BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF025O07

Length=644
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AFY26882.1|  catalase                                                296   8e-99   Ipomoea batatas [batate]
gb|ADB03784.1|  catalase                                                295   4e-94   Ipomoea batatas [batate]
sp|P07145.1|CATA_IPOBA  RecName: Full=Catalase                          295   4e-94   Ipomoea batatas [batate]
ref|XP_009624788.1|  PREDICTED: catalase isozyme 3                      246   5e-75   Nicotiana tomentosiformis
gb|AFR42410.1|  catalase                                                230   3e-73   Eperua falcata
dbj|BAH20283.1|  AT1G20620                                              230   4e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010907090.1|  PREDICTED: catalase isozyme 1-like                 241   4e-73   Elaeis guineensis
ref|XP_009794469.1|  PREDICTED: catalase isozyme 3                      241   6e-73   Nicotiana sylvestris
gb|AGC65520.1|  catalase                                                240   7e-73   Eriobotrya japonica [loquat]
ref|XP_010061172.1|  PREDICTED: catalase isozyme 3-like                 240   8e-73   Eucalyptus grandis [rose gum]
gb|ABY19573.1|  catalase                                                232   3e-72   Manihot esculenta [manioc]
ref|XP_006473789.1|  PREDICTED: catalase-like isoform X1                238   3e-72   Citrus sinensis [apfelsine]
ref|XP_008237987.1|  PREDICTED: catalase isozyme 1                      239   3e-72   Prunus mume [ume]
ref|NP_001289779.1|  catalase isozyme 1                                 239   3e-72   Nelumbo nucifera [Indian lotus]
gb|AAX84671.1|  catalase CAT2                                           232   4e-72   Manihot esculenta [manioc]
ref|XP_006435361.1|  hypothetical protein CICLE_v10000948mg             238   4e-72   Citrus clementina [clementine]
ref|XP_007209948.1|  hypothetical protein PRUPE_ppa004776mg             238   5e-72   Prunus persica
emb|CAD42908.1|  catalase                                               238   5e-72   Prunus persica
gb|ABR15776.1|  catalase                                                232   7e-72   Litchi
sp|Q9AXH0.1|CATA_AVIMR  RecName: Full=Catalase                          238   7e-72   Avicennia marina
gb|AFR42412.1|  catalase                                                226   1e-71   Eperua falcata
gb|KJB57963.1|  hypothetical protein B456_009G187600                    237   1e-71   Gossypium raimondii
emb|CAB56850.1|  catalase                                               235   1e-71   Prunus persica
ref|XP_009413057.1|  PREDICTED: catalase isozyme 2-like                 237   1e-71   Musa acuminata subsp. malaccensis [pisang utan]
sp|P49317.1|CATA3_NICPL  RecName: Full=Catalase isozyme 3               237   1e-71   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_010061174.1|  PREDICTED: catalase isozyme 3-like isoform X2      237   2e-71   Eucalyptus grandis [rose gum]
gb|AIX10947.1|  putative catalase                                       237   2e-71   Gardenia jasminoides
ref|XP_009600533.1|  PREDICTED: catalase isozyme 3-like                 236   2e-71   Nicotiana tomentosiformis
dbj|BAF91369.1|  catalase                                               236   4e-71   Capsicum annuum
ref|XP_010918244.1|  PREDICTED: catalase isozyme 1                      236   4e-71   Elaeis guineensis
ref|XP_010242894.1|  PREDICTED: catalase isozyme 1-like isoform X1      236   4e-71   Nelumbo nucifera [Indian lotus]
ref|XP_008365915.1|  PREDICTED: catalase isozyme 1                      236   4e-71   
ref|XP_008348924.1|  PREDICTED: catalase isozyme 1                      236   4e-71   
ref|XP_010536470.1|  PREDICTED: catalase-2-like                         236   5e-71   Tarenaya hassleriana [spider flower]
ref|XP_002306976.2|  catalase family protein                            236   5e-71   
ref|XP_011041225.1|  PREDICTED: catalase isozyme 1                      236   5e-71   Populus euphratica
gb|KJB14249.1|  hypothetical protein B456_002G115900                    231   6e-71   Gossypium raimondii
gb|AAB88173.1|  catalase                                                230   6e-71   Glycine max [soybeans]
gb|AAM97542.1|  catalase 3                                              235   8e-71   Capsicum annuum
ref|XP_009400996.1|  PREDICTED: catalase isozyme 2                      235   8e-71   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009773579.1|  PREDICTED: catalase isozyme 3-like                 235   8e-71   Nicotiana sylvestris
ref|XP_008237989.1|  PREDICTED: catalase isozyme 1-like                 235   1e-70   Prunus mume [ume]
emb|CDP07287.1|  unnamed protein product                                234   1e-70   Coffea canephora [robusta coffee]
sp|Q9M5L6.1|CATA_CAPAN  RecName: Full=Catalase; AltName: Full=CaCat1    234   2e-70   Capsicum annuum
ref|XP_008802866.1|  PREDICTED: catalase isozyme 1                      234   2e-70   Phoenix dactylifera
ref|XP_010061175.1|  PREDICTED: catalase-like                           234   2e-70   Eucalyptus grandis [rose gum]
ref|XP_010498496.1|  PREDICTED: catalase-3                              234   3e-70   Camelina sativa [gold-of-pleasure]
gb|AIS20825.1|  CAT                                                     234   3e-70   Pyrus x bretschneideri [bai li]
ref|XP_009110221.1|  PREDICTED: catalase-3                              234   3e-70   Brassica rapa
emb|CAI43948.1|  catalase                                               234   3e-70   Populus deltoides
ref|XP_008789355.1|  PREDICTED: catalase isozyme 1-like                 233   3e-70   Phoenix dactylifera
ref|XP_002301920.1|  catalase family protein                            233   3e-70   Populus trichocarpa [western balsam poplar]
gb|AAA57551.1|  catalase                                                231   3e-70   Nicotiana sylvestris
ref|XP_008373403.1|  PREDICTED: catalase isozyme 1                      233   4e-70   
ref|NP_001031072.3|  catalase 3                                         230   5e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011034872.1|  PREDICTED: catalase isozyme 1-like                 233   5e-70   Populus euphratica
gb|KFK44175.1|  hypothetical protein AALP_AA1G224300                    233   6e-70   Arabis alpina [alpine rockcress]
gb|ACJ11733.1|  catalase                                                233   6e-70   Gossypium hirsutum [American cotton]
emb|CDP07288.1|  unnamed protein product                                233   6e-70   Coffea canephora [robusta coffee]
emb|CDY31488.1|  BnaC05g15970D                                          233   7e-70   Brassica napus [oilseed rape]
ref|XP_007210576.1|  hypothetical protein PRUPE_ppa004763mg             232   9e-70   Prunus persica
emb|CDY33636.1|  BnaC08g19360D                                          232   9e-70   Brassica napus [oilseed rape]
emb|CDY29519.1|  BnaA06g14510D                                          232   9e-70   Brassica napus [oilseed rape]
ref|XP_009103334.1|  PREDICTED: catalase-3-like                         232   9e-70   Brassica rapa
emb|CAD42909.1|  catalase                                               232   9e-70   Prunus persica
ref|XP_011074091.1|  PREDICTED: catalase isozyme 3 isoform X2           232   1e-69   
gb|AEQ30070.1|  catalase                                                232   1e-69   Litchi chinensis [litchi]
gb|AJE26131.1|  catalase                                                232   1e-69   Salix matsudana [tortured willow]
ref|XP_011074092.1|  PREDICTED: catalase isozyme 3 isoform X3           232   1e-69   Sesamum indicum [beniseed]
gb|KCW68095.1|  hypothetical protein EUGRSUZ_F01777                     234   1e-69   Eucalyptus grandis [rose gum]
ref|XP_009149539.1|  PREDICTED: catalase-3                              233   2e-69   Brassica rapa
gb|ACJ73905.1|  CAT1                                                    221   2e-69   Solanum nigrum
sp|P55311.1|CATA_SOLME  RecName: Full=Catalase                          232   2e-69   Solanum melongena [aubergine]
ref|XP_009590727.1|  PREDICTED: catalase isozyme 1                      232   2e-69   Nicotiana tomentosiformis
ref|XP_003631925.1|  PREDICTED: catalase isozyme 1-like                 231   2e-69   Vitis vinifera
ref|NP_001268098.1|  catalase                                           231   2e-69   Vitis vinifera
ref|XP_006828714.1|  hypothetical protein AMTR_s00001p00022550          231   2e-69   Amborella trichopoda
dbj|BAH20307.1|  AT1G20620                                              231   2e-69   Arabidopsis thaliana [mouse-ear cress]
emb|CAC04509.1|  catalase                                               224   2e-69   Digitalis lanata [Grecian foxglove]
gb|KHG25152.1|  Catalase isozyme 1                                      231   2e-69   Gossypium arboreum [tree cotton]
sp|P49319.2|CATA1_TOBAC  RecName: Full=Catalase isozyme 1; AltNam...    231   2e-69   Nicotiana tabacum [American tobacco]
emb|CDY01364.1|  BnaA07g11370D                                          233   2e-69   
gb|ACJ76836.3|  catalase                                                231   2e-69   Dimocarpus longan [longan]
ref|XP_009792372.1|  PREDICTED: catalase isozyme 1                      231   3e-69   Nicotiana sylvestris
sp|O24339.1|CATA_SOLAP  RecName: Full=Catalase                          231   3e-69   Soldanella alpina
gb|ADC95629.1|  catalase                                                231   3e-69   Bruguiera gymnorhiza [Burma mangrove]
gb|KJB14250.1|  hypothetical protein B456_002G115900                    231   3e-69   Gossypium raimondii
gb|AET97564.1|  catalase                                                231   3e-69   Ziziphus jujuba [Chinese jujube]
gb|AGV54297.1|  peroxisomal catalase                                    231   4e-69   Phaseolus vulgaris [French bean]
gb|AGE15298.2|  catalase 1                                              231   4e-69   Eriobotrya japonica [loquat]
ref|NP_001237571.1|  catalase-4                                         231   4e-69   Glycine max [soybeans]
dbj|BAJ33995.1|  unnamed protein product                                231   4e-69   Eutrema halophilum
ref|XP_006412153.1|  hypothetical protein EUTSA_v10024932mg             231   4e-69   Eutrema salsugineum [saltwater cress]
ref|NP_564120.1|  catalase 3                                            231   4e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007136018.1|  hypothetical protein PHAVU_009G011100g             231   4e-69   Phaseolus vulgaris [French bean]
gb|AAM65021.1|  unknown                                                 231   5e-69   Arabidopsis thaliana [mouse-ear cress]
emb|CDY31878.1|  BnaC07g15280D                                          230   5e-69   Brassica napus [oilseed rape]
gb|AHF27428.1|  catalase                                                226   5e-69   Cucurbita moschata [ayote]
dbj|BAC79443.1|  catalase                                               230   6e-69   Acacia ampliceps
gb|AAR84578.1|  catalase 1a                                             230   6e-69   Lotus japonicus
ref|XP_010530333.1|  PREDICTED: catalase-2                              230   6e-69   Tarenaya hassleriana [spider flower]
ref|NP_001240021.1|  catalase                                           230   6e-69   Glycine max [soybeans]
gb|ACV30589.1|  catalase                                                220   8e-69   Carica papaya [mamon]
ref|XP_010663966.1|  PREDICTED: catalase isozyme 1                      230   8e-69   Vitis vinifera
ref|XP_006473794.1|  PREDICTED: catalase isozyme 1-like isoform X4      230   8e-69   Citrus sinensis [apfelsine]
ref|XP_006435363.1|  hypothetical protein CICLE_v10000951mg             230   8e-69   Citrus clementina [clementine]
ref|XP_006828715.1|  hypothetical protein AMTR_s00001p00024160          229   1e-68   Amborella trichopoda
ref|XP_006473791.1|  PREDICTED: catalase isozyme 1-like isoform X1      230   1e-68   
gb|AAG43363.1|AF151368_1  catalase                                      229   1e-68   Hevea brasiliensis [jebe]
dbj|BAQ21275.1|  catalase                                               229   1e-68   Citrus tamurana
emb|CCP37650.1|  catalase-1                                             229   1e-68   Nicotiana tabacum [American tobacco]
gb|AFU48609.1|  catalase 1                                              229   2e-68   Nicotiana benthamiana
ref|XP_004238430.1|  PREDICTED: catalase isozyme 3                      229   2e-68   Solanum lycopersicum
gb|ACL27272.1|  catalase                                                229   2e-68   Nicotiana benthamiana
ref|XP_007160597.1|  hypothetical protein PHAVU_001G001000g             229   2e-68   Phaseolus vulgaris [French bean]
gb|AAD50974.1|AF170272_1  catalase CAT1                                 229   2e-68   Manihot esculenta [manioc]
ref|XP_007018034.1|  Catalase 2                                         229   2e-68   
ref|XP_006306495.1|  hypothetical protein CARUB_v10012481mg             229   2e-68   Capsella rubella
sp|P49316.1|CATA2_NICPL  RecName: Full=Catalase isozyme 2               229   2e-68   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
gb|AAF19965.1|AF207906_1  catalase 1                                    229   2e-68   Zantedeschia aethiopica [arum-lily]
ref|NP_001291326.1|  catalase isozyme 1                                 229   2e-68   Sesamum indicum [beniseed]
ref|XP_008452956.1|  PREDICTED: catalase isozyme 1                      229   2e-68   Cucumis melo [Oriental melon]
sp|P17598.2|CATA1_GOSHI  RecName: Full=Catalase isozyme 1               229   2e-68   Gossypium hirsutum [American cotton]
gb|AIA61608.1|  catalase                                                228   3e-68   Gynostemma pentaphyllum [jiaogulan]
ref|NP_001237556.1|  catalase-1/2                                       228   3e-68   Glycine max [soybeans]
gb|AAB62892.1|  catalase-1                                              228   3e-68   Nicotiana glutinosa
gb|AAB71764.1|  catalase 1                                              228   4e-68   Nicotiana tabacum [American tobacco]
gb|ACV92695.1|  catalase                                                228   5e-68   Brassica oleracea
ref|XP_002867092.1|  hypothetical protein ARALYDRAFT_491144             228   5e-68   
gb|AFU90822.1|  catalase                                                228   6e-68   Populus tomentosa [Chinese white poplar]
gb|ABM47415.1|  catalase                                                228   6e-68   Prunus avium [gean]
emb|CDX76313.1|  BnaA08g10870D                                          227   6e-68   
sp|P49315.1|CATA1_NICPL  RecName: Full=Catalase isozyme 1               228   6e-68   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
gb|AFU90823.1|  catalase                                                226   6e-68   Populus x beijingensis
emb|CAA64220.1|  catalase                                               228   6e-68   Arabidopsis thaliana [mouse-ear cress]
gb|AAD30292.1|AF139539_1  catalase 3                                    228   7e-68   Raphanus sativus
sp|Q01297.2|CATA1_RICCO  RecName: Full=Catalase isozyme 1               228   7e-68   Ricinus communis
ref|XP_010941422.1|  PREDICTED: catalase isozyme B                      228   7e-68   Elaeis guineensis
gb|AAB86582.2|  catalase                                                227   7e-68   Raphanus sativus
gb|AAD30291.2|AF139538_1  catalase 2                                    227   7e-68   Raphanus sativus
gb|AAK96854.1|  catalase                                                227   7e-68   Arabidopsis thaliana [mouse-ear cress]
gb|AAF71742.1|AF248491_1  catalase                                      227   8e-68   Raphanus sativus
ref|XP_006283612.1|  hypothetical protein CARUB_v10004668mg             227   8e-68   Capsella rubella
sp|P45739.1|CATA_HELAN  RecName: Full=Catalase                          227   8e-68   Helianthus annuus
prf||2104177A  catalase                                                 227   8e-68
prf||1906388A  catalase                                                 227   8e-68
ref|XP_006342134.1|  PREDICTED: catalase isozyme 3-like                 227   9e-68   Solanum tuberosum [potatoes]
emb|CAA45564.1|  catalase                                               227   9e-68   Arabidopsis thaliana [mouse-ear cress]
ref|NP_195235.1|  catalase 2                                            227   1e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010523643.1|  PREDICTED: catalase-2-like                         227   1e-67   Tarenaya hassleriana [spider flower]
gb|AAD17935.1|  catalase                                                227   1e-67   Brassica juncea [brown mustard]
emb|CDY40645.1|  BnaA03g53180D                                          226   1e-67   Brassica napus [oilseed rape]
ref|XP_010094556.1|  Catalase isozyme 1                                 227   1e-67   Morus notabilis
ref|XP_009138342.1|  PREDICTED: catalase-2                              227   1e-67   Brassica rapa
ref|XP_010536468.1|  PREDICTED: catalase-3-like                         226   1e-67   Tarenaya hassleriana [spider flower]
gb|AAZ29552.1|  catalase-C                                              227   1e-67   Oryza sativa Indica Group [Indian rice]
dbj|BAA34205.1|  catalase                                               226   2e-67   Oryza sativa Japonica Group [Japonica rice]
gb|KFK30147.1|  catalase                                                226   2e-67   Arabis alpina [alpine rockcress]
ref|NP_001048861.1|  Os03g0131200                                       226   2e-67   
sp|P48350.1|CATA1_CUCPE  RecName: Full=Catalase isozyme 1               226   2e-67   Cucurbita pepo
gb|AAC48918.1|  salicylic acid binding catalase                         226   2e-67   Nicotiana tabacum [American tobacco]
gb|AAD17936.1|  catalase                                                226   2e-67   Brassica juncea [brown mustard]
ref|XP_009794245.1|  PREDICTED: catalase isozyme 1                      226   2e-67   Nicotiana sylvestris
gb|KGN55499.1|  hypothetical protein Csa_4G658590                       226   2e-67   Cucumis sativus [cucumbers]
gb|AAC49807.1|  catalase 3                                              226   2e-67   Arabidopsis thaliana [mouse-ear cress]
gb|ACA50528.1|  putative catalase 2                                     226   2e-67   Brassica napus [oilseed rape]
sp|P32290.1|CATA_VIGRR  RecName: Full=Catalase                          226   3e-67   Vigna radiata var. radiata [golden gram]
emb|CDP01803.1|  unnamed protein product                                226   3e-67   Coffea canephora [robusta coffee]
ref|XP_006382992.1|  hypothetical protein POPTR_0005s10340g             226   3e-67   
ref|NP_001235974.1|  catalase-3                                         226   3e-67   Glycine max [soybeans]
ref|XP_011074090.1|  PREDICTED: catalase isoform X1                     226   3e-67   Sesamum indicum [beniseed]
emb|CDX72514.1|  BnaC07g45360D                                          225   3e-67   
ref|XP_002306427.1|  hypothetical protein POPTR_0005s10340g             226   3e-67   Populus trichocarpa [western balsam poplar]
gb|ACJ73906.1|  CAT2                                                    221   4e-67   Solanum nigrum
emb|CDY17510.1|  BnaC03g65530D                                          225   4e-67   Brassica napus [oilseed rape]
gb|EYU30275.1|  hypothetical protein MIMGU_mgv1a005250mg                226   4e-67   Erythranthe guttata [common monkey flower]
gb|KHG12976.1|  Catalase isozyme 2                                      226   4e-67   Gossypium arboreum [tree cotton]
ref|XP_009597278.1|  PREDICTED: catalase isozyme 1                      226   4e-67   Nicotiana tomentosiformis
sp|P30567.1|CATA2_GOSHI  RecName: Full=Catalase isozyme 2               226   4e-67   Gossypium hirsutum [American cotton]
ref|XP_004500876.1|  PREDICTED: catalase-4-like isoform X1              225   4e-67   
gb|ABQ44283.1|  catalase                                                221   4e-67   Saccharum hybrid cultivar NCo 376
gb|ACB11496.1|  catalase                                                225   4e-67   Pinus sylvestris [Scotch pine]
gb|AAR14052.2|  catalase                                                225   5e-67   Solanum tuberosum [potatoes]
dbj|BAJ87148.1|  predicted protein                                      220   5e-67   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010432341.1|  PREDICTED: catalase-2-like                         225   5e-67   Camelina sativa [gold-of-pleasure]
ref|XP_010437527.1|  PREDICTED: catalase-2                              225   5e-67   Camelina sativa [gold-of-pleasure]
gb|AFW69584.1|  catalase1                                               221   5e-67   
ref|XP_004500877.1|  PREDICTED: catalase-4-like isoform X2              225   6e-67   Cicer arietinum [garbanzo]
gb|AAD37788.1|AF149283_1  catalase 1                                    223   6e-67   Phaseolus vulgaris [French bean]
ref|NP_001234186.1|  catalase isozyme 2                                 225   6e-67   
ref|XP_011022275.1|  PREDICTED: catalase-like                           224   7e-67   Populus euphratica
ref|XP_009106100.1|  PREDICTED: catalase-2                              224   8e-67   Brassica rapa
ref|NP_001234827.1|  catalase isozyme 1                                 224   8e-67   Solanum lycopersicum
ref|XP_010934843.1|  PREDICTED: catalase isozyme 2                      224   8e-67   
gb|AHF27430.1|  catalase                                                224   1e-66   Cucurbita moschata [ayote]
ref|XP_006656514.1|  PREDICTED: catalase isozyme B-like                 224   1e-66   Oryza brachyantha
ref|XP_007046520.1|  Catalase 2                                         224   1e-66   Theobroma cacao [chocolate]
ref|XP_011022153.1|  PREDICTED: catalase-2-like isoform X2              224   1e-66   Populus euphratica
ref|XP_008791900.1|  PREDICTED: catalase isozyme 2                      224   1e-66   Phoenix dactylifera
gb|AHF27433.1|  catalase                                                224   1e-66   Cucurbita maxima [Boston marrow]
sp|P49318.1|CATA2_RICCO  RecName: Full=Catalase isozyme 2               224   1e-66   Ricinus communis
gb|ACJ22771.1|  catalase 1                                              224   1e-66   Jatropha curcas
sp|A2YH64.2|CATA2_ORYSI  RecName: Full=Catalase isozyme B; Short=...    224   2e-66   Oryza sativa Indica Group [Indian rice]
ref|XP_006649332.1|  PREDICTED: catalase-1-like                         224   2e-66   Oryza brachyantha
pir||S40265  catalase (EC 1.11.1.6) - eggplant                          224   2e-66
gb|AAY59707.1|  catalase                                                224   2e-66   Oryza sativa Indica Group [Indian rice]
ref|XP_011022152.1|  PREDICTED: catalase-2-like isoform X1              224   2e-66   Populus euphratica
ref|XP_006340832.1|  PREDICTED: catalase isozyme 2                      224   2e-66   Solanum tuberosum [potatoes]
gb|AAC19397.1|  leaf catalase                                           224   2e-66   Mesembryanthemum crystallinum
gb|AAO17721.1|  catalase                                                223   2e-66   Hypericum perforatum
emb|CDY52649.1|  BnaAnng11640D                                          222   2e-66   Brassica napus [oilseed rape]
gb|ABK24453.1|  unknown                                                 223   3e-66   Picea sitchensis
ref|XP_010446982.1|  PREDICTED: catalase-2-like                         223   4e-66   Camelina sativa [gold-of-pleasure]
gb|KDP43757.1|  hypothetical protein JCGZ_22384                         223   4e-66   Jatropha curcas
dbj|BAA05494.1|  catalase                                               223   4e-66   Oryza sativa Japonica Group [Japonica rice]
gb|AAF79625.1|AC027665_26  F5M15.5                                      229   4e-66   Arabidopsis thaliana [mouse-ear cress]
dbj|BAA34204.1|  catalase                                               223   4e-66   Oryza sativa Japonica Group [Japonica rice]
gb|AHF21552.1|  catalase                                                223   4e-66   Hylocereus undatus [dragon fruit]
ref|NP_001058635.1|  Os06g0727200                                       223   5e-66   
ref|XP_008452957.1|  PREDICTED: catalase isozyme 1-like                 223   5e-66   Cucumis melo [Oriental melon]
gb|AAM97541.1|  catalase 2                                              222   6e-66   Capsicum annuum
gb|ADZ45555.1|  catalase                                                222   7e-66   Vigna radiata [mung bean]
ref|XP_010534184.1|  PREDICTED: catalase isozyme 3-like                 222   7e-66   Tarenaya hassleriana [spider flower]
gb|AAC17729.1|  catalase 1                                              219   7e-66   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABC01913.1|  catalase isozyme 1-like protein                         222   7e-66   Solanum tuberosum [potatoes]
emb|CAG23920.1|  catalase                                               222   9e-66   Festuca arundinacea [tall fescue]
gb|ADZ45556.1|  catalase                                                222   1e-65   Vigna radiata [mung bean]
ref|XP_003558892.1|  PREDICTED: catalase-1                              221   1e-65   Brachypodium distachyon [annual false brome]
ref|XP_009108683.1|  PREDICTED: catalase-2-like isoform X2              222   1e-65   
ref|NP_001241808.1|  catalase isozyme B                                 221   1e-65   Zea mays [maize]
emb|CAA42720.1|  catalase-1                                             221   1e-65   Zea mays [maize]
gb|KJB17473.1|  hypothetical protein B456_003G002800                    221   1e-65   Gossypium raimondii
gb|AIU99479.1|  catalase                                                221   2e-65   Saccharum arundinaceum
sp|Q43206.1|CATA1_WHEAT  RecName: Full=Catalase-1                       221   2e-65   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008464839.1|  PREDICTED: catalase isozyme 3                      221   2e-65   Cucumis melo [Oriental melon]
gb|EMT05040.1|  Catalase-1                                              222   2e-65   
gb|AFR53082.1|  CAT                                                     221   2e-65   Anthurium andraeanum [flamingo-lily]
ref|NP_001274863.1|  catalase isozyme 1                                 221   2e-65   Solanum tuberosum [potatoes]
sp|P48352.1|CATA3_CUCPE  RecName: Full=Catalase isozyme 3               221   2e-65   Cucurbita pepo
gb|AAD17933.1|  catalase                                                221   2e-65   Brassica juncea [brown mustard]
gb|AFN81243.1|  catalase 1                                              221   3e-65   Brassica rapa subsp. pekinensis [bai cai]
sp|P49284.1|CATA1_SOLTU  RecName: Full=Catalase isozyme 1               221   3e-65   Solanum tuberosum [potatoes]
gb|ACL35349.1|  catalase                                                221   3e-65   Picea glauca
ref|XP_002890395.1|  F5M15.5                                            227   3e-65   
ref|XP_004144240.1|  PREDICTED: catalase isozyme 3-like                 220   3e-65   
gb|AHF27429.1|  catalase                                                219   3e-65   Cucurbita moschata [ayote]
ref|XP_002510677.1|  catalase, putative                                 227   3e-65   
gb|AHF27432.1|  catalase                                                219   4e-65   Cucurbita maxima [Boston marrow]
gb|AIU99481.1|  catalase                                                220   4e-65   Saccharum spontaneum [fodder cane]
gb|ADM96039.1|  catalase                                                220   4e-65   Cucumis sativus [cucumbers]
gb|AIU99488.1|  catalase                                                220   4e-65   Saccharum hybrid cultivar ROC22
ref|XP_004158284.1|  PREDICTED: catalase isozyme 3-like                 220   4e-65   
gb|AIM43584.1|  catalase                                                220   4e-65   Saccharum hybrid cultivar Yacheng05-179
gb|AAR97905.1|  catalase                                                220   4e-65   Solanum tuberosum [potatoes]
sp|P55312.1|CATA2_SOLTU  RecName: Full=Catalase isozyme 2               220   5e-65   Solanum tuberosum [potatoes]
gb|AIU99485.1|  catalase                                                220   5e-65   Saccharum spontaneum [fodder cane]
ref|XP_004985840.1|  PREDICTED: catalase-1-like                         220   5e-65   Setaria italica
gb|AIU99484.1|  catalase                                                220   5e-65   Saccharum arundinaceum
emb|CAA85470.1|  catalase                                               220   5e-65   Solanum tuberosum [potatoes]
ref|XP_003563243.1|  PREDICTED: catalase isozyme 1                      220   6e-65   Brachypodium distachyon [annual false brome]
sp|P55307.1|CATA1_HORVU  RecName: Full=Catalase isozyme 1               220   6e-65   Hordeum vulgare [barley]
ref|XP_002437631.1|  hypothetical protein SORBIDRAFT_10g030840          219   6e-65   
dbj|BAJ90861.1|  predicted protein                                      219   8e-65   Hordeum vulgare subsp. vulgare [two-rowed barley]
sp|P48351.1|CATA2_CUCPE  RecName: Full=Catalase isozyme 2               219   8e-65   Cucurbita pepo
ref|NP_001105415.1|  catalase isozyme 1                                 219   8e-65   
emb|CDX69111.1|  BnaC01g03420D                                          219   9e-65   
emb|CDP01802.1|  unnamed protein product                                219   9e-65   Coffea canephora [robusta coffee]
gb|ACN36234.1|  unknown                                                 215   1e-64   Zea mays [maize]
gb|KGN55500.1|  hypothetical protein Csa_4G658600                       216   1e-64   Cucumis sativus [cucumbers]
gb|AIU99480.1|  catalase                                                219   2e-64   Saccharum spontaneum [fodder cane]
dbj|BAJ88747.1|  predicted protein                                      219   2e-64   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010692546.1|  PREDICTED: catalase                                218   2e-64   Beta vulgaris subsp. vulgaris [field beet]
gb|EPS69543.1|  catalase                                                218   2e-64   Genlisea aurea
ref|NP_564121.1|  catalase 1                                            218   2e-64   Arabidopsis thaliana [mouse-ear cress]
gb|AAC17731.1|  catalase 1                                              218   2e-64   Arabidopsis thaliana [mouse-ear cress]
gb|AIZ77475.1|  catalase                                                218   3e-64   Triticum aestivum [Canadian hard winter wheat]
gb|AHA50082.1|  catalase                                                218   3e-64   Eleutherococcus senticosus
ref|XP_010063132.1|  PREDICTED: LOW QUALITY PROTEIN: catalase iso...    218   3e-64   
gb|KEH36312.1|  catalase heme-binding enzyme                            218   4e-64   Medicago truncatula
gb|AAK67359.2|AF390210_1  catalase                                      218   4e-64   
gb|AIP93616.1|  CAT1                                                    218   4e-64   
gb|EYU36566.1|  hypothetical protein MIMGU_mgv1a005245mg                218   5e-64   
gb|AIU99482.1|  catalase                                                217   5e-64   
ref|XP_002521709.1|  catalase, putative                                 217   6e-64   
gb|AIU99486.1|  catalase                                                217   7e-64   
ref|XP_004966515.1|  PREDICTED: catalase isozyme 1-like                 218   9e-64   
gb|AIU99487.1|  catalase                                                216   1e-63   
gb|ADU56199.1|  catalase                                                216   1e-63   
gb|AAF61732.1|AF243517_1  catalase 2                                    216   1e-63   
ref|XP_006412154.1|  hypothetical protein EUTSA_v10024932mg             217   1e-63   
gb|KFK44176.1|  hypothetical protein AALP_AA1G224400                    216   2e-63   
ref|XP_009103333.1|  PREDICTED: catalase-1                              216   2e-63   
emb|CDY01363.1|  BnaA07g11360D                                          216   2e-63   
emb|CDY31877.1|  BnaC07g15270D                                          216   2e-63   
gb|AAB07026.1|  catalase 1                                              215   3e-63   
gb|AAG61140.2|AF332973_1  catalase 2                                    215   3e-63   
ref|XP_010692544.1|  PREDICTED: catalase-like                           215   3e-63   
sp|P18122.1|CATA1_MAIZE  RecName: Full=Catalase isozyme 1               215   3e-63   
gb|AIU99483.1|  catalase                                                215   4e-63   
gb|ADU56198.1|  catalase                                                215   4e-63   
sp|P55313.1|CATA2_WHEAT  RecName: Full=Catalase                         215   4e-63   
gb|AHB72694.1|  catalase                                                214   5e-63   
tpg|DAA43177.1|  TPA: catalase2                                         214   6e-63   
sp|P12365.3|CATA2_MAIZE  RecName: Full=Catalase isozyme 2               214   9e-63   
prf||1803522A  catalase                                                 214   9e-63
ref|NP_001105310.1|  catalase isozyme 2                                 214   1e-62   
gb|AAL00886.1|  catalase                                                208   1e-62   
ref|XP_004300681.1|  PREDICTED: catalase isozyme 1                      214   1e-62   
gb|AAF61733.1|AF243518_1  catalase 3                                    213   1e-62   
emb|CAE82295.1|  catalase                                               213   1e-62   
ref|XP_004145541.1|  PREDICTED: catalase isozyme 1-like                 219   2e-62   
gb|ADN94253.1|  catalase                                                213   3e-62   
ref|XP_006416378.1|  hypothetical protein EUTSA_v10007472mg             212   4e-62   
tpg|DAA43178.1|  TPA: catalase2                                         213   5e-62   
ref|XP_002963086.1|  hypothetical protein SELMODRAFT_438313             211   7e-62   
ref|XP_009392261.1|  PREDICTED: catalase isozyme A-like isoform X2      212   7e-62   
gb|AAF61734.1|AF243519_1  catalase 4                                    211   8e-62   
gb|ABB72796.1|  catalase isozyme 1-like protein                         211   1e-61   
gb|ABV55108.1|  catalase 2                                              211   2e-61   
gb|KHG21219.1|  Catalase isozyme 1                                      209   2e-61   
gb|AAC19398.1|  root catalase                                           211   2e-61   
ref|XP_009398521.1|  PREDICTED: catalase isozyme A                      210   2e-61   
dbj|BAA34714.1|  catalase                                               210   3e-61   
gb|ACH63223.1|  catalase                                                210   3e-61   
gb|ADK25939.1|  catalase                                                202   3e-61   
ref|NP_001031073.1|  catalase 3                                         209   4e-61   
ref|XP_002980247.1|  hypothetical protein SELMODRAFT_178171             210   4e-61   
emb|CAA10286.1|  catalase                                               199   4e-61   
gb|ABY21704.1|  catalase-1 precursor                                    209   5e-61   
ref|XP_010061173.1|  PREDICTED: catalase isozyme 2-like isoform X1      209   9e-61   
ref|XP_002961779.1|  hypothetical protein SELMODRAFT_140901             208   1e-60   
dbj|BAH37035.1|  catalase 1                                             207   4e-60   
gb|AFD29285.1|  catalase                                                207   4e-60   
dbj|BAD07937.1|  catalase catA-like protein                             195   2e-59   
gb|KDO85095.1|  hypothetical protein CISIN_1g044386mg                   207   3e-59   
gb|AFI48111.1|  catalase isozyme B                                      193   4e-59   
gb|ABY68162.1|  catalase                                                192   7e-59   
gb|ABY68159.1|  catalase                                                192   9e-59   
gb|ACL81498.1|  catalase                                                203   9e-59   
gb|ABY68158.1|  catalase                                                192   1e-58   
emb|CDY29518.1|  BnaA06g14520D                                          203   1e-58   
emb|CDY31490.1|  BnaC05g15990D                                          203   1e-58   
gb|ABY68164.1|  catalase                                                192   1e-58   
ref|XP_009149540.1|  PREDICTED: catalase-1                              203   1e-58   
sp|P25890.1|CATA_PEA  RecName: Full=Catalase                            202   2e-58   
gb|AJF34884.1|  catalase                                                202   3e-58   
gb|AFI48054.1|  catalase isozyme B                                      191   3e-58   
gb|ABY68160.1|  catalase                                                191   3e-58   
ref|XP_010498497.1|  PREDICTED: catalase-1-like                         202   4e-58   
gb|ABY68161.1|  catalase                                                190   6e-58   
gb|AFI48101.1|  catalase isozyme B                                      189   1e-57   
gb|AFI48068.1|  catalase isozyme B                                      189   2e-57   
ref|XP_001779509.1|  predicted protein                                  200   2e-57   
ref|XP_010459749.1|  PREDICTED: catalase-1-like                         200   2e-57   
ref|XP_010477308.1|  PREDICTED: catalase-1                              199   4e-57   
gb|AFI48131.1|  catalase isozyme B                                      187   1e-56   
dbj|BAH56915.1|  AT1G20620                                              198   1e-56   
gb|AFI48098.1|  catalase isozyme B                                      186   2e-56   
ref|XP_009108684.1|  PREDICTED: catalase-2-like isoform X3              196   4e-56   
ref|XP_010105996.1|  Catalase isozyme 1                                 193   4e-56   
gb|AAC17730.1|  catalase 2                                              193   9e-56   
dbj|BAH19523.1|  AT4G35090                                              195   1e-55   
ref|NP_001031791.1|  catalase 2                                         195   1e-55   
dbj|BAJ92414.1|  predicted protein                                      195   1e-55   
ref|XP_006382986.1|  hypothetical protein POPTR_0005s10340g             196   1e-55   
gb|AFI48130.1|  catalase isozyme B                                      184   2e-55   
gb|AAX88799.1|  catalase                                                195   2e-55   
ref|XP_001752315.1|  predicted protein                                  195   2e-55   
emb|CAH61266.1|  catalase                                               195   2e-55   
gb|ADY02963.1|  catalase                                                194   2e-55   
gb|EMS51034.1|  Catalase isozyme 2                                      195   2e-55   
sp|P55308.1|CATA2_HORVU  RecName: Full=Catalase isozyme 2               194   4e-55   
ref|NP_001045673.1|  Os02g0115700                                       194   5e-55   
gb|ABN71233.2|  catalase                                                193   6e-55   
gb|EAZ21490.1|  hypothetical protein OsJ_05114                          194   7e-55   
ref|XP_008778560.1|  PREDICTED: catalase isozyme 2-like                 193   7e-55   
ref|XP_001784759.1|  predicted protein                                  192   2e-54   
gb|EMS61345.1|  Catalase isozyme 1                                      194   3e-54   
ref|XP_008812256.1|  PREDICTED: catalase isozyme B                      191   4e-54   
gb|ABK24449.1|  unknown                                                 191   6e-54   
ref|XP_004952158.1|  PREDICTED: catalase isozyme 3-like isoform X2      191   6e-54   
gb|ADQ28492.1|  catalase                                                191   7e-54   
gb|EMT06167.1|  Catalase isozyme 2                                      193   9e-54   
ref|XP_003573241.1|  PREDICTED: catalase isozyme 2                      190   1e-53   
emb|CBI29556.3|  unnamed protein product                                179   2e-53   
gb|AGI65617.1|  catalase                                                187   9e-53   
ref|XP_002453177.1|  hypothetical protein SORBIDRAFT_04g001130          186   2e-52   
ref|XP_005645077.1|  catalase                                           187   2e-52   
gb|AGT16203.1|  catalase                                                185   9e-52   
gb|ABR16304.1|  unknown                                                 184   1e-51   
gb|AII23739.1|  catalase                                                184   2e-51   
gb|ABK24543.1|  unknown                                                 184   2e-51   
ref|XP_006646781.1|  PREDICTED: LOW QUALITY PROTEIN: catalase iso...    184   2e-51   
emb|CAA43814.1|  catalase                                               184   3e-51   
pir||CSRZ  catalase (EC 1.11.1.6) catA - rice                           184   3e-51
sp|P55310.1|CATA_SECCE  RecName: Full=Catalase                          183   4e-51   
gb|AFK46618.1|  unknown                                                 171   2e-50   
gb|ABK41476.1|  catalase                                                181   3e-50   
ref|XP_005847557.1|  hypothetical protein CHLNCDRAFT_57817              179   2e-49   
dbj|BAD94702.1|  catalase                                               168   2e-49   
gb|ABY68163.1|  catalase                                                166   2e-48   
gb|AFW66787.1|  catalase3                                               176   3e-48   
gb|AGT16188.1|  catalase                                                176   3e-48   
sp|P18123.2|CATA3_MAIZE  RecName: Full=Catalase isozyme 3               176   3e-48   
gb|AGT16054.1|  catalase                                                176   3e-48   
gb|AGT15888.1|  catalase                                                176   3e-48   
gb|KIY96954.1|  catalase                                                172   3e-48   
gb|AGT16310.1|  catalase                                                176   3e-48   
gb|AID50071.1|  catalase                                                165   6e-48   
gb|AHZ13843.1|  catalase                                                174   8e-48   
gb|AFW66785.1|  catalase3 isoform 1                                     175   3e-47   
gb|KCW70315.1|  hypothetical protein EUGRSUZ_F03557                     172   4e-47   
gb|EMS35721.1|  Catalase isozyme 1                                      163   2e-45   
ref|XP_002950455.1|  catalase                                           167   6e-45   
gb|AEY70510.1|  catalase                                                161   1e-44   
ref|XP_011396830.1|  Catalase isozyme 2                                 166   2e-44   
ref|XP_004952157.1|  PREDICTED: catalase isozyme 3-like isoform X1      166   2e-44   
ref|XP_001696763.1|  catalase/peroxidase                                164   9e-44   
ref|NP_001105416.1|  catalase isozyme 3                                 163   2e-43   
gb|AAA33441.1|  catalase isozyme 3 (EC 1.11.1.6)                        162   2e-43   
ref|XP_005708279.1|  catalase                                           161   6e-43   
emb|CAA73663.1|  catalase                                               160   2e-42   
gb|AAB70006.1|  catalase                                                160   2e-42   
gb|AFW66789.1|  catalase3                                               155   5e-42   
gb|AFW66788.1|  catalase3                                               155   2e-40   
pir||A55092  catalase (EC 1.11.1.6) CAT-2 - maize (fragment)            152   9e-40
ref|XP_006382990.1|  hypothetical protein POPTR_0005s10340g             150   3e-39   
ref|XP_009108682.1|  PREDICTED: catalase-2-like isoform X1              149   3e-38   
gb|KJB10391.1|  hypothetical protein B456_001G198700                    147   4e-38   
gb|ABS72010.1|  putative catalase                                       138   6e-38   
gb|AAR84577.1|  catalase 1b                                             147   6e-38   
ref|XP_002963084.1|  hypothetical protein SELMODRAFT_404656             140   8e-38   
ref|XP_008365914.1|  PREDICTED: catalase isozyme 3-like                 137   3e-37   
gb|ABB88582.1|  catalase                                                145   4e-37   
ref|XP_009392260.1|  PREDICTED: catalase isozyme A-like isoform X1      144   1e-36   
ref|XP_008348923.1|  PREDICTED: catalase isozyme 3-like                 134   2e-36   
gb|KJB17474.1|  hypothetical protein B456_003G002800                    140   1e-35   
emb|CAA42026.1|  catalase                                               132   2e-35   
gb|KDD77132.1|  catalase                                                140   3e-35   
gb|AAO16182.1|  catalase-1                                              123   1e-31   
ref|XP_002980252.1|  hypothetical protein SELMODRAFT_112333             120   7e-31   
ref|XP_005536240.1|  catalase                                           126   2e-30   
emb|CDY43951.1|  BnaC04g21590D                                          122   3e-30   
emb|CDY31866.1|  BnaC07g15160D                                          121   3e-30   
gb|AAP57673.1|  catalase                                                120   2e-29   
gb|ABB51561.1|  truncated catalase 2                                    121   1e-28   
gb|AFH53190.1|  catalase                                                117   2e-28   
gb|AFH53187.1|  catalase                                                117   2e-28   
gb|AFH53189.1|  catalase                                                117   2e-28   
gb|AGS17821.1|  catalase 2                                              117   7e-28   
ref|XP_005712277.1|  unnamed protein product                            118   2e-27   
ref|XP_010242895.1|  PREDICTED: catalase isozyme 1-like isoform X2      114   2e-26   
ref|XP_006435362.1|  hypothetical protein CICLE_v10000948mg             113   5e-26   
ref|XP_008348922.1|  PREDICTED: catalase isozyme 1-like                 113   7e-26   
ref|XP_008382478.1|  PREDICTED: catalase isozyme 1-like                 113   9e-26   
emb|CDP22058.1|  unnamed protein product                                106   5e-25   
ref|XP_006382987.1|  hypothetical protein POPTR_0005s10340g             109   2e-24   
gb|KJE89728.1|  catalase isozyme 2                                      109   5e-24   
ref|XP_004366029.2|  catalase isozyme 2                                 108   6e-24   
gb|AFN85536.1|  catalase                                                100   7e-24   
gb|ACU23083.1|  unknown                                                 103   3e-23   
gb|ABR25882.1|  catalase isozyme b                                    98.6    6e-23   
ref|NP_973873.1|  catalase 3                                            103   2e-22   
gb|AAY34915.1|  catalase                                              97.1    2e-22   
gb|KCW70319.1|  hypothetical protein EUGRSUZ_F03561                     102   4e-22   
ref|XP_005644653.1|  catalase-domain-containing protein                 101   4e-21   
gb|KEH36313.1|  catalase heme-binding enzyme                          98.6    1e-20   
ref|XP_005647994.1|  catalase-domain-containing protein               98.6    3e-20   
gb|AEA86295.1|  putative catalase                                     93.6    5e-20   
ref|XP_002963082.1|  hypothetical protein SELMODRAFT_79329            90.1    1e-19   
gb|ABS89000.1|  catalase                                              91.7    2e-19   
gb|AFA36510.1|  catalase                                              90.1    3e-18   
ref|XP_005642928.1|  catalase                                         92.0    5e-18   
gb|AAR25790.1|  catalase                                              86.3    5e-18   
ref|WP_043830984.1|  catalase                                         89.7    3e-17   
emb|CCQ26769.2|  perixode catalase                                    82.0    6e-17   
gb|ADR01107.1|  catalase 3                                            87.0    9e-17   
ref|WP_044037961.1|  catalase                                         88.2    1e-16   
gb|AHB35639.1|  catalase                                              84.3    1e-16   
ref|WP_026826608.1|  catalase                                         87.0    2e-16   
ref|WP_037277190.1|  catalase                                         87.0    3e-16   
ref|WP_015881004.1|  catalase                                         86.3    4e-16   
ref|WP_016429054.1|  hypothetical protein                             86.3    4e-16   
ref|WP_029723487.1|  catalase                                         86.3    5e-16   
ref|WP_034418237.1|  catalase                                         85.9    7e-16   
ref|WP_032664185.1|  catalase                                         84.3    2e-15   
ref|WP_026673818.1|  catalase                                         84.7    2e-15   
ref|WP_032632526.1|  catalase                                         84.0    3e-15   
gb|ACJ71245.1|  catalase 2                                            83.2    3e-15   
ref|WP_033543820.1|  catalase                                         84.0    3e-15   
ref|WP_003355010.1|  catalase                                         83.6    4e-15   
gb|KIQ35234.1|  catalase                                              83.6    4e-15   
ref|WP_043304355.1|  catalase                                         83.6    4e-15   
ref|XP_006306503.1|  hypothetical protein CARUB_v10012491mg           80.5    5e-15   
ref|WP_031421259.1|  catalase                                         83.2    5e-15   
ref|WP_004887231.1|  catalase                                         83.2    5e-15   
ref|WP_006679508.1|  catalase                                         82.8    7e-15   
ref|WP_032610664.1|  catalase                                         82.8    7e-15   
gb|EXG21610.1|  catalase family protein                               79.0    8e-15   
gb|EXU30623.1|  catalase family protein                               79.0    8e-15   



