCEHKFHGECLLPWLELHSSCPVCRYELPSDETKTETART  240



>ref|XP_009106871.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Brassica rapa]
 ref|XP_009106872.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Brassica rapa]
Length=312

 Score =   130 bits (326),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 58/102 (57%), Positives = 74/102 (73%), Gaps = 5/102 (5%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
             E L+Q+L +NDPNRYGTPPA K AVE L  +KI +  L     QC+VC D FE+  EAK
Sbjct  144  FEALLQRLTDNDPNRYGTPPAQKEAVEALASVKIQEPTL-----QCSVCLDEFEIGVEAK  198

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRN  403
            +MPC+H +H +C++PWLELH+SCPVCRYELP+D+   E  R 
Sbjct  199  EMPCEHKFHGECLLPWLELHSSCPVCRYELPSDETKTETART  240



>ref|XP_004502170.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X1 
[Cicer arietinum]
 ref|XP_004502171.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X2 
[Cicer arietinum]
Length=367

 Score =   130 bits (328),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 68/151 (45%), Positives = 86/151 (57%), Gaps = 14/151 (9%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            L+ L+Q L ENDPNRYGTPPA K AVE LP +KI + +      QC+VC D FE+  EAK
Sbjct  206  LDLLLQHLAENDPNRYGTPPAPKEAVEALPTVKINENL------QCSVCLDDFEVGSEAK  259

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigg  349
            +MPCKH +H  CI+PWLELH+SCPVCR++L  D+        S+Q +  + +S       
Sbjct  260  EMPCKHRFHSACILPWLELHSSCPVCRFQLRADE--------SKQDSVASRSSRNQREDE  311

Query  348  lggggNQENPQTPRTVERRFRVSLPWLFGGF  256
                 N E     R      R S PW F G 
Sbjct  312  NTVHDNAEGDNEGRNSSGGRRFSFPWPFNGL  342



>ref|XP_009831419.1| hypothetical protein, variant [Aphanomyces astaci]
 gb|ETV78700.1| hypothetical protein, variant [Aphanomyces astaci]
Length=308

 Score =   129 bits (325),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 76/103 (74%), Gaps = 1/103 (1%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            +  +I  LM+NDPN++G PPAAK+ ++ LP + I+Q+ +  +   CAVCKD +EL EEA 
Sbjct  194  ISNIINHLMQNDPNQHGAPPAAKTVLDALPKVHISQDEV-DNKHDCAVCKDVYELKEEAL  252

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNS  400
            ++PC H +H  CI+PWL+ HNSCPVCR+ELPTDD +YE+ R  
Sbjct  253  RLPCAHDFHSHCILPWLKQHNSCPVCRFELPTDDQEYESTRGG  295



>ref|XP_002894508.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70767.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=346

 Score =   130 bits (327),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 71/95 (75%), Gaps = 6/95 (6%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
             E L+Q+L ENDPNRYGTPPA K AVE L  +KI       D+ QC+VC D FE+  EAK
Sbjct  184  FEMLLQRLAENDPNRYGTPPAKKEAVEALGTVKI------EDTLQCSVCLDDFEIGTEAK  237

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDP  424
             MPC+H +H DC++PWLE+H+SCPVCRY+LP D+P
Sbjct  238  LMPCEHKFHGDCLLPWLEIHSSCPVCRYQLPADEP  272



>ref|XP_007205383.1| hypothetical protein PRUPE_ppa007335mg [Prunus persica]
 gb|EMJ06582.1| hypothetical protein PRUPE_ppa007335mg [Prunus persica]
Length=372

 Score =   130 bits (328),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 75/105 (71%), Gaps = 8/105 (8%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            L+ L+Q L ENDPNRYGTPPA K AVE LP + I + +      QC+VC D FE   EAK
Sbjct  202  LDLLLQHLAENDPNRYGTPPAQKEAVEALPTVTIKENL------QCSVCLDDFEAGVEAK  255

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDP--DYENRRNS  400
            +MPCKH +H  CI+PWLELH+SCPVCR++LP D+   D +N RNS
Sbjct  256  EMPCKHKFHSGCILPWLELHSSCPVCRFQLPADESKRDSDNSRNS  300



>ref|XP_008220737.1| PREDICTED: E3 ubiquitin-protein ligase CIP8-like [Prunus mume]
 ref|XP_008220813.1| PREDICTED: E3 ubiquitin-protein ligase CIP8-like [Prunus mume]
Length=370

 Score =   130 bits (328),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 75/105 (71%), Gaps = 8/105 (8%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            L+ L+Q L ENDPNRYGTPPA K AVE LP + I + +      QC+VC D FE   EAK
Sbjct  200  LDLLLQHLAENDPNRYGTPPAQKEAVEALPTVTIKENL------QCSVCLDDFEAGVEAK  253

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDP--DYENRRNS  400
            +MPCKH +H  CI+PWLELH+SCPVCR++LP D+   D +N RNS
Sbjct  254  EMPCKHKFHSGCILPWLELHSSCPVCRFQLPADESKRDSDNSRNS  298



>ref|XP_002303979.2| zinc finger family protein [Populus trichocarpa]
 gb|EEE78958.2| zinc finger family protein [Populus trichocarpa]
Length=388

 Score =   130 bits (328),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 89/148 (60%), Gaps = 7/148 (5%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            L+ L+Q L ENDPNRYGTPPA K A+E LP + + + +      QC+VC D FE+  EA+
Sbjct  212  LDLLLQHLAENDPNRYGTPPAQKEAIEALPTVTVKEPL------QCSVCLDDFEIGAEAR  265

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigg  349
            +MPCKH +H  CI+PWLELH+SCPVCR++LP D+   ++ R+     + ++ S       
Sbjct  266  EMPCKHKFHSGCILPWLELHSSCPVCRHQLPADESKLDSERSRNTFDQRDSESTNSESNI  325

Query  348  lggggNQENPQTPRTVERRFRVSLPWLF  265
              G   +E     R+   R R S PW F
Sbjct  326  SNGINVEEGDGEGRSGNGR-RFSFPWPF  352



>ref|XP_009144743.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Brassica rapa]
Length=334

 Score =   130 bits (326),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 71/94 (76%), Gaps = 5/94 (5%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
             E L+Q+L ENDPNRYGTPPA K  VE L  +KI +  L     QC+VC D FE+  EAK
Sbjct  170  FEALLQRLAENDPNRYGTPPARKEDVESLATVKIQEPSL-----QCSVCLDDFEVGVEAK  224

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDD  427
            QMPCKH +H DC++PWLELH+SCPVCRY+LPTD+
Sbjct  225  QMPCKHNFHADCLLPWLELHSSCPVCRYQLPTDE  258



>ref|XP_009831418.1| hypothetical protein H257_07553 [Aphanomyces astaci]
 gb|ETV78699.1| hypothetical protein H257_07553 [Aphanomyces astaci]
Length=327

 Score =   129 bits (325),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 76/103 (74%), Gaps = 1/103 (1%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            +  +I  LM+NDPN++G PPAAK+ ++ LP + I+Q+ +  +   CAVCKD +EL EEA 
Sbjct  213  ISNIINHLMQNDPNQHGAPPAAKTVLDALPKVHISQDEV-DNKHDCAVCKDVYELKEEAL  271

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNS  400
            ++PC H +H  CI+PWL+ HNSCPVCR+ELPTDD +YE+ R  
Sbjct  272  RLPCAHDFHSHCILPWLKQHNSCPVCRFELPTDDQEYESTRGG  314



>ref|XP_008614288.1| hypothetical protein SDRG_10094 [Saprolegnia diclina VS20]
 gb|EQC32347.1| hypothetical protein SDRG_10094 [Saprolegnia diclina VS20]
Length=310

 Score =   129 bits (324),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 75/101 (74%), Gaps = 1/101 (1%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            +  +I  LM+NDP ++G PPA+KS VE LP + IT+E +A +   CAVCKD F + +E +
Sbjct  195  ISTIINHLMQNDPTQHGAPPASKSVVESLPVVHITEEDVAKNQ-DCAVCKDMFAVKDEIR  253

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRR  406
            ++PC H +H DCI+PWL  HNSCPVCR+ELPTDD +YEN +
Sbjct  254  RLPCTHDFHPDCILPWLAQHNSCPVCRFELPTDDQEYENHK  294



>emb|CDY08249.1| BnaA05g13700D [Brassica napus]
Length=335

 Score =   129 bits (325),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 71/94 (76%), Gaps = 5/94 (5%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
             E L+Q+L ENDPNRYGTPPA K  VE L  +KI +  L     QC+VC D FE+  EAK
Sbjct  170  FEALLQRLAENDPNRYGTPPARKEDVESLATVKIQEPSL-----QCSVCLDDFEVGVEAK  224