>gb|AFY26882.1| catalase, partial [Ipomoea batatas]
Length=173

 Score =   296 bits (759),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 139/142 (98%), Positives = 142/142 (100%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            THRHRLGPNYMLLPVNAPKCA+HNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL
Sbjct  32   THRHRLGPNYMLLPVNAPKCAHHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  91

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
            RIVTG+RDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVK+LSEPRVTHEIRSTWISY
Sbjct  92   RIVTGQRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKALSEPRVTHEIRSTWISY  151

Query  283  LTQADRSLGQKVASRLNIRPTM  218
            LTQADRSLGQKVASRLNIRPTM
Sbjct  152  LTQADRSLGQKVASRLNIRPTM  173



>gb|ADB03784.1| catalase [Ipomoea batatas]
Length=492

 Score =   295 bits (756),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 139/142 (98%), Positives = 142/142 (100%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            THRHRLGPNYMLLPVNAPKCA+HNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL
Sbjct  351  THRHRLGPNYMLLPVNAPKCAHHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
            RIVTG+RDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVK+LSEPRVTHEIRSTWISY
Sbjct  411  RIVTGQRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKALSEPRVTHEIRSTWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
            LTQADRSLGQKVASRLNIRPTM
Sbjct  471  LTQADRSLGQKVASRLNIRPTM  492



>sp|P07145.1|CATA_IPOBA RecName: Full=Catalase [Ipomoea batatas]
 emb|CAA29063.1| unnamed protein product [Ipomoea batatas]
Length=492

 Score =   295 bits (756),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 139/142 (98%), Positives = 142/142 (100%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            THRHRLGPNYMLLPVNAPKCA+HNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL
Sbjct  351  THRHRLGPNYMLLPVNAPKCAHHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
            RIVTG+RDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVK+LSEPRVTHEIRSTWISY
Sbjct  411  RIVTGQRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKALSEPRVTHEIRSTWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
            LTQADRSLGQKVASRLNIRPTM
Sbjct  471  LTQADRSLGQKVASRLNIRPTM  492



>ref|XP_009624788.1| PREDICTED: catalase isozyme 3 [Nicotiana tomentosiformis]
Length=492

 Score =   246 bits (628),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD  R+AE++P PL
Sbjct  351  TQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPCRHAEQYPIPL  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
            R++TG+RDKC++EKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIRS WISY
Sbjct  411  RVLTGKRDKCIVEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD+SLGQK+ASRLNIRPTM
Sbjct  471  WSQADKSLGQKIASRLNIRPTM  492



>gb|AFR42410.1| catalase, partial [Eperua falcata]
Length=135

 Score =   230 bits (586),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 101/135 (75%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = -2

Query  622  PNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRR  443
            PN++ LPVNAPKCA+HNN YDG+MNF+HRDEE+DYFPS+FD  R+A+RFP P  IVTG+R
Sbjct  1    PNHLQLPVNAPKCAHHNNHYDGFMNFMHRDEEIDYFPSRFDPVRHAKRFPIPPAIVTGKR  60

Query  442  DKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRS  263
            ++C+IEKEN+FKQPG+RYRSWAPDRQDRF+ RWV+ L++PRVTHEIRS WISYL+QADRS
Sbjct  61   ERCIIEKENDFKQPGERYRSWAPDRQDRFVRRWVEVLADPRVTHEIRSIWISYLSQADRS  120

Query  262  LGQKVASRLNIRPTM  218
            LGQKVAS LN+RP++
Sbjct  121  LGQKVASHLNMRPSI  135



>dbj|BAH20283.1| AT1G20620 [Arabidopsis thaliana]
Length=145

 Score =   230 bits (586),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ PTP 
Sbjct  4    TQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPTPT  63

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
               TG R KCVI+KENNFKQ GDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIR  WISY
Sbjct  64   NSYTGIRTKCVIKKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGIWISY  123

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QADRSLGQK+ASRLN+RP++
Sbjct  124  WSQADRSLGQKLASRLNVRPSI  145



>ref|XP_010907090.1| PREDICTED: catalase isozyme 1-like [Elaeis guineensis]
Length=492

 Score =   241 bits (615),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 105/142 (74%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY++LP NAPKCA+HNN +DG+MNF+HRDEEV+YFPS++D  R+AERFP P 
Sbjct  351  TQRHRLGPNYLMLPANAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAERFPIPF  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
            RI+TGRR+KCVI KENNFKQPG+RYRSWAPDRQ+RFI RWV++LS+PRVT+EIR+ WISY
Sbjct  411  RILTGRREKCVIHKENNFKQPGERYRSWAPDRQERFICRWVEALSDPRVTYEIRTIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +Q DRSLGQK+A+RLN++P+M
Sbjct  471  WSQCDRSLGQKIATRLNVKPSM  492



>ref|XP_009794469.1| PREDICTED: catalase isozyme 3 [Nicotiana sylvestris]
 emb|CCP37652.1| catalase-3 [Nicotiana tabacum]
Length=492

 Score =   241 bits (614),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD  R+AE+ P P 
Sbjct  351  TQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPCRHAEQHPIPP  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
            R++TG+RDKC+IEKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIRS WISY
Sbjct  411  RVLTGKRDKCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD++LGQK+ASRLN+RPTM
Sbjct  471  WSQADKTLGQKIASRLNVRPTM  492



>gb|AGC65520.1| catalase [Eriobotrya japonica]
 gb|AGC65522.1| catalase [Eriobotrya japonica]
 gb|AGC65523.1| catalase [Eriobotrya japonica]
 gb|AGC65524.1| catalase [Eriobotrya japonica]
 gb|AGE15297.2| catalase 2 [Eriobotrya japonica]
Length=492

 Score =   240 bits (613),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 107/142 (75%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVNAPKCA+HNN YDG+MNF+HRDEEVDYFPS++   R+AE FP P 
Sbjct  351  TQRHRLGPNYLQLPVNAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRYQPARHAETFPIPS  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             I+TG+RDKCVIEKENNFKQPG+RYRSWAPDRQ+RF++RWV  LSEPRVT+EIRS WISY
Sbjct  411  NIITGKRDKCVIEKENNFKQPGERYRSWAPDRQERFLHRWVDVLSEPRVTYEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QADRS GQK+A+RLN+RP++
Sbjct  471  WSQADRSFGQKLATRLNVRPSI  492



>ref|XP_010061172.1| PREDICTED: catalase isozyme 3-like [Eucalyptus grandis]
 gb|KCW68094.1| hypothetical protein EUGRSUZ_F01776 [Eucalyptus grandis]
Length=492

 Score =   240 bits (613),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 107/142 (75%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            THR+RLGPNY+ LPVNAPKCA+HNN +DG+MN +HRDEE++YFPSKFD  R+AER+P P 
Sbjct  351  THRYRLGPNYLQLPVNAPKCAHHNNHHDGFMNIMHRDEEINYFPSKFDPVRHAERYPIPS  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
            +IVTG+R+K +IEKENNFKQPG+RYRSWAPDRQ+RFINRW+K+L+EPRVTHE RS WISY
Sbjct  411  QIVTGKREKVIIEKENNFKQPGERYRSWAPDRQERFINRWIKALTEPRVTHEHRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             TQAD+SLGQK+ASRL+ RP+M
Sbjct  471  WTQADKSLGQKLASRLSARPSM  492



>gb|ABY19573.1| catalase [Manihot esculenta]
Length=261

 Score =   232 bits (591),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY +LPVNAPKC YHNN YDG+MNF+HRDEEVDYFPS++D  R+AER P P 
Sbjct  120  TQRHRLGPNYKMLPVNAPKCNYHNNHYDGFMNFMHRDEEVDYFPSRYDPVRHAERTPLPH  179

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             I++GRR+KCVIEKENNFKQPGDRYRSW PDRQ+RF+ R V +LS+PR+THEIRS W+SY
Sbjct  180  AIISGRREKCVIEKENNFKQPGDRYRSWTPDRQERFLCRLVNALSDPRITHEIRSIWVSY  239

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +Q D+SLGQK+ASRLN+RP  
Sbjct  240  WSQCDKSLGQKLASRLNVRPNF  261



>ref|XP_006473789.1| PREDICTED: catalase-like isoform X1 [Citrus sinensis]
Length=477

 Score =   238 bits (608),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY++LPVNAPKC + NN YDG+MNF+HRDEEVDYFPS++D TR+AER+P P 
Sbjct  336  TQRHRLGPNYLMLPVNAPKCPHRNNHYDGFMNFMHRDEEVDYFPSRYDPTRHAERYPIPS  395

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             ++TGRR+K  IEKENNFKQPG+RYRSWAPDRQ+RF+NRW+K+L +PRVTHE+RS W+SY
Sbjct  396  DVITGRREKACIEKENNFKQPGERYRSWAPDRQERFLNRWIKALCDPRVTHEVRSIWVSY  455

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QADRSLGQK+ASRLN+RP++
Sbjct  456  WSQADRSLGQKLASRLNVRPSI  477



>ref|XP_008237987.1| PREDICTED: catalase isozyme 1 [Prunus mume]
Length=492

 Score =   239 bits (609),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 105/142 (74%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVNAPKC++HNN ++G+MNF+HRDEEV+YFPS++D  RNAERFP P 
Sbjct  351  TQRHRLGPNYLQLPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRNAERFPIPP  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             I++G+R+KC+IEKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIRS WISY
Sbjct  411  NILSGKREKCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD+SLGQK+ASRLN+RP++
Sbjct  471  WSQADKSLGQKLASRLNVRPSI  492



>ref|NP_001289779.1| catalase isozyme 1 [Nelumbo nucifera]
 gb|ADY11209.1| catalase [Nelumbo nucifera]
Length=492

 Score =   239 bits (609),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+LLP NAPKCA+HNN ++G+MNF+HR+EEV+YFPS++D  R+AER+P P 
Sbjct  351  TQRHRLGPNYLLLPANAPKCAHHNNHHEGFMNFLHREEEVNYFPSRYDPVRHAERYPIPP  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
            +I TG+R+KCVIEKENNFKQPG+RYRSWAPDRQ+RFI RW+ +LS+PRVTHEIRS WISY
Sbjct  411  QICTGKREKCVIEKENNFKQPGERYRSWAPDRQERFIKRWIDALSDPRVTHEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD+SLGQK+ASRLN++P+M
Sbjct  471  WSQADKSLGQKLASRLNVKPSM  492



>gb|AAX84671.1| catalase CAT2, partial [Manihot esculenta]
Length=270

 Score =   232 bits (591),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY +LPVNAPKC YHNN YDG+MNF+HRDEEVDYFPS++D  R+AER P P 
Sbjct  129  TQRHRLGPNYKMLPVNAPKCNYHNNHYDGFMNFMHRDEEVDYFPSRYDPVRHAERTPLPH  188

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             I++GRR+KCVIEKENNFKQPGDRYRSW PDRQ+RF+ R V +LS+PR+THEIRS W+SY
Sbjct  189  AIISGRREKCVIEKENNFKQPGDRYRSWTPDRQERFLCRLVNALSDPRITHEIRSIWVSY  248

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +Q D+SLGQK+ASRLN+RP  
Sbjct  249  WSQCDKSLGQKLASRLNVRPNF  270



>ref|XP_006435361.1| hypothetical protein CICLE_v10000948mg [Citrus clementina]
 ref|XP_006473790.1| PREDICTED: catalase-like isoform X2 [Citrus sinensis]
 gb|ESR48601.1| hypothetical protein CICLE_v10000948mg [Citrus clementina]
Length=493

 Score =   238 bits (608),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY++LPVNAPKC + NN YDG+MNF+HRDEEVDYFPS++D TR+AER+P P 
Sbjct  352  TQRHRLGPNYLMLPVNAPKCPHRNNHYDGFMNFMHRDEEVDYFPSRYDPTRHAERYPIPS  411

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             ++TGRR+K  IEKENNFKQPG+RYRSWAPDRQ+RF+NRW+K+L +PRVTHE+RS W+SY
Sbjct  412  DVITGRREKACIEKENNFKQPGERYRSWAPDRQERFLNRWIKALCDPRVTHEVRSIWVSY  471

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QADRSLGQK+ASRLN+RP++
Sbjct  472  WSQADRSLGQKLASRLNVRPSI  493



>ref|XP_007209948.1| hypothetical protein PRUPE_ppa004776mg [Prunus persica]
 gb|EMJ11147.1| hypothetical protein PRUPE_ppa004776mg [Prunus persica]
Length=492

 Score =   238 bits (608),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVNAPKC++HNN ++G+MNF+HRDEEV+YFPS++D  R+AERFP P 
Sbjct  351  TQRHRLGPNYLQLPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERFPIPP  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             I++G+R+KC+IEKENNFKQPG+RYRSWAPDRQ+RFI+RWV +LS+PRVTHEIRS WISY
Sbjct  411  NILSGKREKCIIEKENNFKQPGERYRSWAPDRQERFIHRWVDALSDPRVTHEIRSVWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD+SLGQK+ASRLN+RP++
Sbjct  471  WSQADKSLGQKLASRLNVRPSI  492



>emb|CAD42908.1| catalase [Prunus persica]
Length=492

 Score =   238 bits (608),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVNAPKC++HNN ++G+MNF+HRDEEV+YFPS++D  R+AERFP P 
Sbjct  351  TQRHRLGPNYLQLPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERFPIPP  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             I++G+R+KC+IEKENNFKQPG+RYRSWAPDRQ+RFI+RWV +LS+PRVTHEIRS WISY
Sbjct  411  NILSGKREKCIIEKENNFKQPGERYRSWAPDRQERFIHRWVDALSDPRVTHEIRSVWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD+SLGQK+ASRLN+RP++
Sbjct  471  WSQADKSLGQKLASRLNVRPSI  492



>gb|ABR15776.1| catalase [Litchi chinensis]
Length=291

 Score =   232 bits (591),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 105/142 (74%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY++LPVNAPKC +HNN YDG+MNF+HRDEEVDYFPSKF N  NAE+FP P 
Sbjct  150  TQRHRLGPNYLMLPVNAPKCPHHNNHYDGFMNFMHRDEEVDYFPSKFTNVANAEKFPIPG  209

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
            RI +G+R+K  IEKENNFK PGDRYRSWAPDRQ+RFI R V  LS+PRVT EIRS W+SY
Sbjct  210  RICSGKREKACIEKENNFKLPGDRYRSWAPDRQERFIKRVVDGLSDPRVTFEIRSIWVSY  269

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD+SLGQK+ASRLN+RP +
Sbjct  270  WSQADKSLGQKIASRLNVRPNI  291



>sp|Q9AXH0.1|CATA_AVIMR RecName: Full=Catalase [Avicennia marina]
 gb|AAK06839.1|AF328861_1 catalase [Avicennia marina]
 gb|AAP13538.1| catalase [Avicennia marina]
Length=492

 Score =   238 bits (606),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+LLPVNAPKCAYHNN YDG+MNF+HRDEEVDYFPSK+D TR+AER P P 
Sbjct  351  TQRHRLGPNYLLLPVNAPKCAYHNNHYDGFMNFMHRDEEVDYFPSKYDPTRHAERHPIPN  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             ++TGRRD+ VIEKE+NFKQ GDRYRSWAPDRQ+RF+ RWV +LS+PR+T EIRS W+SY
Sbjct  411  AVITGRRDRRVIEKEDNFKQAGDRYRSWAPDRQERFLRRWVDALSDPRLTLEIRSIWVSY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD+S GQK+ASRLN+RPTM
Sbjct  471  WSQADKSFGQKLASRLNVRPTM  492



>gb|AFR42412.1| catalase, partial [Eperua falcata]
Length=131

 Score =   226 bits (576),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 100/130 (77%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = -2

Query  607  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  428
            LPVNAPKCA+HNN YDG+MNF+HRDEE+DYFPS+FD  R+AERFP P  IVTG+R++C+I
Sbjct  2    LPVNAPKCAHHNNHYDGFMNFMHRDEEIDYFPSRFDPVRHAERFPIPPAIVTGKRERCII  61

Query  427  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  248
            EKEN+FKQPG+RYRSWAPDRQDRF+ RWV+ L++PRVTHEIRS WISYL+QADRSLGQKV
Sbjct  62   EKENDFKQPGERYRSWAPDRQDRFVRRWVEVLADPRVTHEIRSIWISYLSQADRSLGQKV  121

Query  247  ASRLNIRPTM  218
            AS LN+RP++
Sbjct  122  ASHLNMRPSI  131



>gb|KJB57963.1| hypothetical protein B456_009G187600 [Gossypium raimondii]
Length=492

 Score =   237 bits (605),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEE++YFPS++D +R+AERFP P 
Sbjct  351  TQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEINYFPSRYDPSRHAERFPIPP  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             + TG+R+KC+IEKENNFKQPG+RYRSWAPDRQ+RFINRWV ++S+PRVTHEIRS WI+Y
Sbjct  411  ALCTGKREKCIIEKENNFKQPGERYRSWAPDRQERFINRWVDAMSDPRVTHEIRSIWITY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD+SLGQK+ASRLN+RP++
Sbjct  471  WSQADKSLGQKLASRLNVRPSI  492



>emb|CAB56850.1| catalase [Prunus persica]
Length=423

 Score =   235 bits (600),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVNAPKC +HNN ++G+MNF+HRDEEV+YFPS+ D  R+AER+P P 
Sbjct  282  TQRHRLGPNYLQLPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRHDPVRHAERYPIPS  341

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             I++G+R+KCVIEKENNFKQPG+RYRSWAPDRQ+RFI+RWV +LS+PRVTHEIRS WISY
Sbjct  342  NILSGKREKCVIEKENNFKQPGERYRSWAPDRQERFIHRWVDALSDPRVTHEIRSVWISY  401

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD+SLGQK+ASRLN+RP++
Sbjct  402  WSQADKSLGQKLASRLNVRPSI  423



>ref|XP_009413057.1| PREDICTED: catalase isozyme 2-like [Musa acuminata subsp. malaccensis]
Length=492

 Score =   237 bits (604),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY++LPVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS++D  R+AERFP P 
Sbjct  351  TQRHRLGPNYLMLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAERFPIPS  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             +VTGRR+K +I KENNFKQPG+RYRSWAPDRQ+RF++RWV +LS+PRVTHEIR  WISY
Sbjct  411  SVVTGRREKSIINKENNFKQPGERYRSWAPDRQERFVHRWVDALSDPRVTHEIRDIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +Q D+SLGQK+A+RLN++PTM
Sbjct  471  WSQCDKSLGQKIATRLNVKPTM  492



>sp|P49317.1|CATA3_NICPL RecName: Full=Catalase isozyme 3 [Nicotiana plumbaginifolia]
 emb|CAA85426.1| catalase [Nicotiana plumbaginifolia]
Length=492

 Score =   237 bits (604),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
              RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD  R+AE++P P 
Sbjct  351  AQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPCRHAEQYPIPP  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             ++TG+RDKC+IEKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIRS W SY
Sbjct  411  CVLTGKRDKCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWFSY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD++LGQK+ASRLN+RPTM
Sbjct  471  WSQADKTLGQKIASRLNVRPTM  492



>ref|XP_010061174.1| PREDICTED: catalase isozyme 3-like isoform X2 [Eucalyptus grandis]
 gb|KCW68092.1| hypothetical protein EUGRSUZ_F01775 [Eucalyptus grandis]
Length=492

 Score =   237 bits (604),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 105/142 (74%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            THR+RLGPNY+ LPVNAPKCA+HNN +DG+MNF+HRDEE++YFPSKFD  R+AER+P P 
Sbjct  351  THRYRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEINYFPSKFDPVRHAERYPIPS  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
            +IVTG+R++ +IEKENNFKQ G+RYRSWAPDRQ+RFINRW+K+LSEPRVTHE RS WISY
Sbjct  411  QIVTGKRERVIIEKENNFKQAGERYRSWAPDRQERFINRWIKALSEPRVTHEHRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             TQAD+S+GQK+AS L+ RP+M
Sbjct  471  WTQADKSIGQKLASSLSARPSM  492



>gb|AIX10947.1| putative catalase [Gardenia jasminoides]
Length=492

 Score =   237 bits (604),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            THRHRLGPNY+ LPVNAPKCA+HNN YDGYMN +HRDEE+DYFPS++D  R+AER P P 
Sbjct  351  THRHRLGPNYLQLPVNAPKCAHHNNHYDGYMNIMHRDEEIDYFPSRYDPVRHAERHPIPT  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
            R++TGRR++ VIEKENNFKQP +RYRSWAPDRQ+RF+ RWV +LS+PR+THEIRS WISY
Sbjct  411  RVLTGRRERRVIEKENNFKQPVERYRSWAPDRQERFVRRWVDALSDPRLTHEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD+SLGQK+A RLN+RPTM
Sbjct  471  WSQADKSLGQKIAFRLNVRPTM  492



>ref|XP_009600533.1| PREDICTED: catalase isozyme 3-like [Nicotiana tomentosiformis]
Length=492

 Score =   236 bits (603),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVNAPKCA+HNN ++G MNF+HRDEEV+YFPS+FD  R+AE++P P 
Sbjct  351  TQRHRLGPNYLQLPVNAPKCAHHNNHHEGVMNFMHRDEEVNYFPSRFDPCRHAEQYPIPP  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
            RI+TG+RD+C+IEKENNFKQPG+RYRSW+PDRQ+RFI RW+ +LS+PRVTHEI + WISY
Sbjct  411  RILTGKRDRCIIEKENNFKQPGERYRSWSPDRQERFICRWINALSDPRVTHEIHTIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD+SLG+K+ASRLN+RPTM
Sbjct  471  WSQADKSLGEKIASRLNVRPTM  492



>dbj|BAF91369.1| catalase [Capsicum annuum]
Length=492

 Score =   236 bits (602),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 107/142 (75%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHR+GPNYM LPVNAPKCA+HNN  DG MNF+HRDEEVDY PS+FD  R AE++P P 
Sbjct  351  TQRHRIGPNYMQLPVNAPKCAHHNNHRDGAMNFMHRDEEVDYLPSRFDPCRPAEQYPIPS  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             ++TGRR+KCVI KENNFKQ G+RYRSWAPDRQDR+IN+WV+SLS+PRVTHEIRS WISY
Sbjct  411  CVLTGRREKCVIPKENNFKQAGERYRSWAPDRQDRYINKWVESLSDPRVTHEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
            L+QAD+S GQKVASRL ++PTM
Sbjct  471  LSQADKSCGQKVASRLTVKPTM  492



>ref|XP_010918244.1| PREDICTED: catalase isozyme 1 [Elaeis guineensis]
Length=492

 Score =   236 bits (602),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY++LP NAPKCA+HNN +DG+MNF+HRDEEV+YFPS++D  R+AERFP P 
Sbjct  351  TQRHRLGPNYLMLPANAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAERFPIPS  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
            RI+TGRR+KCVI KENNFKQPG+RYRSW P+RQ+RFI RWV++LS+PRVTHEI+S WISY
Sbjct  411  RILTGRREKCVIHKENNFKQPGERYRSWDPNRQERFIRRWVEALSDPRVTHEIQSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +Q D+SLGQK+A+RLN++P M
Sbjct  471  WSQCDKSLGQKIATRLNVKPCM  492



>ref|XP_010242894.1| PREDICTED: catalase isozyme 1-like isoform X1 [Nelumbo nucifera]
Length=492

 Score =   236 bits (601),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY++LP NAPKCA+HNN +DG+MNF+HRDEEV+YFPS++D  R+AERFP P 
Sbjct  351  TQRHRLGPNYLMLPANAPKCAHHNNHHDGFMNFLHRDEEVNYFPSRYDPVRHAERFPIPP  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
            RI TG+R+KCVIEKENNFKQPG+RYRS+ PDRQ+RFI RW  +LS+PRVTHEIRS WISY
Sbjct  411  RICTGKREKCVIEKENNFKQPGERYRSFDPDRQERFIKRWFDALSDPRVTHEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD+SLGQK+A+RLN++P+M
Sbjct  471  WSQADKSLGQKLATRLNVKPSM  492



>ref|XP_008365915.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   236 bits (601),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 105/142 (74%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVNAPKC++HNN ++G+MNF+HRDEEV+YFPS++D  R+AE FP P 
Sbjct  351  TQRHRLGPNYLQLPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPARHAETFPIPS  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             I TG+R+KCVIEKENNFKQPG+RYRSWAPDRQ+RF++RWV  LSEPRVTHEIRS WISY
Sbjct  411  NICTGKREKCVIEKENNFKQPGERYRSWAPDRQERFLHRWVDVLSEPRVTHEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QADRS GQK+ASRLN+RP++
Sbjct  471  WSQADRSFGQKLASRLNVRPSI  492



>ref|XP_008348924.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   236 bits (601),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 105/142 (74%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVNAPKC++HNN ++G+MNF+HRDEEV+YFPS++D  R+AE FP P 
Sbjct  351  TQRHRLGPNYLQLPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPARHAETFPIPS  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             I TG+R+KCVIEKENNFKQPG+RYRSWAPDRQ+RF++RWV  LSEPRVTHEIRS WISY
Sbjct  411  NICTGKREKCVIEKENNFKQPGERYRSWAPDRQERFLHRWVDVLSEPRVTHEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QADRS GQK+ASRLN+RP++
Sbjct  471  WSQADRSFGQKLASRLNVRPSI  492



>ref|XP_010536470.1| PREDICTED: catalase-2-like [Tarenaya hassleriana]
Length=492

 Score =   236 bits (601),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVNAPKC +HNN +DG+MNF+HRDEEV+YFPS+FD  R+AERFP+P 
Sbjct  351  TQRHRLGPNYLQLPVNAPKCVHHNNHHDGFMNFMHRDEEVNYFPSRFDPVRHAERFPSPP  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             I +GRR+KC+IEKENNFKQPG+RYRSWAPDRQ+RF+ RWV++LS+ R THEIRS WISY
Sbjct  411  AICSGRREKCIIEKENNFKQPGERYRSWAPDRQERFLKRWVEALSDKRCTHEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD+SLGQK+ASRLN+RP+ 
Sbjct  471  WSQADKSLGQKLASRLNVRPSF  492



>ref|XP_002306976.2| catalase family protein [Populus trichocarpa]
 gb|EEE93972.2| catalase family protein [Populus trichocarpa]
Length=492

 Score =   236 bits (601),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS+ D +R+AERFP P 
Sbjct  351  TQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRHDPSRHAERFPIPS  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             + +GRR+KC+IEKENNFKQPG+RYRSWAPDRQ+RF+ RWV +LSEPRVTHE+RS WISY
Sbjct  411  AVCSGRREKCIIEKENNFKQPGERYRSWAPDRQERFVRRWVDALSEPRVTHEVRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD+SLGQK+AS LN+RP++
Sbjct  471  WSQADKSLGQKLASHLNVRPSV  492



>ref|XP_011041225.1| PREDICTED: catalase isozyme 1 [Populus euphratica]
Length=492

 Score =   236 bits (601),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS+ D +R+AERFP P 
Sbjct  351  TQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRHDPSRHAERFPIPS  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             + +GRR+KC+IEKENNFKQPG+RYRSWAPDRQ+RF+ RWV +LSEPRVTHE+RS WISY
Sbjct  411  AVCSGRREKCIIEKENNFKQPGERYRSWAPDRQERFVCRWVDALSEPRVTHEVRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD+SLGQK+AS LN+RP++
Sbjct  471  WSQADKSLGQKLASHLNVRPSI  492



>gb|KJB14249.1| hypothetical protein B456_002G115900 [Gossypium raimondii]
Length=344

 Score =   231 bits (589),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEE++YFPS++D  R+AE FP P 
Sbjct  203  TQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEINYFPSRYDPVRHAEMFPIPP  262

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             + TGRR+KC+IEKENNFKQPG+RYRSWA DRQ+RFI RWV +LS+PRVTHEIRS WISY
Sbjct  263  AVCTGRREKCIIEKENNFKQPGERYRSWAADRQERFICRWVDALSDPRVTHEIRSIWISY  322

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD+S+GQK+ASRLN+RP++
Sbjct  323  WSQADKSVGQKLASRLNVRPSI  344



>gb|AAB88173.1| catalase, partial [Glycine max]
Length=308

 Score =   230 bits (586),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            + RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE FP P 
Sbjct  167  SQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRYDPVRHAETFPIPP  226

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             I +GRR+KC IEKENNFKQPG+RYRSWAPDRQDRF  RWV +LS+PRVTHEIRS WISY
Sbjct  227  AICSGRREKCGIEKENNFKQPGERYRSWAPDRQDRFNRRWVDALSDPRVTHEIRSVWISY  286

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QADRSLGQK+ASRL++RP +
Sbjct  287  WSQADRSLGQKIASRLSMRPNI  308



>gb|AAM97542.1| catalase 3 [Capsicum annuum]
Length=492

 Score =   235 bits (599),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD  R+AE++P P 
Sbjct  351  TQRHRLGPNYLQLPPNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPCRHAEQYPIPP  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
            R++ G+RD+C+I+KENNFKQPG+RYRSWAPDRQ+RFI RWV +LSEPRVTHEIR+ W+SY
Sbjct  411  RVLNGKRDRCIIQKENNFKQPGERYRSWAPDRQERFICRWVDALSEPRVTHEIRTIWLSY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD+SLGQK+ASRLN++PTM
Sbjct  471  WSQADKSLGQKLASRLNVKPTM  492



>ref|XP_009400996.1| PREDICTED: catalase isozyme 2 [Musa acuminata subsp. malaccensis]
Length=492

 Score =   235 bits (599),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY++LPVNAPKCA+HNN YDG+MNF+HRDEEVDYFPS++D  R+AERFP P 
Sbjct  351  TQRHRLGPNYLMLPVNAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRYDPVRHAERFPIPT  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
            R++TG+R+KC+I KENNFKQPG+RYRS++PDRQ+RFI RWV++LS+P+VTHEIRS WISY
Sbjct  411  RVLTGKREKCMISKENNFKQPGERYRSFSPDRQERFIRRWVEALSDPKVTHEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +Q D+SL QK+A+RL+++P+M
Sbjct  471  WSQCDKSLSQKLATRLSVKPSM  492



>ref|XP_009773579.1| PREDICTED: catalase isozyme 3-like [Nicotiana sylvestris]
Length=492

 Score =   235 bits (599),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVNAPKCA+HNN ++G MNF++RDEEV+YFPS+FD  R+AE++P P 
Sbjct  351  TQRHRLGPNYLQLPVNAPKCAHHNNHHEGVMNFMYRDEEVNYFPSRFDPCRHAEQYPIPP  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
            RI+TG+RD+C+IEKENNFKQPG+RYRSW+PDRQ+RFI RW+ +LS+PRVTHEIR  WISY
Sbjct  411  RILTGKRDRCIIEKENNFKQPGERYRSWSPDRQERFICRWINALSDPRVTHEIRIIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD+SLG+K+ASRLN+RPTM
Sbjct  471  WSQADKSLGEKIASRLNVRPTM  492



>ref|XP_008237989.1| PREDICTED: catalase isozyme 1-like [Prunus mume]
Length=492

 Score =   235 bits (599),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVNAPKC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AER+P P 
Sbjct  351  TQRHRLGPNYLQLPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERYPIPS  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             I+ G+R+KCVIEKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIRS WISY
Sbjct  411  NILYGKREKCVIEKENNFKQPGERYRSWAPDRQERFIRRWVDALSDPRVTHEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD+SLGQK+ASRLN+RP++
Sbjct  471  WSQADKSLGQKLASRLNVRPSI  492



>emb|CDP07287.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   234 bits (598),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LP NAPKCA+HNN +DG+MNF+HRDEEV+YFPS++D  R+AER P P 
Sbjct  351  TQRHRLGPNYLQLPANAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAERHPIPP  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             +++G+RDKCVI+KENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+ RVTHEIRS WISY
Sbjct  411  PVLSGKRDKCVIQKENNFKQPGERYRSWAPDRQERFICRWVDALSDARVTHEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD+SLGQK+A+RLN+RPTM
Sbjct  471  WSQADKSLGQKIATRLNVRPTM  492



>sp|Q9M5L6.1|CATA_CAPAN RecName: Full=Catalase; AltName: Full=CaCat1 [Capsicum annuum]
 gb|AAF34718.1|AF227952_1 catalase [Capsicum annuum]
Length=492

 Score =   234 bits (598),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHR+GPNYM LPVNAPKCA+HNN  DG MNF+HRDEEVDY PS+FD  R AE++P P 
Sbjct  351  TQRHRIGPNYMQLPVNAPKCAHHNNHRDGAMNFMHRDEEVDYLPSRFDPCRPAEQYPIPS  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             ++TGRR+KCVI KENNFKQ G+RYRSWAPDRQDR+IN+WV+SLS+PR THEIRS WISY
Sbjct  411  CVLTGRREKCVIPKENNFKQAGERYRSWAPDRQDRYINKWVESLSDPRATHEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
            L+QAD+S GQKVASRL ++PTM
Sbjct  471  LSQADKSCGQKVASRLTVKPTM  492



>ref|XP_008802866.1| PREDICTED: catalase isozyme 1 [Phoenix dactylifera]
Length=492

 Score =   234 bits (597),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY++LP NAPKCA+HNN +DG+MNF+HRDEEV+YFPS++D  R+AE FP P 
Sbjct  351  TQRHRLGPNYLMLPANAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAETFPIPS  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             ++TGRR+KCVI KENNFKQPG+RYRSWAPDRQ RFI RWV++LS+PRVT+EIRS WISY
Sbjct  411  CVLTGRREKCVIHKENNFKQPGERYRSWAPDRQGRFICRWVEALSDPRVTYEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +Q DRSLGQK+A+RLN++P+M
Sbjct  471  WSQCDRSLGQKIATRLNVKPSM  492



>ref|XP_010061175.1| PREDICTED: catalase-like [Eucalyptus grandis]
Length=492

 Score =   234 bits (597),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVNAPKC +HNN ++G MNF+HRDEEV+YFPS+FD+ R+AE+FP P 
Sbjct  351  TQRHRLGPNYLQLPVNAPKCTHHNNHHEGLMNFMHRDEEVNYFPSRFDSVRHAEKFPIPP  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             ++ G+RD+C+IEKENNFKQPG+RYRSWAPDRQ+RFI RWV++LS+PRVT EIRS WISY
Sbjct  411  PVLNGKRDRCMIEKENNFKQPGERYRSWAPDRQERFIGRWVEALSDPRVTQEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             TQAD+SLGQK+AS LN+RP+M
Sbjct  471  WTQADKSLGQKIASCLNVRPSM  492



>ref|XP_010498496.1| PREDICTED: catalase-3 [Camelina sativa]
 ref|XP_010459748.1| PREDICTED: catalase-3 [Camelina sativa]
 ref|XP_010477307.1| PREDICTED: catalase-3 [Camelina sativa]
Length=492

 Score =   234 bits (596),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P P 
Sbjct  351  TQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPIPT  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
            +  TG R KC+I+KENNFKQPGDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIRS WISY
Sbjct  411  KSYTGIRTKCIIKKENNFKQPGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QADRSLGQK+ASRLN+RP++
Sbjct  471  WSQADRSLGQKLASRLNVRPSI  492



>gb|AIS20825.1| CAT [Pyrus x bretschneideri]
Length=492

 Score =   234 bits (596),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVNAPKC++HNN ++G+MNF+HRDEEV+YFPS++D  R+AE FP P 
Sbjct  351  TQRHRLGPNYLQLPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPARHAETFPIPS  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             I TG+R+KCVIEKENNFKQPG+RYRSWAPDRQ+RF++RWV +LS+PRVT+EIRS WISY
Sbjct  411  NICTGKREKCVIEKENNFKQPGERYRSWAPDRQERFLHRWVDALSDPRVTYEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QADRS GQK+ASRLN+RP++
Sbjct  471  WSQADRSFGQKLASRLNVRPSI  492



>ref|XP_009110221.1| PREDICTED: catalase-3 [Brassica rapa]
 gb|AFN81244.1| catalase 2 [Brassica rapa subsp. pekinensis]
 emb|CDX96630.1| BnaA08g21730D [Brassica napus]
Length=492

 Score =   234 bits (596),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P P 
Sbjct  351  TQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPIPT  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
            +  TG R KC+I+KENNFKQPGDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIRS WISY
Sbjct  411  KSYTGIRTKCIIKKENNFKQPGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QADRSLGQK+ASRLN+RP++
Sbjct  471  WSQADRSLGQKLASRLNVRPSI  492



>emb|CAI43948.1| catalase [Populus deltoides]
 gb|ABK96317.1| unknown [Populus trichocarpa x Populus deltoides]
Length=492

 Score =   234 bits (596),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE FP P 
Sbjct  351  TQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAESFPIPP  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             + +G+R+KC+IEKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIRS WISY
Sbjct  411  AVCSGKREKCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD+SLGQK+ASRLN+RP++
Sbjct  471  WSQADKSLGQKLASRLNVRPSI  492



>ref|XP_008789355.1| PREDICTED: catalase isozyme 1-like [Phoenix dactylifera]
Length=492

 Score =   233 bits (595),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY++LP NAPKCA+HNN +DG+MNF+HRDEEV+YFPS++D  R+AER P P 
Sbjct  351  TQRHRLGPNYLMLPANAPKCAHHNNHHDGFMNFLHRDEEVNYFPSRYDPVRHAERCPIPS  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
            RI+TGRR+KCVI+KENNFKQPG+RYRSW PDRQ RFI RWV++LS+PRVTHEI+S WISY
Sbjct  411  RILTGRREKCVIQKENNFKQPGERYRSWDPDRQGRFIRRWVEALSDPRVTHEIQSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +Q D+SLG+K+A+RLN++P+M
Sbjct  471  WSQCDKSLGRKIATRLNVKPSM  492



>ref|XP_002301920.1| catalase family protein [Populus trichocarpa]
 gb|ABK96479.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE81193.1| catalase family protein [Populus trichocarpa]
Length=492

 Score =   233 bits (595),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE FP P 
Sbjct  351  TQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAESFPIPP  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             + +G+R+KC+IEKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIRS WISY
Sbjct  411  AVCSGKREKCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD+SLGQK+ASRLN+RP++
Sbjct  471  WSQADKSLGQKLASRLNVRPSI  492



>gb|AAA57551.1| catalase, partial [Nicotiana sylvestris]
Length=383

 Score =   231 bits (588),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHR+GPNYM LPVNAPKCA+HNN  DG MNF+HRDEEVDY PS+FD  R+AE++P P 
Sbjct  242  TQRHRIGPNYMQLPVNAPKCAHHNNHRDGAMNFMHRDEEVDYLPSRFDPCRHAEQYPIPS  301

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
            R++TGRR+ CVIEKENNFKQ G+RYRSW PDRQDR++++WV+ LS+PRVT+EIRS WISY
Sbjct  302  RVLTGRREMCVIEKENNFKQAGERYRSWEPDRQDRYVSKWVEHLSDPRVTYEIRSIWISY  361