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDD  427
            QMPCKH +H DC++PWLELH+SCPVCRY+LPTD+
Sbjct  225  QMPCKHNFHADCLLPWLELHSSCPVCRYQLPTDE  258



>ref|XP_006829824.1| hypothetical protein AMTR_s00119p00089020 [Amborella trichopoda]
 gb|ERM97240.1| hypothetical protein AMTR_s00119p00089020 [Amborella trichopoda]
Length=337

 Score =   129 bits (325),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 66/153 (43%), Positives = 89/153 (58%), Gaps = 20/153 (13%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            L+ L+Q L ENDPNRYGTPPA K AVE LP +K        +S +C++C + FE+  EA+
Sbjct  179  LDLLLQHLAENDPNRYGTPPATKEAVEALPTVK------TGESERCSICIEDFEVGAEAR  232

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigg  349
            ++PCKH +H  CI+PWLELH+SCPVCR++LP D+        +                 
Sbjct  233  ELPCKHKFHSGCILPWLELHSSCPVCRFQLPADESKLPQGTGTNSSN-------------  279

Query  348  lggggNQENPQTPRTVERRFRVSLPWLFGGFGS  250
             GG G ++N +  R   RRF V +PW F G  S
Sbjct  280  -GGDGGEQNGEGERENNRRFWVPVPWPFNGLFS  311



>ref|XP_004141480.1| PREDICTED: uncharacterized protein LOC101208708 [Cucumis sativus]
Length=415

 Score =   130 bits (328),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 79/107 (74%), Gaps = 2/107 (2%)
 Frame = -2

Query  705  EQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKI-TQEMLASDSSQCAVCKDSFELDEEAK  529
            + L  Q +END    G+PPAAKSAVE LP +++ T+  LA +   CAVCKD F ++E+ +
Sbjct  293  DTLFGQFVENDNALKGSPPAAKSAVENLPLVELKTENTLAEEVVVCAVCKDKFSMEEKVR  352

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPT  388
            ++PC H YH DCI+PWL + N+CPVCR+ELPTDDPDYE RR SQ+ +
Sbjct  353  KLPCGHYYHDDCILPWLNIRNTCPVCRHELPTDDPDYE-RRQSQRAS  398



>ref|XP_010501167.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Camelina sativa]
Length=355

 Score =   130 bits (326),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 56/95 (59%), Positives = 71/95 (75%), Gaps = 6/95 (6%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
             E L+Q+L ENDPNRYGTPPA K AVE L  +K+ + +      QC+VC D FE+  EAK
Sbjct  192  FEMLVQRLAENDPNRYGTPPAKKEAVEALSTVKMEETL------QCSVCLDDFEIGTEAK  245

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDP  424
             MPCKH +H DC++PWLELH+SCPVCR++LP D+P
Sbjct  246  LMPCKHKFHADCLLPWLELHSSCPVCRFQLPADEP  280



>gb|KGN52539.1| hypothetical protein Csa_5G642700 [Cucumis sativus]
Length=432

 Score =   130 bits (328),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 79/107 (74%), Gaps = 2/107 (2%)
 Frame = -2

Query  705  EQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKI-TQEMLASDSSQCAVCKDSFELDEEAK  529
            + L  Q +END    G+PPAAKSAVE LP +++ T+  LA +   CAVCKD F ++E+ +
Sbjct  310  DTLFGQFVENDNALKGSPPAAKSAVENLPLVELKTENTLAEEVVVCAVCKDKFSMEEKVR  369

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPT  388
            ++PC H YH DCI+PWL + N+CPVCR+ELPTDDPDYE RR SQ+ +
Sbjct  370  KLPCGHYYHDDCILPWLNIRNTCPVCRHELPTDDPDYE-RRQSQRAS  415



>ref|XP_004156174.1| PREDICTED: uncharacterized protein LOC101225971 [Cucumis sativus]
Length=417

 Score =   130 bits (328),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 79/107 (74%), Gaps = 2/107 (2%)
 Frame = -2

Query  705  EQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKI-TQEMLASDSSQCAVCKDSFELDEEAK  529
            + L  Q +END    G+PPAAKSAVE LP +++ T+  LA +   CAVCKD F ++E+ +
Sbjct  295  DTLFGQFVENDNALKGSPPAAKSAVENLPLVELKTENTLAEEVVVCAVCKDKFSMEEKVR  354

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPT  388
            ++PC H YH DCI+PWL + N+CPVCR+ELPTDDPDYE RR SQ+ +
Sbjct  355  KLPCGHYYHDDCILPWLNIRNTCPVCRHELPTDDPDYE-RRQSQRAS  400



>ref|XP_004149638.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Cucumis sativus]
 ref|XP_004166543.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Cucumis sativus]
 gb|KGN54015.1| hypothetical protein Csa_4G267990 [Cucumis sativus]
Length=362

 Score =   129 bits (325),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 73/94 (78%), Gaps = 2/94 (2%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            L+ L+Q + ENDPNRYGTPPA K AV+ LP +++  E+      QC+VC D FE+DEEAK
Sbjct  200  LDLLLQHIAENDPNRYGTPPAQKEAVDALPTVRV--ELEEDSCLQCSVCLDEFEVDEEAK  257

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDD  427
            +MPCKH +H  CI+PWLELH+SCPVCR++LP D+
Sbjct  258  EMPCKHKFHTGCILPWLELHSSCPVCRHQLPGDE  291



>emb|CDY56022.1| BnaA08g29290D [Brassica napus]
Length=313

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 73/102 (72%), Gaps = 5/102 (5%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
             E L+Q+  +NDPNRYGTPPA K AVE L  +KI +  L     QC+VC D FE+  EAK
Sbjct  145  FEALLQRFTDNDPNRYGTPPAQKEAVEALASVKILEPTL-----QCSVCLDDFEIGVEAK  199

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRN  403
            +MPC+H +H +C++PWLELH+SCPVCRYELP+D+   E  R 
Sbjct  200  EMPCEHKFHGECLLPWLELHSSCPVCRYELPSDETKTETART  241



>ref|XP_010483111.1| PREDICTED: E3 ubiquitin-protein ligase RNF126-like [Camelina 
sativa]
Length=409

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 74/155 (48%), Positives = 95/155 (61%), Gaps = 11/155 (7%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            L+ L+Q L ENDPNR GTPPA K AVE LP +KIT+ +      QC+VC D FE   EAK
Sbjct  231  LDLLLQHLAENDPNRQGTPPARKEAVEALPTVKITEPL------QCSVCLDDFEKGTEAK  284

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPT--DDPDYENRRNSQQP--TRnnnnsfgl  361
            +MPCKH +H  CI+PWLELH+SCPVCR+ELP+  DD D     ++++P  TRN  ++   
Sbjct  285  EMPCKHKFHIRCIVPWLELHSSCPVCRFELPSSADDDDETKTDSTERPPRTRNVRDTNNR  344

Query  360  gigglggggNQENPQTPRTVERRFRVSLPWLFGGF  256
             +    G G +      R+   R R S PW F G 
Sbjct  345  NVVESVGSGERGREDDARSGNGR-RFSFPWPFSGL  378



>gb|ADN34278.1| zinc finger protein [Cucumis melo subsp. melo]
Length=409

 Score =   130 bits (326),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 79/107 (74%), Gaps = 2/107 (2%)
 Frame = -2

Query  705  EQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKI-TQEMLASDSSQCAVCKDSFELDEEAK  529
            + L  Q +END    G+PPAAKSAVE LP +++ T+  LA +   CAVCKD F ++E+ +
Sbjct  287  DTLFGQFVENDNALKGSPPAAKSAVENLPLVELKTENTLAEEVVVCAVCKDKFSMEEKVR  346

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPT  388
            ++PC H YH DCI+PWL + N+CPVCR+ELPTDDPDYE RR SQ+ +
Sbjct  347  KLPCGHYYHDDCILPWLNIRNTCPVCRHELPTDDPDYE-RRQSQRGS  392



>gb|ACU20614.1| unknown [Glycine max]
Length=188

 Score =   125 bits (314),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 84/148 (57%), Gaps = 13/148 (9%)
 Frame = -2

Query  699  LIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAKQMP  520
            L+Q L ENDPNRYGTPPA K A+E LP + I +      +SQC+VC D FE+  EAK+MP
Sbjct  45   LLQHLAENDPNRYGTPPAQKEAIEALPTVIINE------NSQCSVCLDDFEVGSEAKEMP  98

Query  519  CKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigglgg  340
            CKH +H  CI+PWLELH+SCPVCR +LP D+       + Q    + ++        +  
Sbjct  99   CKHRFHSGCILPWLELHSSCPVCRLQLPLDE-------SKQDSDLSRDSRSQREDESIEH  151