Query  283  LTQADRSLGQKVASRLNIRPTM  218
            L+QAD+S GQKVASRL ++PTM
Sbjct  362  LSQADKSCGQKVASRLTLKPTM  383



>ref|XP_008373403.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   233 bits (595),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVNAPKC++HNN ++G+MNF+HRDEEV+YFPS++D  R+AE FP P 
Sbjct  351  TQRHRLGPNYLQLPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAETFPIPS  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             I TG+R+KCVIEKENNFKQPG+RYRSWAPDRQ+RF++RWV +LS+PRVT+EIRS WISY
Sbjct  411  NICTGKREKCVIEKENNFKQPGERYRSWAPDRQERFLHRWVDALSDPRVTYEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QADRS GQK+ASRLN+RP++
Sbjct  471  WSQADRSFGQKLASRLNVRPSI  492



>ref|NP_001031072.3| catalase 3 [Arabidopsis thaliana]
 gb|AEE29996.1| catalase 3 [Arabidopsis thaliana]
Length=377

 Score =   230 bits (586),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ PTP 
Sbjct  236  TQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPTPT  295

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
               TG R KCVI+KENNFKQ GDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIR  WISY
Sbjct  296  NSYTGIRTKCVIKKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGIWISY  355

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QADRSLGQK+ASRLN+RP++
Sbjct  356  WSQADRSLGQKLASRLNVRPSI  377



>ref|XP_011034872.1| PREDICTED: catalase isozyme 1-like [Populus euphratica]
Length=492

 Score =   233 bits (594),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE FP P 
Sbjct  351  TQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAESFPIPP  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             + +G+R+KC+IEKENNFKQPG+RYRSWAPDRQ+RF+ RWV +LS+PRVTHEIRS WISY
Sbjct  411  AVCSGKREKCIIEKENNFKQPGERYRSWAPDRQERFVCRWVDALSDPRVTHEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD+SLGQK+ASRLN+RP++
Sbjct  471  WSQADKSLGQKLASRLNVRPSI  492



>gb|KFK44175.1| hypothetical protein AALP_AA1G224300 [Arabis alpina]
Length=492

 Score =   233 bits (594),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 105/142 (74%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P P 
Sbjct  351  TQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPVPS  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
            +  TG R KCVI+KENNFKQPGDRYRSWAPDRQDRFI RWV+ LSEPR+THEIR  WISY
Sbjct  411  KSYTGIRTKCVIKKENNFKQPGDRYRSWAPDRQDRFIKRWVEILSEPRLTHEIRGIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QADRSLGQK+ASRLN+RP++
Sbjct  471  WSQADRSLGQKLASRLNVRPSI  492



>gb|ACJ11733.1| catalase [Gossypium hirsutum]
Length=492

 Score =   233 bits (594),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEE++YFPS++D  R+AE FP P 
Sbjct  351  TQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEINYFPSRYDPVRHAEMFPIPP  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             + TGRR+KC+IEKENNFKQPG+RYRSWA DRQ+RFI RWV++LS+PRVTHEIRS WISY
Sbjct  411  AVCTGRREKCIIEKENNFKQPGERYRSWAADRQERFICRWVEALSDPRVTHEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD+SLGQK+ASRLN+RP++
Sbjct  471  WSQADKSLGQKLASRLNVRPSI  492



>emb|CDP07288.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   233 bits (593),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNYM LPVNAPKCA+HNN YDG+MNF+HRDEEVDYFPS+FD  R+A R P P 
Sbjct  351  TQRHRLGPNYMQLPVNAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRFDPVRHAARHPIPS  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             ++ G+RD+CVI KENNFKQ G+RYRSWAPDRQ+RFI RWV  LS+ RVTHEIRS WISY
Sbjct  411  TVLRGKRDRCVIPKENNFKQAGERYRSWAPDRQERFICRWVDILSDARVTHEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD+SLGQK+A+RLN+RPTM
Sbjct  471  WSQADKSLGQKMATRLNVRPTM  492



>emb|CDY31488.1| BnaC05g15970D [Brassica napus]
Length=500

 Score =   233 bits (594),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P P 
Sbjct  359  TQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPIPN  418

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
            +  TG R KC+I+KENNFKQPGDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIRS WISY
Sbjct  419  KSYTGIRTKCIIKKENNFKQPGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRSIWISY  478

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QADRSLGQK+ASRLN+RP++
Sbjct  479  WSQADRSLGQKLASRLNVRPSI  500



>ref|XP_007210576.1| hypothetical protein PRUPE_ppa004763mg [Prunus persica]
 gb|EMJ11775.1| hypothetical protein PRUPE_ppa004763mg [Prunus persica]
Length=492

 Score =   232 bits (592),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVNAPKC +HNN ++G+MNF+HRDEEV+YFPS+ D  R+AER+P P 
Sbjct  351  TQRHRLGPNYLQLPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRHDPVRHAERYPIPS  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             I++G+R+KCVIEKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIRS WISY
Sbjct  411  NILSGKREKCVIEKENNFKQPGERYRSWAPDRQERFIRRWVDALSDPRVTHEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD+SLGQK+ SRLN+RP++
Sbjct  471  WSQADKSLGQKLLSRLNVRPSI  492



>emb|CDY33636.1| BnaC08g19360D [Brassica napus]
Length=492

 Score =   232 bits (592),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P P 
Sbjct  351  TQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPIPN  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
            +  TG R KC+I+KENNFKQPGDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIRS WISY
Sbjct  411  KSYTGIRTKCIIKKENNFKQPGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QADRSLGQK+ASRLN+RP++
Sbjct  471  WSQADRSLGQKLASRLNVRPSI  492



>emb|CDY29519.1| BnaA06g14510D [Brassica napus]
Length=492

 Score =   232 bits (592),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P P 
Sbjct  351  TQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPIPN  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
            +  TG R KC+I+KENNFKQPGDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIRS WISY
Sbjct  411  KSYTGIRTKCIIKKENNFKQPGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QADRSLGQK+ASRLN+RP++
Sbjct  471  WSQADRSLGQKLASRLNVRPSI  492



>ref|XP_009103334.1| PREDICTED: catalase-3-like [Brassica rapa]
 gb|AAB53101.2| catalase [Brassica napus]
 gb|AET08935.1| catalase [Brassica napus]
Length=492

 Score =   232 bits (592),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P P 
Sbjct  351  TQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPIPN  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
            +  TG R KC+I+KENNFKQPGDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIRS WISY
Sbjct  411  KSYTGIRTKCIIKKENNFKQPGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QADRSLGQK+ASRLN+RP++
Sbjct  471  WSQADRSLGQKLASRLNVRPSI  492



>emb|CAD42909.1| catalase [Prunus persica]
Length=492

 Score =   232 bits (592),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVNAPKC +HNN ++G+MNF+HRDEEV+YFPS+ D  R+AER+P P 
Sbjct  351  TQRHRLGPNYLQLPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRHDPVRHAERYPIPS  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             I++G+R+KCVIEKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIRS WISY
Sbjct  411  NILSGKREKCVIEKENNFKQPGERYRSWAPDRQERFIRRWVDALSDPRVTHEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD+SLGQK+ SRLN+RP++
Sbjct  471  WSQADKSLGQKLLSRLNVRPSI  492



>ref|XP_011074091.1| PREDICTED: catalase isozyme 3 isoform X2 [Sesamum indicum]
Length=492

 Score =   232 bits (592),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D +R+AER+P P 
Sbjct  351  TQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPSRHAERYPIPP  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             +++G+R K  IEKENNFKQPGDRYRSWAPDRQ+RFI RWV++LS+PR+THEIRS W+SY
Sbjct  411  VVLSGKRGKICIEKENNFKQPGDRYRSWAPDRQERFIRRWVEALSDPRLTHEIRSIWVSY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD+SLGQK+ASRLN+RP M
Sbjct  471  WSQADKSLGQKLASRLNVRPAM  492



>gb|AEQ30070.1| catalase, partial [Litchi chinensis]
Length=487

 Score =   232 bits (592),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 105/142 (74%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY++LPVNAPKC +HNN YDG+MNF+HRDEEVDYFPSKF N  NAE+FP P 
Sbjct  346  TQRHRLGPNYLMLPVNAPKCPHHNNHYDGFMNFMHRDEEVDYFPSKFTNVANAEKFPIPG  405

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
            RI +G+R+K  IEKENNFK PGDRYRSWAPDRQ+RFI R V  LS+PRVT EIRS W+SY
Sbjct  406  RICSGKREKACIEKENNFKLPGDRYRSWAPDRQERFIKRVVDGLSDPRVTFEIRSIWVSY  465

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD+SLGQK+ASRLN+RP +
Sbjct  466  WSQADKSLGQKIASRLNVRPNI  487



>gb|AJE26131.1| catalase [Salix matsudana]
Length=492

 Score =   232 bits (592),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE FP P 
Sbjct  351  TQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAESFPIPP  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             + +G+R+KC+IEKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PR THEIRS WISY
Sbjct  411  AVCSGKREKCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRATHEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD+SLGQK+ASRLN+RP++
Sbjct  471  WSQADKSLGQKLASRLNVRPSI  492



>ref|XP_011074092.1| PREDICTED: catalase isozyme 3 isoform X3 [Sesamum indicum]
Length=492

 Score =   232 bits (592),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D +R+AER+P P 
Sbjct  351  TQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPSRHAERYPIPP  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             +++G+R K  IEKENNFKQPGDRYRSWAPDRQ+RFI RWV++LS+PR+THEIRS W+SY
Sbjct  411  VVLSGKRGKICIEKENNFKQPGDRYRSWAPDRQERFIRRWVEALSDPRLTHEIRSIWVSY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD+SLGQK+AS LN+RPTM
Sbjct  471  WSQADKSLGQKLASHLNVRPTM  492



>gb|KCW68095.1| hypothetical protein EUGRSUZ_F01777 [Eucalyptus grandis]
Length=584

 Score =   234 bits (597),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVNAPKC +HNN ++G MNF+HRDEEV+YFPS+FD+ R+AE+FP P 
Sbjct  443  TQRHRLGPNYLQLPVNAPKCTHHNNHHEGLMNFMHRDEEVNYFPSRFDSVRHAEKFPIPP  502

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             ++ G+RD+C+IEKENNFKQPG+RYRSWAPDRQ+RFI RWV++LS+PRVT EIRS WISY
Sbjct  503  PVLNGKRDRCMIEKENNFKQPGERYRSWAPDRQERFIGRWVEALSDPRVTQEIRSIWISY  562

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             TQAD+SLGQK+AS LN+RP+M
Sbjct  563  WTQADKSLGQKIASCLNVRPSM  584



>ref|XP_009149539.1| PREDICTED: catalase-3 [Brassica rapa]
Length=543

 Score =   233 bits (594),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P P 
Sbjct  402  TQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPIPN  461

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
            +  TG R KC+I+KENNFKQPGDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIRS WISY
Sbjct  462  KSYTGIRTKCIIKKENNFKQPGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRSIWISY  521

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QADRSLGQK+ASRLN+RP++
Sbjct  522  WSQADRSLGQKLASRLNVRPSI  543



>gb|ACJ73905.1| CAT1 [Solanum nigrum]
Length=168

 Score =   221 bits (564),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T R+RLGPNY+ LP NAPKCA+HNN YDG MNF+HRDEE+DYFPS++D  R+AE +P P 
Sbjct  27   TQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDQVRHAEIYPIPS  86

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
            ++ +G+R+KC+I+KENNFKQ G+RYR++ PDRQ+RF+ RWV+ LS+PR+T+EIRS WISY
Sbjct  87   KVCSGKREKCIIQKENNFKQAGERYRTFTPDRQERFVRRWVEPLSDPRITYEIRSIWISY  146

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD+SLGQK+ASRLN+RP++
Sbjct  147  WSQADKSLGQKLASRLNVRPSI  168



>sp|P55311.1|CATA_SOLME RecName: Full=Catalase [Solanum melongena]
 emb|CAA50644.1| catalase [Solanum melongena]
Length=492

 Score =   232 bits (591),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 105/142 (74%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHR+GPNYM LPVNAPKCA+HNN  DG MNF+HRDEEVDY PS+FD  R AE++P P 
Sbjct  351  TQRHRIGPNYMQLPVNAPKCAHHNNHRDGAMNFMHRDEEVDYLPSRFDPCRPAEQYPIPS  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             ++TGRR+KCVI KENNFKQ G+RYR+W PDRQDR+IN+WV+SLS+PRVTHEIRS WISY
Sbjct  411  CVLTGRREKCVIPKENNFKQAGERYRTWEPDRQDRYINKWVESLSDPRVTHEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
            L+QAD+S GQKVASRL ++PTM
Sbjct  471  LSQADKSCGQKVASRLLVKPTM  492



>ref|XP_009590727.1| PREDICTED: catalase isozyme 1 [Nicotiana tomentosiformis]
Length=492

 Score =   232 bits (591),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHR+GPNYM LPVNAPKCA+HNN  DG MNF+HRDEEVDY PS+FD  R+AE++P P 
Sbjct  351  TQRHRIGPNYMQLPVNAPKCAHHNNHRDGAMNFMHRDEEVDYLPSRFDPCRHAEQYPIPS  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
            R++TGRR+ CVIEKENNFKQ G+RYRSW PDRQDR++++WV+ LS+PRVT+EIRS WISY
Sbjct  411  RVLTGRREMCVIEKENNFKQAGERYRSWEPDRQDRYVSKWVEHLSDPRVTYEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
            L+QAD+S GQKVASRL ++PTM
Sbjct  471  LSQADKSCGQKVASRLTVKPTM  492



>ref|XP_003631925.1| PREDICTED: catalase isozyme 1-like [Vitis vinifera]
Length=492

 Score =   231 bits (590),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 106/140 (76%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVNAPKCA+HNN +DG MNF+HRDEEVDYFPS+FD  R+AE FP P 
Sbjct  351  TQRHRLGPNYLQLPVNAPKCAFHNNHHDGSMNFMHRDEEVDYFPSRFDPVRHAETFPIPS  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             I  G+R+K VIEKENNFKQPG+RYRS+APDRQ+RFINRWV++LS+PRVT+EIRS WISY
Sbjct  411  TICHGKREKVVIEKENNFKQPGERYRSFAPDRQERFINRWVETLSDPRVTYEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRP  224
             +QADRSLGQK+ASRLN++P
Sbjct  471  WSQADRSLGQKLASRLNVKP  490



>ref|NP_001268098.1| catalase [Vitis vinifera]
 gb|AAL83720.1|AF236127_1 catalase [Vitis vinifera]
Length=492

 Score =   231 bits (590),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 106/140 (76%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVNAPKCA+HNN +DG MNF+HRDEEVDYFPS+FD  R+AE FP P 
Sbjct  351  TQRHRLGPNYLQLPVNAPKCAFHNNHHDGSMNFMHRDEEVDYFPSRFDPVRHAETFPIPS  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             I  G+R+K VIEKENNFKQPG+RYRS+APDRQ+RFINRWV++LS+PRVT+EIRS WISY
Sbjct  411  TICHGKREKVVIEKENNFKQPGERYRSFAPDRQERFINRWVETLSDPRVTYEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRP  224
             +QADRSLGQK+ASRLN++P
Sbjct  471  WSQADRSLGQKLASRLNVKP  490



>ref|XP_006828714.1| hypothetical protein AMTR_s00001p00022550 [Amborella trichopoda]
 gb|ERM96130.1| hypothetical protein AMTR_s00001p00022550 [Amborella trichopoda]
Length=492

 Score =   231 bits (590),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY++LPVNAPKCA+HNN YDG+MNF HRDEEVDYFPS+FD  R+AER P P 
Sbjct  351  TQRHRLGPNYLMLPVNAPKCAHHNNHYDGFMNFAHRDEEVDYFPSRFDPVRHAERCPLPP  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
            ++V+G+R++CVIEKENNFKQPGDRYRS+APDRQ+RF+ R V +LS+ RVTHEIRS WISY
Sbjct  411  QLVSGKRERCVIEKENNFKQPGDRYRSFAPDRQERFVKRIVDALSDTRVTHEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +Q D+SLGQK+A+RLNI+P M
Sbjct  471  WSQCDKSLGQKIATRLNIKPHM  492



>dbj|BAH20307.1| AT1G20620 [Arabidopsis thaliana]
Length=458

 Score =   231 bits (588),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ PTP 
Sbjct  317  TQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPTPT  376

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
               TG R KCVI+KENNFKQ GDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIR  WISY
Sbjct  377  NSYTGIRTKCVIKKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGIWISY  436

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QADRSLGQK+ASRLN+RP++
Sbjct  437  WSQADRSLGQKLASRLNVRPSI  458



>emb|CAC04509.1| catalase [Digitalis lanata]
Length=265

 Score =   224 bits (572),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AERFP P 
Sbjct  124  TQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPCRHAERFPHPP  183

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
              + G+RD+  IEKENNFKQPG++YRS+ PDRQ+RFI RWV +LS+PR+THEIRS W+SY
Sbjct  184  VALNGKRDRICIEKENNFKQPGEKYRSFPPDRQERFIKRWVDALSDPRLTHEIRSIWVSY  243

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             TQAD+SLGQK+ASRLNIRPTM
Sbjct  244  WTQADKSLGQKLASRLNIRPTM  265



>gb|KHG25152.1| Catalase isozyme 1 [Gossypium arboreum]
Length=492

 Score =   231 bits (590),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEE++YFPS++D  R+AE FP P 
Sbjct  351  TQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEINYFPSRYDPVRHAEMFPIPP  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             + TGRR+KC+IEKENNFKQPG+RYRSWA DRQ+RFI RWV++ S+PRVTHEIRS WISY
Sbjct  411  AVCTGRREKCIIEKENNFKQPGERYRSWAADRQERFICRWVEAFSDPRVTHEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD+SLGQK+ASRLN+RP++
Sbjct  471  WSQADKSLGQKLASRLNVRPSI  492



>sp|P49319.2|CATA1_TOBAC RecName: Full=Catalase isozyme 1; AltName: Full=Salicylic acid-binding 
protein; Short=SABP [Nicotiana tabacum]
 gb|AAA57552.1| catalase [Nicotiana tabacum]
Length=492

 Score =   231 bits (590),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHR+GPNYM LPVNAPKCA+HNN  DG MNF+HRDEEVDY PS+FD  R+AE++P P 
Sbjct  351  TQRHRIGPNYMQLPVNAPKCAHHNNHRDGAMNFMHRDEEVDYLPSRFDPCRHAEQYPIPS  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
            R++TGRR+ CVIEKENNFKQ G+RYRSW PDRQDR++++WV+ LS+PRVT+EIRS WISY
Sbjct  411  RVLTGRREMCVIEKENNFKQAGERYRSWEPDRQDRYVSKWVEHLSDPRVTYEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
            L+QAD+S GQKVASRL ++PTM
Sbjct  471  LSQADKSCGQKVASRLTLKPTM  492



>emb|CDY01364.1| BnaA07g11370D [Brassica napus]
Length=556

 Score =   233 bits (594),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P P 
Sbjct  415  TQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPIPN  474

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
            +  TG R KC+I+KENNFKQPGDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIRS WISY
Sbjct  475  KSYTGIRTKCIIKKENNFKQPGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRSIWISY  534

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QADRSLGQK+ASRLN+RP++
Sbjct  535  WSQADRSLGQKLASRLNVRPSI  556



>gb|ACJ76836.3| catalase [Dimocarpus longan]
Length=492

 Score =   231 bits (589),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY++LPVNAPKC +HNN YDG+MNF+HRDEEVDYFPSKF N  NAE+FP P 
Sbjct  351  TQRHRLGPNYLMLPVNAPKCPHHNNHYDGFMNFMHRDEEVDYFPSKFTNVANAEKFPIPS  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
            RI +G+R+K  IEKENNFK PGDRYRSWAPDRQ+RFI R V  LS+PRVT E+RS W+SY
Sbjct  411  RICSGKREKACIEKENNFKLPGDRYRSWAPDRQERFIKRVVDGLSDPRVTFELRSIWVSY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD+SLGQK+ASRLN+RP +
Sbjct  471  WSQADKSLGQKIASRLNVRPNI  492



>ref|XP_009792372.1| PREDICTED: catalase isozyme 1 [Nicotiana sylvestris]
Length=492

 Score =   231 bits (589),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHR+GPNYM LPVNAPKCA+HNN  DG MNF+HRDEEVDY PS+FD  R+AE++P P 
Sbjct  351  TQRHRIGPNYMQLPVNAPKCAHHNNHRDGAMNFMHRDEEVDYLPSRFDPCRHAEQYPIPS  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
            R++TGRR+ CVIEKENNFKQ G+RYRSW PDRQDR++++WV+ LS+PRVT+EIRS WISY
Sbjct  411  RVLTGRREMCVIEKENNFKQAGERYRSWEPDRQDRYVSKWVEHLSDPRVTYEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
            L+QAD+S GQKVASRL ++PTM
Sbjct  471  LSQADKSCGQKVASRLTLKPTM  492



>sp|O24339.1|CATA_SOLAP RecName: Full=Catalase [Soldanella alpina]
 emb|CAB16749.1| catalase [Soldanella alpina]
Length=492

 Score =   231 bits (589),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LP NAPKCA+HNN ++G MNF+HRDEEV+YFPS+FD  R+AER P P 
Sbjct  351  TQRHRLGPNYLQLPPNAPKCAHHNNHHEGLMNFMHRDEEVNYFPSRFDPVRHAERHPIPP  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             ++TG+RD+C+IEKENNFKQPG+RYR++APDRQ+RF+ RWV +LS+PRVTHEIRS WISY
Sbjct  411  PVLTGKRDRCMIEKENNFKQPGERYRTFAPDRQERFVCRWVDALSDPRVTHEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             TQAD+SLGQK+ASRLN+RPTM
Sbjct  471  WTQADKSLGQKLASRLNVRPTM  492



>gb|ADC95629.1| catalase [Bruguiera gymnorhiza]
Length=492

 Score =   231 bits (589),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LP NAPKCA+HNN +DG+MNF+HRDEEV+Y PS+FD  R+AERFP P 
Sbjct  351  TQRHRLGPNYLQLPANAPKCAHHNNHHDGFMNFMHRDEEVNYLPSRFDPVRHAERFPIPP  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             + TGRR+KC+IEKENNFKQPG+RYRSWAPDRQ+RF +RWV++LS+PRVTHEI S WISY
Sbjct  411  AVCTGRREKCIIEKENNFKQPGERYRSWAPDRQERFTHRWVEALSDPRVTHEICSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             TQ D+ LGQK+A+RLN+RP++
Sbjct  471  WTQCDKFLGQKLATRLNVRPSI  492



>gb|KJB14250.1| hypothetical protein B456_002G115900 [Gossypium raimondii]
Length=492

 Score =   231 bits (589),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEE++YFPS++D  R+AE FP P 
Sbjct  351  TQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEINYFPSRYDPVRHAEMFPIPP  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             + TGRR+KC+IEKENNFKQPG+RYRSWA DRQ+RFI RWV +LS+PRVTHEIRS WISY
Sbjct  411  AVCTGRREKCIIEKENNFKQPGERYRSWAADRQERFICRWVDALSDPRVTHEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD+S+GQK+ASRLN+RP++
Sbjct  471  WSQADKSVGQKLASRLNVRPSI  492



>gb|AET97564.1| catalase [Ziziphus jujuba]
Length=492

 Score =   231 bits (588),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+ P P 
Sbjct  351  TQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEQHPIPS  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             I  G+R+KC+IEKENNFKQPG+RYRSWAPDRQ+RFI RW+ +LS+PRVTHEIRS WISY
Sbjct  411  AIFNGKREKCIIEKENNFKQPGERYRSWAPDRQERFIRRWIDALSDPRVTHEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD+SLGQK+ASRLN+RP++
Sbjct  471  WSQADKSLGQKLASRLNVRPSI  492



>gb|AGV54297.1| peroxisomal catalase [Phaseolus vulgaris]
Length=492

 Score =   231 bits (588),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            + RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D+ R+AE FP P 
Sbjct  351  SQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRYDSVRHAESFPIPP  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             I +GRR+KC IEKENNFKQ G+R+RSWAPDRQDRFI RWV +LS+PRVTHEIRS WISY
Sbjct  411  AICSGRREKCGIEKENNFKQAGERFRSWAPDRQDRFIRRWVDALSDPRVTHEIRSVWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QADRSLGQK+AS LN+RP +
Sbjct  471  WSQADRSLGQKIASHLNMRPNI  492



>gb|AGE15298.2| catalase 1 [Eriobotrya japonica]
Length=492

 Score =   231 bits (588),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVNAPKC++HNN ++G+MNF+HRDEEV+YFPS++   R+AE FP P 
Sbjct  351  TQRHRLGPNYLQLPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYQPARHAETFPIPS  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             I+TG+RDKCVIEKENNFKQPG+RYRSWAPDRQ+RF++RWV  LSE RVT+EIRS WISY
Sbjct  411  SIITGKRDKCVIEKENNFKQPGERYRSWAPDRQERFLHRWVDVLSESRVTYEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QADRS GQK+A+RLN+RP++
Sbjct  471  WSQADRSFGQKLATRLNVRPSI  492



>ref|NP_001237571.1| catalase-4 [Glycine max]
 sp|O48561.1|CATA4_SOYBN RecName: Full=Catalase-4 [Glycine max]
 gb|AAB88172.1| catalase [Glycine max]
 gb|KHN33801.1| Catalase-4 [Glycine soja]
Length=492

 Score =   231 bits (588),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            + RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AERFP P 
Sbjct  351  SQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRYDPVRHAERFPIPP  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             I +GRR+KC IEKENNFKQPG+RYRSWAPDRQDRF  RWV +LS+PRVTHEIRS WISY
Sbjct  411  AICSGRREKCGIEKENNFKQPGERYRSWAPDRQDRFARRWVDALSDPRVTHEIRSVWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QADRSLGQK+AS L+ RP +
Sbjct  471  WSQADRSLGQKIASHLSTRPNI  492



>dbj|BAJ33995.1| unnamed protein product [Thellungiella halophila]
Length=492

 Score =   231 bits (588),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS++D  R+AE++PTP 
Sbjct  351  TQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPP  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             + +G+R++C+IEKENNFK+PG+RYRS+AP+RQ+RFI RW+++LS+PR+THEIRS WISY
Sbjct  411  AVCSGKRERCIIEKENNFKEPGERYRSFAPERQERFIRRWIEALSDPRITHEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD+SLGQK+ASRLN+RP++
Sbjct  471  WSQADKSLGQKLASRLNVRPSI  492



>ref|XP_006412153.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
 gb|ESQ53606.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
Length=492

 Score =   231 bits (588),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS++D  R+AE++PTP 
Sbjct  351  TQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPP  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             + +G+R++C+IEKENNFK+PG+RYRS+AP+RQ+RFI RW+++LS+PR+THEIRS WISY
Sbjct  411  AVCSGKRERCIIEKENNFKEPGERYRSFAPERQERFIRRWIEALSDPRITHEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD+SLGQK+ASRLN+RP++
Sbjct  471  WSQADKSLGQKLASRLNVRPSI  492



>ref|NP_564120.1| catalase 3 [Arabidopsis thaliana]
 sp|Q42547.3|CATA3_ARATH RecName: Full=Catalase-3 [Arabidopsis thaliana]
 gb|AAL08303.1| At1g20620/F5M15_4 [Arabidopsis thaliana]
 gb|AAL24212.1| At1g20620/F5M15_4 [Arabidopsis thaliana]
 gb|AEE29995.1| catalase 3 [Arabidopsis thaliana]
Length=492

 Score =   231 bits (588),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ PTP 
Sbjct  351  TQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPTPT  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
               TG R KCVI+KENNFKQ GDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIR  WISY
Sbjct  411  NSYTGIRTKCVIKKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QADRSLGQK+ASRLN+RP++
Sbjct  471  WSQADRSLGQKLASRLNVRPSI  492



>ref|XP_007136018.1| hypothetical protein PHAVU_009G011100g [Phaseolus vulgaris]
 gb|ESW08012.1| hypothetical protein PHAVU_009G011100g [Phaseolus vulgaris]
Length=492

 Score =   231 bits (588),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            + RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D+ R+AE FP P 
Sbjct  351  SQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRYDSVRHAESFPIPP  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             I +GRR+KC IEKENNFKQ G+R+RSWAPDRQDRFI RWV +LS+PRVTHEIRS WISY
Sbjct  411  AICSGRREKCGIEKENNFKQAGERFRSWAPDRQDRFIRRWVDALSDPRVTHEIRSVWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QADRSLGQK+AS LN+RP +
Sbjct  471  WSQADRSLGQKIASHLNMRPNI  492