Query  339  ggNQENPQTPRTVERRFRVSLPWLFGGF  256
              ++E     R      R S PW F G 
Sbjct  152  DNDEERDGEGRNASGGRRFSFPWPFNGL  179



>ref|XP_010257723.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Nelumbo nucifera]
 ref|XP_010257724.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Nelumbo nucifera]
Length=353

 Score =   129 bits (324),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 67/153 (44%), Positives = 91/153 (59%), Gaps = 12/153 (8%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            L+ L+Q L ENDPNRYGTPPA K AVE +P +KIT+ +      QC+VC D  E+  EAK
Sbjct  184  LDLLLQHLAENDPNRYGTPPAQKEAVEAMPTVKITENL------QCSVCLDDLEIGTEAK  237

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigg  349
            +MPCKH +H  CI+PWL+LH+SCP+CR+ +P D+    +  +     R      G    G
Sbjct  238  EMPCKHKFHSGCILPWLKLHSSCPICRFRIPADESKLASDGSGNSENR------GENSSG  291

Query  348  lggggNQENPQTPRTVERRFRVSLPWLFGGFGS  250
            +G  G + + +      RRF V +PW F G  S
Sbjct  292  VGPRGGEGSEEGGNGNGRRFWVPIPWPFNGLFS  324



>gb|KDP31400.1| hypothetical protein JCGZ_11776 [Jatropha curcas]
Length=497

 Score =   130 bits (328),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 74/106 (70%), Gaps = 0/106 (0%)
 Frame = -2

Query  705  EQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAKQ  526
            E L  Q  EN+    G PPAAKS VE LP + +T   L S+++ CAVCKD   + E+AKQ
Sbjct  386  EMLFGQFAENENALMGRPPAAKSVVEKLPSVVLTNVDLESNNALCAVCKDEINVGEKAKQ  445

Query  525  MPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPT  388
            +PC H+YH +CI+PWL + N+CPVCRYELPTDD DYE R+ +Q+  
Sbjct  446  LPCTHLYHGECIVPWLRIRNTCPVCRYELPTDDADYERRKAAQRAV  491



>ref|XP_010044920.1| PREDICTED: E3 ubiquitin-protein ligase CIP8-like [Eucalyptus 
grandis]
 gb|KCW87039.1| hypothetical protein EUGRSUZ_B03585 [Eucalyptus grandis]
 gb|KCW87040.1| hypothetical protein EUGRSUZ_B03585 [Eucalyptus grandis]
Length=379

 Score =   129 bits (325),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 74/107 (69%), Gaps = 8/107 (7%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            L+ L+Q L ENDPNRYGTPPA K AVE +P + I + +      QC+VC D FE+  EAK
Sbjct  206  LDMLLQHLAENDPNRYGTPPAQKEAVESMPTVTIKENL------QCSVCLDDFEIGAEAK  259

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDP--DYENRRNSQQ  394
            +MPCKH +H  CI+PWLELH+SCPVCR++LP D+   D +  RN   
Sbjct  260  EMPCKHKFHSGCILPWLELHSSCPVCRFQLPADESKLDSDGSRNGNN  306



>ref|XP_008459416.1| PREDICTED: uncharacterized protein LOC103498560 [Cucumis melo]
Length=426

 Score =   130 bits (326),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 79/107 (74%), Gaps = 2/107 (2%)
 Frame = -2

Query  705  EQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKI-TQEMLASDSSQCAVCKDSFELDEEAK  529
            + L  Q +END    G+PPAAKSAVE LP +++ T+  LA +   CAVCKD F ++E+ +
Sbjct  304  DTLFGQFVENDNALKGSPPAAKSAVENLPLVELKTENTLAEEVVVCAVCKDKFSMEEKVR  363

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPT  388
            ++PC H YH DCI+PWL + N+CPVCR+ELPTDDPDYE RR SQ+ +
Sbjct  364  KLPCGHYYHDDCILPWLNIRNTCPVCRHELPTDDPDYE-RRQSQRGS  409



>ref|XP_010922808.1| PREDICTED: E3 ubiquitin-protein ligase Praja-1 [Elaeis guineensis]
 ref|XP_010922809.1| PREDICTED: E3 ubiquitin-protein ligase Praja-1 [Elaeis guineensis]
 ref|XP_010922810.1| PREDICTED: E3 ubiquitin-protein ligase Praja-1 [Elaeis guineensis]
 ref|XP_010922812.1| PREDICTED: E3 ubiquitin-protein ligase Praja-1 [Elaeis guineensis]
Length=538

 Score =   130 bits (328),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/102 (57%), Positives = 74/102 (73%), Gaps = 0/102 (0%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
             E+L++QL END +R G PPAA S V  LP + I+ +   + S  CAVCKD   ++ EAK
Sbjct  312  FEELLEQLAENDGSRRGAPPAAASFVASLPSVIISMDHERNGSLICAVCKDPLPINTEAK  371

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRN  403
            Q+PCKH+YH  CI+PWL   NSCPVCRYELPTDDP+YE +R+
Sbjct  372  QLPCKHLYHPSCILPWLAARNSCPVCRYELPTDDPEYEGKRS  413



>ref|XP_010536808.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Tarenaya hassleriana]
 ref|XP_010536809.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Tarenaya hassleriana]
Length=368

 Score =   129 bits (324),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 70/92 (76%), Gaps = 6/92 (7%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            L+ L+Q L ENDPNR GTPPA K AVE LP++KI++ +      QC+VC D FE  EEAK
Sbjct  194  LDLLLQHLSENDPNRQGTPPAGKEAVEALPNVKISEPL------QCSVCLDDFEKGEEAK  247

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPT  433
            +MPCKH YH  CI+PWLELH+SCPVCRYELP 
Sbjct  248  EMPCKHKYHSRCILPWLELHSSCPVCRYELPV  279



>gb|AFG67327.1| hypothetical protein 2_7298_01, partial [Pinus taeda]
 gb|AFG67332.1| hypothetical protein 2_7298_01, partial [Pinus taeda]
 gb|AFG67335.1| hypothetical protein 2_7298_01, partial [Pinus taeda]
Length=132

 Score =   123 bits (309),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 74/98 (76%), Gaps = 3/98 (3%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LEQL+Q+L E+D  R G PPA++++V+ L ++K + +       QCAVCKD FEL + AK
Sbjct  36   LEQLLQELSESDTGRRGPPPASRASVDALEEVKASGK---DAVGQCAVCKDEFELGKYAK  92

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYE  415
            +MPC H+YH DCI+PWL  HNSCPVCRYE+PTDD +Y+
Sbjct  93   RMPCNHVYHADCILPWLARHNSCPVCRYEMPTDDLEYD  130



>ref|XP_007014039.1| RING/U-box superfamily protein, putative isoform 5, partial [Theobroma 
cacao]
 gb|EOY31658.1| RING/U-box superfamily protein, putative isoform 5, partial [Theobroma 
cacao]
Length=310

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 72/101 (71%), Gaps = 6/101 (6%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            L+ L+Q L ENDPNRYGTPPA K A+E +P +KI + +      QC+VC D FE   EA+
Sbjct  201  LDLLLQHLAENDPNRYGTPPAQKEAIEAMPTVKIEENL------QCSVCLDDFEAGSEAR  254

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRR  406
            +MPCKH +H  CI+PWLELH+SCPVCRY++P D+   +  R
Sbjct  255  EMPCKHKFHSGCILPWLELHSSCPVCRYQMPADESKLDTER  295



>ref|XP_009120153.1| PREDICTED: E3 ubiquitin-protein ligase RNF126-like [Brassica 
rapa]
Length=352

 Score =   129 bits (323),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 81/110 (74%), Gaps = 8/110 (7%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFE--LDEE  535
            L+ L+Q L ENDPNR GTPPA K  V+ LP +KIT  +L     QC+VC D FE  ++EE
Sbjct  194  LDLLLQHLAENDPNRQGTPPARKEVVDALPTVKITDPLL-----QCSVCLDEFEKGVEEE  248

Query  534  AKQMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTR  385
            AK+MPCKH +H  CI+PWLELH+SCPVCR+ELP+ D D  ++  S++PTR
Sbjct  249  AKEMPCKHKFHVKCIVPWLELHSSCPVCRFELPSADGD-GSKVESERPTR  297



>emb|CDP18575.1| unnamed protein product [Coffea canephora]
Length=384

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 68/151 (45%), Positives = 90/151 (60%), Gaps = 10/151 (7%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            L+ L+Q L ENDPNRYGTPPA K AVE +P + + +      +SQC+VC + FE+  EAK
Sbjct  216  LDLLLQHLAENDPNRYGTPPAQKEAVEAMPSVTVEE------TSQCSVCLEDFEIGAEAK  269

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigg  349
            +MPCKH +H  CI+PWLELH+SCPVCRY+LP+D+   E+R +      N+         G
Sbjct  270  EMPCKHRFHVGCILPWLELHSSCPVCRYQLPSDESKLESRVSRNGSNNNDAGGNNAAASG  329