>gb|AAM65021.1| unknown [Arabidopsis thaliana]
Length=492

 Score =   231 bits (588),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ PTP 
Sbjct  351  TQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPTPT  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
               TG R KCVI+KENNFKQ GDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIR  WISY
Sbjct  411  NSYTGIRTKCVIKKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QADRSLGQK+ASRLN+RP++
Sbjct  471  WSQADRSLGQKLASRLNVRPSI  492



>emb|CDY31878.1| BnaC07g15280D [Brassica napus]
Length=492

 Score =   230 bits (587),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P P 
Sbjct  351  TQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKAPIPN  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
            +  TG R KC+I+KENNFKQPGDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIR  WISY
Sbjct  411  KSYTGIRTKCIIKKENNFKQPGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QADRSLGQK+ASRLN+RP++
Sbjct  471  WSQADRSLGQKLASRLNVRPSI  492



>gb|AHF27428.1| catalase, partial [Cucurbita moschata]
 gb|AHF27431.1| catalase, partial [Cucurbita maxima]
Length=344

 Score =   226 bits (576),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD +R+AER+P P 
Sbjct  203  TQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPSRHAERYPHPP  262

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             + +G+R++C+IEKENNFK+PG+RYRSW PDRQ+RF+ RWV +LS+ RVTHEIRS WISY
Sbjct  263  AVCSGKRERCIIEKENNFKEPGERYRSWTPDRQERFVRRWVDALSDTRVTHEIRSIWISY  322

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QADRSLGQK+AS LN+RP++
Sbjct  323  WSQADRSLGQKLASHLNVRPSI  344



>dbj|BAC79443.1| catalase [Acacia ampliceps]
Length=492

 Score =   230 bits (587),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHR+GPNY+ LPVNAPKCA+HNN YDG MNF+HRDEEVDYFPS++D  R+AE+FP P 
Sbjct  351  TQRHRIGPNYLQLPVNAPKCAHHNNHYDGTMNFMHRDEEVDYFPSRYDTARHAEKFPIPP  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
              + GRRD+ +IEKENNFKQPGD YR+WAPDRQ+RFI RW+  LS+P+VTHE+RS WISY
Sbjct  411  VNLIGRRDRRIIEKENNFKQPGDLYRTWAPDRQERFIRRWIGVLSDPKVTHEVRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
            L+QADRSLGQKVAS LN+RP++
Sbjct  471  LSQADRSLGQKVASHLNMRPSI  492



>gb|AAR84578.1| catalase 1a [Lotus japonicus]
Length=492

 Score =   230 bits (587),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            + RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AER+P P 
Sbjct  351  SQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERYPIPP  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             I TG R++C IEKENNFKQPG+RYRS+APDRQDRF+ RWV +LS+PRVTHEIRSTWISY
Sbjct  411  AICTGSRERCAIEKENNFKQPGERYRSFAPDRQDRFVRRWVDALSDPRVTHEIRSTWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QADRSLGQK+AS LN+RP++
Sbjct  471  WSQADRSLGQKIASHLNLRPSI  492



>ref|XP_010530333.1| PREDICTED: catalase-2 [Tarenaya hassleriana]
Length=492

 Score =   230 bits (587),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AER+P P 
Sbjct  351  TQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERYPIPP  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             I +GRR++C+IEKENNFKQPG+RYRS+ PDRQ+RFI RW+++LS+PR+THEIRS WISY
Sbjct  411  VICSGRRERCIIEKENNFKQPGERYRSFTPDRQERFIRRWIEALSDPRITHEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD+SLGQK+ASRLN+RP++
Sbjct  471  WSQADQSLGQKLASRLNVRPSI  492



>ref|NP_001240021.1| catalase [Glycine max]
 dbj|BAG09375.1| peroxisomal catalase [Glycine max]
 gb|KHN20113.1| Catalase-4 [Glycine soja]
Length=492

 Score =   230 bits (587),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            + RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE FP P 
Sbjct  351  SQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRYDPVRHAETFPIPP  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             I +GRR+KC IEKENNFKQPG+RYRSWAPDRQDRF  RWV +LS+PRVTHEIRS WISY
Sbjct  411  AICSGRREKCGIEKENNFKQPGERYRSWAPDRQDRFNRRWVDALSDPRVTHEIRSVWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QADRSLGQK+ASRL++RP +
Sbjct  471  WSQADRSLGQKIASRLSMRPNI  492



>gb|ACV30589.1| catalase [Carica papaya]
Length=170

 Score =   220 bits (560),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 125/143 (87%), Gaps = 1/143 (1%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPN+M LPVNAPKCA+ NN +DGYMNF+HRDEEV+Y PSKFD   NAER+P P 
Sbjct  28   TQRHRLGPNFMQLPVNAPKCAHRNNHFDGYMNFMHRDEEVNYHPSKFDPVTNAERYPIPT  87

Query  463  RIVTG-RRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
            ++ +  +R+KC+IEK+N+FKQPG+RYR++ PDRQ+RFINRWVK+LSEPR+THEIRS WI 
Sbjct  88   KVYSACKREKCIIEKQNDFKQPGERYRTFEPDRQERFINRWVKALSEPRITHEIRSIWID  147

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            +L++AD SLG+KVA RLNIRP++
Sbjct  148  WLSRADESLGRKVAMRLNIRPSI  170



>ref|XP_010663966.1| PREDICTED: catalase isozyme 1 [Vitis vinifera]
 emb|CBI40714.3| unnamed protein product [Vitis vinifera]
Length=492

 Score =   230 bits (586),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AER+P P 
Sbjct  351  TQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERYPIPP  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             I+TGRR+KC+I KENNFKQPG+RYRS+APDRQ+RFI RWV +LS+PRVT+EIRS WISY
Sbjct  411  AILTGRREKCIIPKENNFKQPGERYRSFAPDRQERFIQRWVDALSDPRVTYEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD+SLGQK+ASRLN+RP++
Sbjct  471  WSQADKSLGQKLASRLNVRPSI  492



>ref|XP_006473794.1| PREDICTED: catalase isozyme 1-like isoform X4 [Citrus sinensis]
Length=492

 Score =   230 bits (586),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVNAPKCA HNN YDG+MNF+HRDEE+DYFPS++D  R+AE  PTP 
Sbjct  351  TQRHRLGPNYLQLPVNAPKCAQHNNHYDGFMNFMHRDEEIDYFPSRYDPVRHAEMHPTPP  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             I  GRR+KC+I KENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIR  WISY
Sbjct  411  EICGGRREKCIIPKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRHIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QA +SLGQK+ASRLN+RP +
Sbjct  471  WSQACKSLGQKLASRLNVRPNI  492



>ref|XP_006435363.1| hypothetical protein CICLE_v10000951mg [Citrus clementina]
 gb|ESR48603.1| hypothetical protein CICLE_v10000951mg [Citrus clementina]
 gb|KDO85096.1| hypothetical protein CISIN_1g042356mg [Citrus sinensis]
Length=492

 Score =   230 bits (586),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVNAPKCA HNN YDG+MNF+HRDEE+DYFPS++D  R+AE  PTP 
Sbjct  351  TQRHRLGPNYLQLPVNAPKCAQHNNHYDGFMNFMHRDEEIDYFPSRYDPVRHAEMHPTPP  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             I  GRR+KC+I KENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIR  WISY
Sbjct  411  EICGGRREKCIIPKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRHIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QA +SLGQK+ASRLN+RP +
Sbjct  471  WSQACKSLGQKLASRLNVRPNI  492



>ref|XP_006828715.1| hypothetical protein AMTR_s00001p00024160 [Amborella trichopoda]
 gb|ERM96131.1| hypothetical protein AMTR_s00001p00024160 [Amborella trichopoda]
Length=492

 Score =   229 bits (585),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY++LP NAPKCA+HNN YDG+MNF HRDEEVDYFPS+FD  R+AE+FP P 
Sbjct  351  TQRHRLGPNYLMLPANAPKCAHHNNHYDGFMNFAHRDEEVDYFPSRFDPVRHAEKFPMPP  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
            +I +G+R+KC+IEKENNFKQPG+RYRS+A DRQ+RFI RWV +LS+PRVTHEI S WISY
Sbjct  411  QICSGKREKCMIEKENNFKQPGERYRSFAIDRQERFIKRWVDALSDPRVTHEILSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +Q D+SLGQK+A+ LN++P M
Sbjct  471  WSQCDKSLGQKLATHLNLKPNM  492



>ref|XP_006473791.1| PREDICTED: catalase isozyme 1-like isoform X1 [Citrus sinensis]
 ref|XP_006473792.1| PREDICTED: catalase isozyme 1-like isoform X2 [Citrus sinensis]
 ref|XP_006473793.1| PREDICTED: catalase isozyme 1-like isoform X3 [Citrus sinensis]
Length=512

 Score =   230 bits (586),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVNAPKCA HNN YDG+MNF+HRDEE+DYFPS++D  R+AE  PTP 
Sbjct  371  TQRHRLGPNYLQLPVNAPKCAQHNNHYDGFMNFMHRDEEIDYFPSRYDPVRHAEMHPTPP  430

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             I  GRR+KC+I KENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIR  WISY
Sbjct  431  EICGGRREKCIIPKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRHIWISY  490

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QA +SLGQK+ASRLN+RP +
Sbjct  491  WSQACKSLGQKLASRLNVRPNI  512



>gb|AAG43363.1|AF151368_1 catalase [Hevea brasiliensis]
Length=492

 Score =   229 bits (584),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLG NY+ LPVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS+ D  R++ERFP P 
Sbjct  351  TQRHRLGSNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRCDPVRHSERFPIPS  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             I +GRRDKCVIEKENNF+QPG+RYRSWAPDRQ+RF+NR V  LS+PR+THE+RS WISY
Sbjct  411  TICSGRRDKCVIEKENNFEQPGERYRSWAPDRQERFLNRMVGCLSDPRITHELRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             TQ DRSLGQK+A RLN+RP++
Sbjct  471  WTQCDRSLGQKLAFRLNVRPSI  492



>dbj|BAQ21275.1| catalase [Citrus tamurana]
Length=476

 Score =   229 bits (583),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVNAPKCA+HNN YDG+MNF+HRDEE+DYFPS++D  R+AE  PTP 
Sbjct  335  TQRHRLGPNYLQLPVNAPKCAHHNNHYDGFMNFMHRDEEIDYFPSRYDPVRHAEMHPTPP  394

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             I  GRR+KC+I KENNFKQPG+RYRSWAPDRQ+RF+ RWV +LS+PRVTHEIR  WISY
Sbjct  395  EICGGRREKCIIPKENNFKQPGERYRSWAPDRQERFVCRWVDALSDPRVTHEIRHIWISY  454

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QA +SLGQK+ +RLN+RP++
Sbjct  455  WSQACKSLGQKLTARLNVRPSI  476



>emb|CCP37650.1| catalase-1 [Nicotiana tabacum]
Length=492

 Score =   229 bits (584),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T R+RLGPNY+ LP NAPKCA+HNN YDG MNF+HRDEE+DYFPS++D  R+AE++P P 
Sbjct  351  TQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPIPS  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             + TG+R+KCVI+KENNFKQPGDRYRS+ PDRQ+RFI RWV++LS+PR+T+EIRS WISY
Sbjct  411  TMCTGKREKCVIQKENNFKQPGDRYRSFTPDRQERFIRRWVEALSDPRITYEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD+SLGQK+ASRLN+RP++
Sbjct  471  WSQADKSLGQKLASRLNVRPSI  492



>gb|AFU48609.1| catalase 1, partial [Nicotiana benthamiana]
Length=491

 Score =   229 bits (584),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T R+RLGPNY+ LP NAPKCA+HNN YDG MNF+HRDEE+DYFPS++D  R+AE++P P 
Sbjct  350  TQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPIPS  409

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             + TG+R+KCVI+KENNFKQPGDRYRS+ PDRQ+RFI RWV++LS+PR+T+EIRS WISY
Sbjct  410  TMCTGKREKCVIQKENNFKQPGDRYRSFTPDRQERFIRRWVEALSDPRITYEIRSIWISY  469

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD+SLGQK+ASRLN+RP++
Sbjct  470  WSQADKSLGQKLASRLNVRPSI  491



>ref|XP_004238430.1| PREDICTED: catalase isozyme 3 [Solanum lycopersicum]
Length=492

 Score =   229 bits (584),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVNAPKCA+HNN ++G MNF+HRDEEV+Y PS+ D  R+AE++P P 
Sbjct  351  TQRHRLGPNYLQLPVNAPKCAHHNNHHEGLMNFMHRDEEVNYLPSRLDPCRHAEQYPIPP  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
            R++TG+R+K +IEKENNFKQPG+ YRSWAPDRQ+RF+ RWV +LS+PR THEIRS WISY
Sbjct  411  RVLTGKREKVIIEKENNFKQPGEHYRSWAPDRQERFLCRWVDALSDPRATHEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD+SLGQK+ASRLNIRPTM
Sbjct  471  WSQADKSLGQKLASRLNIRPTM  492



>gb|ACL27272.1| catalase [Nicotiana benthamiana]
Length=492

 Score =   229 bits (584),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T R+RLGPNY+ LP NAPKCA+HNN YDG MNF+HRDEE+DYFPS++D  R+AE++P P 
Sbjct  351  TQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPIPS  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             + TG+R+KCVI+KENNFKQPGDRYRS+ PDRQ+RFI RWV++LS+PR+T+EIRS WISY
Sbjct  411  TMCTGKREKCVIQKENNFKQPGDRYRSFTPDRQERFIRRWVEALSDPRITYEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD+SLGQK+ASRLN+RP++
Sbjct  471  WSQADKSLGQKLASRLNVRPSI  492



>ref|XP_007160597.1| hypothetical protein PHAVU_001G001000g [Phaseolus vulgaris]
 gb|ESW32591.1| hypothetical protein PHAVU_001G001000g [Phaseolus vulgaris]
Length=492

 Score =   229 bits (584),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            + RHRLGPNY+ +P NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AER P P 
Sbjct  351  SQRHRLGPNYLQIPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERIPVPP  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
            RI+ G+R+KC+IEKENNFKQPG+RYRSWA DRQ+RF+ RWV +LSEPRVTHEIRS WISY
Sbjct  411  RILDGKREKCMIEKENNFKQPGERYRSWASDRQERFLRRWVDALSEPRVTHEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QADRSLGQK+AS LN++P++
Sbjct  471  WSQADRSLGQKIASHLNLKPSI  492



>gb|AAD50974.1|AF170272_1 catalase CAT1 [Manihot esculenta]
Length=492

 Score =   229 bits (584),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY +LPVNAPKCAYHNN YDG+MNF+HRDEEVDYFPS++D  R+AER P P 
Sbjct  351  TQRHRLGPNYKMLPVNAPKCAYHNNHYDGFMNFMHRDEEVDYFPSRYDPVRHAERSPIPN  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             I +GRR+KCVIEKENNFKQPG+RYRSWAPDRQ+RF+ R V +LSEPR+T EIRS W+SY
Sbjct  411  AICSGRREKCVIEKENNFKQPGERYRSWAPDRQERFLCRLVNALSEPRITFEIRSIWVSY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             ++ D SLGQK+ASRLN+RP +
Sbjct  471  WSKCDASLGQKLASRLNVRPNI  492



>ref|XP_007018034.1| Catalase 2 [Theobroma cacao]
 gb|EOY15259.1| Catalase 2 [Theobroma cacao]
Length=492

 Score =   229 bits (583),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEE++YFPS++D  R+AERFP P 
Sbjct  351  TQRHRLGPNYLQLPPNAPKCAHHNNHHEGFMNFMHRDEEINYFPSRYDPVRHAERFPIPP  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             + +GRR+KC+IEKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIRS WI+Y
Sbjct  411  AVCSGRREKCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWITY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QA +SLGQK+ASRLN++P +
Sbjct  471  WSQACKSLGQKLASRLNVKPNI  492



>ref|XP_006306495.1| hypothetical protein CARUB_v10012481mg [Capsella rubella]
 gb|EOA39393.1| hypothetical protein CARUB_v10012481mg [Capsella rubella]
Length=492

 Score =   229 bits (583),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P P 
Sbjct  351  TQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPIPT  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
               TG R KCVI+KENNFKQ GDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIR  WISY
Sbjct  411  NSYTGIRTKCVIKKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QADRSLGQK+ASRLN+RP++
Sbjct  471  WSQADRSLGQKLASRLNVRPSI  492



>sp|P49316.1|CATA2_NICPL RecName: Full=Catalase isozyme 2 [Nicotiana plumbaginifolia]
 emb|CAA85425.1| catalase [Nicotiana plumbaginifolia]
Length=492

 Score =   229 bits (583),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHR+GPNYM LPVNAPKCA+HNN  DG MNF+HRDEEVDY PS+FD  R+AE++P P 
Sbjct  351  TQRHRIGPNYMQLPVNAPKCAHHNNHRDGAMNFMHRDEEVDYLPSRFDPCRHAEQYPIPS  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
            R++ GRR+ CVIEKENNFKQ G+RYRSW PDRQDR++++WV+ LS+PRVT+EIRS WISY
Sbjct  411  RVLNGRREMCVIEKENNFKQAGERYRSWEPDRQDRYVSKWVEHLSDPRVTYEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
            L+QAD+S GQKVASRL ++PTM
Sbjct  471  LSQADKSCGQKVASRLTLKPTM  492



>gb|AAF19965.1|AF207906_1 catalase 1 [Zantedeschia aethiopica]
Length=492

 Score =   229 bits (583),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY++LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+FP P 
Sbjct  351  TQRHRLGPNYLMLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEQFPIPP  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
            RI+ G R+KC I+KENNFKQPG++YRSWAPDRQ+RFI RW+ +LS+PRVTHEIR+ WI+Y
Sbjct  411  RILNGGREKCCIQKENNFKQPGEKYRSWAPDRQERFIKRWIDALSDPRVTHEIRTIWITY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +Q D+ LGQK+ASRLNI+PT+
Sbjct  471  WSQCDKFLGQKLASRLNIKPTL  492



>ref|NP_001291326.1| catalase isozyme 1 [Sesamum indicum]
 gb|AFJ42575.1| catalase [Sesamum indicum]
Length=492

 Score =   229 bits (583),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D TR++E +P P 
Sbjct  351  TQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPTRHSEMYPIPP  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             +++G+R+K  IEKENNFKQPG+RYRSWAPDRQ+RFI RWV++LS+PR+THEIRS WISY
Sbjct  411  VVLSGKREKRCIEKENNFKQPGERYRSWAPDRQERFIRRWVEALSDPRLTHEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD+SLGQK+ASRLN+RPTM
Sbjct  471  WSQADKSLGQKLASRLNVRPTM  492



>ref|XP_008452956.1| PREDICTED: catalase isozyme 1 [Cucumis melo]
Length=492

 Score =   229 bits (583),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD  R+AER+P P 
Sbjct  351  TQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPARHAERYPHPP  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             + TG+R++CVI+KENNFK+PG+RYRSW PDRQ+RFI RWV +LS+PRVTHEIRS WISY
Sbjct  411  AVCTGKRERCVIQKENNFKEPGERYRSWTPDRQERFIRRWVDALSDPRVTHEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QADRS+GQK+AS LN+RP++
Sbjct  471  WSQADRSVGQKLASHLNVRPSI  492



>sp|P17598.2|CATA1_GOSHI RecName: Full=Catalase isozyme 1 [Gossypium hirsutum]
 emb|CAA36380.1| unnamed protein product [Gossypium hirsutum]
Length=492

 Score =   229 bits (583),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEE++YFPS++D  R+AE FP P 
Sbjct  351  TQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEINYFPSRYDPVRHAEMFPIPP  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             + TGRR+KC+IEKENNFKQPG+RYRSWA DRQ+RFI RWV +LS+PRVTHEIRS WISY
Sbjct  411  AVCTGRREKCIIEKENNFKQPGERYRSWAADRQERFICRWVDALSDPRVTHEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD+S+GQK+AS LN+RP++
Sbjct  471  WSQADKSVGQKLASLLNVRPSI  492



>gb|AIA61608.1| catalase [Gynostemma pentaphyllum]
Length=492

 Score =   228 bits (582),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LP NAPKC++HNN ++G+MNF+HRDEEV+YFPS++D  R+AER+P P 
Sbjct  351  TQRHRLGPNYLQLPANAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPARHAERYPHPP  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             + TG+R++CVI+KENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIRS WISY
Sbjct  411  AVCTGKRERCVIDKENNFKQPGERYRSWAPDRQERFIRRWVNALSDPRVTHEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QADRS+GQK+AS LN+RP++
Sbjct  471  WSQADRSVGQKLASHLNMRPSI  492



>ref|NP_001237556.1| catalase-1/2 [Glycine max]
 sp|P29756.1|CATA1_SOYBN RecName: Full=Catalase-1/2 [Glycine max]
 emb|CAA78056.1| catalase [Glycine max]
 gb|AAB88169.1| catalase [Glycine max]
 gb|AAB88170.1| catalase [Glycine max]
 gb|KHN48523.1| Catalase-1/2 [Glycine soja]
Length=492

 Score =   228 bits (582),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LP NAPKCA+HNN +DG+MNF+HRDEEV+YFPS++D  R+AE+ P P 
Sbjct  351  TQRHRLGPNYLQLPANAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAEKVPVPP  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
            RI+ G+R+KC+IEKENNFKQPG+RYRSW  DRQ+RF+ RWV +LS+PRVTHEIRS WISY
Sbjct  411  RILGGKREKCMIEKENNFKQPGERYRSWPSDRQERFVRRWVDALSDPRVTHEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QADRSLGQK+AS LN++P++
Sbjct  471  WSQADRSLGQKIASHLNLKPSI  492



>gb|AAB62892.1| catalase-1 [Nicotiana glutinosa]
Length=492

 Score =   228 bits (582),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T R+RLGPNY+ LP NAPKCA+HNN YDG MNF+HRDEE+DYFPS++D  R+AE++P P 
Sbjct  351  TQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPIPS  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             + TG+R+KCVI KENNFKQPG+RYRS+ PDRQ+RFI RWV++LS+PR+THEIRS WISY
Sbjct  411  TMCTGKREKCVILKENNFKQPGERYRSFTPDRQERFIRRWVEALSDPRITHEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD+SLGQK+ASRLN+RP++
Sbjct  471  WSQADKSLGQKLASRLNVRPSI  492



>gb|AAB71764.1| catalase 1 [Nicotiana tabacum]
Length=492

 Score =   228 bits (581),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T R+RLGPNY+ LP NAPKCA+HNN YDG MNF+HRDEE+DYFPS++D  R+AE++P P 
Sbjct  351  TQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPIPS  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             + TG+R+KCVI+KENNFKQPGDRYRS+ PDRQ+RFI RWV++LS+PR+T+EIR+ WISY
Sbjct  411  TMCTGKREKCVIQKENNFKQPGDRYRSFTPDRQERFIRRWVEALSDPRITYEIRTIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD+SLGQK+ASRLN+RP++
Sbjct  471  WSQADKSLGQKLASRLNVRPSI  492



>gb|ACV92695.1| catalase [Brassica oleracea]
Length=492

 Score =   228 bits (581),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP 
Sbjct  351  TQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPP  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             + +G+R++CVIEKENNFK+PG+RYRS+ P+RQ+RFI RW+ +LS+PR+THEIRS WISY
Sbjct  411  AVCSGKRERCVIEKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD+SLGQK+ASRLN+RP++
Sbjct  471  WSQADKSLGQKLASRLNVRPSI  492



>ref|XP_002867092.1| hypothetical protein ARALYDRAFT_491144 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43351.1| hypothetical protein ARALYDRAFT_491144 [Arabidopsis lyrata subsp. 
lyrata]
Length=492

 Score =   228 bits (581),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP 
Sbjct  351  TQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPP  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             + +G+R++C+IEKENNFK+PG+RYRS+ P+RQ+RFI RW+++LS+PR+THEIRS WISY
Sbjct  411  AVCSGKRERCIIEKENNFKEPGERYRSFTPERQERFIQRWIEALSDPRITHEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD+SLGQK+ASRLN+RP++
Sbjct  471  WSQADKSLGQKLASRLNVRPSI  492



>gb|AFU90822.1| catalase, partial [Populus tomentosa]
Length=487

 Score =   228 bits (580),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 100/138 (72%), Positives = 123/138 (89%), Gaps = 0/138 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE FP P 
Sbjct  350  TQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAESFPIPP  409

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             + +G+R+KC+IEKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIRS WISY
Sbjct  410  AVCSGKREKCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWISY  469

Query  283  LTQADRSLGQKVASRLNI  230
             +QAD+SLGQK+ASRLN+
Sbjct  470  WSQADKSLGQKLASRLNV  487



>gb|ABM47415.1| catalase [Prunus avium]
Length=492

 Score =   228 bits (580),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNYM LPVNAPKC +HNN  DG+MNF+HRDEEV+YFPS++D  R+AERFP P 
Sbjct  351  TQRHRLGPNYMQLPVNAPKCPHHNNHQDGFMNFMHRDEEVNYFPSRYDPVRHAERFPIPS  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             I+TG+R++ VIEKENNFKQPG+RYRSWAPDRQ+RFI R V +LS+PRV+HEIRS WISY
Sbjct  411  NILTGKRERRVIEKENNFKQPGERYRSWAPDRQERFIRRCVDALSDPRVSHEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD+SLGQK+A+RLN+RP++
Sbjct  471  WSQADKSLGQKIATRLNVRPSI  492



>emb|CDX76313.1| BnaA08g10870D [Brassica napus]
Length=477

 Score =   227 bits (579),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP 
Sbjct  336  TQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPP  395

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             + +G+R++CVIEKENNFK+PG+RYRS+ P+RQ+RFI RW+++LS+PR+THEIRS WISY
Sbjct  396  AVCSGKRERCVIEKENNFKEPGERYRSFTPERQERFIRRWIEALSDPRITHEIRSIWISY  455

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD++LGQK+ASRLN+RP++
Sbjct  456  WSQADKTLGQKLASRLNVRPSI  477



>sp|P49315.1|CATA1_NICPL RecName: Full=Catalase isozyme 1, partial [Nicotiana plumbaginifolia]
 emb|CAA85424.1| catalase [Nicotiana plumbaginifolia]
Length=485

 Score =   228 bits (580),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T R+RLGPNY+ LP NAPKCA+HNN YDG MNF+HRDEE+DYFPS++D  R+AE++P P 
Sbjct  344  TQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPIPS  403

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             + TG+R+KCVI+KENNFKQPG+RYRS+ PDRQ+RFI RWV++LS+PR+T+EIRS WISY
Sbjct  404  TMCTGKREKCVIQKENNFKQPGERYRSFTPDRQERFIRRWVETLSDPRITYEIRSIWISY  463

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD+SLGQK+ASRLN+RP++
Sbjct  464  WSQADKSLGQKLASRLNVRPSI  485



>gb|AFU90823.1| catalase, partial [Populus x beijingensis]
Length=446

 Score =   226 bits (577),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 99/138 (72%), Positives = 123/138 (89%), Gaps = 0/138 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE FP P 
Sbjct  309  TQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAESFPIPP  368

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             + +G+R++C+IEKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIRS WISY
Sbjct  369  AVCSGKRERCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWISY  428

Query  283  LTQADRSLGQKVASRLNI  230
             +QAD+SLGQK+ASRLN+
Sbjct  429  WSQADKSLGQKLASRLNV  446



>emb|CAA64220.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   228 bits (580),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP 
Sbjct  351  TQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDQVRHAEKYPTPP  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             + +G+R++CVIEKENNFK+PG+RYR++ P+RQ+RFI RW+ +LS+PR+THEIRS WISY
Sbjct  411  AVCSGKRERCVIEKENNFKEPGERYRTFTPERQERFIQRWIDALSDPRITHEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD+SLGQK+ASRLN+RP++
Sbjct  471  WSQADKSLGQKLASRLNVRPSI  492



>gb|AAD30292.1|AF139539_1 catalase 3 [Raphanus sativus]
Length=492

 Score =   228 bits (580),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P P 
Sbjct  351  TQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPIPN  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
            +  TG R KC+I+KENNFKQ GDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIRS WISY
Sbjct  411  KSYTGIRTKCIIKKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD SLGQK+ASRLN+RP++
Sbjct  471  WSQADASLGQKLASRLNVRPSI  492



>sp|Q01297.2|CATA1_RICCO RecName: Full=Catalase isozyme 1 [Ricinus communis]
 gb|AAB31537.1| catalase 1 [Ricinus communis=castor beans, hypocotyls, Peptide, 
492 aa]
 dbj|BAA04697.1| catalase CAT1 [Ricinus communis]
Length=492