Query  348  lggggNQENPQTPRTVERRFRVSLPWLFGGF  256
              GG      +      RRF + LPW F   
Sbjct  330  SEGGEGGGRSEN----TRRFSLPLPWPFSSL  356



>ref|XP_002465271.1| hypothetical protein SORBIDRAFT_01g035310 [Sorghum bicolor]
 gb|EER92269.1| hypothetical protein SORBIDRAFT_01g035310 [Sorghum bicolor]
Length=285

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 73/92 (79%), Gaps = 3/92 (3%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            L+ LI+QL +ND  R G PPAA+S+++ +P +KITQ  L+ DS  C VCK+ FEL  EA+
Sbjct  145  LDDLIEQLTQND--RRGPPPAAQSSIDAMPTVKITQRHLSGDS-HCPVCKEKFELGSEAR  201

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPT  433
            +MPCKH+YH DCI+PWLE HNSCPVCRYELPT
Sbjct  202  EMPCKHLYHSDCIVPWLEQHNSCPVCRYELPT  233



>ref|XP_003601604.1| RING finger protein [Medicago truncatula]
Length=352

 Score =   128 bits (322),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 67/151 (44%), Positives = 87/151 (58%), Gaps = 12/151 (8%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            L+ L+Q L ENDPNRYGTPPA K AVE LP +KI + +      QC+VC D FE+  EAK
Sbjct  194  LDLLLQHLSENDPNRYGTPPAPKEAVESLPTVKINENL------QCSVCLDDFEVGSEAK  247

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigg  349
            +MPCKH +H  CI+PWLELH+SCPVCR +L  D+P  ++  +     + ++   G     
Sbjct  248  EMPCKHRFHSACILPWLELHSSCPVCRSQLRVDEPKQDSDVSRNHRNQRDDEIIGHANAN  307

Query  348  lggggNQENPQTPRTVERRFRVSLPWLFGGF  256
              G     +P   R      R S PW F G 
Sbjct  308  AEGDSEGRSPSGGR------RFSFPWPFNGL  332



>ref|NP_564693.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
 gb|AAL11572.1|AF424578_1 At1g55530/T5A14_7 [Arabidopsis thaliana]
 gb|AAD10644.1| Unknown protein [Arabidopsis thaliana]
 gb|AAK62663.1| At1g55530/T5A14_7 [Arabidopsis thaliana]
 gb|AAN18071.1| At1g55530/T5A14_7 [Arabidopsis thaliana]
 gb|AEE33259.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
Length=351

 Score =   128 bits (322),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 69/94 (73%), Gaps = 6/94 (6%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
             E L+Q+L ENDPNRYGTPPA K AVE L  +KI + +      QC+VC D FE+  EAK
Sbjct  184  FEMLLQRLAENDPNRYGTPPAKKEAVEALATVKIEETL------QCSVCLDDFEIGTEAK  237

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDD  427
             MPC H +H DC++PWLELH+SCPVCRY+LP D+
Sbjct  238  LMPCTHKFHSDCLLPWLELHSSCPVCRYQLPADE  271



>gb|EYU44258.1| hypothetical protein MIMGU_mgv1a026933mg [Erythranthe guttata]
Length=417

 Score =   129 bits (324),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 76/106 (72%), Gaps = 3/106 (3%)
 Frame = -2

Query  705  EQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQ---CAVCKDSFELDEE  535
            + L  QL+EN+    G+PPAAKS VE LP + +T+E    D +    CAVCKD F LDE 
Sbjct  294  DALFGQLVENENALKGSPPAAKSVVENLPLVVLTKEEFGGDDNNVAACAVCKDEFALDES  353

Query  534  AKQMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQ  397
              ++PC H+YH +CI+PWL++ N+CPVCRYELPTDD DYE RR+++
Sbjct  354  VAKLPCCHLYHGECILPWLDIRNTCPVCRYELPTDDADYEKRRSNR  399



>gb|AES71855.2| zinc finger, C3HC4 type (RING finger) protein [Medicago truncatula]
Length=356

 Score =   128 bits (322),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 67/151 (44%), Positives = 87/151 (58%), Gaps = 12/151 (8%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            L+ L+Q L ENDPNRYGTPPA K AVE LP +KI + +      QC+VC D FE+  EAK
Sbjct  198  LDLLLQHLSENDPNRYGTPPAPKEAVESLPTVKINENL------QCSVCLDDFEVGSEAK  251

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigg  349
            +MPCKH +H  CI+PWLELH+SCPVCR +L  D+P  ++  +     + ++   G     
Sbjct  252  EMPCKHRFHSACILPWLELHSSCPVCRSQLRVDEPKQDSDVSRNHRNQRDDEIIGHANAN  311

Query  348  lggggNQENPQTPRTVERRFRVSLPWLFGGF  256
              G     +P   R      R S PW F G 
Sbjct  312  AEGDSEGRSPSGGR------RFSFPWPFNGL  336



>gb|AEW08366.1| hypothetical protein 2_7298_01, partial [Pinus radiata]
 gb|AFG67326.1| hypothetical protein 2_7298_01, partial [Pinus taeda]
 gb|AFG67328.1| hypothetical protein 2_7298_01, partial [Pinus taeda]
 gb|AFG67329.1| hypothetical protein 2_7298_01, partial [Pinus taeda]
 gb|AFG67330.1| hypothetical protein 2_7298_01, partial [Pinus taeda]
 gb|AFG67331.1| hypothetical protein 2_7298_01, partial [Pinus taeda]
 gb|AFG67333.1| hypothetical protein 2_7298_01, partial [Pinus taeda]
 gb|AFG67334.1| hypothetical protein 2_7298_01, partial [Pinus taeda]
 gb|AFG67336.1| hypothetical protein 2_7298_01, partial [Pinus taeda]
 gb|AFG67338.1| hypothetical protein 2_7298_01, partial [Pinus taeda]
 gb|AFG67339.1| hypothetical protein 2_7298_01, partial [Pinus taeda]
 gb|AFG67340.1| hypothetical protein 2_7298_01, partial [Pinus taeda]
 gb|AFG67341.1| hypothetical protein 2_7298_01, partial [Pinus taeda]
 gb|AFG67342.1| hypothetical protein 2_7298_01, partial [Pinus taeda]
 gb|AFG67343.1| hypothetical protein 2_7298_01, partial [Pinus taeda]
Length=132

 Score =   122 bits (307),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 74/98 (76%), Gaps = 3/98 (3%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LEQL+Q+L E+D  R G PPA++++V+ L ++K + +       QCAVCKD FEL + AK
Sbjct  36   LEQLLQELSESDTGRRGPPPASRASVDALEEVKASGK---DAVGQCAVCKDEFELGKYAK  92

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYE  415
            +MPC H+YH DCI+PWL  HNSCPVCRYE+PTDD +Y+
Sbjct  93   RMPCNHMYHADCILPWLARHNSCPVCRYEMPTDDLEYD  130



>ref|XP_009415542.1| PREDICTED: E3 ubiquitin-protein ligase CIP8-like [Musa acuminata 
subsp. malaccensis]
Length=382

 Score =   129 bits (323),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 73/97 (75%), Gaps = 0/97 (0%)
 Frame = -2

Query  705  EQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAKQ  526
            E L  Q +E+D N  G+PPAAKS +E LP + +T+E +A  ++ CAVCKD   + E  KQ
Sbjct  257  EVLFGQFVEHDSNFKGSPPAAKSVIESLPSVLLTEEDVAKANALCAVCKDGILVGERVKQ  316

Query  525  MPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYE  415
            +PC H+YH+DCI+PWL + N+CPVCR+ELPTDDP+YE
Sbjct  317  LPCCHLYHEDCILPWLGIRNTCPVCRFELPTDDPEYE  353



>gb|EMT01795.1| RING finger protein 126 [Aegilops tauschii]
Length=266

 Score =   126 bits (317),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 57/92 (62%), Positives = 70/92 (76%), Gaps = 3/92 (3%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LE LI+QL  ND  R G PPA++S+++ +P ++IT   L  DS  C VCKD FEL  EA+
Sbjct  123  LEDLIEQLTHND--RRGPPPASQSSIDAMPSVRITARHLTGDS-HCPVCKDKFELGSEAR  179

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPT  433
            +MPCKH+YH DCI+PWLE HNSCPVCRYELPT
Sbjct  180  EMPCKHLYHSDCILPWLEQHNSCPVCRYELPT  211