 Score =   228 bits (580),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS+ D  RNAE FP P 
Sbjct  351  TQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRCDPARNAESFPVPS  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             I +G+R+KCVIEKENNFKQPG+RYRSWAPDRQ+RF+NR V  LS+PR+THE+R+ WISY
Sbjct  411  AICSGKREKCVIEKENNFKQPGERYRSWAPDRQERFLNRLVGGLSDPRITHELRTIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
              Q D+SLGQK+A+RLN++P++
Sbjct  471  WIQCDKSLGQKLATRLNVKPSI  492



>ref|XP_010941422.1| PREDICTED: catalase isozyme B [Elaeis guineensis]
Length=492

 Score =   228 bits (580),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY++LPVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS++D  R+AERFP P 
Sbjct  351  TQRHRLGPNYLMLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAERFPLPP  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
            R++TG+R+KCVI KENNFKQPG+RYRS+ P RQ+RF++RWV++LS+ RVTHEIR  WI+Y
Sbjct  411  RVLTGKREKCVIGKENNFKQPGERYRSFDPARQERFVHRWVEALSDTRVTHEIRGIWITY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +Q D+SLGQK+A+RLN+RP+M
Sbjct  471  WSQCDKSLGQKLATRLNMRPSM  492



>gb|AAB86582.2| catalase [Raphanus sativus]
Length=491

 Score =   227 bits (579),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP 
Sbjct  350  TQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPP  409

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             + +G+R++C+IEKENNFK+PG+RYRS+ P+RQ+RFI RW+ +LS+PR+THEIRS WISY
Sbjct  410  AVCSGKRERCIIEKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEIRSIWISY  469

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD+SLGQK+ASRLN+RP++
Sbjct  470  WSQADKSLGQKLASRLNVRPSI  491



>gb|AAD30291.2|AF139538_1 catalase 2 [Raphanus sativus]
Length=492

 Score =   227 bits (579),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P P 
Sbjct  351  TQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPIPS  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
            +  TG R KCVI+KENNFKQ GDRYRSWAPDRQDRF+ RWV+ LSE R+THEIRS WISY
Sbjct  411  KSYTGIRTKCVIKKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSELRLTHEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QADRSLGQK+ASRLN+RP++
Sbjct  471  WSQADRSLGQKLASRLNVRPSI  492



>gb|AAK96854.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   227 bits (579),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 95/142 (67%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP 
Sbjct  351  TQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDQVRHAEKYPTPP  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             + +G+R++C+IEKENNFK+PG+RYR++ P+RQ+RFI RW+ +LS+PR+THEIRS WISY
Sbjct  411  AVCSGKRERCIIEKENNFKEPGERYRTFTPERQERFIQRWIDALSDPRITHEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD+SLGQK+ASRLN+RP++
Sbjct  471  WSQADKSLGQKLASRLNVRPSI  492



>gb|AAF71742.1|AF248491_1 catalase [Raphanus sativus]
Length=492

 Score =   227 bits (579),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP 
Sbjct  351  TQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPP  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             + +G+R++C+IEKENNFK+PG+RYRS+ P+RQ+RFI RW+ +LS+PR+THEIRS WISY
Sbjct  411  AVCSGKRERCIIEKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD+SLGQK+ASRLN+RP++
Sbjct  471  WSQADKSLGQKLASRLNVRPSI  492



>ref|XP_006283612.1| hypothetical protein CARUB_v10004668mg [Capsella rubella]
 gb|EOA16510.1| hypothetical protein CARUB_v10004668mg [Capsella rubella]
Length=492

 Score =   227 bits (579),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP 
Sbjct  351  TQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPP  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             + +G+R++CVIEKENNFK+PG+RYRS+ P+RQ+RFI RW+++LS+PR+THEIRS WISY
Sbjct  411  AVCSGKRERCVIEKENNFKEPGERYRSFPPERQERFIRRWIEALSDPRITHEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD+SLGQK+ASRLN+RP++
Sbjct  471  WSQADKSLGQKLASRLNVRPSI  492



>sp|P45739.1|CATA_HELAN RecName: Full=Catalase [Helianthus annuus]
 gb|AAA69866.1| catalase [Helianthus annuus]
Length=492

 Score =   227 bits (579),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 100/140 (71%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LP NAPKCA+HNN YDG+MNF+HRDEE+DYFPS++D  R+AE++P P 
Sbjct  351  TQRHRLGPNYLQLPANAPKCAHHNNHYDGFMNFMHRDEEIDYFPSRYDPARHAEQYPIPP  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
              ++G+RDKCVIEKENNFKQPG+RYRS++PDRQ+RFINR V  LS+PRVTHE+RS W+SY
Sbjct  411  VRLSGKRDKCVIEKENNFKQPGERYRSFSPDRQERFINRVVGGLSDPRVTHEVRSIWVSY  470

Query  283  LTQADRSLGQKVASRLNIRP  224
             +QAD+SLGQK+ASRLN++P
Sbjct  471  WSQADKSLGQKIASRLNVKP  490



>prf||2104177A catalase
Length=492

 Score =   227 bits (579),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 100/140 (71%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LP NAPKCA+HNN YDG+MNF+HRDEE+DYFPS++D  R+AE++P P 
Sbjct  351  TQRHRLGPNYLQLPANAPKCAHHNNHYDGFMNFMHRDEEIDYFPSRYDPARHAEQYPIPP  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
              ++G+RDKCVIEKENNFKQPG+RYRS++PDRQ+RFINR V  LS+PRVTHE+RS W+SY
Sbjct  411  VRLSGKRDKCVIEKENNFKQPGERYRSFSPDRQERFINRVVGGLSDPRVTHEVRSIWVSY  470

Query  283  LTQADRSLGQKVASRLNIRP  224
             +QAD+SLGQK+ASRLN++P
Sbjct  471  WSQADKSLGQKIASRLNVKP  490



>prf||1906388A catalase
Length=492

 Score =   227 bits (579),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 95/142 (67%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP 
Sbjct  351  TQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDQVRHAEKYPTPP  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             + +G+R++C+IEKENNFK+PG+RYR++ P+RQ+RFI RW+ +LS+PR+THEIRS WISY
Sbjct  411  AVCSGKRERCIIEKENNFKEPGERYRTFTPERQERFIQRWIDALSDPRITHEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD+SLGQK+ASRLN+RP++
Sbjct  471  WSQADKSLGQKLASRLNVRPSI  492



>ref|XP_006342134.1| PREDICTED: catalase isozyme 3-like [Solanum tuberosum]
Length=492

 Score =   227 bits (579),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS+ D  R+AE++P P 
Sbjct  351  TQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRLDPCRHAEQYPIPP  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
            R++TG+R+K +IEKENNFKQPG+ YRSWAP RQ+RF+ RWV +LS+ R THEIRS WISY
Sbjct  411  RVLTGKREKVIIEKENNFKQPGEHYRSWAPGRQERFVCRWVDALSDLRATHEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD+SLGQK+ASRLNIRPTM
Sbjct  471  WSQADKSLGQKLASRLNIRPTM  492



>emb|CAA45564.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   227 bits (579),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 95/142 (67%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP 
Sbjct  351  TQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDQVRHAEKYPTPP  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             + +G+R++C+IEKENNFK+PG+RYR++ P+RQ+RFI RW+ +LS+PR+THEIRS WISY
Sbjct  411  AVCSGKRERCIIEKENNFKEPGERYRTFTPERQERFIQRWIDALSDPRITHEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD+SLGQK+ASRLN+RP++
Sbjct  471  WSQADKSLGQKLASRLNVRPSI  492



>ref|NP_195235.1| catalase 2 [Arabidopsis thaliana]
 sp|P25819.3|CATA2_ARATH RecName: Full=Catalase-2 [Arabidopsis thaliana]
 emb|CAA17773.1| catalase [Arabidopsis thaliana]
 emb|CAB80226.1| catalase [Arabidopsis thaliana]
 gb|AAL66998.1| putative catalase [Arabidopsis thaliana]
 gb|AAM44902.1| putative catalase [Arabidopsis thaliana]
 gb|AEE86462.1| catalase 2 [Arabidopsis thaliana]
Length=492

 Score =   227 bits (579),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 95/142 (67%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP 
Sbjct  351  TQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDQVRHAEKYPTPP  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             + +G+R++C+IEKENNFK+PG+RYR++ P+RQ+RFI RW+ +LS+PR+THEIRS WISY
Sbjct  411  AVCSGKRERCIIEKENNFKEPGERYRTFTPERQERFIQRWIDALSDPRITHEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD+SLGQK+ASRLN+RP++
Sbjct  471  WSQADKSLGQKLASRLNVRPSI  492



>ref|XP_010523643.1| PREDICTED: catalase-2-like [Tarenaya hassleriana]
Length=492

 Score =   227 bits (578),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AER+P P 
Sbjct  351  TQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERYPVPS  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             + +GRR++C+IEKENNFKQPG+RYRS+ PDR++RFI RW+++LS+PR+THEIRS WISY
Sbjct  411  VVCSGRRERCIIEKENNFKQPGERYRSFTPDRKERFIRRWIEALSDPRITHEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD+SLGQK+ASR+N+RP +
Sbjct  471  WSQADQSLGQKLASRMNVRPNI  492



>gb|AAD17935.1| catalase [Brassica juncea]
Length=492

 Score =   227 bits (578),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP 
Sbjct  351  TQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPP  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             + +G+R++CVIEKENNFK+PG+RYRS+ P+RQ+RFI RW+++LS+PR+THEIRS WISY
Sbjct  411  AVCSGKRERCVIEKENNFKEPGERYRSFTPERQERFIRRWIEALSDPRITHEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD++LGQK+ASRLN+RP++
Sbjct  471  WSQADKTLGQKLASRLNVRPSI  492



>emb|CDY40645.1| BnaA03g53180D [Brassica napus]
Length=485

 Score =   226 bits (577),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP 
Sbjct  344  TQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPP  403

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             + +G+R++C+IEKENNFK+PG+RYRS+ P+RQ+RFI RW+ +LS+PR+THEIRS WISY
Sbjct  404  AVCSGKRERCIIEKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEIRSIWISY  463

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD+SLGQK+ASRLN+RP +
Sbjct  464  WSQADKSLGQKLASRLNVRPNI  485



>ref|XP_010094556.1| Catalase isozyme 1 [Morus notabilis]
 gb|EXB56310.1| Catalase isozyme 1 [Morus notabilis]
Length=492

 Score =   227 bits (578),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HR+EEV+YFPS++D  R+AER+P P 
Sbjct  351  TQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHREEEVNYFPSRYDPVRHAERYPIPS  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             I TGRR++ VI+KENNFKQPG+RYRS++PDRQ+RFI RWV +LS+PRVTHEIRS WISY
Sbjct  411  AICTGRRERTVIDKENNFKQPGERYRSFSPDRQERFIKRWVNALSDPRVTHEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QADRSLGQK+ASRLN+RP++
Sbjct  471  WSQADRSLGQKLASRLNVRPSI  492



>ref|XP_009138342.1| PREDICTED: catalase-2 [Brassica rapa]
 gb|AAD17934.1| catalase [Brassica juncea]
Length=492

 Score =   227 bits (578),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP 
Sbjct  351  TQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPP  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             + +G+R++C+IEKENNFK+PG+RYRS+ P+RQ+RFI RW+ +LS+PR+THEIRS WISY
Sbjct  411  AVCSGKRERCIIEKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD+SLGQK+ASRLN+RP +
Sbjct  471  WSQADKSLGQKLASRLNVRPNI  492



>ref|XP_010536468.1| PREDICTED: catalase-3-like [Tarenaya hassleriana]
Length=492

 Score =   226 bits (577),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T R+RLGPNY+ LPVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS+FD+ R+A ++P P 
Sbjct  351  TQRYRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRFDSVRHAAKYPIPS  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             I +G R KCVIEKENNFKQPGDRYRSWAPDRQ+R+ NRWV++LS+ RVT EIR  WISY
Sbjct  411  AICSGERVKCVIEKENNFKQPGDRYRSWAPDRQERYANRWVEALSDARVTDEIRGIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
            L+Q+D+SLG KVA+RLN+RP+ 
Sbjct  471  LSQSDKSLGMKVANRLNVRPSF  492



>gb|AAZ29552.1| catalase-C [Oryza sativa Indica Group]
Length=500

 Score =   227 bits (578),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+LLP NAPKCA+HNN YDG+MNF+HRDEEVDYFPS++D  ++A R+P P 
Sbjct  359  TQRHRLGPNYLLLPPNAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRYDPAKHAPRYPIPS  418

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
              +TGRR+K VI KENNFKQPG+RYRSW P RQDRFI RW+ +LS PR+THEIRS W+SY
Sbjct  419  ATLTGRREKVVIAKENNFKQPGERYRSWDPARQDRFIKRWIDALSGPRLTHEIRSIWLSY  478

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QADRSLGQK+ASRL+ +P+M
Sbjct  479  WSQADRSLGQKLASRLSAKPSM  500



>dbj|BAA34205.1| catalase [Oryza sativa Japonica Group]
 gb|AAQ19030.1| catalase [Oryza sativa]
Length=492

 Score =   226 bits (577),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+LLP NAPKCA+HNN YDG+MNF+HRDEEVDYFPS++D  ++A R+P P 
Sbjct  351  TQRHRLGPNYLLLPPNAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRYDPAKHAPRYPIPS  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
              +TGRR+K VI KENNFKQPG+RYRSW P RQDRFI RW+ +LS+PR+THEIRS W+SY
Sbjct  411  ATLTGRREKVVIAKENNFKQPGERYRSWDPARQDRFIKRWIDALSDPRLTHEIRSIWLSY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QADRSLGQK+ASRL+ +P+M
Sbjct  471  WSQADRSLGQKLASRLSAKPSM  492



>gb|KFK30147.1| catalase [Arabis alpina]
Length=492

 Score =   226 bits (577),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++P P 
Sbjct  351  TQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDTVRHAEKYPAPP  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             + +G+R++CVIEKENNFK+PG+RYRS+ P+RQ+RFI RW+++LS+PR+THEIRS WISY
Sbjct  411  AVCSGKRERCVIEKENNFKEPGERYRSFPPERQERFIRRWIEALSDPRITHEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD+SLGQK+ASRLN+RP++
Sbjct  471  WSQADKSLGQKLASRLNVRPSI  492



>ref|NP_001048861.1| Os03g0131200 [Oryza sativa Japonica Group]
 gb|ABF93810.1| Catalase-1, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF10775.1| Os03g0131200 [Oryza sativa Japonica Group]
 dbj|BAG88238.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89941.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74449.1| hypothetical protein OsI_09857 [Oryza sativa Indica Group]
 gb|EEE58275.1| hypothetical protein OsJ_09293 [Oryza sativa Japonica Group]
Length=492

 Score =   226 bits (577),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+LLP NAPKCA+HNN YDG+MNF+HRDEEVDYFPS++D  ++A R+P P 
Sbjct  351  TQRHRLGPNYLLLPPNAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRYDPAKHAPRYPIPS  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
              +TGRR+K VI KENNFKQPG+RYRSW P RQDRFI RW+ +LS+PR+THEIRS W+SY
Sbjct  411  ATLTGRREKVVIAKENNFKQPGERYRSWDPARQDRFIKRWIDALSDPRLTHEIRSIWLSY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QADRSLGQK+ASRL+ +P+M
Sbjct  471  WSQADRSLGQKLASRLSAKPSM  492



>sp|P48350.1|CATA1_CUCPE RecName: Full=Catalase isozyme 1 [Cucurbita pepo]
 dbj|BAA09506.1| catalase [Cucurbita pepo]
Length=492

 Score =   226 bits (577),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD +R+AER+P P 
Sbjct  351  TQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPSRHAERYPHPP  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             + +G+R++C+IEKENNFK+PG+RYRSW PDRQ+RF+ RWV +LS+ RVTHEIRS WISY
Sbjct  411  AVCSGKRERCIIEKENNFKEPGERYRSWTPDRQERFVRRWVDALSDTRVTHEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QADRSLGQK+AS LN+RP++
Sbjct  471  WSQADRSLGQKLASHLNVRPSI  492



>gb|AAC48918.1| salicylic acid binding catalase, partial [Nicotiana tabacum]
Length=489

 Score =   226 bits (576),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHR+GPNYM LPVNAPKCA+HNN  DG MNF+HRDEEVDY PS+FD  R+AE++P P 
Sbjct  348  TQRHRIGPNYMQLPVNAPKCAHHNNHRDGAMNFMHRDEEVDYLPSRFDPCRHAEQYPIPS  407

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
            R++TGRR+ CVIEKENNFKQ G+RYRSW PDRQDR++++WV+ LS+PRVT+EIRS WI  
Sbjct  408  RVLTGRREMCVIEKENNFKQAGERYRSWEPDRQDRYVSKWVEHLSDPRVTYEIRSIWICS  467

Query  283  LTQADRSLGQKVASRLNIRPTM  218
            L+QAD+S GQKVASRL ++PTM
Sbjct  468  LSQADKSCGQKVASRLTLKPTM  489



>gb|AAD17936.1| catalase [Brassica juncea]
Length=492

 Score =   226 bits (577),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP 
Sbjct  351  TQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPP  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             I +G+R++C+IEKENNFK+PG+RYRS+ P+RQ+RFI RW+ +LS+PR+THEIRS WISY
Sbjct  411  AICSGKRERCIIEKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD+SLGQK+A+RLN+RP++
Sbjct  471  WSQADKSLGQKLANRLNVRPSI  492



>ref|XP_009794245.1| PREDICTED: catalase isozyme 1 [Nicotiana sylvestris]
Length=492

 Score =   226 bits (577),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T R+RLGPNY+ LP NAPKCA+HNN YDG MNF+HRDEE+DYFPS++D  R+AE++P P 
Sbjct  351  TQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPIPS  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             + TG+R+KCVI+KENNFKQ GDRYRS+ PDRQ+RFI RWV++LS+PR+T+EIRS WISY
Sbjct  411  TMCTGKREKCVIQKENNFKQAGDRYRSFTPDRQERFIRRWVEALSDPRITYEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD+SLGQK+ASRLN+RP++
Sbjct  471  WSQADKSLGQKLASRLNVRPSI  492



>gb|KGN55499.1| hypothetical protein Csa_4G658590 [Cucumis sativus]
Length=492

 Score =   226 bits (576),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AER+P P 
Sbjct  351  TQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPARHAERYPHPP  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             + TG+R++CVI+KENNFK+PG+RYRSW PDRQ+RFI RWV +LS+PRVTHEIRS WI+Y
Sbjct  411  AVCTGKRERCVIQKENNFKEPGERYRSWTPDRQERFIRRWVDALSDPRVTHEIRSIWITY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QADRS+GQK+AS LN+RP++
Sbjct  471  WSQADRSVGQKLASHLNVRPSI  492



>gb|AAC49807.1| catalase 3 [Arabidopsis thaliana]
 gb|AAC17732.1| catalase 3 [Arabidopsis thaliana]
Length=492

 Score =   226 bits (576),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 121/142 (85%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ PTP 
Sbjct  351  TQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPTPT  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
               TG R KCVI+KENNFKQ GDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIR  W SY
Sbjct  411  NSYTGIRTKCVIKKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGIWTSY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
              +ADRSLGQK+ASRLN+RP++
Sbjct  471  WLKADRSLGQKLASRLNVRPSI  492



>gb|ACA50528.1| putative catalase 2 [Brassica napus]
Length=492

 Score =   226 bits (576),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 98/140 (70%), Positives = 127/140 (91%), Gaps = 0/140 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP 
Sbjct  351  TQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPP  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             + +G+R++C+IEKENNF+QPG+RYRSW  DRQ+RF+ R+V++L+EPRVTHEIRS WISY
Sbjct  411  AVCSGKRERCIIEKENNFQQPGERYRSWDADRQERFVKRFVEALAEPRVTHEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRP  224
             TQAD+SLGQK+ASRLN+RP
Sbjct  471  WTQADKSLGQKLASRLNVRP  490



>sp|P32290.1|CATA_VIGRR RecName: Full=Catalase [Vigna radiata var. radiata]
 dbj|BAA02755.1| catalase [Vigna radiata var. radiata]
Length=492

 Score =   226 bits (575),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            + RHRLGPNY+LLP NAPK A+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+FP P 
Sbjct  351  SQRHRLGPNYLLLPANAPKSAHHNNHHEGFMNFIHRDEEVNYFPSRYDPVRHAEKFPIPP  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             + +GRR+K  IEKENNFKQ G+R+RSWAPDRQDRFI RWV +LS+PRVTHEIRS WISY
Sbjct  411  AVFSGRREKIAIEKENNFKQAGERFRSWAPDRQDRFIRRWVDALSDPRVTHEIRSVWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QADRSLGQK+AS LN+RP +
Sbjct  471  WSQADRSLGQKIASHLNMRPNI  492



>emb|CDP01803.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   226 bits (575),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LP NAPKCA+HNN +DG+MNF+HRDEEVDYFPS++D  R+AE  P P 
Sbjct  351  TQRHRLGPNYLQLPANAPKCAHHNNHHDGFMNFMHRDEEVDYFPSRYDPVRHAEMHPIPS  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             ++TGRR+K +I KENNFKQPG+RYRS+APDRQ+RFI RWV +LS+PRVT+EIRS WISY
Sbjct  411  AVLTGRREKTIIPKENNFKQPGERYRSFAPDRQERFICRWVDALSDPRVTYEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD+SLGQK+ASRLNIRP++
Sbjct  471  WSQADKSLGQKLASRLNIRPSI  492



>ref|XP_006382992.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60789.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
Length=490

 Score =   226 bits (575),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD  R+AER+P P 
Sbjct  349  TQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERYPNPS  408

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             I TG+R+KC+IEKENNFKQPG+RYRS++PDR++RF+ RWV++LS+PRVT+EIRS WISY
Sbjct  409  VIHTGKREKCIIEKENNFKQPGERYRSFSPDRKERFVRRWVEALSDPRVTYEIRSIWISY  468

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD+SLGQK+AS LN+RP++
Sbjct  469  WSQADKSLGQKLASHLNMRPSI  490



>ref|NP_001235974.1| catalase-3 [Glycine max]
 sp|O48560.1|CATA3_SOYBN RecName: Full=Catalase-3 [Glycine max]
 gb|AAB88171.1| catalase [Glycine max]
 gb|KHN12602.1| Catalase-3 [Glycine soja]
Length=492

 Score =   226 bits (575),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LP N+PKCA+HNN +DG+MNF+HRDEEV+YFPS++D  R+AER P P 
Sbjct  351  TQRHRLGPNYLQLPANSPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAERVPVPP  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
            R + G+R+KC+IEKENNFKQPG+RYRSW  DRQ+RF+ RWV +LS+PRVTHEIRS WISY
Sbjct  411  RTLGGKREKCMIEKENNFKQPGERYRSWPSDRQERFVRRWVDALSDPRVTHEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QADRSLGQK+AS LN++P++
Sbjct  471  WSQADRSLGQKIASHLNLKPSI  492



>ref|XP_011074090.1| PREDICTED: catalase isoform X1 [Sesamum indicum]
Length=513

 Score =   226 bits (576),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHR+GPNY+ LPVNAPKC +HNN +DG MNF+HRDEEV+YFPS++D  R+AE+FP P 
Sbjct  372  TQRHRIGPNYLQLPVNAPKCPHHNNHHDGAMNFMHRDEEVNYFPSRYDPCRHAEKFPIPP  431

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             +++G+R K VIEKENNFKQPGDRYRSWAPDRQ+RFI RW+ +LS+PR+T EIRS W+SY
Sbjct  432  VVLSGQRVKTVIEKENNFKQPGDRYRSWAPDRQERFIRRWIDALSDPRLTAEIRSIWVSY  491

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             TQAD+SLGQK+ASRLN+RP M
Sbjct  492  WTQADKSLGQKLASRLNVRPAM  513



>emb|CDX72514.1| BnaC07g45360D [Brassica napus]
Length=480

 Score =   225 bits (574),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVNAPKCA+HNN ++G+MN +HRDEEV+YFPS++D  R+AE++PTP 
Sbjct  339  TQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNVMHRDEEVNYFPSRYDPVRHAEKYPTPP  398

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             + +G+R++CVIEKENNFK+PG+RYRS+ P+RQ+RFI RW+ +LS+PR+THEIRS WISY
Sbjct  399  AVCSGKRERCVIEKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEIRSIWISY  458

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD+SLGQK+ASRLN+RP++
Sbjct  459  WSQADKSLGQKLASRLNVRPSI  480



>ref|XP_002306427.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 ref|XP_006382993.1| catalase family protein [Populus trichocarpa]
 emb|CAI43950.1| catalase [Populus deltoides]
 gb|EEE93423.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60790.1| catalase family protein [Populus trichocarpa]
Length=492

 Score =   226 bits (575),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD  R+AER+P P 
Sbjct  351  TQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERYPNPS  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             I TG+R+KC+IEKENNFKQPG+RYRS++PDR++RF+ RWV++LS+PRVT+EIRS WISY
Sbjct  411  VIHTGKREKCIIEKENNFKQPGERYRSFSPDRKERFVRRWVEALSDPRVTYEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD+SLGQK+AS LN+RP++
Sbjct  471  WSQADKSLGQKLASHLNMRPSI  492



>gb|ACJ73906.1| CAT2 [Solanum nigrum]
Length=315

 Score =   221 bits (562),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHR+GPNYM LPVNAPKCA+HNNS DG MNF+HRDEEVDY PS+FD  R AE++P P 
Sbjct  174  TQRHRIGPNYMQLPVNAPKCAHHNNSRDGAMNFMHRDEEVDYLPSRFDPCRPAEQYPIPS  233

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             ++ G R  CV  KENNFKQ G+RYRSW PDRQDR+IN+WV+SLS+PRVTHEI S WISY
Sbjct  234  CVLNGPRTMCVTPKENNFKQAGERYRSWEPDRQDRYINKWVESLSDPRVTHEIPSIWISY  293

Query  283  LTQADRSLGQKVASRLNIRPTM  218
            L+QAD+S GQKVASRL ++P M
Sbjct  294  LSQADKSCGQKVASRLTVKPPM  315



>emb|CDY17510.1| BnaC03g65530D [Brassica napus]
Length=477

 Score =   225 bits (574),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 95/142 (67%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP 
Sbjct  336  TQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPP  395

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             + +G+R++CVIEKENNFK+PG+RYRS+ P+RQ+RFI RW+++LS+PR+THEIRS WISY
Sbjct  396  AVCSGKRERCVIEKENNFKEPGERYRSFTPERQERFIRRWIEALSDPRITHEIRSIWISY  455

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD++LGQK+AS LN+RP++
Sbjct  456  WSQADKTLGQKLASHLNVRPSI  477



>gb|EYU30275.1| hypothetical protein MIMGU_mgv1a005250mg [Erythranthe guttata]
Length=492

 Score =   226 bits (575),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            + RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+ P P 
Sbjct  351  SQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPCRHAEKHPIPP  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             +++G+RD+C IEKENNFKQPG+RYR+++PDRQ+RFI RWV +LS+PR+THEIRS WISY
Sbjct  411  VVLSGKRDRCCIEKENNFKQPGERYRTFSPDRQERFIRRWVDALSDPRLTHEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD+SLGQK+ASRLN+RPTM
Sbjct  471  WSQADKSLGQKLASRLNVRPTM  492



>gb|KHG12976.1| Catalase isozyme 2 [Gossypium arboreum]
Length=492

 Score =   226 bits (575),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+ P P 
Sbjct  351  TQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKHPIPS  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             +++G+R+KC+I KENNFKQPG+RYRS++ DRQ+RFINRW+ +LS+PRVTHEIRS WISY
Sbjct  411  TVLSGKREKCIIGKENNFKQPGERYRSFSADRQERFINRWIDALSDPRVTHEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD+SLGQK+ASRLN+RP++
Sbjct  471  WSQADKSLGQKIASRLNVRPSI  492



>ref|XP_009597278.1| PREDICTED: catalase isozyme 1 [Nicotiana tomentosiformis]
 emb|CCP37651.1| catalase-1 [Nicotiana tabacum]
Length=492

 Score =   226 bits (575),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T R+RLGPNY+ LP NAPKCA+HNN YDG MNF+HRDEE+DYFPS++D  R+AE++P P 
Sbjct  351  TQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPIPS  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             + TG+R+KCVI+KENNF QPG+RYRS+ PDRQ+RFI RWV++LS+PR+T+EIRS WISY
Sbjct  411  TMCTGKREKCVIQKENNFNQPGERYRSFTPDRQERFIRRWVEALSDPRITYEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD+SLGQK+ASRLN+RP++
Sbjct  471  WSQADKSLGQKLASRLNVRPSI  492



>sp|P30567.1|CATA2_GOSHI RecName: Full=Catalase isozyme 2 [Gossypium hirsutum]
 emb|CAA39998.1| subunit 2 of cotton catalase [Gossypium hirsutum]
Length=492

 Score =   226 bits (575),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+ P P 
Sbjct  351  TQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKHPIPS  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             +++G+R+KC+I KENNFKQPG+RYRS++ DRQ+RFINRW+ +LS+PRVTHEIRS WISY
Sbjct  411  TVLSGKREKCIIGKENNFKQPGERYRSFSADRQERFINRWIDALSDPRVTHEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD+SLGQK+ASRLN+RP++
Sbjct  471  WSQADKSLGQKIASRLNVRPSI  492



>ref|XP_004500876.1| PREDICTED: catalase-4-like isoform X1 [Cicer arietinum]
Length=493

 Score =   225 bits (574),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            + RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS+ D  R+AERFPTP 
Sbjct  352  SQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRHDPVRHAERFPTPP  411

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
              ++G+R++C+  KENNFKQPG+RYR+WAPDRQDRF  RW+++LS+PRVTHE+RS WISY
Sbjct  412  AALSGKRERCIRPKENNFKQPGERYRTWAPDRQDRFARRWIEALSDPRVTHEVRSIWISY  471

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QADRSLGQK+AS LN+RP++
Sbjct  472  WSQADRSLGQKIASHLNMRPSI  493



>gb|ABQ44283.1| catalase [Saccharum hybrid cultivar NCo 376]
Length=339

 Score =   221 bits (563),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 121/142 (85%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+LLP NAPKCA+HNN YDG+MNF+HRDEEVDYFPS++D  +NA R+P P 
Sbjct  198  TQRHRLGPNYLLLPANAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRYDPAKNAPRYPIPT  257

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
              +TGRRDK VI KENNFKQPG+RYR+  P RQ+RFI RWV +LS+PR+THEIRS W+S 
Sbjct  258  VHITGRRDKTVIAKENNFKQPGERYRAMDPARQERFIKRWVDALSDPRLTHEIRSIWLSN  317

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QADRSLGQK+ASRL+ +P+M
Sbjct  318  WSQADRSLGQKLASRLSAKPSM  339



>gb|ACB11496.1| catalase [Pinus sylvestris]
Length=492

 Score =   225 bits (574),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY++LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD  R+AERFP P 
Sbjct  351  TQRHRLGPNYLMLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERFPIPS  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
               TG+R+KCVIEKENNFKQPG+RYRS+AP+RQ+RF+ RWV +LS+PRVTHEI S WISY
Sbjct  411  HTHTGKREKCVIEKENNFKQPGERYRSFAPERQERFVKRWVAALSDPRVTHEICSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +Q D+SLGQK+A+RLN++  M
Sbjct  471  WSQCDKSLGQKIAARLNMKANM  492



>gb|AAR14052.2| catalase [Solanum tuberosum]
Length=475

 Score =   225 bits (573),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T R+RLGPNY+ LP NAPKCA+HNN YDG MNF+HRDEE+DYFPS++D  R+AE +P P 
Sbjct  334  TQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDQVRHAEVYPIPS  393

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             + +G+R+KC+I+KENNFKQPG+RYR++ PDRQ+RFI RWV++LS+PR+T+EIRS WISY
Sbjct  394  TVCSGKREKCIIQKENNFKQPGERYRTFTPDRQERFIRRWVEALSDPRITYEIRSIWISY  453

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD+SLGQK+ASRLN+RP++
Sbjct  454  WSQADKSLGQKLASRLNVRPSI  475



>dbj|BAJ87148.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=302

 Score =   220 bits (560),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY++LPVNAPKCA+HNN +DG MNF+HRDEEV+YFPS+FD TR+AE++P P 
Sbjct  161  TQRHRLGPNYLMLPVNAPKCAHHNNHHDGLMNFIHRDEEVNYFPSRFDPTRHAEKYPMPP  220

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
            R+++G R+KC+I+KENNFKQ G+RYRS+ P RQDRF+ RWV +L++ RVTHEI+S W+SY
Sbjct  221  RVLSGCREKCIIDKENNFKQAGERYRSFDPARQDRFLQRWVDALTDARVTHEIQSIWVSY  280

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +Q D SLGQK+ASRL I+P M
Sbjct  281  WSQCDASLGQKLASRLKIKPNM  302



>ref|XP_010432341.1| PREDICTED: catalase-2-like [Camelina sativa]
Length=492

 Score =   225 bits (574),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS++D  R+AE++P P 
Sbjct  351  TQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDQVRHAEKYPAPP  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             + +G+R++CVI KENNFK+PG+RYRS+ P+RQ+RFI RW+ +LS+PR+THEIRS WISY
Sbjct  411  AVCSGKRERCVIAKENNFKEPGERYRSFPPERQERFICRWIDALSDPRITHEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD+SLGQK+ASRLN+RP++
Sbjct  471  WSQADKSLGQKLASRLNVRPSI  492



>ref|XP_010437527.1| PREDICTED: catalase-2 [Camelina sativa]
Length=492

 Score =   225 bits (574),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS++D  R+AE++P P 
Sbjct  351  TQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDQVRHAEKYPAPP  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             + +G+R++CVI KENNFK+PG+RYRS+ P+RQ+RFI RW+ +LS+PR+THEIRS WISY
Sbjct  411  AVCSGKRERCVIAKENNFKEPGERYRSFPPERQERFICRWIDALSDPRITHEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD+SLGQK+ASRLN+RP++
Sbjct  471  WSQADKSLGQKLASRLNVRPSI  492



>gb|AFW69584.1| catalase1 [Zea mays]
Length=353

 Score =   221 bits (564),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY++LPVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS+FD  R+AE+ P P 
Sbjct  212  TQRHRLGPNYLMLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRFDPARHAEKVPIPP  271

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
            R++TG R+KC+I+KENNFKQ G+RYRS+ P RQDRFI RWV +L++PRVTHE R+ WISY
Sbjct  272  RVLTGCREKCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALTDPRVTHEHRTIWISY  331

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +Q D +LGQK+ASRLN++P+M
Sbjct  332  WSQCDAALGQKLASRLNLKPSM  353



>ref|XP_004500877.1| PREDICTED: catalase-4-like isoform X2 [Cicer arietinum]
Length=492

 Score =   225 bits (573),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            + RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS+ D  R+AERFPTP 
Sbjct  351  SQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRHDPVRHAERFPTPP  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
              ++G+R++C+  KENNFKQPG+RYR+WAPDRQDRF  RW+++LS+PRVTHE+RS WISY
Sbjct  411  AALSGKRERCIRPKENNFKQPGERYRTWAPDRQDRFARRWIEALSDPRVTHEVRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QADRSLGQK+AS LN+RP++
Sbjct  471  WSQADRSLGQKIASHLNMRPSI  492



>gb|AAD37788.1|AF149283_1 catalase 1 [Phaseolus vulgaris]
Length=428

 Score =   223 bits (569),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 99/137 (72%), Positives = 121/137 (88%), Gaps = 0/137 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            + RHRLGPNY+ +P NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AER P P 
Sbjct  292  SQRHRLGPNYLQIPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERIPVPP  351

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
            RI+ G+R+KC+IEKENNFKQPG+RYRSWA DRQ+RF+ RWV +LSEPRVTHEIRS WISY
Sbjct  352  RILDGKREKCMIEKENNFKQPGERYRSWASDRQERFLRRWVDALSEPRVTHEIRSIWISY  411

Query  283  LTQADRSLGQKVASRLN  233
             +QADRSLGQK+AS LN
Sbjct  412  WSQADRSLGQKIASHLN  428



>ref|NP_001234186.1| catalase isozyme 2 [Solanum lycopersicum]
 sp|Q9XHH3.1|CATA2_SOLLC RecName: Full=Catalase isozyme 2 [Solanum lycopersicum]
 gb|AAD41256.1| catalase 2 [Solanum lycopersicum]
Length=492

 Score =   225 bits (573),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T R+RLGPNY+ LP NAPKCA+HNN YDG MNF+HRDEE+DYFPS++D  R+AE +P P 
Sbjct  351  TQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDQVRHAEVYPIPS  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             + +G+R+KC+I+KENNFKQPG+RYRS+ PDRQ+RFI RWV++LS+PR+T+EIRS WI+Y
Sbjct  411  TVCSGKREKCIIQKENNFKQPGERYRSFTPDRQERFIRRWVEALSDPRITYEIRSIWITY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD+SLGQK+ASRLN+RP++
Sbjct  471  WSQADKSLGQKLASRLNVRPSI  492



>ref|XP_011022275.1| PREDICTED: catalase-like [Populus euphratica]
Length=476

 Score =   224 bits (572),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD  R+AER+P P 
Sbjct  335  TQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERYPNPS  394

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             I TG+R+KC+IEKENNFKQPG+RYRS++PDR++RF+ RWV++LS+PRVT+EIRS WISY
Sbjct  395  VIHTGKREKCIIEKENNFKQPGERYRSFSPDRKERFVRRWVEALSDPRVTYEIRSIWISY  454

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD+SLGQK+AS LN+RP +
Sbjct  455  WSQADKSLGQKLASHLNMRPGI  476



>ref|XP_009106100.1| PREDICTED: catalase-2 [Brassica rapa]
Length=492

 Score =   224 bits (572),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 95/142 (67%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVN+PKC++HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP 
Sbjct  351  TQRHRLGPNYLQLPVNSPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPP  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             + +G+R++CVIEKENNFK+PG+RYRS+ P+RQ+RFI RW+ +LS+PR+THEIRS WISY
Sbjct  411  AVCSGKRERCVIEKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD+SLGQK+ASRLN+RP +
Sbjct  471  WSQADKSLGQKLASRLNVRPNI  492



>ref|NP_001234827.1| catalase isozyme 1 [Solanum lycopersicum]
 sp|P30264.1|CATA1_SOLLC RecName: Full=Catalase isozyme 1 [Solanum lycopersicum]
 gb|AAA34145.1| catalase [Solanum lycopersicum]
 prf||1909364A catalase
Length=492

 Score =   224 bits (572),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHR+GPNYM LPVNAPKC +HNN  DG MN  HRDEEVDY PS+FD  R AE++P P 
Sbjct  351  TQRHRIGPNYMQLPVNAPKCGHHNNHRDGAMNMTHRDEEVDYLPSRFDPCRPAEQYPIPS  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             ++ GRR  CVI KENNFKQ G+RYRSW PDRQDR+IN+WV+SLS+PRVTHEIRS WISY
Sbjct  411  CVLNGRRTNCVIPKENNFKQAGERYRSWEPDRQDRYINKWVESLSDPRVTHEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
            L+QAD+S GQKVASRL ++PTM
Sbjct  471  LSQADKSCGQKVASRLTVKPTM  492



>ref|XP_010934843.1| PREDICTED: catalase isozyme 2 [Elaeis guineensis]
 gb|AFS65099.1| catalase 2 [Elaeis guineensis]
Length=492

 Score =   224 bits (572),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T R+RLGPNY++LPVNAPKCA+HNN +DG MNF+ R+EEVDYFPS+ D  R+AERFP P 
Sbjct  351  TQRYRLGPNYLMLPVNAPKCAFHNNQFDGLMNFMQRNEEVDYFPSRHDPLRHAERFPIPS  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
            R+VTG+R+K VI K+N+FKQPG+RYRSWAPDRQ+RF+ RW +SL  P+V+HE+RS WI+Y
Sbjct  411  RVVTGKREKIVIPKQNDFKQPGERYRSWAPDRQERFVRRWAESLGHPKVSHELRSIWITY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
            LTQ D SLGQKVA+RLN++P+M
Sbjct  471  LTQCDVSLGQKVANRLNVKPSM  492



>gb|AHF27430.1| catalase [Cucurbita moschata]
Length=492

 Score =   224 bits (571),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 127/143 (89%), Gaps = 1/143 (1%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVNAPKC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+FP P 
Sbjct  350  TQRHRLGPNYLQLPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRYDPCRHAEKFPMPP  409

Query  463  RIVTGRRDKCVIEKE-NNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
             ++TG+R++CVI KE NNFKQ GDRYRSWAPDRQDRF+ R+V++LS+PRVTHE+R+ WIS
Sbjct  410  NVLTGKRERCVIPKENNNFKQAGDRYRSWAPDRQDRFVKRFVEALSDPRVTHEVRNIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QADRSLGQK+ASRLN+RP +
Sbjct  470  YWSQADRSLGQKIASRLNVRPNI  492



>ref|XP_006656514.1| PREDICTED: catalase isozyme B-like [Oryza brachyantha]
Length=492

 Score =   224 bits (571),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 121/142 (85%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY++LPVNAPKCAYHNN +DG MNF+HRDEEV+YFPS+FD  R+AE+ P P 
Sbjct  351  TQRHRLGPNYLMLPVNAPKCAYHNNHHDGTMNFMHRDEEVNYFPSRFDAARHAEKVPVPP  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
            R++TG R+KCVI KENNFKQ G+RYRS+ P RQDRFI RWV +LS+PR+THE+R  WISY
Sbjct  411  RVLTGCREKCVINKENNFKQAGERYRSFDPARQDRFIQRWVDALSDPRITHELRGIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +Q D SLGQK+ASRLN++P M
Sbjct  471  WSQCDASLGQKLASRLNLKPNM  492



>ref|XP_007046520.1| Catalase 2 [Theobroma cacao]
 gb|EOX90677.1| Catalase 2 [Theobroma cacao]
Length=492

 Score =   224 bits (571),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD  R+AE++P P 
Sbjct  351  TQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAEKYPIPT  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             I +G+R+KC+I+KENNF+QPG+RYRS+APDRQ+RFI RWV +LS+PRVT+EIRS WISY
Sbjct  411  AICSGKREKCIIDKENNFQQPGERYRSFAPDRQERFIYRWVDALSDPRVTYEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             ++AD+SLGQK+ASRL++RP++
Sbjct  471  WSKADKSLGQKLASRLSVRPSI  492



>ref|XP_011022153.1| PREDICTED: catalase-2-like isoform X2 [Populus euphratica]
Length=492

 Score =   224 bits (571),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD  R+AER+P P 
Sbjct  351  TQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERYPNPS  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             I TG+R+KC+IEKENNFKQPG+RYRS++PDR++RF+ RWV++LS+PRVT+EIRS WISY
Sbjct  411  VIHTGKREKCIIEKENNFKQPGERYRSFSPDRKERFVRRWVEALSDPRVTYEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD+SLGQK+AS LN+RP +
Sbjct  471  WSQADKSLGQKLASHLNMRPGI  492



>ref|XP_008791900.1| PREDICTED: catalase isozyme 2 [Phoenix dactylifera]
Length=492

 Score =   224 bits (571),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T R+RLGPNY++LPVNAPKCA+HNN +DG MNF+ R+EEVDYFPS+ D  R+AERFP P 
Sbjct  351  TQRYRLGPNYLMLPVNAPKCAFHNNQFDGLMNFMQRNEEVDYFPSRHDPLRHAERFPIPS  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
            R+VTG+R+K VI K+N+FKQPG+RYRSWAPDRQ+RF+ RW +SL  P+V+HE+RS WI+Y
Sbjct  411  RVVTGKREKTVIPKQNDFKQPGERYRSWAPDRQERFVRRWAESLGHPKVSHELRSIWITY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
            LTQ D SLGQKVA+RLN++P+M
Sbjct  471  LTQCDVSLGQKVANRLNVKPSM  492



>gb|AHF27433.1| catalase [Cucurbita maxima]
Length=492

 Score =   224 bits (571),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 127/143 (89%), Gaps = 1/143 (1%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVNAPKC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+FP P 
Sbjct  350  TQRHRLGPNYLQLPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRYDPCRHAEKFPMPP  409

Query  463  RIVTGRRDKCVIEKE-NNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
             ++TG+R++CVI KE NNFKQ GDRYRSWAPDRQDRF+ R+V++LS+PRVTHE+R+ WIS
Sbjct  410  NVLTGKRERCVIPKENNNFKQAGDRYRSWAPDRQDRFVKRFVEALSDPRVTHEVRNIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QADRSLGQK+ASRLN+RP +
Sbjct  470  YWSQADRSLGQKIASRLNVRPNI  492



>sp|P49318.1|CATA2_RICCO RecName: Full=Catalase isozyme 2 [Ricinus communis]
 gb|AAB31538.1| catalase 2 [Ricinus communis=castor beans, hypocotyls, Peptide, 
492 aa]
 dbj|BAA04698.1| catalase CAT2 [Ricinus communis]
Length=492

 Score =   224 bits (571),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLG NY+ LPVNAPKC YHNN YDG+MNF+HRDEEVDYF S++D  R+AE+ P P 
Sbjct  351  TQRHRLGTNYLQLPVNAPKCPYHNNHYDGFMNFMHRDEEVDYFQSRYDPVRHAEKVPIPN  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             I +GRR+KCVIEKE+NF+QPGDRYRSWAPDRQ+RF+ R V +LSEPR+THEIRS W+S+
Sbjct  411  AICSGRREKCVIEKEDNFRQPGDRYRSWAPDRQERFLCRLVNALSEPRITHEIRSIWVSW  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             TQ D+SLGQK+ASRLN+RP +
Sbjct  471  WTQCDKSLGQKLASRLNVRPNI  492



>gb|ACJ22771.1| catalase 1 [Jatropha curcas]
 gb|KDP36790.1| hypothetical protein JCGZ_08081 [Jatropha curcas]
Length=492

 Score =   224 bits (571),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNYM LPVNAPKC +HNN YDG+MNF+HRDEE+DYF S++D  R+AER+P P 
Sbjct  351  TQRHRLGPNYMQLPVNAPKCPHHNNHYDGFMNFMHRDEEIDYFQSRYDPVRHAERYPIPN  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             I++GRR+KCVI KENNFKQPG+RYRSW PDRQ+RF+ R V +LS+PR+THEIR  W+SY
Sbjct  411  AIISGRREKCVIPKENNFKQPGERYRSWTPDRQERFLCRLVNALSDPRITHEIRGIWVSY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +Q D+SLGQK+ASRLN+RP +
Sbjct  471  WSQCDQSLGQKLASRLNVRPNI  492



>sp|A2YH64.2|CATA2_ORYSI RecName: Full=Catalase isozyme B; Short=CAT-B [Oryza sativa Indica 
Group]
 gb|EEC81340.1| hypothetical protein OsI_24526 [Oryza sativa Indica Group]
Length=492

 Score =   224 bits (570),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY++LPVNAPKCAYHNN +DG MNF+HRDEEV+YFPS+FD  R+AE+ P P 
Sbjct  351  TQRHRLGPNYLMLPVNAPKCAYHNNHHDGSMNFMHRDEEVNYFPSRFDAARHAEKVPIPP  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
            R++TG R+KCVI+KENNFKQ G+RYRS+ P RQDRF+ RWV +LS+PR+THE+R  WISY
Sbjct  411  RVLTGCREKCVIDKENNFKQAGERYRSFDPARQDRFLQRWVDALSDPRITHELRGIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +Q D SLGQK+ASRLN++P M
Sbjct  471  WSQCDASLGQKLASRLNLKPNM  492



>ref|XP_006649332.1| PREDICTED: catalase-1-like [Oryza brachyantha]
Length=492

 Score =   224 bits (570),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+LLP NAPKCA+HNN YDG+MNF+HRDEEVDYFPS++D  ++A R+P P 
Sbjct  351  TQRHRLGPNYLLLPANAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRYDPAKHAPRYPIPS  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
              +TGRR+K VI KENNFKQPG+RYRSW P RQ+RFI RW+ +LS+PR+THEIRS W+SY
Sbjct  411  VNLTGRREKTVIPKENNFKQPGERYRSWDPARQERFIKRWIDALSDPRLTHEIRSIWLSY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QADRSLGQK+ASRL+ +P+M
Sbjct  471  WSQADRSLGQKLASRLSAKPSM  492



>pir||S40265 catalase (EC 1.11.1.6) - eggplant
Length=502

 Score =   224 bits (571),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/136 (75%), Positives = 119/136 (88%), Gaps = 0/136 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHR+GPNYM LPVNAPKCA+HNN  DG MNF+HRDEEVDY PS+FD  R AE++P P 
Sbjct  351  TQRHRIGPNYMQLPVNAPKCAHHNNHRDGAMNFMHRDEEVDYLPSRFDPCRPAEQYPIPS  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             ++TGRR+KCVI KENNFKQ G+RYR+W PDRQDR+IN+WV+SLS+PRVTHEIRS WISY
Sbjct  411  CVLTGRREKCVIPKENNFKQAGERYRTWEPDRQDRYINKWVESLSDPRVTHEIRSIWISY  470

Query  283  LTQADRSLGQKVASRL  236
            L+QAD+S GQKVASRL
Sbjct  471  LSQADKSCGQKVASRL  486



>gb|AAY59707.1| catalase [Oryza sativa Indica Group]
Length=492

 Score =   224 bits (570),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY++LPVNAPKCAYHNN +DG MNF+HRDEEV+YFPS+FD  R+AE+ P P 
Sbjct  351  TQRHRLGPNYLMLPVNAPKCAYHNNHHDGSMNFMHRDEEVNYFPSRFDAARHAEKVPIPP  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
            R++TG R+KCVI+KENNFKQ G+RYRS+ P RQDRF+ RWV +LS+PR+THE+R  WISY
Sbjct  411  RVLTGCREKCVIDKENNFKQAGERYRSFDPARQDRFLQRWVDALSDPRITHELRGIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +Q D SLGQK+ASRLN++P M
Sbjct  471  WSQCDASLGQKLASRLNLKPNM  492



>ref|XP_011022152.1| PREDICTED: catalase-2-like isoform X1 [Populus euphratica]
Length=511

 Score =   224 bits (571),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD  R+AER+P P 
Sbjct  370  TQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERYPNPS  429

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             I TG+R+KC+IEKENNFKQPG+RYRS++PDR++RF+ RWV++LS+PRVT+EIRS WISY
Sbjct  430  VIHTGKREKCIIEKENNFKQPGERYRSFSPDRKERFVRRWVEALSDPRVTYEIRSIWISY  489

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD+SLGQK+AS LN+RP +
Sbjct  490  WSQADKSLGQKLASHLNMRPGI  511



>ref|XP_006340832.1| PREDICTED: catalase isozyme 2 [Solanum tuberosum]
Length=492

 Score =   224 bits (570),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 95/142 (67%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T R+RLGPNY+ LP NAPKCA+HNN YDG MNF+HRDEE+DYFPS++D  R+AE +P P 
Sbjct  351  TQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDQVRHAEVYPIPS  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             + +G+R+KC+I+KENNFKQPG+RYR++ PDRQ+RFI RWV++LS+PR+T+EIRS WI+Y
Sbjct  411  TVCSGKREKCIIQKENNFKQPGERYRTFTPDRQERFIRRWVEALSDPRITYEIRSIWITY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD+SLGQK+ASRLN+RP++
Sbjct  471  WSQADKSLGQKLASRLNVRPSI  492



>gb|AAC19397.1| leaf catalase [Mesembryanthemum crystallinum]
Length=492

 Score =   224 bits (570),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVNAPKCA+HNN YDG MNF+HRD+EVDYFPS++D  R+AER+P P 
Sbjct  351  TQRHRLGPNYLQLPVNAPKCAHHNNHYDGQMNFMHRDDEVDYFPSRYDPVRHAERYPIPP  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             ++ G RD+ +I+KENNFKQPG+RYRSW P RQ+RFI RWV +LS+PR+THEIR+ WISY
Sbjct  411  NVLNGNRDRQIIQKENNFKQPGERYRSWDPARQERFICRWVDALSDPRITHEIRNIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD+S+G K+ASRLN+RPTM
Sbjct  471  WSQADKSVGMKLASRLNVRPTM  492



>gb|AAO17721.1| catalase [Hypericum perforatum]
Length=492

 Score =   223 bits (569),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVNAPK A+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++P P 
Sbjct  351  TQRHRLGPNYLQLPVNAPKSAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPIPP  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             ++ GRR+KC+I KENNFKQPG+RYRS++PDRQ+RF+NRW+ SLS+PRVTHEIR+ W++Y
Sbjct  411  VVLNGRREKCMIAKENNFKQPGERYRSFSPDRQERFLNRWISSLSDPRVTHEIRAIWVTY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
              QAD+SLGQK+ASRLN+RP M
Sbjct  471  WYQADKSLGQKLASRLNVRPNM  492



>emb|CDY52649.1| BnaAnng11640D [Brassica napus]
Length=449

 Score =   222 bits (566),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVN+PKC++HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP 
Sbjct  308  TQRHRLGPNYLQLPVNSPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPP  367

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             + +G+R++CVIEKENNFK+PG+RYRS+ P+R +RFI RW+ +LS+PR+THEIRS WISY
Sbjct  368  AVCSGKRERCVIEKENNFKEPGERYRSFTPERLERFIGRWIDALSDPRITHEIRSIWISY  427

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD+SLGQK+ASRLN+RP +
Sbjct  428  WSQADKSLGQKLASRLNVRPNI  449



>gb|ABK24453.1| unknown [Picea sitchensis]
Length=492

 Score =   223 bits (568),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY++LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD  R+AERFP P 
Sbjct  351  TQRHRLGPNYLMLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERFPIPS  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
               +G R+KCVIEKENNFKQPG+RYRS+ PDRQ+RF+ RWV +LS+PRVTHEI S WISY
Sbjct  411  HTHSGMREKCVIEKENNFKQPGERYRSFEPDRQERFVKRWVAALSDPRVTHEICSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +Q+D+SLGQK+A+RLN++  M
Sbjct  471  WSQSDKSLGQKIAARLNMKANM  492



>ref|XP_010446982.1| PREDICTED: catalase-2-like [Camelina sativa]
Length=492

 Score =   223 bits (568),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS++D  R+AE++P P 
Sbjct  351  TQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAEKYPAPP  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             + +G R++CVI KENNFK+PG+RYRS+ P+RQ+RFI RW+ +LS+PR+THEIRS WISY
Sbjct  411  AVCSGTRERCVIAKENNFKEPGERYRSFPPERQERFICRWIDALSDPRITHEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD+SLGQK+ASRLN+RP++
Sbjct  471  WSQADKSLGQKLASRLNVRPSI  492



>gb|KDP43757.1| hypothetical protein JCGZ_22384 [Jatropha curcas]
Length=492

 Score =   223 bits (568),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++P P 
Sbjct  351  TQRHRLGPNYLQLPPNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPIPP  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             ++TGRR+K VI KENNFKQPG+RYRS+ PDR+DRFI RWV++LS+PRVT+EIRS WISY
Sbjct  411  PVLTGRREKTVIPKENNFKQPGERYRSFTPDRKDRFIRRWVEALSDPRVTYEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD+SLGQK+AS LN+RPTM
Sbjct  471  WSQADKSLGQKIASHLNMRPTM  492



>dbj|BAA05494.1| catalase [Oryza sativa Japonica Group]
Length=492

 Score =   223 bits (568),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY++LPVNAPKCAYHNN +DG MNF+HRDEEV+YFPS+FD  R+AE+ P P 
Sbjct  351  TQRHRLGPNYLMLPVNAPKCAYHNNHHDGSMNFMHRDEEVNYFPSRFDAARHAEKVPIPP  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
            R++TG R+KCVI+KENNF+Q G+RYRS+ P RQDRF+ RWV +LS+PR+THE+R  WISY
Sbjct  411  RVLTGCREKCVIDKENNFQQAGERYRSFDPARQDRFLQRWVDALSDPRITHELRGIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +Q D SLGQK+ASRLN++P M
Sbjct  471  WSQCDASLGQKLASRLNLKPNM  492



>gb|AAF79625.1|AC027665_26 F5M15.5 [Arabidopsis thaliana]
 gb|AAF80611.1|AC069251_4 F2D10.11 [Arabidopsis thaliana]
Length=1013

 Score =   229 bits (585),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 104/141 (74%), Positives = 122/141 (87%), Gaps = 0/141 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ PTP 
Sbjct  390  TQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPTPT  449

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
               TG R KCVI+KENNFKQ GDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIR  WISY
Sbjct  450  NSYTGIRTKCVIKKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGIWISY  509

Query  283  LTQADRSLGQKVASRLNIRPT  221
             +QADRSLGQK+ASRLN+RP+
Sbjct  510  WSQADRSLGQKLASRLNVRPS  530


 Score =   218 bits (556),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = -2

Query  643   THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
             + RHRLGPNY+ LPVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS+ D  R+AE++PT  
Sbjct  872   SQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRLDPVRHAEKYPTTP  931

Query  463   RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
              + +G R+KC I KENNFKQPG+RYRSW  DRQ+RF+ R+V++LSEPRVTHEIRS WISY
Sbjct  932   IVCSGNREKCFIGKENNFKQPGERYRSWDSDRQERFVKRFVEALSEPRVTHEIRSIWISY  991