>ref|XP_007014035.1| RING/U-box superfamily protein isoform 1 [Theobroma cacao]
 ref|XP_007014036.1| RING/U-box superfamily protein isoform 1 [Theobroma cacao]
 ref|XP_007014037.1| RING/U-box superfamily protein isoform 1 [Theobroma cacao]
 ref|XP_007014038.1| RING/U-box superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY31654.1| RING/U-box superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY31655.1| RING/U-box superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY31656.1| RING/U-box superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY31657.1| RING/U-box superfamily protein isoform 1 [Theobroma cacao]
Length=367

 Score =   128 bits (322),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 72/101 (71%), Gaps = 6/101 (6%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            L+ L+Q L ENDPNRYGTPPA K A+E +P +KI + +      QC+VC D FE   EA+
Sbjct  201  LDLLLQHLAENDPNRYGTPPAQKEAIEAMPTVKIEENL------QCSVCLDDFEAGSEAR  254

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRR  406
            +MPCKH +H  CI+PWLELH+SCPVCRY++P D+   +  R
Sbjct  255  EMPCKHKFHSGCILPWLELHSSCPVCRYQMPADESKLDTER  295



>emb|CDM85845.1| unnamed protein product [Triticum aestivum]
Length=288

 Score =   127 bits (318),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 57/92 (62%), Positives = 71/92 (77%), Gaps = 3/92 (3%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LE LI+QL  ND  R G PPA++S+++ +P ++IT   L  DS  C VCKD FEL+ EA+
Sbjct  146  LEDLIEQLTHND--RRGPPPASQSSIDAMPSVRITARHLTGDS-HCPVCKDKFELESEAR  202

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPT  433
            +MPCKH+YH DCI+PWLE HNSCPVCRYELPT
Sbjct  203  EMPCKHLYHSDCILPWLEQHNSCPVCRYELPT  234



>ref|XP_002514591.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF47697.1| zinc finger protein, putative [Ricinus communis]
Length=479

 Score =   129 bits (324),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 75/106 (71%), Gaps = 0/106 (0%)
 Frame = -2

Query  705  EQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAKQ  526
            E L  Q  EN+ +    PPAAKS VE LP + +T+E + S+++ CAVCKD   + E+AKQ
Sbjct  368  EMLFGQFAENENSLIVRPPAAKSVVEKLPSVVLTKEDVESNNALCAVCKDEINVGEKAKQ  427

Query  525  MPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPT  388
            +PC H YH DCI+PWL + N+CPVCRYELPTDD DYE R+ +Q+  
Sbjct  428  LPCTHRYHGDCILPWLGIRNTCPVCRYELPTDDADYERRKAAQRAV  473



>emb|CDY22483.1| BnaC03g22930D [Brassica napus]
Length=303

 Score =   127 bits (318),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 57/92 (62%), Positives = 65/92 (71%), Gaps = 0/92 (0%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LE+L +QL      R G PPA +S+++ LP IKI Q  L S  S CAVCKD FEL  EAK
Sbjct  136  LEELFEQLSAGTTTRSGPPPAPRSSIDALPTIKIAQRHLRSSDSNCAVCKDEFELGAEAK  195

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPT  433
            QMPC HIYH DCI+PWL  HNSCPVCR ELP+
Sbjct  196  QMPCNHIYHSDCIVPWLVQHNSCPVCRQELPS  227



>ref|XP_011089756.1| PREDICTED: E3 ubiquitin-protein ligase CIP8-like isoform X2 [Sesamum 
indicum]
Length=379

 Score =   128 bits (321),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 67/148 (45%), Positives = 88/148 (59%), Gaps = 16/148 (11%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            L+ L+Q L ENDPNRYGTPPA K AVE LP +K+ + +      QC+VC D  E+  E K
Sbjct  206  LDLLLQHLSENDPNRYGTPPAQKEAVEALPTVKVEETL------QCSVCLDDCEIGTEVK  259

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDD--PDYENRRNSQQPTRnnnnsfglgi  355
            +MPCKH +H  CI+PWLELH+SCP+CRY++P D+   D E  RN+   +    +      
Sbjct  260  EMPCKHKFHSSCILPWLELHSSCPICRYQIPCDELKLDAEGTRNNNTNSSQEISIDNNNA  319

Query  354  gglggggNQENPQTPRTVERRFRVSLPW  271
            G  G   N+          R+F VSLPW
Sbjct  320  GNGGDDRNENG--------RQFSVSLPW  339



>emb|CDY22790.1| BnaA06g02870D [Brassica napus]
Length=270

 Score =   126 bits (316),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 73/94 (78%), Gaps = 3/94 (3%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LE LIQQL E+DPNRYG PPA+KSAV+ LP +K+T   + S+ +QCAVC D FE     K
Sbjct  128  LEDLIQQLGEDDPNRYGPPPASKSAVDALPTVKVT---MRSEMNQCAVCTDEFEDGVSVK  184

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDD  427
            +MPC H+YH+DC++PWL + N+CPVCR+EL TDD
Sbjct  185  EMPCGHVYHQDCLIPWLRMRNTCPVCRHELRTDD  218



>ref|XP_008351262.1| PREDICTED: E3 ubiquitin-protein ligase CIP8-like [Malus domestica]
 ref|XP_008351269.1| PREDICTED: E3 ubiquitin-protein ligase CIP8-like [Malus domestica]
Length=378

 Score =   128 bits (321),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 75/103 (73%), Gaps = 10/103 (10%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            L+ L+Q L ENDPNRYGTPPA K AVE LP + I + +      QC+VC D FE+  EAK
Sbjct  203  LDLLLQHLAENDPNRYGTPPAQKEAVEALPTVTIKENL------QCSVCLDDFEVGXEAK  256

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNS  400
            +MPCKH +H  CI+PWLELH+SCPVCR++LP D    E++R+S
Sbjct  257  EMPCKHKFHSGCILPWLELHSSCPVCRFQLPAD----ESKRDS  295



>emb|CDY36794.1| BnaA03g10920D [Brassica napus]
Length=780

 Score =   131 bits (330),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 81/110 (74%), Gaps = 7/110 (6%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            L+ L+Q L ENDPNR GTPPA K AVE LP +K+T+ +L     QC+VC D FE   EAK
Sbjct  609  LDLLLQHLAENDPNRQGTPPARKEAVEALPTVKVTEPLL-----QCSVCLDEFERGVEAK  663

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPT--DDPDYENRRNSQQPTR  385
            +MPCKH +H  CI+PWLE+H+SCPVCR+ELP+  DD D E++  S++ TR
Sbjct  664  EMPCKHKFHVKCIVPWLEIHSSCPVCRFELPSGNDDGDDESKVVSERGTR  713



>ref|XP_010450985.1| PREDICTED: E3 ubiquitin-protein ligase RNF115 isoform X1 [Camelina 
sativa]
 ref|XP_010450991.1| PREDICTED: E3 ubiquitin-protein ligase RNF115 isoform X2 [Camelina 
sativa]
Length=408

 Score =   128 bits (322),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 72/155 (46%), Positives = 92/155 (59%), Gaps = 11/155 (7%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            L+ L+Q L ENDPNR GTPPA K AVE LP +KI + +      QC+VC D FE   EAK
Sbjct  229  LDLLLQHLAENDPNRQGTPPARKEAVEALPTVKIMEPL------QCSVCLDDFEKGTEAK  282

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPT--DDPDYENRRNSQQPTRnnnnsfglgi  355
            +MPCKH +H  CI+PWLELH+SCPVCR+ELP+  DD D     ++++P R  N       
Sbjct  283  EMPCKHKFHICCIVPWLELHSSCPVCRFELPSSADDDDETKTDSTERPVRTRNVRETSNR  342

Query  354  gglggggNQENPQT--PRTVERRFRVSLPWLFGGF  256
              +   G+ E  +    R+   R R S PW F G 
Sbjct  343  NVVESVGSAERGREDDARSGNGR-RFSFPWPFSGL  376



>emb|CDX94901.1| BnaC05g07700D [Brassica napus]
Length=314

 Score =   127 bits (318),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 68/91 (75%), Gaps = 0/91 (0%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LE+LI+QL     +  G PPAAKS+++ LP IKITQ+ L S  S C VCK+ FEL  EAK
Sbjct  146  LEELIEQLSSGISHHRGPPPAAKSSIDALPTIKITQKHLKSSDSHCPVCKEEFELKSEAK  205

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELP  436
            QMPCKH+YH DCI+PWL  HN+CPVCR ELP
Sbjct  206  QMPCKHVYHSDCIVPWLVQHNTCPVCRKELP  236



>ref|XP_011089755.1| PREDICTED: E3 ubiquitin-protein ligase CIP8-like isoform X1 [Sesamum 
indicum]
Length=398

 Score =   128 bits (321),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 67/148 (45%), Positives = 88/148 (59%), Gaps = 16/148 (11%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            L+ L+Q L ENDPNRYGTPPA K AVE LP +K+ + +      QC+VC D  E+  E K
Sbjct  225  LDLLLQHLSENDPNRYGTPPAQKEAVEALPTVKVEETL------QCSVCLDDCEIGTEVK  278