Query  283   LTQADRSLGQKVASRLNIRPTM  218
              +QAD+SLGQK+A+RLN+RP  
Sbjct  992   WSQADKSLGQKLATRLNVRPNF  1013



>dbj|BAA34204.1| catalase [Oryza sativa Japonica Group]
Length=492

 Score =   223 bits (567),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY++LPVNAPKCAYHNN +DG MNF+HRDEEV+YFPS+FD  R+AE+ P P 
Sbjct  351  TQRHRLGPNYLMLPVNAPKCAYHNNHHDGSMNFMHRDEEVNYFPSRFDAARHAEKVPIPP  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
            R++TG R+KCVI+KENNF+Q G+RYRS+ P RQDRF+ RWV +LS+PR+THE+R  WISY
Sbjct  411  RVLTGCREKCVIDKENNFQQAGERYRSFDPARQDRFLQRWVDALSDPRITHELRGIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +Q D SLGQK+ASRLN++P M
Sbjct  471  WSQCDASLGQKLASRLNLKPNM  492



>gb|AHF21552.1| catalase [Hylocereus undatus]
Length=492

 Score =   223 bits (567),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 119/142 (84%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
              R+RLG NYM+LPVNAPKCA+HNN YDG MNF+HRDEE+DYFPSKFD  R AE++P   
Sbjct  351  AQRYRLGANYMMLPVNAPKCAHHNNQYDGVMNFMHRDEEIDYFPSKFDPARQAEKYPILT  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
            ++ TG+R+K VI KENNFKQPGDRYRSW P RQ+RF+ RWV  LS+PRVT E+RS W+SY
Sbjct  411  KVYTGKREKTVIPKENNFKQPGDRYRSWDPARQERFVKRWVDVLSDPRVTLELRSIWVSY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
            L+Q DRSLG KVA+RLN+RPTM
Sbjct  471  LSQCDRSLGMKVATRLNMRPTM  492



>ref|NP_001058635.1| Os06g0727200 [Oryza sativa Japonica Group]
 sp|Q0D9C4.1|CATA2_ORYSJ RecName: Full=Catalase isozyme B; Short=CAT-B [Oryza sativa Japonica 
Group]
 dbj|BAD61813.1| catalase [Oryza sativa Japonica Group]
 dbj|BAF20549.1| Os06g0727200 [Oryza sativa Japonica Group]
 gb|EAZ38347.1| hypothetical protein OsJ_22721 [Oryza sativa Japonica Group]
 dbj|BAG91437.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94401.1| unnamed protein product [Oryza sativa Japonica Group]
Length=492

 Score =   223 bits (567),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY++LPVNAPKCAYHNN +DG MNF+HRDEEV+YFPS+FD  R+AE+ P P 
Sbjct  351  TQRHRLGPNYLMLPVNAPKCAYHNNHHDGSMNFMHRDEEVNYFPSRFDAARHAEKVPIPP  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
            R++TG R+KCVI+KENNF+Q G+RYRS+ P RQDRF+ RWV +LS+PR+THE+R  WISY
Sbjct  411  RVLTGCREKCVIDKENNFQQAGERYRSFDPARQDRFLQRWVDALSDPRITHELRGIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +Q D SLGQK+ASRLN++P M
Sbjct  471  WSQCDASLGQKLASRLNLKPNM  492



>ref|XP_008452957.1| PREDICTED: catalase isozyme 1-like [Cucumis melo]
Length=492

 Score =   223 bits (567),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 122/139 (88%), Gaps = 0/139 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS+ D   +AER+P P 
Sbjct  351  TQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRIDPAHHAERYPQPP  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             + TG+R++CVIEKENNFKQPG+RYRSW  DRQ+RF+ RWV +LS+PRVTHEIR+ WISY
Sbjct  411  AVYTGKRERCVIEKENNFKQPGERYRSWPADRQERFVGRWVDALSDPRVTHEIRNIWISY  470

Query  283  LTQADRSLGQKVASRLNIR  227
             +QAD+SLGQK+ASRLN++
Sbjct  471  WSQADKSLGQKLASRLNVK  489



>gb|AAM97541.1| catalase 2, partial [Capsicum annuum]
Length=484

 Score =   222 bits (566),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 95/142 (67%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T R+RLGPNY+ LP NAPKCA+HNN YDG MNF+HRDEE+DYFPS++D  R+AE +P P 
Sbjct  343  TQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAENYPIPT  402

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             + +G+R+KC+I+KENNF+QPG+RYRS++ DRQ+RFI RWV++LS+PR+T+EIRS WISY
Sbjct  403  TVCSGKREKCIIQKENNFQQPGERYRSFSADRQERFIRRWVEALSDPRITYEIRSIWISY  462

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD+SLGQK+ASRLN+RP++
Sbjct  463  WSQADKSLGQKLASRLNVRPSI  484



>gb|ADZ45555.1| catalase [Vigna radiata]
Length=492

 Score =   222 bits (566),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            + RHRLGPNY+LLP NAPK A+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+FP P 
Sbjct  351  SQRHRLGPNYLLLPANAPKSAHHNNHHEGFMNFIHRDEEVNYFPSRYDPVRHAEKFPIPP  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             I +GRR+K  IEKENNFKQ G+R+RSWAPDRQDRF  RWV +LS+PRVTHEIRS WISY
Sbjct  411  AICSGRREKIAIEKENNFKQAGERFRSWAPDRQDRFTRRWVDALSDPRVTHEIRSVWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QADRSLGQK+AS L++RP +
Sbjct  471  WSQADRSLGQKIASHLSMRPNI  492



>ref|XP_010534184.1| PREDICTED: catalase isozyme 3-like [Tarenaya hassleriana]
Length=492

 Score =   222 bits (566),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T R+RLGPNY+ LPVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS+FD+ R+A ++P P 
Sbjct  351  TQRYRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRFDSVRHAAKYPIPS  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             + +G R KCVIEKENNFKQPG+RYRSWAPDRQ+R+  RWV++LS+ RVT EIR  WISY
Sbjct  411  AVCSGERIKCVIEKENNFKQPGERYRSWAPDRQERYAKRWVEALSDARVTDEIRGVWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
            L+Q+D+SLG KVA+RLN+RP+ 
Sbjct  471  LSQSDKSLGMKVANRLNVRPSF  492



>gb|AAC17729.1| catalase 1, partial [Hordeum vulgare subsp. vulgare]
Length=398

 Score =   219 bits (559),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY++LPVNAPKCA+HNN +DG MNF+HRDEEV+YFPS+FD TR+AE++P P 
Sbjct  257  TQRHRLGPNYLMLPVNAPKCAHHNNHHDGLMNFIHRDEEVNYFPSRFDPTRHAEKYPMPP  316

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
            R+++G R+KC+I+KENNFKQ G+RYRS+ P RQDRF+ RWV +L++ RVTHEI+S W+SY
Sbjct  317  RVLSGCREKCIIDKENNFKQAGERYRSFDPARQDRFLQRWVDALTDARVTHEIQSIWVSY  376

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +Q D SLGQK+ASRL I+P M
Sbjct  377  WSQCDASLGQKLASRLKIKPNM  398



>gb|ABC01913.1| catalase isozyme 1-like protein [Solanum tuberosum]
Length=492

 Score =   222 bits (566),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHR+GPNYM LPVNAPKC +HNN  DG MN  HRDEEVDY PS+FD  R AE++P P 
Sbjct  351  TQRHRIGPNYMQLPVNAPKCGHHNNHRDGAMNMTHRDEEVDYLPSRFDPCRPAEQYPIPA  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             ++ GRR  CVI KENNFKQ G+RYRSW  DRQDR+IN+WV+SLS+PRVTHEIRS WISY
Sbjct  411  CVLNGRRTNCVIPKENNFKQAGERYRSWESDRQDRYINKWVESLSDPRVTHEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
            L+QAD+S GQKVASRL ++PTM
Sbjct  471  LSQADKSCGQKVASRLTVKPTM  492



>emb|CAG23920.1| catalase [Festuca arundinacea]
Length=492

 Score =   222 bits (565),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+LLP NAPKC++HNN YDG MNF+HRDEEVDYFPS+FD   +A R+P P 
Sbjct  351  TQRHRLGPNYLLLPANAPKCSHHNNHYDGLMNFMHRDEEVDYFPSRFDPATDAPRYPIPS  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
            R + GRR+K VIEKENNFKQPG+RYRS  P RQ+RFINRW+ +LS+PR+THEI++ W+SY
Sbjct  411  RTLNGRREKMVIEKENNFKQPGERYRSMDPARQERFINRWIDALSDPRLTHEIKAIWLSY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QADRSLGQK+A RL+++P+M
Sbjct  471  WSQADRSLGQKLAGRLSVKPSM  492



>gb|ADZ45556.1| catalase [Vigna radiata]
Length=492

 Score =   222 bits (565),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 99/140 (71%), Positives = 121/140 (86%), Gaps = 0/140 (0%)
 Frame = -2

Query  637  RHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRI  458
            RHRLGPNY+LLP NAPK A+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+FP P  I
Sbjct  353  RHRLGPNYLLLPANAPKSAHHNNHHEGFMNFIHRDEEVNYFPSRYDPVRHAEKFPIPPAI  412

Query  457  VTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLT  278
             +GRR+K  IEKENNFKQ G+R+RSWAPDRQDRF  RWV +LS+PRVTHEIRS WISY +
Sbjct  413  CSGRREKIAIEKENNFKQAGERFRSWAPDRQDRFTRRWVDALSDPRVTHEIRSVWISYWS  472

Query  277  QADRSLGQKVASRLNIRPTM  218
            QADRSLGQK+AS L++RP +
Sbjct  473  QADRSLGQKIASHLSMRPNI  492



>ref|XP_003558892.1| PREDICTED: catalase-1 [Brachypodium distachyon]
Length=492

 Score =   221 bits (564),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 121/142 (85%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+LLP NAPKCA+HNN YDG MNF+HRDEEVDYFPS+FD  ++A R+P P 
Sbjct  351  TQRHRLGPNYLLLPANAPKCAHHNNHYDGTMNFMHRDEEVDYFPSRFDPAKHAPRYPIPS  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
                GRR+K VIEKENNFKQPG+RYRS  P RQ+RFINRW+ +LS+PR+THEI+S W+SY
Sbjct  411  STCNGRREKMVIEKENNFKQPGERYRSMDPARQERFINRWIDALSDPRLTHEIKSIWLSY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QADRSLGQK+ASRL+ +P+M
Sbjct  471  WSQADRSLGQKLASRLSAKPSM  492



>ref|XP_009108683.1| PREDICTED: catalase-2-like isoform X2 [Brassica rapa]
Length=496

 Score =   222 bits (565),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 97/146 (66%), Positives = 129/146 (88%), Gaps = 4/146 (3%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP 
Sbjct  351  TQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPP  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPD----RQDRFINRWVKSLSEPRVTHEIRST  296
             + +G+R++CVIEKENNFK+PG RYRS+ PD    RQ+RFI RW+++LS+PR+THEIRS 
Sbjct  411  AVCSGKRERCVIEKENNFKEPGGRYRSFTPDSFDFRQERFIRRWIEALSDPRITHEIRSI  470

Query  295  WISYLTQADRSLGQKVASRLNIRPTM  218
            WISY +QAD++LGQK+ASRLN+RP++
Sbjct  471  WISYWSQADKTLGQKLASRLNVRPSI  496



>ref|NP_001241808.1| catalase isozyme B [Zea mays]
 gb|ACG48924.1| catalase isozyme B [Zea mays]
 gb|ACN25578.1| unknown [Zea mays]
 gb|AFW69583.1| catalase1 [Zea mays]
Length=492

 Score =   221 bits (564),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY++LPVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS+FD  R+AE+ P P 
Sbjct  351  TQRHRLGPNYLMLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRFDPARHAEKVPIPP  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
            R++TG R+KC+I+KENNFKQ G+RYRS+ P RQDRFI RWV +L++PRVTHE R+ WISY
Sbjct  411  RVLTGCREKCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALTDPRVTHEHRTIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +Q D +LGQK+ASRLN++P+M
Sbjct  471  WSQCDAALGQKLASRLNLKPSM  492



>emb|CAA42720.1| catalase-1 [Zea mays]
Length=492

 Score =   221 bits (564),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY++LPVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS+FD  R+AE+ P P 
Sbjct  351  TQRHRLGPNYLMLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRFDPARHAEKVPIPP  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
            R++TG R+KC+I+KENNFKQ G+RYRS+ P RQDRFI RWV +L++PRVTHE R+ WISY
Sbjct  411  RVLTGCREKCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALTDPRVTHEHRTIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +Q D +LGQK+ASRLN++P+M
Sbjct  471  WSQCDAALGQKLASRLNLKPSM  492



>gb|KJB17473.1| hypothetical protein B456_003G002800 [Gossypium raimondii]
Length=492

 Score =   221 bits (564),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+ P P 
Sbjct  351  TQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKHPIPS  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             + +G+R+KC+I KENNFKQPG+RYRS++ DRQ+RFINRW+ +LS+ RVTHEIRS WISY
Sbjct  411  TVYSGKREKCIIGKENNFKQPGERYRSFSADRQERFINRWIDALSDSRVTHEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD+SLGQK+ASRLN+RP++
Sbjct  471  WSQADKSLGQKIASRLNVRPSI  492



>gb|AIU99479.1| catalase [Saccharum arundinaceum]
Length=492

 Score =   221 bits (564),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY++LPVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS+FD  R+AE+ P P 
Sbjct  351  TQRHRLGPNYLMLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRFDPARHAEKVPIPS  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
            R++TG R+KC+I+KENNFKQ G+RYRS+ P RQDRFI RWV +LS+PRVTHE  + WISY
Sbjct  411  RVLTGCREKCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALSDPRVTHEHHTIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +Q D SLGQK+ASRLN++P M
Sbjct  471  WSQCDASLGQKLASRLNLKPNM  492



>sp|Q43206.1|CATA1_WHEAT RecName: Full=Catalase-1 [Triticum aestivum]
 dbj|BAA13068.1| catalase [Triticum aestivum]
 gb|ADF83496.1| catalase [Triticum aestivum]
Length=492

 Score =   221 bits (563),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+LLP NAPKC++HNN YDG MNF+HRDEEVDYFPS+FD  ++A R+P P 
Sbjct  351  TQRHRLGPNYLLLPANAPKCSHHNNHYDGLMNFMHRDEEVDYFPSRFDPAKHAPRYPIPS  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
            R + GRR+K VIEKENNFKQPG+RYRS  P RQ+RFINRW+ +LS+PR+THEI++ W+SY
Sbjct  411  RTLNGRREKMVIEKENNFKQPGERYRSMDPARQERFINRWIDALSDPRLTHEIKAIWLSY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD+SLGQK+ASRL+ +P+M
Sbjct  471  WSQADKSLGQKLASRLSSKPSM  492



>ref|XP_008464839.1| PREDICTED: catalase isozyme 3 [Cucumis melo]
 gb|ADN33988.1| catalase [Cucumis melo subsp. melo]
Length=492

 Score =   221 bits (563),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 97/143 (68%), Positives = 128/143 (90%), Gaps = 1/143 (1%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVNAPKC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+FP P 
Sbjct  350  TQRHRLGPNYLQLPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRYDPCRHAEKFPMPP  409

Query  463  RIVTGRRDKCVIEKEN-NFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
             +++G+R++CVI KEN NFKQ GDRYRSWAPDRQ+RF+ R+V++LS+PRVTHE+R+ WIS
Sbjct  410  NVLSGKRERCVIPKENHNFKQAGDRYRSWAPDRQERFVRRFVEALSDPRVTHEVRNIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QADRSLGQK+ASR+N+RP++
Sbjct  470  YWSQADRSLGQKIASRMNVRPSI  492



>gb|EMT05040.1| Catalase-1 [Aegilops tauschii]
Length=526

 Score =   222 bits (565),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+LLP NAPKC++HNN YDG MNF+HRDEEVDYFPS+FD  ++A R+P P 
Sbjct  385  TQRHRLGPNYLLLPANAPKCSHHNNHYDGLMNFMHRDEEVDYFPSRFDPAKHAPRYPIPS  444

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
            R + GRR+K VIEKENNFKQPG+RYRS  P RQ+RFINRW+ +LS+PR+THEI++ W+SY
Sbjct  445  RTLNGRREKMVIEKENNFKQPGERYRSMDPARQERFINRWIDALSDPRLTHEIKAIWLSY  504

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD+SLGQK+ASRL+ +P+M
Sbjct  505  WSQADKSLGQKLASRLSSKPSM  526



>gb|AFR53082.1| CAT [Anthurium andraeanum]
Length=492

 Score =   221 bits (563),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T R+RLGPNY++LPVNAPKCA+ N+ YDG MNF+HRDEEV+YFPS+ D  R+AER+P   
Sbjct  351  TQRYRLGPNYLMLPVNAPKCAHKNSHYDGLMNFMHRDEEVNYFPSRHDPLRHAERYPINN  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
            RIVTGRR+KC+IEK+N+FKQPGDRYRSWA DRQ+RF+ RWV++L+ P+V+HE+RS W+SY
Sbjct  411  RIVTGRREKCIIEKQNDFKQPGDRYRSWAHDRQERFVRRWVEALAHPKVSHEVRSIWVSY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
            L+++D SLGQKVA+RLN++P+M
Sbjct  471  LSKSDVSLGQKVANRLNMKPSM  492



>ref|NP_001274863.1| catalase isozyme 1 [Solanum tuberosum]
 gb|ABY21246.1| catalase isozyme [Solanum tuberosum]
Length=492

 Score =   221 bits (563),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHR+GPNYM LPVNAPKC +HNN  DG MN  HRDEEVDYFPS+FD  R AE++P P 
Sbjct  351  TQRHRIGPNYMQLPVNAPKCGHHNNHRDGAMNMTHRDEEVDYFPSRFDPCRPAEQYPIPA  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             ++ GRR  CVI KENN KQ G+RYRSW  DRQDR+IN+WV+SLS+PRVTHEIRS WISY
Sbjct  411  CVLNGRRTNCVIPKENNSKQAGERYRSWESDRQDRYINKWVESLSDPRVTHEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
            L+QAD+S GQKVASRL ++PTM
Sbjct  471  LSQADKSCGQKVASRLTVKPTM  492



>sp|P48352.1|CATA3_CUCPE RecName: Full=Catalase isozyme 3 [Cucurbita pepo]
 dbj|BAA09508.1| catalase [Cucurbita pepo]
Length=492

 Score =   221 bits (562),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 126/143 (88%), Gaps = 1/143 (1%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVNAPKC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+FP P 
Sbjct  350  TQRHRLGPNYLQLPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRYDPCRHAEKFPMPP  409

Query  463  RIVTGRRDKCVIEKE-NNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
             ++TG+R++CVI KE NNFKQ GDRYRSWAPDRQDRF+ R+V++LS+PRVT E+R+ WIS
Sbjct  410  NVLTGKRERCVIPKENNNFKQAGDRYRSWAPDRQDRFVKRFVEALSDPRVTDEVRNIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QADRSLGQK+ASRLN+RP +
Sbjct  470  YWSQADRSLGQKIASRLNVRPNI  492



>gb|AAD17933.1| catalase [Brassica juncea]
Length=496

 Score =   221 bits (563),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 96/146 (66%), Positives = 130/146 (89%), Gaps = 4/146 (3%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP 
Sbjct  351  TQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPP  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPD----RQDRFINRWVKSLSEPRVTHEIRST  296
             + +G+R++CVIEKENNFK+PG+RYRS+ P+    RQ+RFI RW+++LS+PR+THEIRS 
Sbjct  411  AVCSGKRERCVIEKENNFKEPGERYRSFTPESFDFRQERFIRRWIEALSDPRITHEIRSI  470

Query  295  WISYLTQADRSLGQKVASRLNIRPTM  218
            WISY +QAD++LGQK+ASRLN+RP++
Sbjct  471  WISYWSQADKTLGQKLASRLNVRPSI  496



>gb|AFN81243.1| catalase 1 [Brassica rapa subsp. pekinensis]
Length=492

 Score =   221 bits (562),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP 
Sbjct  351  TQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPP  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             + +G+R++CVIEKENNFK+PG+RYRS+ P+RQ+RFI RW+++L +PR+THEIRS WI Y
Sbjct  411  AVCSGKRERCVIEKENNFKEPGERYRSFTPERQERFIRRWIEALFDPRITHEIRSIWIFY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD++ GQK+ASRLN+RP++
Sbjct  471  WSQADKTFGQKLASRLNVRPSI  492



>sp|P49284.1|CATA1_SOLTU RecName: Full=Catalase isozyme 1 [Solanum tuberosum]
 gb|AAA80650.1| catalase [Solanum tuberosum]
Length=492

 Score =   221 bits (562),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHR+GPNYM LPVNAPKC +HNN  DG MN  HRDEEVDYFPS+FD  R AE++P P 
Sbjct  351  TQRHRIGPNYMQLPVNAPKCGHHNNHRDGAMNMTHRDEEVDYFPSRFDPCRPAEQYPIPA  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             ++ GRR  CVI KENN KQ G+RYRSW  DRQDR+IN+WV+SLS+PRVTHEIRS WISY
Sbjct  411  CVLNGRRTNCVIPKENNSKQAGERYRSWESDRQDRYINKWVESLSDPRVTHEIRSIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
            L+QAD+S GQKVASRL ++PTM
Sbjct  471  LSQADKSCGQKVASRLTVKPTM  492



>gb|ACL35349.1| catalase [Picea glauca]
Length=492

 Score =   221 bits (562),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY++LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD  R+AERFP P 
Sbjct  351  TQRHRLGPNYLMLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERFPIPS  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
               +G R+KCVIEKENNFKQPG+RYRS+ PDRQ+RF+ RWV +LS+PRVTHEI S WI Y
Sbjct  411  HTHSGMREKCVIEKENNFKQPGERYRSFEPDRQERFVKRWVAALSDPRVTHEICSIWIFY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +Q+D+SLGQK+A+RLN++  M
Sbjct  471  WSQSDKSLGQKIAARLNMKANM  492



>ref|XP_002890395.1| F5M15.5 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66654.1| F5M15.5 [Arabidopsis lyrata subsp. lyrata]
Length=981

 Score =   227 bits (579),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P P 
Sbjct  358  TQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKAPIPT  417

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
               TG R KCVI+KENNFKQ GDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIR  WISY
Sbjct  418  NSYTGIRTKCVIKKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGIWISY  477

Query  283  LTQADRSLGQKVASRLNIRPT  221
             +QADRSLGQK+ASRLN+RP+
Sbjct  478  WSQADRSLGQKLASRLNVRPS  498


 Score =   218 bits (556),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            + RHRLGPNY+ LPVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS+ D  R+AE++PT  
Sbjct  840  SQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRLDPVRHAEKYPTTP  899

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             + TG R+KC I KENNF+QPG+RYRSW  DRQ+RF+ R+V++LSEPRVTHEIRS WISY
Sbjct  900  IVCTGNREKCFIGKENNFQQPGERYRSWDSDRQERFVKRFVEALSEPRVTHEIRSIWISY  959

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +QAD+SLGQK+A+RLN+RP  
Sbjct  960  WSQADKSLGQKLATRLNVRPNF  981



>ref|XP_004144240.1| PREDICTED: catalase isozyme 3-like [Cucumis sativus]
Length=483

 Score =   220 bits (561),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 97/143 (68%), Positives = 127/143 (89%), Gaps = 1/143 (1%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVNAPKC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+FP P 
Sbjct  341  TQRHRLGPNYLQLPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRYDPCRHAEKFPMPP  400

Query  463  RIVTGRRDKCVIEKEN-NFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
             +++G+R++CVI KEN NFKQ GDRYRSWAPDRQ+RF+ R+V++LS+PRVTHE+R+ WIS
Sbjct  401  NVLSGKRERCVIPKENHNFKQAGDRYRSWAPDRQERFVRRFVEALSDPRVTHEVRNIWIS  460

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QADRSLGQK+ASR+N+RP +
Sbjct  461  YWSQADRSLGQKIASRMNVRPNI  483



>gb|AHF27429.1| catalase, partial [Cucurbita moschata]
Length=461

 Score =   219 bits (559),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 97/143 (68%), Positives = 126/143 (88%), Gaps = 1/143 (1%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVNAPKC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++P P 
Sbjct  319  TQRHRLGPNYLQLPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRYDACRHAEKYPMPP  378

Query  463  RIVTGRRDKCVIEKEN-NFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
             +++G+R++CVI KEN NFKQ GDRYRSWAPDRQ+RF+NR+V++LS+ +VTHE+R+ WIS
Sbjct  379  NVLSGKRERCVIPKENHNFKQAGDRYRSWAPDRQERFVNRFVEALSDSKVTHEVRNIWIS  438

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y TQADRSLGQK+ASR+N RP M
Sbjct  439  YWTQADRSLGQKIASRMNARPNM  461



>ref|XP_002510677.1| catalase, putative [Ricinus communis]
 gb|EEF52864.1| catalase, putative [Ricinus communis]
Length=974

 Score =   227 bits (578),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS+ D  RNAE FP P 
Sbjct  833  TQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRCDPARNAESFPVPS  892

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             I +G+R+KCVIEKENNFKQPG+RYRSWAPDRQ+RF+NR V  LS+PR+THE+R+ WISY
Sbjct  893  AICSGKREKCVIEKENNFKQPGERYRSWAPDRQERFLNRLVGGLSDPRITHELRTIWISY  952

Query  283  LTQADRSLGQKVASRLNIRPTM  218
              Q D+SLGQK+A+RLN++P++
Sbjct  953  WIQCDKSLGQKLATRLNVKPSI  974


 Score =   222 bits (566),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 101/141 (72%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLG NY+ LPVNAPKC YHNN YDG+MNF+HRDEEVDYF S++D  R+AE+ P P 
Sbjct  351  TQRHRLGTNYLQLPVNAPKCPYHNNHYDGFMNFMHRDEEVDYFQSRYDPVRHAEKVPIPN  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
             I +GRR+KCVIEKE+NF+QPGDRYRSWAPDRQ+RF+ R V +LSEPR+THEIRS W+S+
Sbjct  411  AICSGRREKCVIEKEDNFRQPGDRYRSWAPDRQERFLCRLVNALSEPRITHEIRSIWVSW  470

Query  283  LTQADRSLGQKVASRLNIRPT  221
             TQ D+SLGQK+ASRLN RP+
Sbjct  471  WTQCDKSLGQKLASRLNNRPS  491



>gb|AHF27432.1| catalase, partial [Cucurbita maxima]
Length=461

 Score =   219 bits (559),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 97/143 (68%), Positives = 126/143 (88%), Gaps = 1/143 (1%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVNAPKC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++P P 
Sbjct  319  TQRHRLGPNYLQLPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRYDACRHAEKYPMPP  378

Query  463  RIVTGRRDKCVIEKEN-NFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
             +++G+R++CVI KEN NFKQ GDRYRSWAPDRQ+RF+NR+V++LS+ +VTHE+R+ WIS
Sbjct  379  NVLSGKRERCVIPKENHNFKQAGDRYRSWAPDRQERFVNRFVEALSDSKVTHEVRNIWIS  438

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y TQADRSLGQK+ASR+N RP M
Sbjct  439  YWTQADRSLGQKIASRMNARPNM  461



>gb|AIU99481.1| catalase [Saccharum spontaneum]
Length=492

 Score =   220 bits (561),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY++LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD  R+AE+ P P 
Sbjct  351  TQRHRLGPNYLMLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPARHAEKVPIPT  410

Query  463  RIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISY  284
            R++TG R+KC+I+KENNFKQ G+RYRS+ P RQDRFI RWV +LS+PRVTHE  + WISY
Sbjct  411  RVLTGCREKCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALSDPRVTHEHHTIWISY  470

Query  283  LTQADRSLGQKVASRLNIRPTM  218
             +Q D SLGQK+ASRLN++P M
Sbjct  471  WSQCDASLGQKLASRLNLKPNM  492



>gb|ADM96039.1| catalase [Cucumis sativus]
Length=492

 Score =   220 bits (561),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 97/143 (68%), Positives = 127/143 (89%), Gaps = 1/143 (1%)
 Frame = -2

Query  643  THRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPL  464
            T RHRLGPNY+ LPVNAPKC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+FP P 
Sbjct  350  TQRHRLGPNYLQLPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRYDPCRHAEKFPMPP  409

Query  463  RIVTGRRDKCVIEKEN-NFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
             +++G+R++CVI KEN NFKQ GDRYRSWAPDRQ+RF+ R+V++LS+PRVTHE+R+ WIS
Sbjct  410  NVLSGKRERCVIPKENHNFKQAGDRYRSWAPDRQERFVRRFVEALSDPRVTHEVRNIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QADRSLGQK+ASR+N+RP +
Sbjct  470  YWSQADRSLGQKIASRMNVRPNI  492



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 960833956375