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDD--PDYENRRNSQQPTRnnnnsfglgi  355
            +MPCKH +H  CI+PWLELH+SCP+CRY++P D+   D E  RN+   +    +      
Sbjct  279  EMPCKHKFHSSCILPWLELHSSCPICRYQIPCDELKLDAEGTRNNNTNSSQEISIDNNNA  338

Query  354  gglggggNQENPQTPRTVERRFRVSLPW  271
            G  G   N+          R+F VSLPW
Sbjct  339  GNGGDDRNENG--------RQFSVSLPW  358



>ref|XP_010105294.1| E3 ubiquitin-protein ligase RING1 [Morus notabilis]
 gb|EXC04259.1| E3 ubiquitin-protein ligase RING1 [Morus notabilis]
Length=381

 Score =   128 bits (321),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 57/105 (54%), Positives = 76/105 (72%), Gaps = 8/105 (8%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            L+ L+Q L ENDPNRYGTPPA K AVE LP + I + +      QC+VC D FE+  +AK
Sbjct  204  LDMLLQHLAENDPNRYGTPPAQKEAVEALPTVAIKENL------QCSVCLDDFEIGADAK  257

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDP--DYENRRNS  400
            +MPCKH +H  CI+PWLELH+SCPVCR++LP+++   D +  RN+
Sbjct  258  EMPCKHKFHNGCILPWLELHSSCPVCRFQLPSNESKRDSDGTRNA  302



>emb|CBI24304.3| unnamed protein product [Vitis vinifera]
Length=179

 Score =   123 bits (309),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 68/91 (75%), Gaps = 3/91 (3%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LE+LI+QL  ND  R G PPA +S+++ +P IKITQ  L SDS  C VCKD FEL  EA+
Sbjct  60   LEELIEQLTMND--RRGPPPATRSSIDAMPTIKITQRHLRSDS-HCPVCKDKFELGSEAR  116

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELP  436
            QMPC HIYH DCI+PWL  HNSCPVCR ELP
Sbjct  117  QMPCDHIYHSDCIVPWLVQHNSCPVCRQELP  147



>ref|XP_009339205.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Pyrus x bretschneideri]
 ref|XP_009339206.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Pyrus x bretschneideri]
 ref|XP_009339207.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Pyrus x bretschneideri]
Length=375

 Score =   127 bits (320),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 75/103 (73%), Gaps = 10/103 (10%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            L+ L+Q L ENDPNRYGTPPA K AVE LP + I + M      QC+VC D FE+  EAK
Sbjct  203  LDLLLQHLAENDPNRYGTPPAQKEAVEALPAVTIKENM------QCSVCLDDFEVGVEAK  256

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNS  400
            +MPCKH +H  CI+PWL+LH+SCPVCR++LP D    E++R+S
Sbjct  257  EMPCKHKFHSGCILPWLDLHSSCPVCRFQLPAD----ESKRDS  295



>ref|XP_002864451.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40710.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=395

 Score =   128 bits (321),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 74/154 (48%), Positives = 93/154 (60%), Gaps = 10/154 (6%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            L+ L+Q L ENDPNR GTPPA K AVE LP +KI + +      QC+VC D FE   EAK
Sbjct  218  LDLLLQHLAENDPNRQGTPPARKEAVEALPTVKIMEPL------QCSVCLDDFEKGTEAK  271

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTD-DPDYENRRNSQQP--TRnnnnsfglg  358
            ++PCKH +H  CI+PWLELH+SCPVCR+ELP+  D D E + +S++P  TRN   S    
Sbjct  272  ELPCKHKFHIRCIVPWLELHSSCPVCRFELPSSADDDDETKIDSERPPRTRNVGESNNRN  331

Query  357  igglggggNQENPQTPRTVERRFRVSLPWLFGGF  256
            I    G   +      R+   R R S PW F G 
Sbjct  332  IVENVGNAERGRQDEARSGNGR-RFSFPWPFSGL  364



>ref|XP_006392629.1| hypothetical protein EUTSA_v10012351mg, partial [Eutrema salsugineum]
 gb|ESQ29915.1| hypothetical protein EUTSA_v10012351mg, partial [Eutrema salsugineum]
Length=389

 Score =   128 bits (321),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 73/101 (72%), Gaps = 6/101 (6%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
             E L+Q+L ENDPNRYGTPPA K AVE L  +KI + +      QC+VC D F++  EAK
Sbjct  245  FEMLLQRLAENDPNRYGTPPARKEAVEALASVKIEETL------QCSVCLDDFDIGTEAK  298

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRR  406
            QMPC+H +H +C++PWLELH+SCPVCRY+L  D+   E+ R
Sbjct  299  QMPCEHKFHGECLLPWLELHSSCPVCRYQLHADETKSESVR  339



>dbj|BAA77204.1| ring finger protein [Cicer arietinum]
Length=131

 Score =   122 bits (305),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 69/98 (70%), Gaps = 0/98 (0%)
 Frame = -2

Query  699  LIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAKQMP  520
            L  QL+EN+    G+PP AKS VE LP +++T+E L      CAVCKD   L+E+ +++P
Sbjct  34   LFGQLLENESGLKGSPPTAKSFVENLPLVELTEEELKGKDIVCAVCKDEVMLEEKVRKLP  93

Query  519  CKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRR  406
            C H YH DCI+PWL + N+CPVCR+ELPTDD DYE  +
Sbjct  94   CSHCYHGDCILPWLSIRNTCPVCRFELPTDDADYERSK  131



>gb|KDP20275.1| hypothetical protein JCGZ_06861 [Jatropha curcas]
Length=385

 Score =   127 bits (320),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 92/157 (59%), Gaps = 14/157 (9%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            L+ L+Q L ENDPNRYGTPPA K AV+ +P + + Q +      QCAVC + FE+ EEA+
Sbjct  216  LDLLLQHLAENDPNRYGTPPAQKEAVQAMPIVAVEQSL------QCAVCVEEFEIGEEAR  269

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigg  349
            +MPCKH +H  CI+PWLELH+SCPVCRY++P D+   +   +     R  NN   +G G 
Sbjct  270  EMPCKHKFHGGCIIPWLELHSSCPVCRYQMPCDESKIQESGSRSDGGRMENNEARMGNGV  329

Query  348  lggggNQENPQTPRTVERRFRVSLPWLFGGFGSPAET  238
              G              RR+ V +PW F G  S + T
Sbjct  330  GDGEQVGNG--------RRYWVPVPWPFEGMFSLSPT  358



>ref|NP_197086.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
 emb|CAC01781.1| putative protein [Arabidopsis thaliana]
 gb|AAL15297.1| AT5g15820/F14F8_200 [Arabidopsis thaliana]
 gb|AAM47324.1| AT5g15820/F14F8_200 [Arabidopsis thaliana]
 gb|AED92211.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
Length=348

 Score =   127 bits (318),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 74/98 (76%), Gaps = 0/98 (0%)
 Frame = -2

Query  699  LIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAKQMP  520
            +I Q+ +N+    GTPPA+KS V+GLPD+++T E L+S S  CA+CKD     E+ K++P
Sbjct  249  IIGQMFDNETGIKGTPPASKSVVDGLPDVELTIEELSSVSIVCAICKDEVVFKEKVKRLP  308

Query  519  CKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRR  406
            CKH YH +CI+PWL + N+CPVCR+ELPTDD +YE +R
Sbjct  309  CKHYYHGECIIPWLGIRNTCPVCRHELPTDDLEYERKR  346



>ref|XP_011025108.1| PREDICTED: E3 ubiquitin-protein ligase RNF115-like isoform X2 
[Populus euphratica]
 ref|XP_011025109.1| PREDICTED: E3 ubiquitin-protein ligase RNF115-like isoform X2 
[Populus euphratica]
 ref|XP_011025110.1| PREDICTED: E3 ubiquitin-protein ligase RNF115-like isoform X2 
[Populus euphratica]
Length=373

 Score =   127 bits (319),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 88/148 (59%), Gaps = 7/148 (5%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            L+ L+Q L ENDPNRYGTPPA K A+E LP + + + +      QC+VC D FE+  EA+
Sbjct  197  LDLLLQHLAENDPNRYGTPPAQKEAIEALPTVTVKEPL------QCSVCLDDFEIVAEAR  250

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigg  349
            +MPCKH +H  CI+PWLELH+SCPVCR++LP D+   ++ R+     + ++ S       
Sbjct  251  EMPCKHKFHSGCILPWLELHSSCPVCRHQLPADESKLDSERSRNTLDQRDSESTNSESNI  310

Query  348  lggggNQENPQTPRTVERRFRVSLPWLF  265
              G   QE     R+   R R S  W F
Sbjct  311  SNGINVQEGHGEGRSGNGR-RFSFLWPF  337



>ref|XP_010318505.1| PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin-protein ligase RING1 
[Solanum lycopersicum]
Length=355

 Score =   127 bits (319),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 69/155 (45%), Positives = 90/155 (58%), Gaps = 16/155 (10%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            L+ L+Q L ENDPNRYGTPPA K  VE LP + I + +      QC+VC + FE+  EAK
Sbjct  189  LDVLLQHLAENDPNRYGTPPAQKEVVEALPVVTIDETL------QCSVCLEDFEIGTEAK  242

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigg  349
            +MPC+H +H  CI+PWLELH++CPVCR++L +D+   E+   S                 
Sbjct  243  EMPCRHKFHGGCILPWLELHSTCPVCRHQLLSDESKVESDDGSANTN---------AQSS  293

Query  348  lggggNQENPQTPRTVERRFRVSLPW-LFGGFGSP  247
             G G   E+  T     RRF VSLPW L G F +P
Sbjct  294  NGNGTRYEDEDTRNENGRRFPVSLPWPLSGLFSTP  328



>ref|NP_001050120.1| Os03g0351800 [Oryza sativa Japonica Group]
 gb|ABF95940.1| Zinc finger, C3HC4 type family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF12034.1| Os03g0351800 [Oryza sativa Japonica Group]
 gb|EAZ26918.1| hypothetical protein OsJ_10846 [Oryza sativa Japonica Group]
 dbj|BAG91984.1| unnamed protein product [Oryza sativa Japonica Group]
Length=283

 Score =   125 bits (315),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 71/91 (78%), Gaps = 3/91 (3%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            L+ LI+QL +ND  R G PPA +S+++ +P +KITQ  L+ DS  C VCKD FEL  EA+
Sbjct  145  LDDLIEQLTQND--RRGPPPATQSSIDAMPTVKITQRHLSGDS-HCPVCKDKFELGSEAR  201

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELP  436
            +MPCKH+YH DCI+PWLE HNSCPVCRYELP
Sbjct  202  EMPCKHLYHSDCIVPWLEQHNSCPVCRYELP  232



>ref|XP_010087330.1| E3 ubiquitin-protein ligase RING1 [Morus notabilis]
 gb|EXB28904.1| E3 ubiquitin-protein ligase RING1 [Morus notabilis]
Length=449

 Score =   128 bits (321),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 73/100 (73%), Gaps = 0/100 (0%)
 Frame = -2

Query  705  EQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAKQ  526
            + L  Q  EN+ +  G PPA+K+ VE LP + +TQE + ++++ CAVCKD   + E+AKQ
Sbjct  342  DMLFGQFTENEVDLMGRPPASKTVVENLPSVVLTQEDVENNNALCAVCKDEMGVGEKAKQ  401

Query  525  MPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRR  406
            +PC H YH DCIMPWL + N+CPVCR+ELPTDD DYE RR
Sbjct  402  LPCSHRYHGDCIMPWLGIRNTCPVCRHELPTDDADYERRR  441



>ref|XP_004984362.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Setaria italica]
Length=285

 Score =   125 bits (315),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 57/92 (62%), Positives = 72/92 (78%), Gaps = 3/92 (3%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            L+ LI+QL +ND  R G PPAA+S+++ +P +KITQ  L+ DS  C VCK+ FEL  EA+
Sbjct  145  LDDLIEQLTQND--RRGPPPAAQSSIDAMPTVKITQRHLSGDS-HCPVCKEKFELGSEAR  201

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPT  433
            +MPC H+YH DCI+PWLE HNSCPVCRYELPT
Sbjct  202  EMPCNHLYHSDCIVPWLEQHNSCPVCRYELPT  233



>ref|XP_002523395.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF38974.1| zinc finger protein, putative [Ricinus communis]
Length=394

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 75/104 (72%), Gaps = 6/104 (6%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            L+ L+Q L ENDPNRYGTPPA K A+E LP + I       ++SQC+VC D FE+  EAK
Sbjct  202  LDLLLQHLAENDPNRYGTPPAQKEAIEALPTVTI------KNTSQCSVCLDDFEIGTEAK  255

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQ  397
            +MPCKH +H  CI+PWLELH+SCPVCR++LP ++  +++    Q
Sbjct  256  EMPCKHRFHDVCILPWLELHSSCPVCRFQLPAEESKFDSAERLQ  299



>gb|KDP30629.1| hypothetical protein JCGZ_16194 [Jatropha curcas]
Length=377

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 55/108 (51%), Positives = 76/108 (70%), Gaps = 6/108 (6%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            L+ L+Q L ENDPNRYGTPPA K A+E LP++ I + +      QC+VC D  E+  EAK
Sbjct  185  LDLLLQHLAENDPNRYGTPPALKEAIEALPNVTIKETI------QCSVCLDDLEVGTEAK  238

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTR  385
            +MPCKH +H +C++PWLELH+SCPVCR++LP D+   ++ R+     R
Sbjct  239  EMPCKHKFHSNCLLPWLELHSSCPVCRFQLPADESKSDSERSQNISDR  286



>ref|XP_009794149.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Nicotiana 
sylvestris]
 ref|XP_009794150.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Nicotiana 
sylvestris]
 ref|XP_009794151.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Nicotiana 
sylvestris]
Length=316

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 72/92 (78%), Gaps = 3/92 (3%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            L+QLI+QL  ND  R G PPA +SA++ LP +KITQ  L +DS QC VC+D+FEL  EA+
Sbjct  148  LQQLIEQLSIND--RQGPPPAPRSAIDALPTVKITQRHLNTDS-QCPVCQDNFELGSEAR  204

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPT  433
            QMPCKHIYH DCI+PWL  HNSCPVCR ELP+
Sbjct  205  QMPCKHIYHADCIVPWLVRHNSCPVCRLELPS  236



>ref|XP_002317961.2| hypothetical protein POPTR_0012s06680g [Populus trichocarpa]
 gb|EEE96181.2| hypothetical protein POPTR_0012s06680g [Populus trichocarpa]
Length=423

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 56/106 (53%), Positives = 74/106 (70%), Gaps = 0/106 (0%)
 Frame = -2

Query  705  EQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAKQ  526
            E L  Q MEN+    G PPAAKS VE LP + +T+  + S+++ CAVCKD   + E  KQ
Sbjct  312  ETLFGQFMENENAMMGRPPAAKSVVEKLPSMVVTKGDVESNNAVCAVCKDDTNVGERVKQ  371

Query  525  MPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPT  388
            +PC H YH +CI+PWL + N+CPVCRYELPTDD DYE R+ +++P 
Sbjct  372  LPCMHRYHGECIVPWLGIRNTCPVCRYELPTDDADYERRKVAERPA  417



>ref|XP_006650082.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X1 
[Oryza brachyantha]
 ref|XP_006650083.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X2 
[Oryza brachyantha]
Length=282

 Score =   125 bits (314),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 70/91 (77%), Gaps = 3/91 (3%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            L+ LI+QL +ND  R G PPA +S+++ +P +KITQ  L  DS  C VCKD FEL  EA+
Sbjct  145  LDDLIEQLTQND--RQGPPPATQSSIDAMPTVKITQRHLTGDS-HCPVCKDKFELGSEAR  201

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELP  436
            +MPCKH+YH DCI+PWLE HNSCPVCRYELP
Sbjct  202  EMPCKHLYHSDCIVPWLEQHNSCPVCRYELP  232



>ref|XP_010261518.1| PREDICTED: uncharacterized protein LOC104600329 [Nelumbo nucifera]
Length=481

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 74/107 (69%), Gaps = 0/107 (0%)
 Frame = -2

Query  705  EQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAKQ  526
            E +  Q  E + +  G+PPAAK+ VE LP I +TQ+ + +++  CAVCKD     E+AK+
Sbjct  358  EMIFGQFAETEASLKGSPPAAKTVVENLPSIFLTQDDVQNNNVLCAVCKDEISTSEQAKR  417

Query  525  MPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTR  385
            +PC H YH DCI+PWL + N+CPVCRYELPTDDPDYE RR  +   R
Sbjct  418  LPCSHHYHGDCIIPWLSIRNTCPVCRYELPTDDPDYERRRTQRAGHR  464



>ref|XP_010942240.1| PREDICTED: E3 ubiquitin-protein ligase CIP8-like [Elaeis guineensis]
Length=423

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 72/98 (73%), Gaps = 0/98 (0%)
 Frame = -2

Query  705  EQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAKQ  526
            E L  Q  E + +  G+PPAAKS VE LP + +T+E +A+DS+ CAVCKD   L E AK+
Sbjct  298  EILFGQFTEQNSSIRGSPPAAKSVVENLPSVLVTEEDVANDSTCCAVCKDEISLGEMAKR  357

Query  525  MPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYEN  412
            +PC H YH  CI+PWL + N+CPVCRYELPTDDP+YEN
Sbjct  358  LPCSHHYHGGCIVPWLGIRNTCPVCRYELPTDDPEYEN  395



>ref|XP_009133459.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Brassica rapa]
 emb|CDY35437.1| BnaA03g19230D [Brassica napus]
Length=317

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 57/92 (62%), Positives = 65/92 (71%), Gaps = 0/92 (0%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LE+L +QL      R G PPA +S+++ LP IKI Q  L S  S CAVCKD FEL  EAK
Sbjct  136  LEELFEQLSAGTTTRRGPPPAPRSSIDALPTIKIAQRHLRSSDSNCAVCKDEFELGTEAK  195

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPT  433
            QMPC HIYH DCI+PWL  HNSCPVCR ELP+
Sbjct  196  QMPCNHIYHSDCIVPWLVQHNSCPVCRQELPS  227



>ref|XP_006279491.1| hypothetical protein CARUB_v10026533mg [Capsella rubella]
 gb|EOA12389.1| hypothetical protein CARUB_v10026533mg [Capsella rubella]
Length=399

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 91/151 (60%), Gaps = 10/151 (7%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            L+ L+Q L ENDPNR GTPPA K AVE LP +KI + +      QC+VC D FE   EAK
Sbjct  222  LDLLLQHLAENDPNRQGTPPARKEAVEALPTVKIMEPL------QCSVCLDDFEKGTEAK  275

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELP-TDDPDYENRRNSQQP--TRnnnnsfglg  358
            ++PCKH +H  CI+PWLELH+SCPVCR+ELP T D D E + +S++P  TR    +    
Sbjct  276  ELPCKHKFHIRCIVPWLELHSSCPVCRFELPSTADDDDETKTDSERPPRTRIVRETNNRN  335

Query  357  igglggggNQENPQTPRTVERRFRVSLPWLF  265
            +    G   +      R+   R R S PW F
Sbjct  336  VVENVGNAERGREDDARSGNGR-RFSFPWPF  365



>ref|XP_004228482.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Solanum lycopersicum]
 ref|XP_004228483.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Solanum lycopersicum]
Length=318

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 73/92 (79%), Gaps = 3/92 (3%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            L+QLI+QL  ND  R G PPA +SA++ LP ++ITQ  L+ DS QC+VC+D+FEL  EA+
Sbjct  149  LQQLIEQLSVND--RQGPPPAPRSAIDALPTVRITQRHLSIDS-QCSVCQDNFELGAEAR  205

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPT  433
            QMPCKH+YH DCI+PWL  HNSCPVCR ELP+
Sbjct  206  QMPCKHLYHSDCIVPWLVRHNSCPVCRLELPS  237



>ref|XP_009384344.1| PREDICTED: E3 ubiquitin-protein ligase Praja-2-like isoform X3 
[Musa acuminata subsp. malaccensis]
Length=463

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 76/109 (70%), Gaps = 1/109 (1%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
             E+L++QL E D +R G PPAA S V  LP + ++++     +  CAVCKD   +D EAK
Sbjct  245  FEELLEQLAETDSSRRGAPPAAASFVRTLPSVVVSKDHQRKGTQICAVCKDPLLVDTEAK  304

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYEN-RRNSQQPTR  385
            ++PC+H+YH  CI+PWL + NSCPVCRYELPTDDP+YE  +RN  Q  R
Sbjct  305  RLPCRHLYHPSCILPWLNVRNSCPVCRYELPTDDPEYEEAKRNLNQTER  353



>ref|XP_009384343.1| PREDICTED: E3 ubiquitin-protein ligase Praja-2-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=493

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 76/109 (70%), Gaps = 1/109 (1%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
             E+L++QL E D +R G PPAA S V  LP + ++++     +  CAVCKD   +D EAK
Sbjct  275  FEELLEQLAETDSSRRGAPPAAASFVRTLPSVVVSKDHQRKGTQICAVCKDPLLVDTEAK  334

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYEN-RRNSQQPTR  385
            ++PC+H+YH  CI+PWL + NSCPVCRYELPTDDP+YE  +RN  Q  R
Sbjct  335  RLPCRHLYHPSCILPWLNVRNSCPVCRYELPTDDPEYEEAKRNLNQTER  383



>ref|XP_002882822.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59081.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=294

 Score =   125 bits (314),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 71/97 (73%), Gaps = 6/97 (6%)
 Frame = -2

Query  708  LEQLIQQLMEND-PNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEA  532
             E L+Q+L END  NRYGTPPA K AVE L  +KI + +L     QC+VC D FE+  EA
Sbjct  173  FETLLQRLAENDLNNRYGTPPATKEAVEALAMVKIEESLL-----QCSVCLDDFEIGMEA  227

Query  531  KQMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPD  421
            K+MPCKH +H DC++PWLELH+SCPVCRY LPT D D
Sbjct  228  KEMPCKHKFHSDCLLPWLELHSSCPVCRYLLPTADDD  264



>ref|XP_010443291.1| PREDICTED: E3 ubiquitin-protein ligase RNF126-like [Camelina 
sativa]
Length=404

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 72/155 (46%), Positives = 92/155 (59%), Gaps = 11/155 (7%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            L+ L+Q L ENDPNR GTPPA K AVE LP +KI + +      QC+VC D FE   EAK
Sbjct  222  LDLLLQHLAENDPNRQGTPPARKEAVEALPTVKIMEPL------QCSVCLDDFEKGTEAK  275

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPT--DDPDYENRRNSQQP--TRnnnnsfgl  361
            +MPCKH +H  CI+PWLELH+SCPVCR+ELP+  DD D     ++++P  TRN   +   
Sbjct  276  EMPCKHKFHICCIVPWLELHSSCPVCRFELPSSADDDDETKTDSTERPPRTRNVRETNNR  335

Query  360  gigglggggNQENPQTPRTVERRFRVSLPWLFGGF  256
             +    G   +      R+   R R S PW F G 
Sbjct  336  NVVESVGSAERGREDDARSGNGR-RFSFPWPFSGL  369



>ref|XP_010544579.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X3 
[Tarenaya hassleriana]
Length=347

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 72/93 (77%), Gaps = 2/93 (2%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            LE+LI+QL END  R G PPA +SA+E +P +KIT + L  D SQC+VC + F++  EAK
Sbjct  202  LEELIEQLTEND--RPGLPPAPESAIEAIPTVKITSDHLKKDGSQCSVCLEEFQVGGEAK  259

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTD  430
            ++PC HIYH DCI+PWL LHNSCPVCR+E+P +
Sbjct  260  ELPCTHIYHNDCIVPWLRLHNSCPVCRHEVPLN  292



>ref|XP_007037687.1| Zinc finger protein, putative isoform 2, partial [Theobroma cacao]
 gb|EOY22188.1| Zinc finger protein, putative isoform 2, partial [Theobroma cacao]
Length=446

 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 70/101 (69%), Gaps = 0/101 (0%)
 Frame = -2

Query  705  EQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAKQ  526
            E L  Q  END    G PPA+K  VE LP + +TQE + + ++ CAVCKD   L E+ KQ
Sbjct  339  EMLFGQFTENDNAYIGRPPASKYVVENLPSVVVTQEDVVNGNALCAVCKDEVNLGEKMKQ  398

Query  525  MPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRN  403
            +PC H YH DCI+PWL + N+CPVCR+ELPTDD DYE RR+
Sbjct  399  LPCAHRYHGDCIIPWLGIRNTCPVCRHELPTDDADYERRRS  439



>ref|XP_011025107.1| PREDICTED: E3 ubiquitin-protein ligase RNF115-like isoform X1 
[Populus euphratica]
Length=423

 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 88/148 (59%), Gaps = 7/148 (5%)
 Frame = -2

Query  708  LEQLIQQLMENDPNRYGTPPAAKSAVEGLPDIKITQEMLASDSSQCAVCKDSFELDEEAK  529
            L+ L+Q L ENDPNRYGTPPA K A+E LP + + + +      QC+VC D FE+  EA+
Sbjct  247  LDLLLQHLAENDPNRYGTPPAQKEAIEALPTVTVKEPL------QCSVCLDDFEIVAEAR  300

Query  528  QMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigg  349
            +MPCKH +H  CI+PWLELH+SCPVCR++LP D+   ++ R+     + ++ S       
Sbjct  301  EMPCKHKFHSGCILPWLELHSSCPVCRHQLPADESKLDSERSRNTLDQRDSESTNSESNI  360

Query  348  lggggNQENPQTPRTVERRFRVSLPWLF  265
              G   QE     R+   R R S  W F
Sbjct  361  SNGINVQEGHGEGRSGNGR-RFSFLWPF  387



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1219970116365